(data stored in SCRATCH917 zone)

EMBL: CP001585

ID   CP001585; SV 1; circular; genomic DNA; STD; PRO; 4640720 BP.
XX
AC   CP001585;
XX
PR   Project:PRJNA36507;
XX
DT   06-NOV-2009 (Rel. 102, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Yersinia pestis D106004, complete genome.
XX
KW   .
XX
OS   Yersinia pestis D106004
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Yersiniaceae; Yersinia.
XX
RN   [1]
RP   1-4640720
RX   PUBMED; 19815893.
RA   Zhang Z., Hai R., Song Z., Xia L., Liang Y., Cai H., Liang Y., Shen X.,
RA   Zhang E., Xu J., Yu D., Yu X.J.;
RT   "Spatial variation of Yersinia pestis from Yunnan Province of China";
RL   Am. J. Trop. Med. Hyg. 81(4):714-717(2009).
XX
RN   [2]
RP   1-4640720
RA   Hai R., Yu D., Xia L., Zhu X., Liang Y., Shen X., Zhang E., Zhang H.;
RT   ;
RL   Submitted (15-JAN-2009) to the INSDC.
RL   State Key Laboratory for Infectious Disease Prevention and Control,
RL   Institute for Communicable Disease Control and Prevention, Chinese Center
RL   for Disease Control and Prevention, No.5 Liuzi Changping, Beijing, Beijing
RL   102206, China
XX
DR   MD5; 253cf4286e4526b13cffb370c49f2b75.
DR   BioSample; SAMN02603871.
DR   EnsemblGenomes-Gn; EBG00001159328.
DR   EnsemblGenomes-Gn; EBG00001159329.
DR   EnsemblGenomes-Gn; EBG00001159330.
DR   EnsemblGenomes-Gn; EBG00001159331.
DR   EnsemblGenomes-Gn; EBG00001159332.
DR   EnsemblGenomes-Gn; EBG00001159333.
DR   EnsemblGenomes-Gn; EBG00001159334.
DR   EnsemblGenomes-Gn; EBG00001159335.
DR   EnsemblGenomes-Gn; EBG00001159336.
DR   EnsemblGenomes-Gn; EBG00001159337.
DR   EnsemblGenomes-Gn; EBG00001159338.
DR   EnsemblGenomes-Gn; EBG00001159339.
DR   EnsemblGenomes-Gn; EBG00001159340.
DR   EnsemblGenomes-Gn; EBG00001159341.
DR   EnsemblGenomes-Gn; EBG00001159342.
DR   EnsemblGenomes-Gn; EBG00001159343.
DR   EnsemblGenomes-Gn; EBG00001159344.
DR   EnsemblGenomes-Gn; EBG00001159345.
DR   EnsemblGenomes-Gn; EBG00001159346.
DR   EnsemblGenomes-Gn; EBG00001159347.
DR   EnsemblGenomes-Gn; EBG00001159348.
DR   EnsemblGenomes-Gn; EBG00001159349.
DR   EnsemblGenomes-Gn; EBG00001159350.
DR   EnsemblGenomes-Gn; EBG00001159351.
DR   EnsemblGenomes-Gn; EBG00001159352.
DR   EnsemblGenomes-Gn; EBG00001159353.
DR   EnsemblGenomes-Gn; EBG00001159354.
DR   EnsemblGenomes-Gn; EBG00001159355.
DR   EnsemblGenomes-Gn; EBG00001159356.
DR   EnsemblGenomes-Gn; EBG00001159358.
DR   EnsemblGenomes-Gn; EBG00001159359.
DR   EnsemblGenomes-Gn; EBG00001159360.
DR   EnsemblGenomes-Gn; EBG00001159361.
DR   EnsemblGenomes-Gn; EBG00001159362.
DR   EnsemblGenomes-Gn; EBG00001159363.
DR   EnsemblGenomes-Gn; EBG00001159364.
DR   EnsemblGenomes-Gn; EBG00001159365.
DR   EnsemblGenomes-Gn; EBG00001159366.
DR   EnsemblGenomes-Gn; EBG00001159367.
DR   EnsemblGenomes-Gn; EBG00001159368.
DR   EnsemblGenomes-Gn; EBG00001159369.
DR   EnsemblGenomes-Gn; EBG00001159371.
DR   EnsemblGenomes-Gn; EBG00001159373.
DR   EnsemblGenomes-Gn; EBG00001159374.
DR   EnsemblGenomes-Gn; EBG00001159375.
DR   EnsemblGenomes-Gn; EBG00001159376.
DR   EnsemblGenomes-Gn; EBG00001159377.
DR   EnsemblGenomes-Gn; EBG00001159378.
DR   EnsemblGenomes-Gn; EBG00001159379.
DR   EnsemblGenomes-Gn; EBG00001159380.
DR   EnsemblGenomes-Gn; EBG00001159381.
DR   EnsemblGenomes-Gn; EBG00001159382.
DR   EnsemblGenomes-Gn; EBG00001159383.
DR   EnsemblGenomes-Gn; EBG00001159384.
DR   EnsemblGenomes-Gn; EBG00001159385.
DR   EnsemblGenomes-Gn; EBG00001159386.
DR   EnsemblGenomes-Gn; EBG00001159387.
DR   EnsemblGenomes-Gn; EBG00001159388.
DR   EnsemblGenomes-Gn; EBG00001159389.
DR   EnsemblGenomes-Gn; EBG00001159390.
DR   EnsemblGenomes-Gn; EBG00001159391.
DR   EnsemblGenomes-Gn; EBG00001159392.
DR   EnsemblGenomes-Gn; EBG00001159393.
DR   EnsemblGenomes-Gn; EBG00001159394.
DR   EnsemblGenomes-Gn; EBG00001159395.
DR   EnsemblGenomes-Gn; EBG00001159396.
DR   EnsemblGenomes-Gn; EBG00001159397.
DR   EnsemblGenomes-Gn; EBG00001159398.
DR   EnsemblGenomes-Gn; EBG00001159400.
DR   EnsemblGenomes-Gn; EBG00001159402.
DR   EnsemblGenomes-Gn; EBG00001159404.
DR   EnsemblGenomes-Gn; EBG00001159405.
DR   EnsemblGenomes-Gn; EBG00001159406.
DR   EnsemblGenomes-Gn; EBG00001159407.
DR   EnsemblGenomes-Gn; EBG00001159409.
DR   EnsemblGenomes-Gn; EBG00001159410.
DR   EnsemblGenomes-Gn; EBG00001159411.
DR   EnsemblGenomes-Gn; EBG00001159413.
DR   EnsemblGenomes-Gn; EBG00001159414.
DR   EnsemblGenomes-Gn; EBG00001159415.
DR   EnsemblGenomes-Gn; EBG00001159416.
DR   EnsemblGenomes-Gn; EBG00001159417.
DR   EnsemblGenomes-Gn; EBG00001159418.
DR   EnsemblGenomes-Gn; EBG00001159419.
DR   EnsemblGenomes-Gn; EBG00001159420.
DR   EnsemblGenomes-Gn; EBG00001159421.
DR   EnsemblGenomes-Gn; EBG00001159422.
DR   EnsemblGenomes-Gn; EBG00001159423.
DR   EnsemblGenomes-Gn; EBG00001159424.
DR   EnsemblGenomes-Gn; EBG00001159425.
DR   EnsemblGenomes-Gn; EBG00001159426.
DR   EnsemblGenomes-Gn; EBG00001159427.
DR   EnsemblGenomes-Gn; EBG00001159428.
DR   EnsemblGenomes-Gn; EBG00001159429.
DR   EnsemblGenomes-Gn; EBG00001159430.
DR   EnsemblGenomes-Gn; EBG00001159432.
DR   EnsemblGenomes-Gn; EBG00001159433.
DR   EnsemblGenomes-Gn; EBG00001159434.
DR   EnsemblGenomes-Gn; EBG00001159435.
DR   EnsemblGenomes-Gn; EBG00001159436.
DR   EnsemblGenomes-Gn; EBG00001159437.
DR   EnsemblGenomes-Gn; EBG00001159438.
DR   EnsemblGenomes-Gn; EBG00001159439.
DR   EnsemblGenomes-Gn; EBG00001159440.
DR   EnsemblGenomes-Gn; EBG00001159441.
DR   EnsemblGenomes-Gn; EBG00001159442.
DR   EnsemblGenomes-Gn; EBG00001159443.
DR   EnsemblGenomes-Gn; EBG00001159444.
DR   EnsemblGenomes-Gn; EBG00001159445.
DR   EnsemblGenomes-Gn; EBG00001159446.
DR   EnsemblGenomes-Gn; EBG00001159447.
DR   EnsemblGenomes-Gn; EBG00001159448.
DR   EnsemblGenomes-Gn; EBG00001159449.
DR   EnsemblGenomes-Gn; EBG00001159450.
DR   EnsemblGenomes-Gn; EBG00001159451.
DR   EnsemblGenomes-Gn; EBG00001159452.
DR   EnsemblGenomes-Gn; EBG00001159453.
DR   EnsemblGenomes-Gn; EBG00001159454.
DR   EnsemblGenomes-Gn; EBG00001159455.
DR   EnsemblGenomes-Gn; EBG00001159456.
DR   EnsemblGenomes-Gn; EBG00001159457.
DR   EnsemblGenomes-Gn; EBG00001159458.
DR   EnsemblGenomes-Gn; EBG00001159459.
DR   EnsemblGenomes-Gn; EBG00001159460.
DR   EnsemblGenomes-Gn; EBG00001159461.
DR   EnsemblGenomes-Gn; EBG00001159462.
DR   EnsemblGenomes-Gn; EBG00001159463.
DR   EnsemblGenomes-Gn; EBG00001159464.
DR   EnsemblGenomes-Gn; EBG00001159465.
DR   EnsemblGenomes-Gn; EBG00001159466.
DR   EnsemblGenomes-Gn; EBG00001159467.
DR   EnsemblGenomes-Gn; EBG00001159468.
DR   EnsemblGenomes-Gn; EBG00001159469.
DR   EnsemblGenomes-Gn; EBG00001159470.
DR   EnsemblGenomes-Gn; EBG00001159471.
DR   EnsemblGenomes-Gn; EBG00001159472.
DR   EnsemblGenomes-Gn; EBG00001159473.
DR   EnsemblGenomes-Gn; EBG00001159474.
DR   EnsemblGenomes-Gn; EBG00001159475.
DR   EnsemblGenomes-Gn; EBG00001159476.
DR   EnsemblGenomes-Gn; EBG00001159477.
DR   EnsemblGenomes-Gn; EBG00001159478.
DR   EnsemblGenomes-Gn; EBG00001159479.
DR   EnsemblGenomes-Gn; EBG00001159480.
DR   EnsemblGenomes-Gn; EBG00001159481.
DR   EnsemblGenomes-Gn; EBG00001159482.
DR   EnsemblGenomes-Gn; EBG00001159483.
DR   EnsemblGenomes-Gn; EBG00001159484.
DR   EnsemblGenomes-Gn; EBG00001159485.
DR   EnsemblGenomes-Gn; EBG00001159486.
DR   EnsemblGenomes-Gn; EBG00001159487.
DR   EnsemblGenomes-Gn; EBG00001159488.
DR   EnsemblGenomes-Gn; EBG00001159489.
DR   EnsemblGenomes-Gn; EBG00001159490.
DR   EnsemblGenomes-Gn; EBG00001159491.
DR   EnsemblGenomes-Gn; EBG00001159492.
DR   EnsemblGenomes-Gn; EBG00001159493.
DR   EnsemblGenomes-Gn; EBG00001159494.
DR   EnsemblGenomes-Gn; EBG00001159495.
DR   EnsemblGenomes-Gn; EBG00001159496.
DR   EnsemblGenomes-Gn; EBG00001159497.
DR   EnsemblGenomes-Gn; EBG00001159498.
DR   EnsemblGenomes-Gn; EBG00001159499.
DR   EnsemblGenomes-Gn; EBG00001159500.
DR   EnsemblGenomes-Gn; EBG00001159501.
DR   EnsemblGenomes-Gn; EBG00001159502.
DR   EnsemblGenomes-Gn; EBG00001159503.
DR   EnsemblGenomes-Gn; EBG00001159504.
DR   EnsemblGenomes-Gn; EBG00001159505.
DR   EnsemblGenomes-Gn; EBG00001159506.
DR   EnsemblGenomes-Gn; EBG00001159507.
DR   EnsemblGenomes-Gn; EBG00001159508.
DR   EnsemblGenomes-Gn; EBG00001159509.
DR   EnsemblGenomes-Gn; EBG00001159510.
DR   EnsemblGenomes-Gn; EBG00001159512.
DR   EnsemblGenomes-Gn; EBG00001159513.
DR   EnsemblGenomes-Gn; EBG00001159514.
DR   EnsemblGenomes-Gn; EBG00001159515.
DR   EnsemblGenomes-Gn; EBG00001159516.
DR   EnsemblGenomes-Gn; EBG00001159517.
DR   EnsemblGenomes-Gn; EBG00001159518.
DR   EnsemblGenomes-Gn; EBG00001159519.
DR   EnsemblGenomes-Gn; EBG00001159520.
DR   EnsemblGenomes-Gn; EBG00001159521.
DR   EnsemblGenomes-Gn; EBG00001159522.
DR   EnsemblGenomes-Gn; EBG00001159523.
DR   EnsemblGenomes-Gn; EBG00001159524.
DR   EnsemblGenomes-Gn; EBG00001159525.
DR   EnsemblGenomes-Gn; EBG00001159526.
DR   EnsemblGenomes-Gn; EBG00001159527.
DR   EnsemblGenomes-Gn; EBG00001159528.
DR   EnsemblGenomes-Gn; EBG00001159529.
DR   EnsemblGenomes-Gn; EBG00001159530.
DR   EnsemblGenomes-Gn; EBG00001159531.
DR   EnsemblGenomes-Gn; EBG00001159532.
DR   EnsemblGenomes-Gn; EBG00001159533.
DR   EnsemblGenomes-Gn; EBG00001159534.
DR   EnsemblGenomes-Gn; EBG00001159535.
DR   EnsemblGenomes-Gn; EBG00001159536.
DR   EnsemblGenomes-Gn; EBG00001159537.
DR   EnsemblGenomes-Gn; EBG00001159538.
DR   EnsemblGenomes-Gn; EBG00001159539.
DR   EnsemblGenomes-Gn; EBG00001159540.
DR   EnsemblGenomes-Gn; EBG00001159541.
DR   EnsemblGenomes-Gn; EBG00001159542.
DR   EnsemblGenomes-Gn; EBG00001159543.
DR   EnsemblGenomes-Gn; EBG00001159544.
DR   EnsemblGenomes-Gn; EBG00001159545.
DR   EnsemblGenomes-Gn; EBG00001159546.
DR   EnsemblGenomes-Gn; EBG00001159547.
DR   EnsemblGenomes-Gn; EBG00001159548.
DR   EnsemblGenomes-Gn; EBG00001159549.
DR   EnsemblGenomes-Gn; EBG00001159550.
DR   EnsemblGenomes-Gn; EBG00001159551.
DR   EnsemblGenomes-Gn; EBG00001159552.
DR   EnsemblGenomes-Gn; EBG00001159553.
DR   EnsemblGenomes-Gn; EBG00001159554.
DR   EnsemblGenomes-Gn; EBG00001159555.
DR   EnsemblGenomes-Gn; EBG00001159556.
DR   EnsemblGenomes-Gn; EBG00001159557.
DR   EnsemblGenomes-Gn; EBG00001159558.
DR   EnsemblGenomes-Gn; YPD4_2929.
DR   EnsemblGenomes-Gn; YPD4_3582.
DR   EnsemblGenomes-Gn; YPD4_r1.
DR   EnsemblGenomes-Gn; YPD4_r10.
DR   EnsemblGenomes-Gn; YPD4_r11.
DR   EnsemblGenomes-Gn; YPD4_r12.
DR   EnsemblGenomes-Gn; YPD4_r13.
DR   EnsemblGenomes-Gn; YPD4_r14.
DR   EnsemblGenomes-Gn; YPD4_r15.
DR   EnsemblGenomes-Gn; YPD4_r16.
DR   EnsemblGenomes-Gn; YPD4_r17.
DR   EnsemblGenomes-Gn; YPD4_r18.
DR   EnsemblGenomes-Gn; YPD4_r19.
DR   EnsemblGenomes-Gn; YPD4_r2.
DR   EnsemblGenomes-Gn; YPD4_r20.
DR   EnsemblGenomes-Gn; YPD4_r3.
DR   EnsemblGenomes-Gn; YPD4_r4.
DR   EnsemblGenomes-Gn; YPD4_r5.
DR   EnsemblGenomes-Gn; YPD4_r6.
DR   EnsemblGenomes-Gn; YPD4_r7.
DR   EnsemblGenomes-Gn; YPD4_r8.
DR   EnsemblGenomes-Gn; YPD4_r9.
DR   EnsemblGenomes-Gn; YPD4_t1.
DR   EnsemblGenomes-Gn; YPD4_t10.
DR   EnsemblGenomes-Gn; YPD4_t11.
DR   EnsemblGenomes-Gn; YPD4_t12.
DR   EnsemblGenomes-Gn; YPD4_t13.
DR   EnsemblGenomes-Gn; YPD4_t14.
DR   EnsemblGenomes-Gn; YPD4_t15.
DR   EnsemblGenomes-Gn; YPD4_t16.
DR   EnsemblGenomes-Gn; YPD4_t17.
DR   EnsemblGenomes-Gn; YPD4_t18.
DR   EnsemblGenomes-Gn; YPD4_t19.
DR   EnsemblGenomes-Gn; YPD4_t2.
DR   EnsemblGenomes-Gn; YPD4_t20.
DR   EnsemblGenomes-Gn; YPD4_t21.
DR   EnsemblGenomes-Gn; YPD4_t22.
DR   EnsemblGenomes-Gn; YPD4_t23.
DR   EnsemblGenomes-Gn; YPD4_t24.
DR   EnsemblGenomes-Gn; YPD4_t25.
DR   EnsemblGenomes-Gn; YPD4_t26.
DR   EnsemblGenomes-Gn; YPD4_t27.
DR   EnsemblGenomes-Gn; YPD4_t28.
DR   EnsemblGenomes-Gn; YPD4_t29.
DR   EnsemblGenomes-Gn; YPD4_t3.
DR   EnsemblGenomes-Gn; YPD4_t30.
DR   EnsemblGenomes-Gn; YPD4_t31.
DR   EnsemblGenomes-Gn; YPD4_t32.
DR   EnsemblGenomes-Gn; YPD4_t33.
DR   EnsemblGenomes-Gn; YPD4_t34.
DR   EnsemblGenomes-Gn; YPD4_t35.
DR   EnsemblGenomes-Gn; YPD4_t36.
DR   EnsemblGenomes-Gn; YPD4_t37.
DR   EnsemblGenomes-Gn; YPD4_t38.
DR   EnsemblGenomes-Gn; YPD4_t39.
DR   EnsemblGenomes-Gn; YPD4_t4.
DR   EnsemblGenomes-Gn; YPD4_t40.
DR   EnsemblGenomes-Gn; YPD4_t41.
DR   EnsemblGenomes-Gn; YPD4_t42.
DR   EnsemblGenomes-Gn; YPD4_t43.
DR   EnsemblGenomes-Gn; YPD4_t44.
DR   EnsemblGenomes-Gn; YPD4_t45.
DR   EnsemblGenomes-Gn; YPD4_t46.
DR   EnsemblGenomes-Gn; YPD4_t47.
DR   EnsemblGenomes-Gn; YPD4_t48.
DR   EnsemblGenomes-Gn; YPD4_t49.
DR   EnsemblGenomes-Gn; YPD4_t5.
DR   EnsemblGenomes-Gn; YPD4_t50.
DR   EnsemblGenomes-Gn; YPD4_t51.
DR   EnsemblGenomes-Gn; YPD4_t52.
DR   EnsemblGenomes-Gn; YPD4_t53.
DR   EnsemblGenomes-Gn; YPD4_t54.
DR   EnsemblGenomes-Gn; YPD4_t55.
DR   EnsemblGenomes-Gn; YPD4_t56.
DR   EnsemblGenomes-Gn; YPD4_t57.
DR   EnsemblGenomes-Gn; YPD4_t58.
DR   EnsemblGenomes-Gn; YPD4_t59.
DR   EnsemblGenomes-Gn; YPD4_t6.
DR   EnsemblGenomes-Gn; YPD4_t60.
DR   EnsemblGenomes-Gn; YPD4_t61.
DR   EnsemblGenomes-Gn; YPD4_t62.
DR   EnsemblGenomes-Gn; YPD4_t63.
DR   EnsemblGenomes-Gn; YPD4_t64.
DR   EnsemblGenomes-Gn; YPD4_t65.
DR   EnsemblGenomes-Gn; YPD4_t66.
DR   EnsemblGenomes-Gn; YPD4_t67.
DR   EnsemblGenomes-Gn; YPD4_t68.
DR   EnsemblGenomes-Gn; YPD4_t69.
DR   EnsemblGenomes-Gn; YPD4_t7.
DR   EnsemblGenomes-Gn; YPD4_t8.
DR   EnsemblGenomes-Gn; YPD4_t9.
DR   EnsemblGenomes-Tr; EBT00001747900.
DR   EnsemblGenomes-Tr; EBT00001747901.
DR   EnsemblGenomes-Tr; EBT00001747902.
DR   EnsemblGenomes-Tr; EBT00001747903.
DR   EnsemblGenomes-Tr; EBT00001747904.
DR   EnsemblGenomes-Tr; EBT00001747905.
DR   EnsemblGenomes-Tr; EBT00001747906.
DR   EnsemblGenomes-Tr; EBT00001747907.
DR   EnsemblGenomes-Tr; EBT00001747908.
DR   EnsemblGenomes-Tr; EBT00001747909.
DR   EnsemblGenomes-Tr; EBT00001747910.
DR   EnsemblGenomes-Tr; EBT00001747911.
DR   EnsemblGenomes-Tr; EBT00001747912.
DR   EnsemblGenomes-Tr; EBT00001747913.
DR   EnsemblGenomes-Tr; EBT00001747914.
DR   EnsemblGenomes-Tr; EBT00001747915.
DR   EnsemblGenomes-Tr; EBT00001747916.
DR   EnsemblGenomes-Tr; EBT00001747917.
DR   EnsemblGenomes-Tr; EBT00001747918.
DR   EnsemblGenomes-Tr; EBT00001747919.
DR   EnsemblGenomes-Tr; EBT00001747920.
DR   EnsemblGenomes-Tr; EBT00001747921.
DR   EnsemblGenomes-Tr; EBT00001747922.
DR   EnsemblGenomes-Tr; EBT00001747923.
DR   EnsemblGenomes-Tr; EBT00001747924.
DR   EnsemblGenomes-Tr; EBT00001747925.
DR   EnsemblGenomes-Tr; EBT00001747926.
DR   EnsemblGenomes-Tr; EBT00001747927.
DR   EnsemblGenomes-Tr; EBT00001747928.
DR   EnsemblGenomes-Tr; EBT00001747929.
DR   EnsemblGenomes-Tr; EBT00001747930.
DR   EnsemblGenomes-Tr; EBT00001747931.
DR   EnsemblGenomes-Tr; EBT00001747932.
DR   EnsemblGenomes-Tr; EBT00001747933.
DR   EnsemblGenomes-Tr; EBT00001747934.
DR   EnsemblGenomes-Tr; EBT00001747935.
DR   EnsemblGenomes-Tr; EBT00001747936.
DR   EnsemblGenomes-Tr; EBT00001747937.
DR   EnsemblGenomes-Tr; EBT00001747938.
DR   EnsemblGenomes-Tr; EBT00001747939.
DR   EnsemblGenomes-Tr; EBT00001747940.
DR   EnsemblGenomes-Tr; EBT00001747941.
DR   EnsemblGenomes-Tr; EBT00001747942.
DR   EnsemblGenomes-Tr; EBT00001747943.
DR   EnsemblGenomes-Tr; EBT00001747944.
DR   EnsemblGenomes-Tr; EBT00001747945.
DR   EnsemblGenomes-Tr; EBT00001747946.
DR   EnsemblGenomes-Tr; EBT00001747947.
DR   EnsemblGenomes-Tr; EBT00001747948.
DR   EnsemblGenomes-Tr; EBT00001747949.
DR   EnsemblGenomes-Tr; EBT00001747950.
DR   EnsemblGenomes-Tr; EBT00001747951.
DR   EnsemblGenomes-Tr; EBT00001747952.
DR   EnsemblGenomes-Tr; EBT00001747953.
DR   EnsemblGenomes-Tr; EBT00001747954.
DR   EnsemblGenomes-Tr; EBT00001747955.
DR   EnsemblGenomes-Tr; EBT00001747956.
DR   EnsemblGenomes-Tr; EBT00001747957.
DR   EnsemblGenomes-Tr; EBT00001747958.
DR   EnsemblGenomes-Tr; EBT00001747959.
DR   EnsemblGenomes-Tr; EBT00001747960.
DR   EnsemblGenomes-Tr; EBT00001747961.
DR   EnsemblGenomes-Tr; EBT00001747962.
DR   EnsemblGenomes-Tr; EBT00001747963.
DR   EnsemblGenomes-Tr; EBT00001747964.
DR   EnsemblGenomes-Tr; EBT00001747965.
DR   EnsemblGenomes-Tr; EBT00001747966.
DR   EnsemblGenomes-Tr; EBT00001747967.
DR   EnsemblGenomes-Tr; EBT00001747968.
DR   EnsemblGenomes-Tr; EBT00001747969.
DR   EnsemblGenomes-Tr; EBT00001747970.
DR   EnsemblGenomes-Tr; EBT00001747971.
DR   EnsemblGenomes-Tr; EBT00001747972.
DR   EnsemblGenomes-Tr; EBT00001747973.
DR   EnsemblGenomes-Tr; EBT00001747974.
DR   EnsemblGenomes-Tr; EBT00001747975.
DR   EnsemblGenomes-Tr; EBT00001747976.
DR   EnsemblGenomes-Tr; EBT00001747977.
DR   EnsemblGenomes-Tr; EBT00001747978.
DR   EnsemblGenomes-Tr; EBT00001747979.
DR   EnsemblGenomes-Tr; EBT00001747980.
DR   EnsemblGenomes-Tr; EBT00001747981.
DR   EnsemblGenomes-Tr; EBT00001747982.
DR   EnsemblGenomes-Tr; EBT00001747983.
DR   EnsemblGenomes-Tr; EBT00001747984.
DR   EnsemblGenomes-Tr; EBT00001747985.
DR   EnsemblGenomes-Tr; EBT00001747986.
DR   EnsemblGenomes-Tr; EBT00001747987.
DR   EnsemblGenomes-Tr; EBT00001747988.
DR   EnsemblGenomes-Tr; EBT00001747989.
DR   EnsemblGenomes-Tr; EBT00001747990.
DR   EnsemblGenomes-Tr; EBT00001747991.
DR   EnsemblGenomes-Tr; EBT00001747992.
DR   EnsemblGenomes-Tr; EBT00001747993.
DR   EnsemblGenomes-Tr; EBT00001747994.
DR   EnsemblGenomes-Tr; EBT00001747995.
DR   EnsemblGenomes-Tr; EBT00001747996.
DR   EnsemblGenomes-Tr; EBT00001747997.
DR   EnsemblGenomes-Tr; EBT00001747998.
DR   EnsemblGenomes-Tr; EBT00001747999.
DR   EnsemblGenomes-Tr; EBT00001748000.
DR   EnsemblGenomes-Tr; EBT00001748001.
DR   EnsemblGenomes-Tr; EBT00001748002.
DR   EnsemblGenomes-Tr; EBT00001748003.
DR   EnsemblGenomes-Tr; EBT00001748004.
DR   EnsemblGenomes-Tr; EBT00001748005.
DR   EnsemblGenomes-Tr; EBT00001748006.
DR   EnsemblGenomes-Tr; EBT00001748007.
DR   EnsemblGenomes-Tr; EBT00001748008.
DR   EnsemblGenomes-Tr; EBT00001748009.
DR   EnsemblGenomes-Tr; EBT00001748010.
DR   EnsemblGenomes-Tr; EBT00001748011.
DR   EnsemblGenomes-Tr; EBT00001748012.
DR   EnsemblGenomes-Tr; EBT00001748013.
DR   EnsemblGenomes-Tr; EBT00001748014.
DR   EnsemblGenomes-Tr; EBT00001748015.
DR   EnsemblGenomes-Tr; EBT00001748016.
DR   EnsemblGenomes-Tr; EBT00001748017.
DR   EnsemblGenomes-Tr; EBT00001748018.
DR   EnsemblGenomes-Tr; EBT00001748019.
DR   EnsemblGenomes-Tr; EBT00001748020.
DR   EnsemblGenomes-Tr; EBT00001748021.
DR   EnsemblGenomes-Tr; EBT00001748022.
DR   EnsemblGenomes-Tr; EBT00001748023.
DR   EnsemblGenomes-Tr; EBT00001748024.
DR   EnsemblGenomes-Tr; EBT00001748025.
DR   EnsemblGenomes-Tr; EBT00001748026.
DR   EnsemblGenomes-Tr; EBT00001748027.
DR   EnsemblGenomes-Tr; EBT00001748028.
DR   EnsemblGenomes-Tr; EBT00001748029.
DR   EnsemblGenomes-Tr; EBT00001748030.
DR   EnsemblGenomes-Tr; EBT00001748031.
DR   EnsemblGenomes-Tr; EBT00001748032.
DR   EnsemblGenomes-Tr; EBT00001748033.
DR   EnsemblGenomes-Tr; EBT00001748034.
DR   EnsemblGenomes-Tr; EBT00001748035.
DR   EnsemblGenomes-Tr; EBT00001748036.
DR   EnsemblGenomes-Tr; EBT00001748037.
DR   EnsemblGenomes-Tr; EBT00001748038.
DR   EnsemblGenomes-Tr; EBT00001748039.
DR   EnsemblGenomes-Tr; EBT00001748040.
DR   EnsemblGenomes-Tr; EBT00001748041.
DR   EnsemblGenomes-Tr; EBT00001748042.
DR   EnsemblGenomes-Tr; EBT00001748043.
DR   EnsemblGenomes-Tr; EBT00001748044.
DR   EnsemblGenomes-Tr; EBT00001748045.
DR   EnsemblGenomes-Tr; EBT00001748046.
DR   EnsemblGenomes-Tr; EBT00001748047.
DR   EnsemblGenomes-Tr; EBT00001748048.
DR   EnsemblGenomes-Tr; EBT00001748049.
DR   EnsemblGenomes-Tr; EBT00001748050.
DR   EnsemblGenomes-Tr; EBT00001748051.
DR   EnsemblGenomes-Tr; EBT00001748052.
DR   EnsemblGenomes-Tr; EBT00001748053.
DR   EnsemblGenomes-Tr; EBT00001748054.
DR   EnsemblGenomes-Tr; EBT00001748055.
DR   EnsemblGenomes-Tr; EBT00001748056.
DR   EnsemblGenomes-Tr; EBT00001748057.
DR   EnsemblGenomes-Tr; EBT00001748058.
DR   EnsemblGenomes-Tr; EBT00001748059.
DR   EnsemblGenomes-Tr; EBT00001748060.
DR   EnsemblGenomes-Tr; EBT00001748061.
DR   EnsemblGenomes-Tr; EBT00001748062.
DR   EnsemblGenomes-Tr; EBT00001748063.
DR   EnsemblGenomes-Tr; EBT00001748064.
DR   EnsemblGenomes-Tr; EBT00001748065.
DR   EnsemblGenomes-Tr; EBT00001748066.
DR   EnsemblGenomes-Tr; EBT00001748067.
DR   EnsemblGenomes-Tr; EBT00001748068.
DR   EnsemblGenomes-Tr; EBT00001748069.
DR   EnsemblGenomes-Tr; EBT00001748070.
DR   EnsemblGenomes-Tr; EBT00001748071.
DR   EnsemblGenomes-Tr; EBT00001748072.
DR   EnsemblGenomes-Tr; EBT00001748074.
DR   EnsemblGenomes-Tr; EBT00001748075.
DR   EnsemblGenomes-Tr; EBT00001748077.
DR   EnsemblGenomes-Tr; EBT00001748080.
DR   EnsemblGenomes-Tr; EBT00001748081.
DR   EnsemblGenomes-Tr; EBT00001748083.
DR   EnsemblGenomes-Tr; EBT00001748084.
DR   EnsemblGenomes-Tr; EBT00001748086.
DR   EnsemblGenomes-Tr; EBT00001748087.
DR   EnsemblGenomes-Tr; EBT00001748089.
DR   EnsemblGenomes-Tr; EBT00001748091.
DR   EnsemblGenomes-Tr; EBT00001748093.
DR   EnsemblGenomes-Tr; EBT00001748095.
DR   EnsemblGenomes-Tr; EBT00001748097.
DR   EnsemblGenomes-Tr; EBT00001748099.
DR   EnsemblGenomes-Tr; EBT00001748100.
DR   EnsemblGenomes-Tr; EBT00001748103.
DR   EnsemblGenomes-Tr; EBT00001748104.
DR   EnsemblGenomes-Tr; EBT00001748105.
DR   EnsemblGenomes-Tr; EBT00001748106.
DR   EnsemblGenomes-Tr; EBT00001748107.
DR   EnsemblGenomes-Tr; EBT00001748108.
DR   EnsemblGenomes-Tr; EBT00001748109.
DR   EnsemblGenomes-Tr; EBT00001748110.
DR   EnsemblGenomes-Tr; EBT00001748111.
DR   EnsemblGenomes-Tr; EBT00001748112.
DR   EnsemblGenomes-Tr; EBT00001748113.
DR   EnsemblGenomes-Tr; EBT00001748114.
DR   EnsemblGenomes-Tr; EBT00001748115.
DR   EnsemblGenomes-Tr; EBT00001748116.
DR   EnsemblGenomes-Tr; EBT00001748117.
DR   EnsemblGenomes-Tr; EBT00001748118.
DR   EnsemblGenomes-Tr; EBT00001748119.
DR   EnsemblGenomes-Tr; EBT00001748120.
DR   EnsemblGenomes-Tr; EBT00001748121.
DR   EnsemblGenomes-Tr; EBT00001748122.
DR   EnsemblGenomes-Tr; EBT00001748123.
DR   EnsemblGenomes-Tr; EBT00001748124.
DR   EnsemblGenomes-Tr; EBT00001748125.
DR   EnsemblGenomes-Tr; EBT00001748127.
DR   EnsemblGenomes-Tr; EBT00001748128.
DR   EnsemblGenomes-Tr; EBT00001748129.
DR   EnsemblGenomes-Tr; EBT00001748130.
DR   EnsemblGenomes-Tr; EBT00001748131.
DR   EnsemblGenomes-Tr; EBT00001748132.
DR   EnsemblGenomes-Tr; EBT00001748133.
DR   EnsemblGenomes-Tr; EBT00001748135.
DR   EnsemblGenomes-Tr; EBT00001748137.
DR   EnsemblGenomes-Tr; YPD4_2929.
DR   EnsemblGenomes-Tr; YPD4_3582.
DR   EnsemblGenomes-Tr; YPD4_r1-1.
DR   EnsemblGenomes-Tr; YPD4_r10-1.
DR   EnsemblGenomes-Tr; YPD4_r11-1.
DR   EnsemblGenomes-Tr; YPD4_r12-1.
DR   EnsemblGenomes-Tr; YPD4_r13-1.
DR   EnsemblGenomes-Tr; YPD4_r14-1.
DR   EnsemblGenomes-Tr; YPD4_r15-1.
DR   EnsemblGenomes-Tr; YPD4_r16-1.
DR   EnsemblGenomes-Tr; YPD4_r17-1.
DR   EnsemblGenomes-Tr; YPD4_r18-1.
DR   EnsemblGenomes-Tr; YPD4_r19-1.
DR   EnsemblGenomes-Tr; YPD4_r2-1.
DR   EnsemblGenomes-Tr; YPD4_r20-1.
DR   EnsemblGenomes-Tr; YPD4_r3-1.
DR   EnsemblGenomes-Tr; YPD4_r4-1.
DR   EnsemblGenomes-Tr; YPD4_r5-1.
DR   EnsemblGenomes-Tr; YPD4_r6-1.
DR   EnsemblGenomes-Tr; YPD4_r7-1.
DR   EnsemblGenomes-Tr; YPD4_r8-1.
DR   EnsemblGenomes-Tr; YPD4_r9-1.
DR   EnsemblGenomes-Tr; YPD4_t1-1.
DR   EnsemblGenomes-Tr; YPD4_t10-1.
DR   EnsemblGenomes-Tr; YPD4_t11-1.
DR   EnsemblGenomes-Tr; YPD4_t12-1.
DR   EnsemblGenomes-Tr; YPD4_t13-1.
DR   EnsemblGenomes-Tr; YPD4_t14-1.
DR   EnsemblGenomes-Tr; YPD4_t15-1.
DR   EnsemblGenomes-Tr; YPD4_t16-1.
DR   EnsemblGenomes-Tr; YPD4_t17-1.
DR   EnsemblGenomes-Tr; YPD4_t18-1.
DR   EnsemblGenomes-Tr; YPD4_t19-1.
DR   EnsemblGenomes-Tr; YPD4_t2-1.
DR   EnsemblGenomes-Tr; YPD4_t20-1.
DR   EnsemblGenomes-Tr; YPD4_t21-1.
DR   EnsemblGenomes-Tr; YPD4_t22-1.
DR   EnsemblGenomes-Tr; YPD4_t23-1.
DR   EnsemblGenomes-Tr; YPD4_t24-1.
DR   EnsemblGenomes-Tr; YPD4_t25-1.
DR   EnsemblGenomes-Tr; YPD4_t26-1.
DR   EnsemblGenomes-Tr; YPD4_t27-1.
DR   EnsemblGenomes-Tr; YPD4_t28-1.
DR   EnsemblGenomes-Tr; YPD4_t29-1.
DR   EnsemblGenomes-Tr; YPD4_t3-1.
DR   EnsemblGenomes-Tr; YPD4_t30-1.
DR   EnsemblGenomes-Tr; YPD4_t31-1.
DR   EnsemblGenomes-Tr; YPD4_t32-1.
DR   EnsemblGenomes-Tr; YPD4_t33-1.
DR   EnsemblGenomes-Tr; YPD4_t34-1.
DR   EnsemblGenomes-Tr; YPD4_t35-1.
DR   EnsemblGenomes-Tr; YPD4_t36-1.
DR   EnsemblGenomes-Tr; YPD4_t37-1.
DR   EnsemblGenomes-Tr; YPD4_t38-1.
DR   EnsemblGenomes-Tr; YPD4_t39-1.
DR   EnsemblGenomes-Tr; YPD4_t4-1.
DR   EnsemblGenomes-Tr; YPD4_t40-1.
DR   EnsemblGenomes-Tr; YPD4_t41-1.
DR   EnsemblGenomes-Tr; YPD4_t42-1.
DR   EnsemblGenomes-Tr; YPD4_t43-1.
DR   EnsemblGenomes-Tr; YPD4_t44-1.
DR   EnsemblGenomes-Tr; YPD4_t45-1.
DR   EnsemblGenomes-Tr; YPD4_t46-1.
DR   EnsemblGenomes-Tr; YPD4_t47-1.
DR   EnsemblGenomes-Tr; YPD4_t48-1.
DR   EnsemblGenomes-Tr; YPD4_t49-1.
DR   EnsemblGenomes-Tr; YPD4_t5-1.
DR   EnsemblGenomes-Tr; YPD4_t50-1.
DR   EnsemblGenomes-Tr; YPD4_t51-1.
DR   EnsemblGenomes-Tr; YPD4_t52-1.
DR   EnsemblGenomes-Tr; YPD4_t53-1.
DR   EnsemblGenomes-Tr; YPD4_t54-1.
DR   EnsemblGenomes-Tr; YPD4_t55-1.
DR   EnsemblGenomes-Tr; YPD4_t56-1.
DR   EnsemblGenomes-Tr; YPD4_t57-1.
DR   EnsemblGenomes-Tr; YPD4_t58-1.
DR   EnsemblGenomes-Tr; YPD4_t59-1.
DR   EnsemblGenomes-Tr; YPD4_t6-1.
DR   EnsemblGenomes-Tr; YPD4_t60-1.
DR   EnsemblGenomes-Tr; YPD4_t61-1.
DR   EnsemblGenomes-Tr; YPD4_t62-1.
DR   EnsemblGenomes-Tr; YPD4_t63-1.
DR   EnsemblGenomes-Tr; YPD4_t64-1.
DR   EnsemblGenomes-Tr; YPD4_t65-1.
DR   EnsemblGenomes-Tr; YPD4_t66-1.
DR   EnsemblGenomes-Tr; YPD4_t67-1.
DR   EnsemblGenomes-Tr; YPD4_t68-1.
DR   EnsemblGenomes-Tr; YPD4_t69-1.
DR   EnsemblGenomes-Tr; YPD4_t7-1.
DR   EnsemblGenomes-Tr; YPD4_t8-1.
DR   EnsemblGenomes-Tr; YPD4_t9-1.
DR   EuropePMC; PMC2897648; 20453098.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00018; CsrB.
DR   RFAM; RF00021; Spot_42.
DR   RFAM; RF00022; GcvB.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00033; MicF.
DR   RFAM; RF00034; RprA.
DR   RFAM; RF00040; rne5.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00057; RyhB.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00078; MicA.
DR   RFAM; RF00079; OmrA-B.
DR   RFAM; RF00081; ArcZ.
DR   RFAM; RF00082; SraG.
DR   RFAM; RF00083; GlmZ_SraJ.
DR   RFAM; RF00101; SraC_RyeA.
DR   RFAM; RF00110; RybB.
DR   RFAM; RF00111; RyeB.
DR   RFAM; RF00112; CyaR_RyeE.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00128; GlmY_tke1.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00368; sroB.
DR   RFAM; RF00369; sroC.
DR   RFAM; RF00382; DnaX.
DR   RFAM; RF00383; IS1222_FSE.
DR   RFAM; RF00391; RtT.
DR   RFAM; RF00506; Thr_leader.
DR   RFAM; RF00512; Leu_leader.
DR   RFAM; RF00513; Trp_leader.
DR   RFAM; RF00514; His_leader.
DR   RFAM; RF00552; rncO.
DR   RFAM; RF00630; P26.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01317; CRISPR-DR4.
DR   RFAM; RF01393; isrJ.
DR   RFAM; RF01394; isrK.
DR   RFAM; RF01396; isrN.
DR   RFAM; RF01405; STnc490k.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01707; JUMPstart.
DR   RFAM; RF01728; STAXI.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01748; nuoG.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01769; greA.
DR   RFAM; RF01770; rimP.
DR   RFAM; RF01796; frnS.
DR   RFAM; RF01830; StyR-44.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01859; Phe_leader.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF02029; sraA.
DR   RFAM; RF02030; tp2.
DR   RFAM; RF02031; tpke11.
DR   RFAM; RF02074; STnc240.
DR   SILVA-LSU; CP001585.
DR   SILVA-SSU; CP001585.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4640720
FT                   /organism="Yersinia pestis D106004"
FT                   /strain="D106004"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:637382"
FT   gene            complement(270..710)
FT                   /locus_tag="YPD4_0001"
FT   CDS_pept        complement(270..710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0001"
FT                   /product="flavodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56910"
FT                   /protein_id="ACY56910.1"
FT                   /translation="MADITLISGSTLGSAEYVAEHLADKLEEAGFSTEILHGPELDELT
FT                   LNGLWLIVTSTHGAGDLPDNLQPLLEQIEQQKPDLSQVRFGAVGLGSSEYDTFCGAIIK
FT                   LDQQLIAQGAQRLGEILEIDVIQHEIPEDPAEIWVKDWINLL"
FT   gene            complement(803..1264)
FT                   /gene="asnC"
FT                   /locus_tag="YPD4_0002"
FT   CDS_pept        complement(803..1264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnC"
FT                   /locus_tag="YPD4_0002"
FT                   /product="regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56911"
FT                   /protein_id="ACY56911.1"
FT                   /translation="MSEIYQIDNLDRSILKALMENARTPYAELAKNLAVSPGTIHVRVE
FT                   KMRQAGIITAACVHVNPKQLGYDVCCFIGIILKSAKDYPSALKKLESLEEVVEAYYTTG
FT                   HYSIFIKVMCKSIDALQQVLINKIQTIDEIQSTETLISLQNPIMRTIVP"
FT   gene            1434..2426
FT                   /gene="asnA"
FT                   /locus_tag="YPD4_0003"
FT   CDS_pept        1434..2426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnA"
FT                   /locus_tag="YPD4_0003"
FT                   /product="asparagine synthetase AsnA"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56912"
FT                   /protein_id="ACY56912.1"
FT                   /translation="MKKQFIQKQQQISFVKSFFSRQLEQQLGLIEVQAPILSRVGDGTQ
FT                   DNLSGSEKAVQVKVKSLPDSTFEVVHSLAKWKRKTLGRFDFGADQGVYTHMKALRPDED
FT                   RLSAIHSVYVDQWDWERVMGDGERNLAYLKSTVNKIYAAIKETEAAISAEFGVKPFLPD
FT                   HIQFIHSESLRARFPDLDAKGRERAIAKELGAVFLIGIGGKLADGQSHDVRAPDYDDWT
FT                   SPSAEGFSGLNGDIIVWNPILEDAFEISSMGIRVDAEALKRQLALTGDEDRLELEWHQS
FT                   LLRGEMPQTIGGGIGQSRLVMLLLQKQHIGQVQCGVWGPEISEKVDGLL"
FT   gene            complement(2525..3991)
FT                   /locus_tag="YPD4_0004"
FT   CDS_pept        complement(2525..3991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0004"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56913"
FT                   /protein_id="ACY56913.1"
FT                   /translation="MLSLATLDMLLSISEGELIEEMVVGLLAAPQLAIFFEKFPRIKRA
FT                   LMKDIPGWKQNLQQRIREASVPPGLANEFSLYQQSLLEDSPQFYAHLPDIVAQLQDLHS
FT                   PFATQAKTLVQTADLAKNPPGGDSLQTLFLQRWRVSLILQTITIHHQLLEQEREQLLAE
FT                   LQRRLALSGALEPILTTNDNAAGRLWDMSQGHLQRGDYQLLLQYGDFLQQQPELIRLAE
FT                   QLGRSRSAKAQPAPDARYEPYTVMVRQPDSVPEEVSGIHQSNDILRLLPTELVMLGMSE
FT                   LEFEFYRRLLERRLLTYRLQGDNWQEKTQQRPVSLKQNDEQPRGPFIVCVDTSGSMGGF
FT                   NEQCAKAFCLALLRIALADNRRCYIMLFATEIIHYELSADNGIEQAIRFLNQHFRGGTD
FT                   LAACLANTLNKMEDREWYDADAVIISDFIAQRLPEELVRKIKIQQQAHQHRFHAVAMSA
FT                   YGKPGIMRIFDHIWRFDTSLKSRLIRRWKR"
FT   gene            complement(3995..5548)
FT                   /locus_tag="YPD4_0005"
FT   CDS_pept        complement(3995..5548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0005"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56914"
FT                   /protein_id="ACY56914.1"
FT                   /translation="MAQSSQLAERISRLSHALESGLYERQEAIRLCLLAALSGESVFLL
FT                   GPPGIAKSLIARRLKFAFRHARAFEYLMTRFSTPEEVFGPLSIQALKEEGRYQRMTGGY
FT                   LPEAEIVFLDEIWKAGPAILNTLLTAINERRFRNGDREDSIPMRLLVTASNELPDADSS
FT                   LEALYDRMLIRLWLDRVQEKQNFRSLLISRQNENHNPVAENLSITDEEFHQWQPLIDKI
FT                   TLPDHCFELIFQLRQRLSALEHAPYVSDRRWKKALRLLQASAFFSGRDEITPIDLILLK
FT                   DCLWHDLNSFKLLQQQLEQLLTEQGYQQQSLLMKLQDINSKWLQHQQQQSDHQALTVVK
FT                   QSGMFSRKAQYALPDNLTDSTLTLLLQKPLNLHDIQVNHLQVDKEALAQWLNKGGALRA
FT                   KLNGVGYAQSIDAEIDDQLHIIILDVSRQPSTLSLPGATTTSVPPELLLALTKLESTLA
FT                   EQRRLFSQHQPCLFTPSSWLAKIEASLLQVVEQLQFQQIQFQQIQFQQRKFQQQKHSGH
FT                   "
FT   gene            5822..7690
FT                   /gene="kup"
FT                   /locus_tag="YPD4_0006"
FT   CDS_pept        5822..7690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kup"
FT                   /locus_tag="YPD4_0006"
FT                   /product="potassium transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56915"
FT                   /protein_id="ACY56915.1"
FT                   /translation="MSTEHKQYLSAVTLAAIGVVYGDIGTSPLYTLRECFSGHYGFDVR
FT                   PDVVFGFLSLIFWMLILVVSVKYLTYVMRADNAGEGGILTLMSLAGRNTSSRATSILVV
FT                   LGLIGGSFFYGEVVITPAISVMSAIEGLEIAAPALDPYIVPCSIAVLTLLFVIQKHGTG
FT                   SVGKLFAPVMLVWFLTLALLGLRSIIANPEVLAALNPKWAISFFVEYKSVSFFALGAVV
FT                   LAITGVEALYADMGHFGKFPIRLAWFTVVLPSLVLNYFGQGALLLKNPEAIKNPFFLLA
FT                   PDWALIPLLILATLATVIASQAVISGVFSLTRQAVRLGYLPPMRIIHTSEMESGQIYIP
FT                   VINWTLYLAVVLVIIGFERSSNLAAAYGIAVTGTMVITSILFCTVAWKNWHWNRFLVVF
FT                   LLMVLLIIDIPMFSANVLKLFSGGWLPLSLGLVMFIIMTTWKSERFSLLRRMHEHSNSL
FT                   EAMIASLEKSPPVRVPGTAVYMSRAMNVIPFALLHNLKHNKVLHERVVLLTMRTDDVPY
FT                   VHNVERVTIEQLSPTFWRVVARYGWRETPNVAEIFHRCGLEGLSCQMMETSFFMSHESL
FT                   ILTKRPWHLFLRGKLFIALSRNALRAPDQFEIPPNRVIELGTQVEI"
FT   gene            7895..8314
FT                   /locus_tag="YPD4_0007"
FT   CDS_pept        7895..8314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0007"
FT                   /product="ribose permease"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56916"
FT                   /protein_id="ACY56916.1"
FT                   /translation="MKKGVLLNADISAVISRLGHTDQIVIGDAGLPIPATTTRIDLALT
FT                   RGVPGFLQVVDVVTQEMQVENAYLAEEIVKNNPQLHEALLVLLTQLEQRQENQIALRYI
FT                   SHEAFKEQTKQSRAVIRSGECSPFANIILGSGVTF"
FT   gene            8365..9291
FT                   /gene="rbsK"
FT                   /locus_tag="YPD4_0008"
FT   CDS_pept        8365..9291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsK"
FT                   /locus_tag="YPD4_0008"
FT                   /product="ribokinase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56917"
FT                   /protein_id="ACY56917.1"
FT                   /translation="METGKLVVLGSINADHILNIEQFPRPGETVIGQQYNVAFGGKGAN
FT                   QAVAAGRSGADIAFIACVGDDDIGERVRQQLTADKIDTQPIEAIKGATTGVALIFVNSD
FT                   GENVIGINAGANSAVTPEYLRRYQQQVIDADALLMQLESPLDTVIAAAKLAKQHQTQVI
FT                   LNPAPARKLPDELLTLVDMITPNETEAERLTGIHIEQDDDAAKAAQILHDKGIATVIIT
FT                   LGSRGVWLSEQGKGKLVAGFKVNAVDTIAAGDTFNGALLTALLEGQSMDVAVRFAHAAA
FT                   AIAVTRPGAQPSIPWRAEIDSFLQERV"
FT   gene            complement(9511..10887)
FT                   /locus_tag="YPD4_0009"
FT   CDS_pept        complement(9511..10887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0009"
FT                   /product="membrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56918"
FT                   /protein_id="ACY56918.1"
FT                   /translation="MAFFMQALDATILNTALPSIAESLNRSPLTMQSAIISYTLTVAML
FT                   IPVSGWLADRFGTRRIFILAVSLFTFGSLLCALSGSLAFLVASRVIQGIGGAMMMPVAR
FT                   LALIRAYPRSELLPVLNFVTIPGLVGPVMGPLLGGLLVTYTTWHWIFILNIPIGLLGIF
FT                   YARKYMPNFTMPKRTFDFVGFLLFGISLVMISTSLEIMGRPEIADYLPAATLLGGLLML
FT                   IFYIFHAKGHPNPLIGLPLFKTRTFSVGIAGNVASRLGTGCVPFLMPLMLQVGFGYSAL
FT                   IAGCMMAPTAIGSIMAKSAVTQVLRSLGYRKVLVGITLIIGVLIASFALQSPGMSAWMM
FT                   ILPLFILGIAMSTQFTAMNTITLADLTDNNASSGNSVLAVTQQLSISFGIAISATVLRF
FT                   YDGLSLGGNVDHFHYTFITMGIVTLLSSLVFLLLKPRDGDNLIQGRNVKKVAPQVKNNV
FT                   "
FT   gene            complement(11015..11704)
FT                   /locus_tag="YPD4_0010"
FT   CDS_pept        complement(11015..11704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0010"
FT                   /product="putative GntR-famly transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56919"
FT                   /protein_id="ACY56919.1"
FT                   /translation="MQLNTQQQAAQRNLSYLLAEKIGQRILAGEYEAGSILPGEIELGE
FT                   QFGVSRTAVREAVKMLAAKGMLLPRPRIGTRVMPQTNWNYLDQELLTWWMTKENFDQVM
FT                   QHFLILRTSLEPQACYLAATHANEKQRELLASLVAEMRALHSNFNREQWIQVDTQFHKL
FT                   IYEASGNPFLISFANLFSSVYYSYFRAITGDEVIKLQHHQNIVDTILAGDNQGALFACQ
FT                   VLLKTVD"
FT   gene            12291..13762
FT                   /locus_tag="YPD4_r1"
FT   rRNA            12291..13762
FT                   /locus_tag="YPD4_r1"
FT                   /product="16S ribosomal RNA"
FT   gene            13943..14018
FT                   /locus_tag="YPD4_t1"
FT   tRNA            13943..14018
FT                   /locus_tag="YPD4_t1"
FT                   /product="tRNA-Glu"
FT   gene            14271..17177
FT                   /locus_tag="YPD4_r2"
FT   rRNA            14271..17177
FT                   /locus_tag="YPD4_r2"
FT                   /product="23S ribosomal RNA"
FT   gene            17177..17410
FT                   /locus_tag="YPD4_r3"
FT   rRNA            17177..17410
FT                   /locus_tag="YPD4_r3"
FT                   /product="5S ribosomal RNA"
FT   gene            17905..19113
FT                   /gene="y1062"
FT                   /locus_tag="YPD4_0011"
FT   CDS_pept        17905..19113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="y1062"
FT                   /locus_tag="YPD4_0011"
FT                   /product="transposase for the IS285 insertion element"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56920"
FT                   /protein_id="ACY56920.1"
FT                   /translation="MDEKKLKALAAELAKGLKTEADLNAFSRMLTKLTVETALNAELTE
FT                   HLGHEKNTPKSGSNTRNGYSSKTLLCDDGEIELNTPRDRENTFEPQLIKKNQTRITQMD
FT                   SQILSLYAKGMTTREIVATFKEMYDADVSPTLISKVTDAVKEQVAEWQNRQLDALYPIV
FT                   YMDCIVVKVRQNGSVINKAVFLALGINTEGQKELLGMWLAENEGAKFWLSVLTELKNRG
FT                   LQDILIACVDGLKGFPDAINSVYPQTHIQLCIIHMVRNSLKYVSWKDYKAVTSGLKMVY
FT                   QAPTEEAALMALDKFAEAWDDKYPQISKSWRTHWENLNTFFGYPPDIRKAIYTTNAIES
FT                   VNSVIRAAIKKRKVFPTDDSVRKVVYLAIKDASKKWSMPIQNWRLAMSRFIIEFGDRLS
FT                   DHL"
FT   gene            complement(19171..19728)
FT                   /gene="mobB"
FT                   /locus_tag="YPD4_0012"
FT   CDS_pept        complement(19171..19728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mobB"
FT                   /locus_tag="YPD4_0012"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein B"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56921"
FT                   /protein_id="ACY56921.1"
FT                   /translation="MGTKEKRPMMNYKSPPLLGIAAYSGTGKTTLLKSLIPLLQQRQVR
FT                   VGLIKHTHHNMEIDTPGKDSYELRKAGALQTLVASDCRWALMTETPEQQPLNLHYLASR
FT                   LDASTIDLILVEGFKHEPINKIALYRESIGKPFSGLIDKHVIALASDKPIETTVKQLDI
FT                   NQPEQITEFICTWLENISFEVR"
FT   gene            complement(19701..20288)
FT                   /locus_tag="YPD4_0013"
FT   CDS_pept        complement(19701..20288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0013"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein A"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56922"
FT                   /protein_id="ACY56922.1"
FT                   /translation="MQPNITGVILAGGRSSRMGGNDKGLIPLNGKPLFQYVIDRFKPQV
FT                   SDLVINANRNQGLYKESGIPVIDDIITGFVGPLAGMHAGLSYASTEWVVFAPCDVPALP
FT                   SDLVSQLWQGKKQALAAYANDDERAHPTFALMHISLKTQLADYLIRGDRKLMLFLDSIN
FT                   AQRVKFSGKADLFSNLNTPADCDLWEQKRRGQ"
FT   gene            20791..21777
FT                   /locus_tag="YPD4_0014"
FT   CDS_pept        20791..21777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0014"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56923"
FT                   /protein_id="ACY56923.1"
FT                   /translation="MNNSAFNFQTLSPDLIMDALEGAGLRVDSGLTALNSYENRVYQFM
FT                   DEESKRYVVKFYRPERWSSEQITEEHQFSLDLAESEIPVIAPLRLNGKTLHTHCGFFFA
FT                   VFPSVGGRQYEIDNLDQLEWVGRFLGRIHQAARNSLFVARPTMGIEEYLTEPRQLLANC
FT                   DLVPVKQRDKFLAAADLLITTIKQYWHTEWQPLRLHGDCHPGNILWRDGPMFVDLDDAR
FT                   NGPAIQDLWMLLHGDRRDQSMQLDILLEAYSEFADFDQRELALIEPLRAMRMVYYLAWV
FT                   ARRWQDPAFPKSFPWMAESDFWLQQTASFTEQVKLLQEPPLQLMPMY"
FT   gene            21957..22427
FT                   /locus_tag="YPD4_0015"
FT   CDS_pept        21957..22427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0015"
FT                   /product="secreted thiol:disulfide interchange protein
FT                   DsbA"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56924"
FT                   /protein_id="ACY56924.1"
FT                   /translation="MLQFEEVYQVPKAVKKALPEGTKMTRYHVEFLGPLGKQLTQAWAV
FT                   AMALGVEEKITPLMFEGVQKTQTVQTPGDIRNVFIKAGISGEDYDAALNSFVVKSLVAQ
FT                   QQKAAEDLQLRGVPAMFVNGKYMIKNDGMDTSSMDNYVKQYADVVTFLLTQK"
FT   gene            22919..25717
FT                   /gene="polA"
FT                   /locus_tag="YPD4_0016"
FT   CDS_pept        22919..25717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /locus_tag="YPD4_0016"
FT                   /product="DNA polymerase I"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56925"
FT                   /protein_id="ACY56925.1"
FT                   /translation="MAQIAENPLLLVDGSSYLYRAYHAFPPLTNGSGEPTGAMYGVLNM
FT                   LRSLLLQYRPSHVAVVFDAKGKTFRDELFAEYKSHRPPMPDDLRVQIEPLHQMVKAMGL
FT                   PLLVVSGVEADDVIGTLAREAEKAGHSVLISTGDKDMAQLVTPNITLINTMNNTILGPQ
FT                   DVCDKYGVPPELIIDFLALMGDSSDNIPGVPGVGEKTAQALLQGLGGLDTLFSNLDKIS
FT                   TLTFRGAKTMSAKLEQNKDVAYLSYKLATIKTDVELDVTCDELTVSPPDDKQLHQLFSR
FT                   YEFKRWLADVEAGKWLDSKKDRPTGQTSSQSFVAADTAPTAEVTAVLSQENYQTILDEK
FT                   ALADWIERLKAAEVFAFDTETDGLDTLSCNLIGMSFAVAPGEAAYLPLAHDYLDAPPQL
FT                   DRDWVLATLKPLLEDDKALKVGQNLKFDKSMLARYGIDLKGIAFDTMLESYVLDSVAGR
FT                   HDMDSLAERYLNHKTITFEEIAGKGKNQLTFNQIALEQAGPYAAEDADVTLQLHLVLWP
FT                   KLQQSEGLKRVFQEIEMPLLPILSRIERTGVLIDQNILAAHSKELTIRLDELEKQAHEL
FT                   AEEPFNLASPKQLQAILYEKQKLPILKKTPGGAASTNEEVLAELALDYPLPKVILEYRG
FT                   LAKLKSTYTDKLPLMINPVSGRVHTSYHQAVTATGRLSSRDPNLQNIPVRNEEGRRIRQ
FT                   AFIAPKGYCIMAADYSQIELRIMAHLSQDNGLLAAFAAGQDIHRATAAEVFGSPLEKVT
FT                   TEQRRSAKAINFGLIYGMSAFGLARQLGIPRGEAQRYMDLYFERYPGVLEYMERTRKQA
FT                   AEQGYVTTLDGRRLYLPDIHSRNANRRKAAEREAINAPMQGTAADIIKRAMIAVDGWLQ
FT                   QEPEPLVRVIMQVHDELVFEVHESVLQSAEQKIRELMEQSMQLAVPLKVDVGVGANWDQ
FT                   AH"
FT   gene            26075..26584
FT                   /locus_tag="YPD4_0017"
FT   CDS_pept        26075..26584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0017"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56926"
FT                   /protein_id="ACY56926.1"
FT                   /translation="MRSGNCKCSTRNQKGVPMRDEKSLAHTRWNCKYHIVFAPKYRRQV
FT                   FYREKRRAIGSILRKLCEWKNVNILEAECCVDHIHMLLEIPPKMSVSGFMGYLKGKSSL
FT                   MLYEQFGDLKFKYRNREFWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGS
FT                   PFTGRK"
FT   gene            complement(26836..27486)
FT                   /locus_tag="YPD4_0018"
FT   CDS_pept        complement(26836..27486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0018"
FT                   /product="GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56927"
FT                   /protein_id="ACY56927.1"
FT                   /translation="MTIRNYNYHMTHFVISAPDIRHLPRDEGIEVAFAGRSNAGKSSAL
FT                   NTLTNQKGLARTSKTPGRTQLINLFEVVDGVRLVDLPGYGYAEVPEEMKLKWQRALGEY
FT                   LQKRNCLKGLVVLMDIRHPLKDLDQQMITWAVAVGTPVLLLLTKADKLASGARKAQLNL
FT                   VREAIIPFMGDIQVEAFSSLKKIGVDKLREKLDTWFSEIPPEVMAEEFDGEGE"
FT   gene            28231..28797
FT                   /locus_tag="YPD4_0019"
FT   CDS_pept        28231..28797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0019"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56928"
FT                   /protein_id="ACY56928.1"
FT                   /translation="MKQPNKAPRANIAAPKGTATPKRRRKTRDELDAEARDRKRQKKHS
FT                   GNRSGARTNVEGSNKKGHSQTQEKDPRVGSKVPVPLVIESQVKAKSMPKPVEKNVVKPR
FT                   LTPEEELAKLENDERLDALLDRLDNDEVLNKEDQAYVDLTLDRIDALMEQLGIELGDDE
FT                   DDVEREEKQEDILQLLKRGNPKDTF"
FT   gene            28980..30353
FT                   /gene="hemN"
FT                   /locus_tag="YPD4_0020"
FT   CDS_pept        28980..30353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemN"
FT                   /locus_tag="YPD4_0020"
FT                   /product="coproporphyrinogen III oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56929"
FT                   /protein_id="ACY56929.1"
FT                   /translation="MSEHAIVWDLSLIQKYNYSGPRYTSYPTALEFSEDYNESAFQQAV
FT                   KRYPQRPLSLYVHIPFCHKLCYFCGCNKLVTRQQHKADEYLVVLEKEIRQRAALFTGRQ
FT                   VSQMHWGGGTPTYLNKTQISHLMTVLREHFDFLPDAEQSIEVDPREIELDVLDHLRAEG
FT                   FNRLSMGVQDFNKEVQRLVNREQDEDFIFALIARAKALGFNSTNIDLIYGLPKQTPESF
FT                   AFTLKRVAELNPDRLSVFNYAHLPSLFAAQRKIKDADLPTAEQRLDILQHTIRFLTESG
FT                   YQFIGMDHFARPDDELAIAQQEGTLHRNFQGYTTQGESDLLGLGVSAISMLGDSYAQNE
FT                   KDLETYYACVEQRGNALWRGLTMTEDDCLRRDVIKTLICHFQLSYQPIEQRYGIRFADY
FT                   FAEDFELLAPFEQDGLVERNETGLRVTPRGRLLIRNICMCFDIYLRKQARKQQFSRVI"
FT   gene            complement(30407..31819)
FT                   /gene="ntrC"
FT                   /locus_tag="YPD4_0021"
FT   CDS_pept        complement(30407..31819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntrC"
FT                   /locus_tag="YPD4_0021"
FT                   /product="nitrogen regulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56930"
FT                   /protein_id="ACY56930.1"
FT                   /translation="MQRGIVWIVDDDSSIRWVLERALTGAGLNCVAFDSGNQVLDALAT
FT                   RTPDVLLSDIRMPGMDGLALLKQIKQRHPMLPVIIMTAHSDLDAAVSAYQQGAFDYLPK
FT                   PFDIDEAVALVERAISHYQEQQQPARSQPVSGPTADIIGEAPAMQDVFRIIGRLSRSSI
FT                   SVLINGESGTGKELVAHALHRHSPRAKALFIALNMAAIPKDLIESELFGHEKGAFTGAN
FT                   QVRQGRFEQADTGTLFLDEIGDMPLDVQTRLLRVLADGQFYRVGGYAPVKVDVRIIAAT
FT                   HQNLELRVQEGKFREDLFHRLNVIRVHLPPLRERSEDIPRLARYFLHVAAKELGVESKN
FT                   LHPETEAALTRLPWPGNVRQLENTCRWLTVMAAGQEVLVQDLPSELFETHMPDASGQRA
FT                   PDSWSTLLAQWADRALRSGHQDLLSEAQPEMERTLLTTALRHTQGHKQEAARLLGWGRN
FT                   TLTRKLKELGME"
FT   gene            complement(31827..32876)
FT                   /gene="ntrB"
FT                   /locus_tag="YPD4_0022"
FT   CDS_pept        complement(31827..32876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntrB"
FT                   /locus_tag="YPD4_0022"
FT                   /product="Two component regulatory protein involved in
FT                   nitrogen assimilation"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56931"
FT                   /protein_id="ACY56931.1"
FT                   /translation="MATGTLPDAGQILNTLINSILLLDDDLAIHYANPAAQQLLAQSSR
FT                   KLFGTPLPDLLGYFSLNIVLMRESLQAGQGFTDNEVTLVVDGRAHILSLTAQSLAEGFI
FT                   LLELAPMDNQRRLSQEQLQHAQQVAARDLVRGLAHEIKNPLGGLRGAAQLLAKALPDPA
FT                   LLEYTQVIIEQADRLRNLVDRLLGPQRPGQHITQSIHQVAERVCQLVSLEKPDNVTLIR
FT                   DYDPSLPELAHDPDQIEQVLLNITRNALQALGETGGTITLRTRTAFQVTLHGMRYRLAA
FT                   RIDIEDDGPGVPTQLQDTVFYPMVSGREGGTGLGLSIARNLIDQHSGKIEFNSWPGHTE
FT                   FSVYLPIRQ"
FT   gene            complement(33129..34538)
FT                   /gene="glnA"
FT                   /locus_tag="YPD4_0023"
FT   CDS_pept        complement(33129..34538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnA"
FT                   /locus_tag="YPD4_0023"
FT                   /product="glutamine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56932"
FT                   /protein_id="ACY56932.1"
FT                   /translation="MSAEHVLTMLNEHEVKFVDLRFTDTKGKEQHITIPAHQVNADFFE
FT                   EGKMFDGSSIGGWKGINESDMVLMPDASTAVMDPFFADSTLIIRCDILEPGTMQGYDRD
FT                   PRSISKRAEDFLKSSGIADTVLFGPEPEFFLFDDIRFGSSINGSHVSIDDVEGAWNSST
FT                   KYEGGNKGHRPAVKGGYFPVPPVDSAQDLRSAMCLTMEEMGLVVEAHHHEVATAGQNEV
FT                   ATRFNTMTKKADEIQIYKYVVHNVAHAFGKTATFMPKPMFGDNGSGMHCHMSLSKNGNN
FT                   LFAGDKYGGLSEIALFYIGGIIKHAKAINALANPTTNSYKRLVPGYEAPVMLAYSARNR
FT                   SASIRIPVVASPKARRIEARFPDPAANPYLCFAALLMAGLDGIINKIHPGDAMDKNLYD
FT                   LPPEEEAEIPKVAGSLDEAMAALNEDREFLTRGGVFTDDAIDAYIELRREEMDRVRMTP
FT                   HPVEFELYYSV"
FT   gene            35100..36923
FT                   /gene="bipA"
FT                   /locus_tag="YPD4_0024"
FT   CDS_pept        35100..36923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bipA"
FT                   /locus_tag="YPD4_0024"
FT                   /product="putative GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56933"
FT                   /protein_id="ACY56933.1"
FT                   /translation="MIENLRNIAIIAHVDHGKTTLVDKLLQQSGTFGERTEATERVMDS
FT                   NDLEKERGITILAKNTAINWKDYRINIVDTPGHADFGGEVERVMSMVDSVLLVVDAMDG
FT                   PMPQTRFVTKKAFAHGLKPIVVINKVDRPGARPDWVVDQVFDLFVNLDATDEQLDFPII
FT                   YASALMGIAGEDHNDMAEDMTPLYQAIIDHVPAPDVDSSGPLQMQISQLDYNNYVGVIG
FT                   IGRIKRGIVKPNQQVTVIDSEGKTRNGKVGKVLGHMGLERIETTQAEAGDIVAITGLGE
FT                   LNISDTICDVNAVEALPPLSVDEPTVTMYFCVNTSPFCGKEGKYVTSRQILDRLNKELI
FT                   HNVALRVEETEDADAFRVSGRGELHLSVLIENMRREGFELAVSRPKVINRIIDGRNQEP
FT                   FESVTLDIEEQHQGAVMQAMGERKGDVKDMIPDGKGRIRLDYMIPSRGLIGFRTEFMTM
FT                   TSGTGLLYSTFSHYDDVRPGDIGQRQNGVLISNGQGKAVAFALYKLQDRGKLFIGHGTE
FT                   VYEGQIIGIHSRSNDLTVNCLTGKQLTNMRASGTDEATTLVPFLKKTLEQALEFIDDDE
FT                   LVEVTPQSIRIRKRHLTENDRKRAGRGPREG"
FT   gene            37245..37835
FT                   /locus_tag="YPD4_0025"
FT   CDS_pept        37245..37835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0025"
FT                   /product="phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56934"
FT                   /protein_id="ACY56934.1"
FT                   /translation="MLYIFDLGNVIVDIDFKRVLGVWSKLSSVPLATLNERFTMGEVFQ
FT                   QHERGEISDEDFAHQLSDEMGISLSFEQFAEGWQAIFVALRPEVIDIMNKLRREGNRVV
FT                   VLSNTNRLHCYYWPEHYPEVAAAADHMYLSQDLGMRKPEARIYQHVLNAENVPAEQAVF
FT                   FDDVEANVLAAKAVGINAIHVTDRQIIPTYFSL"
FT   gene            37932..38816
FT                   /gene="rbn"
FT                   /locus_tag="YPD4_0026"
FT   CDS_pept        37932..38816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbn"
FT                   /locus_tag="YPD4_0026"
FT                   /product="ribonuclease BN"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56935"
FT                   /protein_id="ACY56935.1"
FT                   /translation="MASFRRFRLLSPLKPCVTFGRMLYTRIDKDGLTMLAGHLAYVSLL
FT                   SLVPLITVIFALFAAFPMFAEISIKLKAFIFANFMPATGDIIQNYLEQFVANSNRMTVV
FT                   GTCGLIVTALLLIYSVDSVLNIIWRSKIQRSLVFSFAVYWMVLTLGPILVGASMVISSY
FT                   LLSLHWLAHARVDSMIDEILRVFPLLISWVSFWLLYSVVPTVRVPARDALIGALVAALL
FT                   FELGKKGFAMYITLFPSYQLIYGVLAVIPILFLWVYWSWCIVLLGAEITVTLGEYRAER
FT                   HHAKSVTTQSPEM"
FT   gene            38823..39260
FT                   /locus_tag="YPD4_0027"
FT   CDS_pept        38823..39260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0027"
FT                   /product="D-tyrosyl-tRNA deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56936"
FT                   /protein_id="ACY56936.1"
FT                   /translation="MIALIQRALSASVVVEGNIVGEIGPGLLVLLGVEQGDTEQKAQRL
FT                   CERVLGYRIFSDENDKMNLNVQQAGGSVLVVSQFTLVADTQKGMRPSFSRGAIPQEADR
FT                   LYQYFVAQCRERGVKTETGLFAADMKVSLVNDGPVTFWLQV"
FT   gene            complement(39334..40113)
FT                   /locus_tag="YPD4_0028"
FT   CDS_pept        complement(39334..40113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0028"
FT                   /product="insertion sequence IS100, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56937"
FT                   /protein_id="ACY56937.1"
FT                   /translation="MMELQHQRLMALAGQLQLESLISAAPALSQQAVDQEWSYMDFLEH
FT                   LLHEEKLARHQRKQAMYTRMAAFPAVKTFEEYDFTFATGAPQKQLQSLRSLSFIERNEN
FT                   IVLLGPSGVGKTHLAIAMGYEAVRAGIKVRFTTAADLLLQLSTAQRQGRYKTTLQRGVM
FT                   APRLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQTFAGDAALTS
FT                   AMLDRILHHSHVVQIKGESYRLRQKRKAGVIAEANPE"
FT   gene            complement(40113..41135)
FT                   /locus_tag="YPD4_0029"
FT   CDS_pept        complement(40113..41135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0029"
FT                   /product="transposase for insertion sequence IS100"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56938"
FT                   /protein_id="ACY56938.1"
FT                   /translation="MVTFETVMEIKILHKQGMSSRAIARELGISRNTVKRYLQAKSEPP
FT                   KYTPRPAVASLLDEYRDYIRQRIADAHPYKIPATVIAREIRDQGYRGGMTILRAFIRSL
FT                   SVPQEQEPAVRFETEPGRQMQVDWGTMRNGRSPLHVFVAVLGYSRMLYIEFTDNMRYDT
FT                   LETCHRNAFRFFGGVPREVLYDNMKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFSPRLC
FT                   RPFRAQTKGKVERMVQYTRNSFYIPLMTRLRPMGITVDVETANRHGLRWLHDVANQRKH
FT                   ETIQARPCDRWLEEQQSMLALPPEKKEYDVHLDENLVNFDKHPLHHPLSIYDSFCRGVA
FT                   "
FT   gene            41405..42328
FT                   /locus_tag="YPD4_0030"
FT   CDS_pept        41405..42328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56939"
FT                   /protein_id="ACY56939.1"
FT                   /translation="MYHLRVPITEQELKDYYQFRWEMLRKPLHQPIGSEKDAYDAMAHH
FT                   QMVVDEQGKAVAIGRLYINADNEAAIRFLAVAPSVRNKGLGTLVAMTLESVARQEGVKR
FT                   VVCSAREDAVDFFAKLGFVCQGEITAPQTTPVRHFLMIKPVATMDDILHRPDWCGQLQQ
FT                   AWYDHIPLSEKMGVRISQYTGQRFVTTMPEAGNQNPHHTLFAGSLFSLATLTGWGLIWL
FT                   LLRERHLGGTIILADAHIRYSAPVTGRPRAVAELSSLSGDLDRLARGRRARVQLNVNLF
FT                   GDENQGAVFEGTYMVLPVAAGDDMAN"
FT   gene            complement(42463..44172)
FT                   /locus_tag="YPD4_0031"
FT   CDS_pept        complement(42463..44172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0031"
FT                   /product="possible exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56940"
FT                   /protein_id="ACY56940.1"
FT                   /translation="MKFLGKTLLTLLLLFALSIVLCYAVLQTSWAAGWLSRWVSNNSGY
FT                   HLSLRGIDHRWSQPGQISFSDVTLARADQPPFLTAQQVIFGLSWRQLTDPKHFLSLQLQ
FT                   NGSLTLNNSTPSLPLQADTLQLTDMTLNTTVESKNATSQWKIAGQHVNGGLVPWQPIPG
FT                   NSFGENTQFHFSAGFLTINDISAQQIYLQGSIQKDILTLTNFGANIAQGELTGNARQSA
FT                   DGSWLVDRLRLSNIRLQTTASLEDVWNNVLQLPPITLKRFDLIDARVEGKGWAVNDVDL
FT                   TLKNITFKQGDWQSDDGELVFNASDIIKGNIHLIDPIATFTLSPEGVAINQFTTRWQDG
FT                   LLRTLGSWSRATHRLQLGELTVVALVYTLPNDWKQLWQQTLPDWLSEVYVGKLSANRNL
FT                   LIDISPDFPFQITSLDAAGSNLLLAKNHQWGVWSGSLVLNAGNATFNKNDIRRPSLALN
FT                   ANEQQITFSDLSAFTKEGLLEATASIDQTPDRALSLALTGRSVDLNFLHNWGWPALPLQ
FT                   GLGNLKLQIKGNLTADAPLKPTLNGSLQAIDSNGQQINQTVLHGVVQGTAEQ"
FT   gene            complement(44320..45147)
FT                   /locus_tag="YPD4_0032"
FT   CDS_pept        complement(44320..45147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0032"
FT                   /product="putative membrane permease"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56941"
FT                   /protein_id="ACY56941.1"
FT                   /translation="MSDNTFGAPKNLLLAGAVLGVIILLNRQRNPYLRVASLVIAMAVG
FT                   YLLAWALGMLPESRPVVDTALITIPTPLYYGLSFDWNLLIPLMLIFMVTSLETIGDITA
FT                   TSDVSEQPVRGPLYMKRLKGGVLANGLNSMLSAIFNTFPNSCFGQNNGVIQLTGVASRY
FT                   VGFVVAIMLIILGLFPAVAGFVQHIPEPVLGGATLVMFGTIAASGVRIVSRETLNRRAI
FT                   MIMALSLAVGMGVAQQPLILQFAPDWIKTLFSSGIAAGGITAIVLNLLFPQEK"
FT   gene            complement(45137..45706)
FT                   /locus_tag="YPD4_0033"
FT   CDS_pept        complement(45137..45706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0033"
FT                   /product="putative membrane permease"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56942"
FT                   /protein_id="ACY56942.1"
FT                   /translation="MSTQSAELDTAPPSPAHPSELIYHLEDRPPLPQTLFAACQHLLAM
FT                   FVAVITPGLLICQALGLPAEDTQRIISMSLFASGLASLLQIKTWGPVGSGLLSIQGTSF
FT                   NFVSPLIMGGLALKNGGADIPTMMAALFGTLMVASCTEILLSHVLHLARRIIYPAGIRY
FT                   CGDDYRPVIDSSWADIYWWWLWCDER"
FT   gene            45944..47158
FT                   /gene="gltS"
FT                   /locus_tag="YPD4_0034"
FT   CDS_pept        45944..47158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltS"
FT                   /locus_tag="YPD4_0034"
FT                   /product="sodium/glutamate symport carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56943"
FT                   /protein_id="ACY56943.1"
FT                   /translation="MFHLDTYGTLVAACLVLLLGRKLVQTVPFLKKYTIPEPVAGGLLV
FT                   AFMMLLVQKTLGWEVSFDMSLKDPLMLAFFATIGLNANLASLRAGGKALSIFVFIVVGL
FT                   LLVQNTIGIVLAKLMGLDPLMGLLAGSITLSGGHGTGAAWSKLFSERYGFENATEVAMA
FT                   CATFGLVLGGLIGGPVARYLVKHSSTPEGTPDDSAVPSAFEKPSAGRMITSLVLIETIA
FT                   MISICLMAGNLIAGWLQGTMFELPIFVCVLFVGVILSNTLSASGFYRVFDRAVSVLGNV
FT                   SLSLFLAMALMSLKLWELASLALPMLVILSVQALAMALYAIFVTYRIMGKNYDAAVLAA
FT                   GHCGFGLGATPTAIANMQAITDRFGPSHLAFLVVPMVGAFFIDIVNAIVIKLYLLLPIF
FT                   PAVTG"
FT   gene            complement(47524..49605)
FT                   /gene="recG"
FT                   /locus_tag="YPD4_0035"
FT   CDS_pept        complement(47524..49605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recG"
FT                   /locus_tag="YPD4_0035"
FT                   /product="ATP-dependent DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56944"
FT                   /protein_id="ACY56944.1"
FT                   /translation="MKGRLLDAVPLSTLSGVGASQAGKLAKIGLETIQDLLLHLPLRYE
FT                   DRTRLYRIGDLLPGLSVTVEGEVLRSDISFGRRRMMTCQISDGSGVLTLRFFNFNAAMK
FT                   NSLSVGKHVIAYGEAKRGNNGPEIIHPEYRVHGENIGVELQESLTPVYPTTEGIRQATL
FT                   RKLIDQALAMLDTCVIAELLPIELSRSLISLPEAIHTLHRPPADIQLADLEQGKHPAQR
FT                   RLIMEELLAHNLSMLAVRAGAQSYRALPLMAEEQLKQRFLAALPFTPTQAQQRVVAEIE
FT                   RDMTQSFPMMRLIQGDVGSGKTLVAALAALRAIAHGKQVALMAPTELLAEQHATTFRQW
FT                   LEPLGFSVGWLAGKQKGKARLAQQEAVASGQVSMVIGTHAMFQEQVQFSGLALVIIDEQ
FT                   HRFGVHQRLTLWEKGEEQGFHPHQLIMTATPIPRTLAMTAYADLDTSVIDELPPGRTPV
FT                   TTVAIPDTRRSDVIQRVKNACLEEGRQAYWVCTLIEESELLEAQAAEVTCEELKIALPE
FT                   IKVGLVHGRMKGPEKQAIMLAFKQGELQLLVATTVIEVGVDVPNASLMIIDNPERLGLA
FT                   QLHQLRGRVGRGAVASHCVLLYKTPLSKTAQMRLQVLRDSNDGFVIAQRDLEIRGPGEL
FT                   LGTRQTGSAEFKVADLLRDQAMIPEVQRVARHLHQQYPEHAKALIERWLPERVRYTNA"
FT   gene            complement(49606..50265)
FT                   /locus_tag="YPD4_0036"
FT   CDS_pept        complement(49606..50265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0036"
FT                   /product="tRNA (guanosine-2-O-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56945"
FT                   /protein_id="ACY56945.1"
FT                   /translation="MLATRQPDLTVCLEQVHKPHNVSAIIRTADAVGIHQVHAIWPTTQ
FT                   MYTRLSAAAGSNSWVQVKTHPHIADAIAYLKSQDMQILATHLSDKAVDFREIDYTRPTC
FT                   ILMGQEKTGISPEALALADQDIIIPMIGMVQSLNVSVASALILYEAQRQRQNAGMYKRT
FT                   HSVLAESEQQRLLFEGGYPVLAHVAKRKGLPQPHIDEQGQIIADAQWWSAMQATES"
FT   gene            complement(50304..52412)
FT                   /gene="spoT"
FT                   /locus_tag="YPD4_0037"
FT   CDS_pept        complement(50304..52412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoT"
FT                   /locus_tag="YPD4_0037"
FT                   /product="guanosine-3,5-bisbis(diphosphate)
FT                   3-pyrophosphydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56946"
FT                   /protein_id="ACY56946.1"
FT                   /translation="MYLFESLNLLIQRYLPEEQIKRLKQAYLVARDAHEGQTRSSGEPY
FT                   ITHPVAVACILAEMRLDYETLMAALLHDVIEDTPATYQDMEQLFGKSVAELVEGVSKLD
FT                   KLNFRDKKEAQAENFRKMIMAMVQDIRVILIKLADRTHNMRTLGSLRPDKRRRIARETL
FT                   EIYSPLAHRLGIHHLKTELEELGFEALYPNRYRVIKEVVKAARGNRKEMIQKILAEIEG
FT                   RLTEAGIPCRVSGREKHLYSIYCKMHLKEQRFHSIMDIYAFRVIVKEVDTCYRVLGQAH
FT                   SLYKPRPGRVKDYIAIPKANGYQSLHTSLIGPHGVPVEVQIRTEDMDQMAEMGVAAHWA
FT                   YKEQGESGTTAQIRAQRWMQSLLELQQSAGSSFEFIESVKSDLFPDEIYVFTPEGRIVE
FT                   LPAGATPVDFAYVVHTDIGHACVGARVDRQPYPLSQPLSSGQTVEIITAPGARPNAAWL
FT                   NFVVSSKARAKIRQLLKNLKRDESVSLGRRLLNHALGNGRKLSDISEENIKHELDRMKL
FT                   ATVDDLLAEIGLGNAMSVVVAKNLLGDPSTLGTSASGTRKLPIKGADGVLITFAKCCRP
FT                   IPGDPIIAHISPGKGLVIHHESCRNIRGYQKEPEKFMAVEWDQETEQEFIAEIKVDMFN
FT                   QQGALANLTAAINAAESNIQSLNTEEKDGRVYSAFIRLTTRNRVHLANIMRKIRIMPDV
FT                   VKVSRNRN"
FT   gene            complement(52762..53385)
FT                   /gene="gmk"
FT                   /locus_tag="YPD4_0038"
FT   CDS_pept        complement(52762..53385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmk"
FT                   /locus_tag="YPD4_0038"
FT                   /product="guanylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56947"
FT                   /protein_id="ACY56947.1"
FT                   /translation="MVQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSISHTTRAKR
FT                   PGENHGEHYFFVSEKEFCQMIDDDAFLEHAKVFENYYGTSRLAIEQVLATGVDVFLDID
FT                   WQGAQQIRAKMPTARSIFILPPSKTELDRRLRGRGQDSEEVIAKRMEQAVAEMAHYAEY
FT                   DYLIVNDDFNLALSDLKTIIRAERLRLGRQKQRHDALISKLLAD"
FT   gene            53813..55489
FT                   /gene="ligA2"
FT                   /locus_tag="YPD4_0039"
FT   CDS_pept        53813..55489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ligA2"
FT                   /locus_tag="YPD4_0039"
FT                   /product="DNA ligase, NAD-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56948"
FT                   /protein_id="ACY56948.1"
FT                   /translation="MFLLISNTIVVGGAWATSTCPDWPATRIAVEINALEQQLNKWSAA
FT                   YHQQGHSPVTDDIYDQLQDKLRVWQSCRGLPDKTESQPIPGKGQFLHPVAHTGLKKLKD
FT                   ETALTRWMAGRKNLWVQPKVDGVAVTLVYHGGKLVQLLSRGNGVKGQNWTEKAPFISAI
FT                   PQYIANAPALLTLQGELFLLMDGHQQAKSGGVNARSTVAGALMRKSPSPLLAQVGVFIW
FT                   AWPDGPTTMKEKVALLQVMGFPFTAKYSEPVMSHLDVVQWRQFWFQAPLPFVTDGVVVR
FT                   QEEEPAGRYWQATPGQWSMAWKYPPLQHIAEVKDIHFTLGRTGKGTVVLEVLPIKIDDK
FT                   WIRRVNIGSVTRWKQWDIAPGDHITLALAGHGIPRLDNVVWRVHQRNTITAPNWDKFHQ
FT                   LSCFQRLPHGCEPQFLSRLIWLSGPGGLDIGGIGGGFWQELIHHELINDLVGWLLLTPE
FT                   QIASIPGIGNARAEKIYQQFQRAKQQPFSRWLLALGFPQVVSVDAQWQVVLRRSLSEWA
FT                   TMAGIGQMRAKQIKHFLDHPDVQALADFLSTQKVVGFELTE"
FT   gene            complement(55502..56125)
FT                   /locus_tag="YPD4_0040"
FT   CDS_pept        complement(55502..56125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56949"
FT                   /protein_id="ACY56949.1"
FT                   /translation="MLLSVLYIIGITAEAMTGALAAGRRQMDMFGVIIIASATAIGGGS
FT                   VRDMLLGHYPLGWVKHPEYIVIVAIAAIVTTWMAPLMKQLRHLFLVLDAIGLIVFSIIG
FT                   AQIALDMGHSTIIAAIAAVITGVFGGVLRDMLCNCIPLVFQKEIYAGISFAAAWIYIAL
FT                   QYTPLSHNWVIIITLITGLALDYSPYDSGLACLYSNMSTQTIKL"
FT   gene            complement(56528..57391)
FT                   /locus_tag="YPD4_0041"
FT   CDS_pept        complement(56528..57391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0041"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56950"
FT                   /protein_id="ACY56950.1"
FT                   /translation="MIRSMTAYARRDIKGEWGNAAWELRSVNQRYLETYIRLPEQFRSL
FT                   EPVIRERIRSRLTRGKIECHLRFELDANAQSSLILNEKLAKQLVEAGNWVKMQSDEGEI
FT                   NPVDILRWPGVMSAEEQDLDAISTELMQALDTALDDFIVSRETEGAALKTLIEQRLEGV
FT                   SAEVVKVRAHMPNILQWQRERLLNKLEEAQVQLENTRLEQELVLMAQRIDVAEELDRLE
FT                   AHVKETYNILKKKEAVGRRLDFMMQEFNRESNTLASKSINAEVTNSAIELKVLIEQMRE
FT                   QIQNIE"
FT   gene            57518..58234
FT                   /gene="rph"
FT                   /locus_tag="YPD4_0042"
FT   CDS_pept        57518..58234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rph"
FT                   /locus_tag="YPD4_0042"
FT                   /product="ribonuclease PH"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56951"
FT                   /protein_id="ACY56951.1"
FT                   /translation="MRPADRAAQQVRPLTLTRNYTKHAEGSVLVEFGDTKVLCTATVEE
FT                   GVPRFLKGQGQGWITAEYGMLPRSTHSRNAREAAKGKQGGRTLEIQRLIARSLRAAVDL
FT                   KKLGEFTITLDCDVLQADGGTRTASISGACVALADALNKLVASGKLKANPMKGLVAAVS
FT                   VGIVKGEALCDLEYVEDSAAETDMNVVMMEDGRMIEVQGTAEGEPFSHEELLALLDLAR
FT                   GGIETIFQAQKAALES"
FT   gene            58401..59048
FT                   /gene="pyrE"
FT                   /locus_tag="YPD4_0043"
FT   CDS_pept        58401..59048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="YPD4_0043"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56952"
FT                   /protein_id="ACY56952.1"
FT                   /translation="MKAYQREFIEFALNKQVLKFGEFTLKSGRISPYFFNAGLFNTGLD
FT                   LAKLGRFYAAALMDCGVEFDLLFGPAYKGIPIATTTAVALAEHHERDVPYCFNRKEAKT
FT                   HGEGGNLVGSPLQGRVMLVDDVITAGTAIRESMEIINAQGATLAGVMISLDRQERGRGE
FT                   ISAIQEVERDYHCKVIAIVTLNDVIRYLEDKPEMAEHLVAVRQYREQYGVTL"
FT   gene            complement(59183..59734)
FT                   /locus_tag="YPD4_0044"
FT   CDS_pept        complement(59183..59734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0044"
FT                   /product="TetR-family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56953"
FT                   /protein_id="ACY56953.1"
FT                   /translation="MQALAQMLESSDGSQRITTAKLAANVGVSEAALYRHFPSKTRMFD
FT                   SLIEFIEDSLMSRINLILQDEKETFNRLRLILLLVLGFAERNPGLTRIMTGHALMFEQD
FT                   RLQGRINQLFERIEMQLRQVLREKKLRDGQGFIHDEALLATQLLAFCEGMLSRFVRSEF
FT                   RYCPTQEFDSRWPLIVAQLQ"
FT   gene            complement(59901..60356)
FT                   /gene="dut"
FT                   /locus_tag="YPD4_0045"
FT   CDS_pept        complement(59901..60356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dut"
FT                   /locus_tag="YPD4_0045"
FT                   /product="deoxyuridine 5-triphosphate nucleotidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56954"
FT                   /protein_id="ACY56954.1"
FT                   /translation="MKKIDIKILDPRVGNEFPLPTYATEGSAGLDLRACLDHAVELQPG
FT                   QTTLLPTGLAIHIGDSALAAVILPRSGLGHKHGIVLGNLVGLIDSDYQGQLMVSVWNRG
FT                   QQPFTIEPGERIAQMVFVPVVQAEFNLVEDFTDSERGTGGFGHSGRQ"
FT   gene            complement(60337..61446)
FT                   /gene="dfp"
FT                   /locus_tag="YPD4_0046"
FT   CDS_pept        complement(60337..61446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dfp"
FT                   /locus_tag="YPD4_0046"
FT                   /product="phosphopantothenoylcysteine
FT                   synthase/decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56955"
FT                   /protein_id="ACY56955.1"
FT                   /translation="MRVVMTHAAKAFIAPLTLQAVSGYPVSDDLLDPAAEAAMGHIELG
FT                   KWADLVIIAPATADLLARMAAGMANDLLTTVCLATAAPIAAVPAMNQQMYRAPATQENL
FT                   QTLSKWGVLLWGPDSGSQACGDIGPGRMLDPQEIVALAYNHFSAKQDLQHLSVMITAGP
FT                   TREPLDPVRFISNQSSGKMGFAIAQALAARGSNVTLIAGPVNLSTPEGVKRIDVITALE
FT                   MQQAVQKIAQQQNIFISCAAVADYRAEHVSDEKIKKQGDEITLKLVKNPDIVAGVASMA
FT                   KNRPFVVGFAAETQNVEEYARQKLARKNLDLICANDVSLAEHGFNSDTNALHLFWSTGE
FT                   KRLPLSDKYLLSQRLIDEIVSRYDEKNRH"
FT   gene            61748..62416
FT                   /gene="radC"
FT                   /locus_tag="YPD4_0047"
FT   CDS_pept        61748..62416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radC"
FT                   /locus_tag="YPD4_0047"
FT                   /product="DNA repair protein RadC"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56956"
FT                   /protein_id="ACY56956.1"
FT                   /translation="MDEWYGQVAPREKLLKYGAAVLTDAELLAIFLRTGIPGMHVMKMA
FT                   EYLIETFGSLHGLISADYQTLCAHKGIGASKYSQIQAIGELACRCFSSHLMRESVLLNP
FT                   GITQKFLQNILSHREREIFLVVFLDNQHRVIRHEEMFTGTISSVEVHPREIVREALKVN
FT                   AAALILAHNHPSGKAEPSQADRLITTQVIKACSLLDIRVLDHLVVGRGECVSFAERGWL
FT                   "
FT   gene            63177..63986
FT                   /gene="mutM"
FT                   /locus_tag="YPD4_0048"
FT   CDS_pept        63177..63986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutM"
FT                   /locus_tag="YPD4_0048"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56957"
FT                   /protein_id="ACY56957.1"
FT                   /translation="MPELPEVETSRRGIEPYLVGQTILYAVVRNARLRWPVSDEILTLS
FT                   DQPVLSVQRRAKYLLLELPKGWIIIHLGMSGSLRVLSEETAAEKHDHVDLVVSNGKILR
FT                   YTDPRRFGAWLWAKDLETSNVLAHLGPEPLSDEFTAQYLFDKSRNKRTLIKPWLMDNKV
FT                   VVGVGNIYASESLFAAGILPDRAAGSLTDAESVLLVATIKAVLLHSIEQGGTTLRDFLQ
FT                   SDGKPGYFAQELQVYGRAGEPCRQCGHPIEIAKHGQRSTFFCRHCQH"
FT   gene            complement(63992..64471)
FT                   /gene="coaD"
FT                   /locus_tag="YPD4_0049"
FT   CDS_pept        complement(63992..64471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaD"
FT                   /locus_tag="YPD4_0049"
FT                   /product="phosphopantetheine adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56958"
FT                   /protein_id="ACY56958.1"
FT                   /translation="MITKAIYPGTFDPITNGHLDLVTRASAMFSHVILAIADSSSKKPM
FT                   FTLDERVALAKKVTAPLKNVEVLGFSELMAEFAKKHNANILVRGLRSVSDFEYEWQLAN
FT                   MNRHLMPKLESVFLIPSEKWSFISSSLVKEVARHGGDITPFLPKPVTKALLAKLA"
FT   gene            complement(64468..65250)
FT                   /gene="kdtX"
FT                   /locus_tag="YPD4_0050"
FT   CDS_pept        complement(64468..65250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdtX"
FT                   /locus_tag="YPD4_0050"
FT                   /product="lipopolysaccharide core biosynthesis glycosyl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56959"
FT                   /protein_id="ACY56959.1"
FT                   /translation="MGTKKRLSVVMITKNEASLLTDCLASVAWADEIIVLDSGSEDETR
FT                   ALAQQFGAKVYSNINWPGYGKQRQLAQQYASGDYILMLDADERVTPELKIAIESVLLAP
FT                   EEGAVYSCSRRNLFLGRFMRHSGWYPDRVTRLYPHHQYRYNDNLVHESLDSGSAKVIPL
FT                   AGDLLHLTCRDFFAFQRKQLSYAEAWAIQRHQQGKSCSYFAILSHTLGAFSKTWLLRAG
FT                   FLDGKQGLLLAVVNAQYTFNKYAALWALSHQYQKSEKS"
FT   gene            complement(65251..66528)
FT                   /gene="kdtA"
FT                   /locus_tag="YPD4_0051"
FT   CDS_pept        complement(65251..66528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdtA"
FT                   /locus_tag="YPD4_0051"
FT                   /product="3-deoxy-D-manno-octulosonic-acid transferase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56960"
FT                   /protein_id="ACY56960.1"
FT                   /translation="MLLRLYQVLLYLIQPLIWLRLLLRSRKAPAYRKRWGERYGFCAGK
FT                   VVAGGIMLHSVSVGETLAAIPLVRALRHRYPSLPITVTTMTPTGSERVQSAFGKDVHHV
FT                   YLPYDLPGSVNRFLDQVNPKLVIIMETELWPNLINTLHRRKIPLVIANARLSARSAAGY
FT                   KKIGSFIRTILQRITLIAAQNQEDGDRFIELGLKRSQLTVTGSLKFDISVTPELAARAV
FT                   TLRRQWAPHRPVWIATSTHDGEETILLEAHRQLLQQFPTLLLILVPRHPERFGKAVELT
FT                   QKIGLSYTLRSKGEVPSSSTQVVIGDTMGELMLLYGIADLAFVGGSLVERGGHNPLEAA
FT                   AHAIPVLMGPHTFNFKDICAKLEQAEGLITVTDTLSLVKEITVLLTDEDCRLYYGRHAV
FT                   DVLHENQGALQRLLHLLEPYLPQRSH"
FT   gene            complement(66948..67913)
FT                   /gene="rfaC"
FT                   /locus_tag="YPD4_0052"
FT   CDS_pept        complement(66948..67913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfaC"
FT                   /locus_tag="YPD4_0052"
FT                   /product="lipopolysaccharide heptosyltransferase-1"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56961"
FT                   /protein_id="ACY56961.1"
FT                   /translation="MHVLIVKTSSMGDVLHTLPALTDAMNAIPGIRFDWVVEEGFSQIP
FT                   SWHPAVDKVIPVAIRRWRKNWFGSDTRQERCDFKRVVQQRSYDRVIDAQGLIKSAALIT
FT                   RIAKGTKHGPDCKSAREPFASWFYNCRHEIDTKQHAVERIRQLFAKSLGYDKPESYGDY
FT                   AIAQRFLNQLPADAGQYLVFLHATTRDNKHWPESHWVQLIELVQPTGLKIKLPWGAEHE
FT                   HQRALRLAEHFPHVEVLPKLSLQQVAEVLAGAKAVVSVDTGLSHLTAALDRPNITLFGP
FT                   TDPGLIGGYGKNQIAVISEQKKMDSLSAPTIMARLETLIS"
FT   gene            complement(67913..68977)
FT                   /gene="rfaF"
FT                   /locus_tag="YPD4_0053"
FT   CDS_pept        complement(67913..68977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfaF"
FT                   /locus_tag="YPD4_0053"
FT                   /product="ADP-heptose--LPS heptosyltransferase II"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56962"
FT                   /protein_id="ACY56962.1"
FT                   /translation="MKILVIGPSWVGDMMMSQSLYRTLKAEYPAADIDVMAPAWCRPLL
FT                   ARMPEVRHAIPMPLGHGAFAFEERRRLGLALRETEYDRAYVLPNSFKSALIPYFSGIKR
FT                   RIGWRGEMRYFLLNDLRILDKQAFPMMVQRYVALAYDKERIRSAADLPQPLLWPQLQVR
FT                   DEEIAETTASFNLTDNRPIIGFCPGAEFGPAKRWPHYHYATLAQKLIDDGYQVILFGSA
FT                   KDNEAGEDIRQALSDTDREYCLNLAGQTSLEQAVVLIAACSAVVSNDSGLMHVAAALNK
FT                   PLVALYGPSSPDFTPPLSEKATVIRLITGYHKVRKGDSAQGYHQSLIDIQPEHVMAALE
FT                   KQLATQECSVKGGD"
FT   gene            complement(69008..69940)
FT                   /gene="rfaD"
FT                   /locus_tag="YPD4_0054"
FT   CDS_pept        complement(69008..69940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfaD"
FT                   /locus_tag="YPD4_0054"
FT                   /product="ADP-L-glycero-D-manno-heptose-6-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56963"
FT                   /protein_id="ACY56963.1"
FT                   /translation="MIIVTGGAGFIGSNIVKALNNIGYKDILVVDNLKDGTKFVNLVDL
FT                   DIADYMDKEDFVASIVAGDDMGDIDAIFHEGACSSTTEWDGKYMMDNNYQYSKDILHFC
FT                   LDRSIPFLYASSAATYGGRTDNFIEDRQYEQPLNVYGYSKFLFDQYVREILPQADSQIC
FT                   GFRYFNVYGPREGHKGSMASVAFHLNNQINAGERPKLFAGSENFKRDFIYVGDVADVNL
FT                   WFWQNGVSGIFNCGTGRAESFQAVADAVVDYHQSGPVEYIEFPEKLKGRYQAYTQADLT
FT                   KLRAAGYGKPFKTVAEGVKEYLAWLNRSV"
FT   gene            70186..71397
FT                   /gene="kbl"
FT                   /locus_tag="YPD4_0055"
FT   CDS_pept        70186..71397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kbl"
FT                   /locus_tag="YPD4_0055"
FT                   /product="2-amino-3-ketobutyrate coenzyme A ligase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56964"
FT                   /protein_id="ACY56964.1"
FT                   /translation="MSLPCNKHPFYQQLEQQLDTTRTEGLYKNERVITSAQQANIAVAD
FT                   GSRVINFCANNYLGLANHPKLIAAAKAGMDSHGFGMASVRFICGTQDIHKELEHKLASF
FT                   LGMEDAILYSSCFDANGGLFETLLGPEDAIISDALNHASIIDGVRLCKAKRYRYANNDM
FT                   TELEAQLKQAKAEGARHIMIATDGVFSMDGVIANLKRVCDLADEYQALVMVDDSHAVGV
FT                   IGANGRGTHEYCEVMDRVDIITGTLGKALGGASGGYTAGRKELVEWLRQRSRPYLFSNS
FT                   LAPAIVAASIEVLSLLEEGGALRDRLWANARLFREKMSAAGFTLAGADHAIIPVMLGEA
FT                   KLAQDFANALLKEGIYVTGFFFPVVPKGQARIRTQMSAGHTTEQVERAIEAFVRIGKQL
FT                   NVIA"
FT   gene            71407..72432
FT                   /gene="tdh"
FT                   /locus_tag="YPD4_0056"
FT   CDS_pept        71407..72432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tdh"
FT                   /locus_tag="YPD4_0056"
FT                   /product="L-threonine 3-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56965"
FT                   /protein_id="ACY56965.1"
FT                   /translation="MKALSKLKAEEGIWMTDVPQPELGHNDIMIKIRKTAICGTDVHIY
FT                   NWDEWSQKTIPVPMVVGHEYVGEVVAIGQEVKGFNIGDRVSGEGHITCGHCRNCRGGRT
FT                   HLCRNTVGVGVNRPGSFAEYLVIPAFNAFKIPDNISDELAAIFDPFGNAVHTALSFDLV
FT                   GEDVLVSGAGPIGIMAAAVCKHVGARHVVIADVNEYRLDLARKMGVTRAVNVSKENLND
FT                   VMTELGMTEGFDVGLEMSGAPPAFRSLLNSMNHGGRIAMLGIPPSDMSIDWNQVIFKGL
FT                   FIKGIYGREMFETWYKMAALIQSGLDLTPIITHRFPIDEFQQGFDAMRSGKSGKVVLSW
FT                   D"
FT   gene            complement(72570..73070)
FT                   /locus_tag="YPD4_0057"
FT   CDS_pept        complement(72570..73070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0057"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56966"
FT                   /protein_id="ACY56966.1"
FT                   /translation="MIKRKIFLDDSQNEAAIRQQFNRAVALARRNGSAIAIGHPHPATI
FT                   KVLQQMLPQLPADIVLVRPSALLNEPVQSLSPDKTKPREPVKGQRLPAIKQCKAKASYV
FT                   PEKIYADKLFILLGESLMQNPAVIFIQQHWQQYFTPAPPATPIDEQKAIENTEKLPPKK
FT                   AAQ"
FT   gene            complement(73067..73504)
FT                   /locus_tag="YPD4_0058"
FT   CDS_pept        complement(73067..73504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0058"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56967"
FT                   /protein_id="ACY56967.1"
FT                   /translation="MRYFNTRQFIIVSTLFIASTAQAGKLSIVIDDFGYRPQNENKILQ
FT                   MPLPISVAILPNAPYAREMATKAHNQGREILIHLPMAPQSKQPLERDTLQPSMSSEEIQ
FT                   RIIRQAANNVPYAKGMNNHMGSAMTASLPGMQKVMQALVSK"
FT   gene            complement(73528..74898)
FT                   /locus_tag="YPD4_0059"
FT   CDS_pept        complement(73528..74898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0059"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56968"
FT                   /protein_id="ACY56968.1"
FT                   /translation="MKDRELLAKSITTKDAVSDGRESPSLLSDKLSRLPWSTLYASVFC
FT                   AGVLLLPFSGQAVEPPVAAKASENKNQLKTLQQDIAEKEKSVQQQKKQRSSLLDQLKQQ
FT                   ENTISQTSRSLRETQATLAELSKDIASLTTSIEKLQNQQSQQQSILSKQLAAAFKQGKH
FT                   SSLQLILSGEESQRSERILAYFSYLNEARQKAIEELKQTRTTLSAEKKMLEQKQNQHKA
FT                   LLDEQKAQQQKLEQARIARQKTLTSLEASLEKDQQSLAELKLNESRLRDQIAKAEREAK
FT                   ARAEREAKEAARVREQVKVKEQQAKKTGSSYKPSESERSLMARTGGLGRPGGQALWPVR
FT                   GNVSHRFGEPLQGELRWKGMVITAPEGSEVKAIADGRVLLADWLQGYGLVVVIEHGKGD
FT                   MSLYGYNQSALVNVGAQVKAGQPIALVGTSGGQGEPSLYFEIRRQGQAVNPQPWLGR"
FT   gene            complement(74908..76455)
FT                   /locus_tag="YPD4_0060"
FT   CDS_pept        complement(74908..76455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0060"
FT                   /product="phosphoglyceromutase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56969"
FT                   /protein_id="ACY56969.1"
FT                   /translation="MSSTKKPLVLTILDGYGHREEQQDNAILNAKTPVMDVLWQQQPHT
FT                   LIAASGLDVGLPDGQMGNSEVGHVNLGAGRIVYQDLTRLDKEIKEGDFFTNPTLTAAVD
FT                   NAVKTGKAVHIMGLLSAGGVHSHEDHIMAMVELAAKRGATAIYLHAFLDGRDTPPRSAE
FT                   SSLKRFTAKFAELGNGRIASIIGRYYAMDRDNRWDRVQLAYDLLTQAKGEFTADNAVAG
FT                   LQAAYARGENDEFVKPTVIQATGEADAAMNEGDTLIFMNFRADRARQITRTFVNAEFDG
FT                   FKRDKVVNFGDFIMLTEYAADIKVACAYPPASLTNTFGEWLMKHDKTQLRISETEKYAH
FT                   VTFFYNGGVEEPFKGEDRILINSPKVATYDLQPEMSSAELTEKLVSAIGSGKYDVIICN
FT                   YPNGDMVGHTGDYDAAVKAVETLDNCIEQVVAAVKAADGQLLITADHGNAEQMRDPATG
FT                   QAHTAHTSLPVPLIYVGNKAVKAVEGGKLSDIAPTMLSLMEMEIPQEMTGKPLFIVE"
FT   gene            76852..77286
FT                   /locus_tag="YPD4_0061"
FT   CDS_pept        76852..77286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0061"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56970"
FT                   /protein_id="ACY56970.1"
FT                   /translation="MLQEIMQFISQHPILSLAWVLLFGAVVFTSFKNSLSKVKEVTRGE
FT                   ATRLINKEDAVVVDIRTREDYRKGHIANSINLIPSDIKNGNLGELEKHKTQPIIVVCAM
FT                   GTTSRASADMLSKAGFERVFTLKEGISGWSGENLPLARGK"
FT   gene            77741..78217
FT                   /gene="secB"
FT                   /locus_tag="YPD4_0062"
FT   CDS_pept        77741..78217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secB"
FT                   /locus_tag="YPD4_0062"
FT                   /product="export protein SecB"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56971"
FT                   /protein_id="ACY56971.1"
FT                   /translation="MSEQNNTEMAFQIQRIYTKDISFEAPNAPQVFQQDWQPEVKLDLD
FT                   TASSQLAEDVYEVVLRVTVTASLGEETAFLCEVQQGGIFSVAGIEGTQLAHCLGAYCPN
FT                   ILFPYARECITSLVSRGTFPQLNLAPVNFDALFMNYLQQQAEGEVEGVEQRQDA"
FT   gene            78217..79236
FT                   /gene="gpsA"
FT                   /locus_tag="YPD4_0063"
FT   CDS_pept        78217..79236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpsA"
FT                   /locus_tag="YPD4_0063"
FT                   /product="NAD(P)H-dependent glycerol-3-phosphate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56972"
FT                   /protein_id="ACY56972.1"
FT                   /translation="MNTNPASMAVIGAGSYGTALAITLARNGHQVVLWGHDPKHIQQLQ
FT                   QDRCNRAFLPDAAFPDTLRLETDLACALAASRDVLVVVPSHVFGAVLHQLKPHLRKDAR
FT                   IVWATKGLEAETGRLLQDVAREVLGEAIPLAVISGPTFAKELAAGLPTAIALASTDVQF
FT                   SEDLQQLLHCGKSFRVYSNPDFIGVQLGGAVKNVIAIGAGMSDGIGFGANARTALITRG
FT                   LAEMTRLGTALGADPSTFMGMAGLGDLVLTCTDNQSRNRRFGIMLGQGLGVKEAQDNIG
FT                   QVVEGYRNTKEVLALAQRHGVEMPITEQIYQVLYCHKNAREAALTLLGRTKKDEKIGI"
FT   gene            79502..80323
FT                   /gene="cysE"
FT                   /locus_tag="YPD4_0064"
FT   CDS_pept        79502..80323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysE"
FT                   /locus_tag="YPD4_0064"
FT                   /product="serine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56973"
FT                   /protein_id="ACY56973.1"
FT                   /translation="MSSEELEQVWSNIKSEARALAECEPMLASFFHATLLKHENLGSAL
FT                   SYILANKLANPIMPAIAIREVVEEAYRSDAHMIVSAARDILAVRLRDPAVDKYSTPLLY
FT                   LKGFHALQAYRIGHWLWAQDRKALAIYLQNQVSVAFGVDIHPAATIGCGIMLDHATGIV
FT                   IGETAVVENDVSILQSVTLGGTGKTSGDRHPKIREGVMIGAGAKILGNIEVGRGAKIGA
FT                   GSVVLQSVPAHTTAAGVPARIVGKPESDKPSLDMDQHFNGSIQGFEYGDGI"
FT   gene            complement(80446..80934)
FT                   /locus_tag="YPD4_0065"
FT   CDS_pept        complement(80446..80934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0065"
FT                   /product="putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56974"
FT                   /protein_id="ACY56974.1"
FT                   /translation="MLNIVLFEPEIPPNTGNIIRLCANTGCQLHLIKPLGFTWDDKRLR
FT                   RAGLDYHEFADIKHHHDYQAFLDSEKLDSTQPARLFALTTKGTPAHSAVSYQANDYLLF
FT                   GPETRGLPAYILDALPAQQKIRIPMQADSRSMNLSNAVSVVVYEAWRQLGYPGALLKE"
FT   gene            81123..82187
FT                   /locus_tag="YPD4_0066"
FT   CDS_pept        81123..82187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0066"
FT                   /product="bifunctional regulatory protein/DNA repair
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56975"
FT                   /protein_id="ACY56975.1"
FT                   /translation="MNNVKDPRWAAIINRDKTADGQFVYAVKTTGIYCRPSCPSRRAKA
FT                   ENIEFFIDNTAAEQAGYRPCKRCQPTQLSRAQQQVEKISQACRLIELAETPPKLNELAA
FT                   QLGLSTFYFHRLFKAITGLTPKGYANATRSERIRAQLSHGGSVTDAIFEAGYNSSSRFY
FT                   AQSQQLLGMTPTRYRKGGCDARLHFAVGESSLGAILVAKSELGVCAILLGDDPVRLVQQ
FT                   LQDKFPQANLVGGDAEFEQWVAQVVGCVEAPKLGLNLPLDIRGTAFQQRVWQALREIPI
FT                   GETASYADIASRIGSPTAVRAVAGACAANILAVAIPCHRVIRQDGALSGYRWGVERKRL
FT                   LLEREGVEKEAEDH"
FT   gene            complement(82236..83612)
FT                   /locus_tag="YPD4_0067"
FT   CDS_pept        complement(82236..83612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0067"
FT                   /product="two component sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56976"
FT                   /protein_id="ACY56976.1"
FT                   /translation="MINSLTTRIFAIFWFTLESVLMLVLMVPKLDSRQLTVLLDSEQRQ
FT                   GTMLEQHIEAELANDPANDLMWWRRLHRAIEKWAPPGQHLILVTSEGRIIGVQRQEVQM
FT                   VRNFIGQSDNADQPKKKKYGRVEMVGPFSIRDGEDNYQLYLIRPANSPQSDFINLMFDR
FT                   PLLLLIATMLISAPLLLWLAWSLAKPARKLKNAADDVARGNLKQHPELESGPQEFLATG
FT                   ASFNQMISSLDRMVVAQQRLISDISHELRTPLTRLQLATALMRRRHGEGKELERIEMEA
FT                   QRLDSMINDLLVLSRSQHKNELHREPIKADELWSDVLENAQFEAEQMGKTLVVTAPPGP
FT                   WPLFCNPAALDSALENIVRNALRYSHHHIAVAFSIDNQGVTIIVDDDGPGVSPEDREQI
FT                   FRPFYRTDEARDRASGGTGLGLAIVETAVSQHRGWVKAEDSPLGGLRLIVWLPLHPLKS
FT                   "
FT   gene            complement(83609..84307)
FT                   /gene="cpxR"
FT                   /locus_tag="YPD4_0068"
FT   CDS_pept        complement(83609..84307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpxR"
FT                   /locus_tag="YPD4_0068"
FT                   /product="two component system response regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56977"
FT                   /protein_id="ACY56977.1"
FT                   /translation="MHKILLVDDDRELTSLLKELLEMEGFNVVVAYDGEQALSQLDSSI
FT                   DLLLLDIMMPRKNGIETLKELRQHHQTPVIMLTARGSELDRVLGLELGADDYLAKPFND
FT                   RELVARIRAILRRSNWSEQQQNAEQGAPTLEVDCLQLNPGRQEASFEGQPLELTGTEFT
FT                   LLYLLAQHLGQVVSREHLSQEVLGKRLTPFDRAIDMHISNLRRKLPDRKDGLPWFKTLR
FT                   GRGYLMVSET"
FT   gene            84481..84969
FT                   /gene="cpxP"
FT                   /locus_tag="YPD4_0069"
FT   CDS_pept        84481..84969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpxP"
FT                   /locus_tag="YPD4_0069"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56978"
FT                   /protein_id="ACY56978.1"
FT                   /translation="MRKVTTLVMASMFVLGSSAAFAADNTKVTEGYHGDGKMMMNKKGD
FT                   RGHHNMFDGINLTEQQRQQMRDLMRQSHQSQPRLDLEDREAMHKLITADKFDEAAVRAQ
FT                   AEKMSQNQIERHVEMAKVRNQMYNLLTPEQKEALNKKHQERIEKLQQKPAAQPSSAQK"
FT   gene            85647..86606
FT                   /locus_tag="YPD4_0070"
FT   CDS_pept        85647..86606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56979"
FT                   /protein_id="ACY56979.1"
FT                   /translation="MIAQEDAHDYHRPMKTTPTPHDALFKNFMTQPATACDLLEFHLPP
FT                   ELRQLCDLSTLRLESGSFIENNLRACYSDVLYSLKTTVGDGYVYALIEHQSSPDKHMAF
FT                   RLMRYAIAAMQSHLEAGYDKLPLVIPILFYHGMVTPYPYPMSWLHAFNQPELAGQLYCG
FT                   NFPLVDVTVIPDHEIMTHRRIALLELLQKHIRQRDLSELLDQLVILIASGYTTEDQLKS
FT                   AINYIIQVGETAEPEVFIRSLAHRLPEHEESLMTIAQKLEQKGEARGIVKGRVEGRVEG
FT                   AQETALKIARTMLANGLDRATVMKMTGLSEEELTQIHH"
FT   gene            87168..88070
FT                   /gene="fieF"
FT                   /locus_tag="YPD4_0071"
FT   CDS_pept        87168..88070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fieF"
FT                   /locus_tag="YPD4_0071"
FT                   /product="ferrous iron efflux protein F"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56980"
FT                   /protein_id="ACY56980.1"
FT                   /translation="MDPQYARWVKAAALSATALASILLIIKIFAWWHTGSVSLLAALVD
FT                   SLVDLAASLTNLFVVRYSLQPADEEHTFGHGKAESLAALAQSMFISGSALFLFLTGFRH
FT                   LASPEPLQDPSIGIGVTLVALFSTLILVTFQRWVVRKTHSQAIRADMLHYQSDVLMNGA
FT                   ILIALALSWYGFRRADALFALGIGVYILYSALRMGYEAVQSLLDRALPDDERQQIIDIV
FT                   TSWPGVIGAHDLRTRRSGQTRFIQLHLEMEDMMPLMEAHVLAEQVEHALLYRFPGADVL
FT                   IHQDPCSVVPKERHAHWEL"
FT   gene            88288..89271
FT                   /gene="pfkA"
FT                   /locus_tag="YPD4_0072"
FT   CDS_pept        88288..89271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfkA"
FT                   /locus_tag="YPD4_0072"
FT                   /product="6-phosphofructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56981"
FT                   /protein_id="ACY56981.1"
FT                   /translation="MVKKIGVLTSGGDAPGMNAAIRGVVRAALSAGLDVFGIEDGYLGL
FT                   YENRMKKLDRYSVSDMINRGGTFLGSARFPEFRDPEVRKVALKNMHERGIDGLVVIGGD
FT                   GSYAGADLLTKEGGIHCVGLPGTIDNDVAGTDYTIGFFTALETVVEAIDRLRDTSSSHQ
FT                   RISIVEVMGRYCGDLTLAAAIAGGCEFIAIPEVEFKRDDLVAEIKAGIAKGKKHAIVAI
FT                   TEKLDDIDSLAKYIEKETGRETRGTVLGHIQRGGAPVAYDRILASRMGAYAVDLLLQDH
FT                   DYKKGGFCVGVQNEKMVHELISVCIAPENKKSKFKEDWYDTAKKLF"
FT   gene            89492..90481
FT                   /gene="sbp1"
FT                   /locus_tag="YPD4_0073"
FT   CDS_pept        89492..90481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbp1"
FT                   /locus_tag="YPD4_0073"
FT                   /product="exported sulfate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56982"
FT                   /protein_id="ACY56982.1"
FT                   /translation="MRKWGVGLSLLVLASGAMAKDIQLLNVSYDPTREFYQEYNQAFSK
FT                   YWQQQTGDKVTVRQSHGGSGKQATSVINGIEADVVTLALAYDVDAIAERGRIDKNWIKR
FT                   LPDNSAPYTSTIVFLVRKGNPKQIHDWSDLVKPGTSVITPNPKTSGGARWNYLAAWGYA
FT                   LEHNNNDQAKAQEFVNALYKNVEVLDSGARGATNTFVERGIGDVLIAWENEALLAVNEV
FT                   GNGQFDIVTPSVSILAEPTVSVVDKVVDKRGTRDVADAYLKYLYSPEGQTIAAKNYYRP
FT                   RDPVVAAKFAKEFPQLKLFTIDEVFGGWTQAQKTHFATGGVFDEISKR"
FT   gene            complement(90731..91303)
FT                   /locus_tag="YPD4_0074"
FT   CDS_pept        complement(90731..91303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0074"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56983"
FT                   /protein_id="ACY56983.1"
FT                   /translation="MDATKRVEAGEAFDVVILSANAIDKLIDSGKILPNSRIDLVKSGV
FT                   AIAVKEGAQIMDVSSEETVKQAVLAANTIAYSTGPSGVYLTEVFEHWGIAEQIKDRIVK
FT                   VPPGVPVGSLVAKGEVELGFQQLSELLHLKGIIILGPLPTDIQIMTHFSAGVPLKTNQQ
FT                   KAIKVLLDFLASPAATEAKIKNGMEPI"
FT   gene            complement(91625..93052)
FT                   /locus_tag="YPD4_0075"
FT   CDS_pept        complement(91625..93052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0075"
FT                   /product="putative membrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56984"
FT                   /protein_id="ACY56984.1"
FT                   /translation="MKNKIWKLCILVMIPLVIWFIPPPEGLTELSWRLSGFYLAAICGL
FT                   ILKPFSEAVVLLGVVGFAGFFLNNTSQILVGYATSTVWLVFAAFGISISFVKTGLGRRI
FT                   AFHMIRFCGSTTLRLGYVTAFLEFVISPVTPSNTARSGGIVFPIILSVVKALGSEPGDT
FT                   AKKAGSYLMSNIYFVMKVSSFMFITAMAPNLLAADFAAKILGIHLDWGVWALAMVVPGL
FT                   LLLLIVPAVGYYLDKPELKKVDNKKIADEGLAELGPITRNEKLLVGIFISALLGWALPS
FT                   LLGQLFGITLKIDATAVAIMAMALCILLGVIKWDDVLQNKGAWNTLLWFGGIIGLASAL
FT                   SKEKVFDWLANLIQNNVDFGHNPFIALTIIGFLSIIIRYFFASASSYAIAMLPVFLTVG
FT                   KVAGADPMALALVLAATNSYGGALTHYGGGSAPIIFGAGYNNVKQWWASGAVIATVCFI
FT                   VTMTVGYVWWQFLGFVK"
FT   gene            complement(93118..93831)
FT                   /locus_tag="YPD4_0076"
FT   CDS_pept        complement(93118..93831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0076"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56985"
FT                   /protein_id="ACY56985.1"
FT                   /translation="MSLVNMKGVVVTNIERAELALLQRFAEYGVATVHEAQLRQGLLDE
FT                   RIKPIQQGRCIAGNAVTVLVTPGDNWMFHVAVEQCQPGDVLLVAPTSECHDGFFGDLLA
FT                   TSLLARGVVALVGDIGIRDSQTLREMNFPVWSRAVWAQGTVKASLGSVNVPVICAGQLV
FT                   NPGDIVVADDDGVVIVPREQATAIADAAQTRVDLETSKRQRLANGELGLDIYQMRAPLA
FT                   KKGLRYVNSLNALKS"
FT   gene            complement(93828..94565)
FT                   /locus_tag="YPD4_0077"
FT   CDS_pept        complement(93828..94565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0077"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56986"
FT                   /protein_id="ACY56986.1"
FT                   /translation="MAMIPQKTALVVSAHSADFVWRAGGAIALHVEQGYQVHIVCLSYG
FT                   ERGESAKLWRKGDMTEERVKASRHTEAQAAANVLGASIEFFDMGDYPLRADKESLFRLA
FT                   DVFRRIQPHFVLTHSLADPYNYDHPLAANLAQEARIIAQAEGYRPGEAIIGAPPVYCFE
FT                   PHQPEQCGWKPDVLLDITSVWEKKYAAIQCMAGQEHLWEYYTRVALQRGVQAKRNIGIA
FT                   STKTIIHGEGYQSLFPRVTEDLS"
FT   gene            94702..95937
FT                   /locus_tag="YPD4_0078"
FT   CDS_pept        94702..95937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0078"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56987"
FT                   /protein_id="ACY56987.1"
FT                   /translation="MQKKNDRNSIKIMQIRAFCMTAEQGAASLAALNLFRTQSAITRSI
FT                   RDLEHTLAISLFERHAKGMLLTDLGNVILPRARSAMEELTRIPALLRRLQQRDDEGIED
FT                   LEPTWLFNERRLQIFLSLYRQQHALHVAQALDITQSAVSAALKVLEKGAGMYLFHRTPK
FT                   GMLPTPAGHEIAPCISRALNALHHIPEEITAHRGDLTGSVRVGALPLSRARLLPQAMIK
FT                   LISRHPGIKIVTNESGFTALIAELRAGDIDFIIGALRNEKMLLDIHSEILFEEELILLA
FT                   RPNHPLSDRRVKNQELKDIQWVLPRNHAPSRHLLEVAFCKMGLASPQPVVESGDPAVVR
FT                   ALLLGSDMVAAVSSHQLDFEVSEGILIPLQVNLTGTRREIGLMTRQKALNSPATDALIN
FT                   CVREVIQSSNDK"
FT   gene            complement(96169..96936)
FT                   /gene="tpiA"
FT                   /locus_tag="YPD4_0079"
FT   CDS_pept        complement(96169..96936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tpiA"
FT                   /locus_tag="YPD4_0079"
FT                   /product="triosephosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56988"
FT                   /protein_id="ACY56988.1"
FT                   /translation="MRHPLVMGNWKLNGSTHMVNELIAGLRKELSTVDGCGVAIAPPAI
FT                   YLNQAKHELAGSRIALGAQNVDVNLSGAFTGETSAEMLKDIGAQYIIIGHSERRTYHQE
FT                   SDELIAKKFGVLKEIGLIPVLCIGESEAENEAGQTEAVCAKQLDAVLNTLGVKAFEGAV
FT                   IAYEPIWAIGTGKSATPAQAQAVHKFIRDHIAKQDAAVAAQVIIQYGGSVNDKNAAELF
FT                   TQPDIDGALVGGASLKADAFAVIVKAAAKAKKA"
FT   gene            complement(97065..97700)
FT                   /locus_tag="YPD4_0080"
FT   CDS_pept        complement(97065..97700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56989"
FT                   /protein_id="ACY56989.1"
FT                   /translation="MRKEIVSMRIILLLAALLLITFMLITTINHAHADPTNDSSPPKEG
FT                   APPIAPYLLFNAPTFDLTLVKFRESYNRANPTLPINEFHAITVKEDSPPLTRAASKINE
FT                   NLYASTALEKGTGKIKTLQITYLPIKGNEEKTAKLLAINYMAALMRQFEPTLSVAQSLA
FT                   NVQKLLTEGKGSPFYAHTIGAIRYVVADNGEKGLTFAVEPIKLSLSEA"
FT   gene            97848..98282
FT                   /locus_tag="YPD4_0081"
FT   CDS_pept        97848..98282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0081"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56990"
FT                   /protein_id="ACY56990.1"
FT                   /translation="MTIQQWCFSFKGRIGRREFWIWMGLWLLAMLVIFTLAGKEWLPIQ
FT                   SASFALVFLLWPTAAVVVKRLHDRNKAGWWALLAVLAWMLMAGNWQMLTPIWQWGVGRF
FT                   IPTLIFVMMFIDCGAFLGTEGDNRFGPEAVPVKFFADKAK"
FT   gene            complement(98623..99369)
FT                   /gene="fpr"
FT                   /locus_tag="YPD4_0082"
FT   CDS_pept        complement(98623..99369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fpr"
FT                   /locus_tag="YPD4_0082"
FT                   /product="ferredoxin--NADP reductase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56991"
FT                   /protein_id="ACY56991.1"
FT                   /translation="MAEWVSGKITHIEHWTDALFSLQVNAPVDPFTAGQFAKLALDING
FT                   ERVQRAYSYVNAPSDHNLEFYLVTVPEGKLSPRLDQLSVGGEVMITKQAAGFFVLEEIP
FT                   DCDTLWMLATGTAIGPYLSILQEGQDLERFKHLVLVHAARFAHDLSYLPLMQQLEQRYN
FT                   GKLRIQTVVSREESPGSLTGRVPALIENGALEAAVGLKIDAKDSHVMLCGNPQMVRDTQ
FT                   QLLKEQREMRKHLRRKPGHMTSEQYW"
FT   gene            complement(99524..100579)
FT                   /gene="glpX"
FT                   /locus_tag="YPD4_0083"
FT   CDS_pept        complement(99524..100579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpX"
FT                   /locus_tag="YPD4_0083"
FT                   /product="fructose-1,6-bisphosphatase, class II"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56992"
FT                   /protein_id="ACY56992.1"
FT                   /translation="MPIFSFSIPQSTGLTMKRELAIEFSRVTEAAALAGYKWLGRGDKN
FT                   AADGAAVQAMRIMLNQVNIDGRIVIGEGEIDEAPMLFIGEHVGTGQGDAVDIAVDPIEG
FT                   TRMTAMGQANALAVLAVGDQGTFLHAPDMYMEKLVVGPAAKGAIDLNLPLEQNLCNIAT
FT                   ALNKPLADLTVITLAKPRHDGIIAAMQQLGVKVFAIPDGDVAASILTCMPESEVDVMYC
FT                   IGGAPEGVISAAVIRALDGDMQGRLLPRHQVKGDSEDNRRIGEQELLRCKSMGIEAGNV
FT                   LQLGDMARNDNVIFSATGITKGDLLEGIYRKGNMATTETLLIRGKSRTIRRIRSTHFLD
FT                   RKDPALHEFLL"
FT   gene            complement(100771..102294)
FT                   /gene="glpK"
FT                   /locus_tag="YPD4_0084"
FT   CDS_pept        complement(100771..102294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpK"
FT                   /locus_tag="YPD4_0084"
FT                   /product="glycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56993"
FT                   /protein_id="ACY56993.1"
FT                   /translation="MTTENTTQKKYIVALDQGTTSSRAVVLDHNANIVSVSQREFTQIY
FT                   PKAGWVEHDPMEIWATQSSTLIEVLAKAGINSDEIAGIGITNQRETTIVWDKVTGKPVY
FT                   NAIVWQCRRTADICEKLKKEGLEEYIRHNTGLVVDPYFSGTKVKWILDNVEGARERAER
FT                   GELLFGTVDTWLVWNMTQGRVHVTDYTNASRTMMFNIRTKEWDDRMLKALNIPRAMLPE
FT                   VRPSSEIYGKTNIGGKGGTRIPIAGIAGDQQAALFGQLCVQPGMAKNTYGTGCFLLMNT
FT                   GEEAVQSTHGLLTTIACGPRGEVNYALEGAVFIGGASIQWLRDELKLIGDATDSEYFAT
FT                   KVKNSNGVYVVPAFTGLGAPYWDPYARGAIFGLTRGVNSNHIIRATLESIAYQTRDVLD
FT                   AMQADSGARLKSLRVDGGAVANNFLMQFQADILGTRVERPAIRESTALGAAFLAGLATG
FT                   FWDDLDEVKSKASIEREFRPGIETTERDIRYKGWKKAVARARDWEEHDE"
FT   gene            complement(102471..103319)
FT                   /gene="glpF"
FT                   /locus_tag="YPD4_0085"
FT   CDS_pept        complement(102471..103319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpF"
FT                   /locus_tag="YPD4_0085"
FT                   /product="glycerol uptake facilitator protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56994"
FT                   /protein_id="ACY56994.1"
FT                   /translation="MSQTASSTLKGQCIAEFLGTGLLIFFGAGCVAALKLAGASFGQWE
FT                   ISIIWGLGVAMAIYLTAAISGAHLNPAVTIALWLFACFERRKVLPYIVAQVAGAFCAAA
FT                   LVYGLYYSLFVDFEQTHQMVRGSTESLQLAGIFSTYPNPHISVVQAFLVETVITAILMC
FT                   LILALTDDGNGIPRGPLAPLLIGILIAVIGASMGPLTGFALNPARDLGPKAFSYLAGWG
FT                   DIAFTGGRDIPYFLVPIFGPIVGALLGAFGYRALIGRHLPCDVCTLEDEESTTITTERK
FT                   A"
FT   gene            complement(104394..104903)
FT                   /locus_tag="YPD4_0086"
FT   CDS_pept        complement(104394..104903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0086"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56995"
FT                   /protein_id="ACY56995.1"
FT                   /translation="MRSGNCKCSTRNQKGVPMRDEKSLAHTRWNCKYHIVFAPKYRRQV
FT                   FYREKRRAIGSILRKLCEWKNVNILEAEYCVDHIHMLLEIPPKMSVSGFMGYLKGKSSL
FT                   MLYEQFGDLKFKYRNREFWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGS
FT                   PFTGRK"
FT   gene            complement(105237..107351)
FT                   /locus_tag="YPD4_0087"
FT   CDS_pept        complement(105237..107351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0087"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56996"
FT                   /protein_id="ACY56996.1"
FT                   /translation="MNDTHFNEIKNRLNFSFRRKVPQVLQTEAAECGLACLVMTCRYHG
FT                   MDIDLFNLRQRFGISSHGATLALLINISAQLKFKTRALSLDLDELRQLKTPCILHWDMS
FT                   HFVVLVAVKGTRFIIHDPAFGRRTVSLSEMSQHFTGVALELWPNSEFTRQKSRTRLSLL
FT                   SLMRNISGLPGFLTKIFCLSLMVEAINLLLPVGTQLVMDHVIIAEDYDLLALICIGLLF
FT                   FILFRTFLSMLRSWTSLVMGSLVDVQWKAGLFDHLLKLPLAYFEKRKLGDIQSRFGSLD
FT                   IIRSTLTNNVVNGIIDGLMSIGVFIMMFLYGGWLVWVVLGFTAMYMILRLATYNQYRQA
FT                   SEEQIVKNAKASSHFMETLYGISTLKALGLAATRSQFWLNLNIDTTNANIRLTKLDMFF
FT                   GGVNTLICTIDQVVILWLGASMVIDGQMTLGMFVAFNAYRGQFSDRATNLINMVLQLRM
FT                   LALHSERIADIVFTETEKEQTPRQLLSPNQPAVFEARNIAFQYDNLSKPIFSDLNIHVE
FT                   AGESVAITGPSGIGKTTLMKVIAGLLTPSQGHILIDGLDITTVGLNNYRDCIACVLQDD
FT                   KLFAGSIADNIASFDVNKDEQRILSCANHCNIHKEIMHMPMGYETLISELGGSLSGGQK
FT                   QRLLIARALYRQPSLLFLDEATSHLDLANEAHINNAIASLKITRIFIAHRPSTIASAQR
FT                   IINLEKQNVS"
FT   gene            complement(107344..108636)
FT                   /locus_tag="YPD4_0088"
FT   CDS_pept        complement(107344..108636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0088"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56997"
FT                   /protein_id="ACY56997.1"
FT                   /translation="MSSNQIFRRDAVEYIRTKWLGKALLTSGYSTTFIAALCAIFLVLL
FT                   ITLIIYGTYTRRINVNGEVISQPHPINIFSPQQGFITKKWVEVGDIVRKGQHLYQIDVS
FT                   RTTFSGNVSLNSLEAINNQLSQIDSIINNTQKNKELTLLNLRQQLAQYQKAHKKSQELV
FT                   DNAGKGMDDMRRTMASYGTYQRQGLITKDQLTNQRSLFYQQQNAFQSLNTQLIQESLQI
FT                   AKLESEISTRASDFDNDISQYLFQKGDLKRQLAEVDASGMLLINSPSDGKIENMSVTQG
FT                   QMVNVNDSLVQLTPSDNPYYCLVLWVPNNSVPYINTGDKVNIRYDAFPFEKFGQFPGRI
FT                   ISISNVPVSQQEIASYNIAPRLPNGGLIEPYYKVIVALDDIHFRYQSKPLMLSNGLKAN
FT                   VTLFLEKRPLYQWMLSPFYDIKKSVTGPVNE"
FT   gene            109769..110302
FT                   /locus_tag="YPD4_0089"
FT   CDS_pept        109769..110302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0089"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56998"
FT                   /protein_id="ACY56998.1"
FT                   /translation="MIVAMTLSVSAWAISEQAKSEQATTVPNNDIVCHVAHLNARFDDK
FT                   EGLFEGASQSGTLLILRNISARACQVNAMPVISFEGAVGQQLAVFRKVPRGMRQEPVLS
FT                   PVTVAAGAEVAVQLRWVASDAFDGNNCVTPEKVVVTLLGGTLRLPFGRQMCAASGDTEF
FT                   FSQAPVGPATNEVQ"
FT   gene            complement(110419..110853)
FT                   /locus_tag="YPD4_0090"
FT   CDS_pept        complement(110419..110853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0090"
FT                   /product="S-adenosylmethionine:2-demethylmenaquinone
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACY56999"
FT                   /protein_id="ACY56999.1"
FT                   /translation="MVEPLFSNFGGRTSFGGKITTVKCFEDNGLLFDLLEENGLGRVLV
FT                   VDGGGSVRRALINAELAELALKNEWEGIVVYGAVRQVDDLAELDIGIQAMAAIPVGAAD
FT                   EGVGESDIRVNFGGVTFFSGDHLYADNTGIILSEDPLDIE"
FT   gene            complement(111046..111963)
FT                   /gene="menA"
FT                   /locus_tag="YPD4_0091"
FT   CDS_pept        complement(111046..111963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menA"
FT                   /locus_tag="YPD4_0091"
FT                   /product="1,4-dihydroxy-2-naphthoate octaprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57000"
FT                   /protein_id="ACY57000.1"
FT                   /translation="MSLSINTSQTQAWLESLRPRTLPLAFASIVTGSALAVWLDSFKPA
FT                   VALLALLTAGLLQILSNLANDYGDAVKGSDTEERIGPLRGMQKGIISHQQMKVALIITV
FT                   ILTIISGIALIAVACEKPSDILGFLLLGLMAIVAAITYTVGRKPYGYMGLGDISVLVFF
FT                   GWLSVAGTYYLQAGHFDSIVMLPATACGLLATAVLNINNLRDIENDKANGKNTLAVRLG
FT                   PVVARYYHALLIGAAIFCLALFSILHLHSWHGWIFLLAIPLLGKHALFVLRDPTAAGMR
FT                   PMLEQMVKAALLTNILFAVGLVFS"
FT   gene            complement(112199..113530)
FT                   /gene="hslU"
FT                   /locus_tag="YPD4_0092"
FT   CDS_pept        complement(112199..113530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslU"
FT                   /locus_tag="YPD4_0092"
FT                   /product="ATP-dependent protease ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57001"
FT                   /protein_id="ACY57001.1"
FT                   /translation="MSEMTPREIVSELDSHIIGQDKAKRAVAIALRNRWRRMQLNEELR
FT                   HEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLT
FT                   DAAVKMVRHQSIEKMRYRAEELAEERILDVLIPPAKNNWGVPDESQEPSATRQTFRKKL
FT                   REGQLDDKEIEIDLAAAPMGVEIMAPPGMEEMTNQLQSMFQNIAGQKQKPRKIKIKEAL
FT                   KLLIEEEAAKLVNPEELKQQAIDAVEQHGIVFIDEIDKICKRGQTSGPDVSREGVQRDL
FT                   LPLVEGCTVSTKHGMVKTDHILFIASGAFQVSSPSDLIPELQGRLPIRVELQALTTDDF
FT                   ERILTEPSASLTEQYKALMATEGVTIEFTREGIRKIAEAAWQVNERTENIGARRLHTVL
FT                   ERLMEDISYDASESSGQSITIDAEYVGKHLDELVADEDLSRFIL"
FT   gene            complement(113601..114125)
FT                   /gene="hslV"
FT                   /locus_tag="YPD4_0093"
FT   CDS_pept        complement(113601..114125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslV"
FT                   /locus_tag="YPD4_0093"
FT                   /product="ATP-dependent protease peptidase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57002"
FT                   /protein_id="ACY57002.1"
FT                   /translation="MTTIVSVRRDGHVVIGGDGQVTLGNTVMKGNAKKVRRLYNNKVIA
FT                   GFAGGTADAFTLFELFERKLEMHQGHLTKAAVELAKDWRTDRMLRKLEALLAVADETAS
FT                   LIITGNGDVVQPEDDLIAIGSGGPYAQSAARALLENTELGARDIVEKSLSIAGDICIYT
FT                   NRFQTIEELTY"
FT   gene            complement(114225..115070)
FT                   /gene="ftsN"
FT                   /locus_tag="YPD4_0094"
FT   CDS_pept        complement(114225..115070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsN"
FT                   /locus_tag="YPD4_0094"
FT                   /product="cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57003"
FT                   /protein_id="ACY57003.1"
FT                   /translation="MAQRDYVSRGRSGARRKSTSRKKRSAPIVSKTVMALAVALLVVFV
FT                   GGLYFITHNKPGELPLLPNHDPRTGNGLPPKPEERWRYIKELENRQIGVPMPTEPSAGG
FT                   EVNAKTELTNEQRQLLEQMQADMRQQPTQLSEVPYNQGMQQVPRSAVTIKPPATSVQPQ
FT                   PVTPPRQTTIPVQPQAPAPVRTPPAAPVTQAVTPPKVEKEKEKTQRWMVQCGSFKAVDQ
FT                   AESIRAQLAFAGIESRITSGGGWNRVVLGPYNSKAAADKALQRLQGAGQSGCIPLSVGG
FT                   "
FT   gene            complement(115136..116164)
FT                   /gene="cytR"
FT                   /locus_tag="YPD4_0095"
FT   CDS_pept        complement(115136..116164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cytR"
FT                   /locus_tag="YPD4_0095"
FT                   /product="transcriptional repressor"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57004"
FT                   /protein_id="ACY57004.1"
FT                   /translation="MENKKEFTMTTMKDVAEMAGVSTATVSRALMNPEKVSTVTRQKVE
FT                   QAVLAVGYSPHALSRNIKRNESRTILVIVPDISDPFFADVIQGIEHAAAQQGYLILIGD
FT                   CAQQTQQERTFVNLIITKQIDGMLLLGSNLPFDASKEEQRNLPPMVMANEFAPELELPT
FT                   VHIDNLTAAYEAVNYLHELGHKRIACIAGPESLPLSHYRLQGYIQALRRNGITVDNDYI
FT                   IRGDFSYEAGAQSFAALMELPHPPTAIFSHNDVMAVGAIWQAKQLGLRIPQDVSLVGFD
FT                   DLKLSQFCDPPLTTVAQPRYQIGQQAMLLLLEQLQGHSVQSGSRLLDTELIIRESTAAP
FT                   KH"
FT   gene            complement(116517..118715)
FT                   /gene="priA"
FT                   /locus_tag="YPD4_0096"
FT   CDS_pept        complement(116517..118715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="priA"
FT                   /locus_tag="YPD4_0096"
FT                   /product="primosome assembly protein PriA"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57005"
FT                   /protein_id="ACY57005.1"
FT                   /translation="MSVVQVALPVPLARTFDYRLDSAMACPVVGARVSVPFGKRKAIGI
FT                   VVGLSDTSTFPLEQLKTIDAILDNHSLFPPSLWRILCWATEYYHYPIGEVLFHALPILL
FT                   RQGRPAQSAPLWQWFVTEQGRATPPESLKRAPKQQQALAALLQKPVYRHQVNEMALTES
FT                   ALQALRSKGLIDLRAQEATTTDWRHSFSVLGERLRLNTEQATAVGAIRSEDNQFAAWLL
FT                   AGVTGSGKTEVYLSVLENILAQGRQALILVPEIGLTPQTIARFRERFNAPVEVLHSGLN
FT                   DSERLSVWLRARSGEAAIVIGTRSALFTPFSRLGVIIIDEEHDSSYKQQEGWRYHARDL
FT                   AVFRAREEGIPIVMGTATPALETLHNVQMGKYRQLTLTKRAGSAKPAAQHLLDLKGLPL
FT                   KVGLSQPLLKQMKTHLQAGNQVILFLNRRGYAPALLCHECGWIAECQRCDHYYTLHQNH
FT                   RQLRCHHCDSQRPVPQQCPKCGSTHLVSVGVGTEQLENELAPLFPETPITRIDRDTTSR
FT                   KGSLEQYLADVHQGGARILIGTQMLAKGHHFPDVTLVALLDVDGALFSADFRSAERFAQ
FT                   LYTQVSGRAGRAGKQGEVILQTHHPEHPLLQILLQQGYDAFAKQALEERKSVFLPPYTS
FT                   HIIVRSEDHDNQQSALFLQQLRNLLEASPLKDEALWIMGPVPALQAKRGGRFRWQLLLQ
FT                   HPSRQLLQRLIKTSQPLISTLPQARKVKWTIDVDPIDS"
FT   gene            complement(119716..120171)
FT                   /locus_tag="YPD4_0097"
FT   CDS_pept        complement(119716..120171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0097"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57006"
FT                   /protein_id="ACY57006.1"
FT                   /translation="MNPNYAKPSAAFTAASWSALLGGFVIFLIGLWNADMQLNERGYYF
FT                   AVLILGLFSAVSLQKTVRDKLEGLAITSIYYGLCWVAFIVAVLLLCIGLWNATLALSEK
FT                   GFYGVTFFMTLFGAIAVQKNTRDSAMSSDTESASLFKKVRDQLKAED"
FT   gene            complement(120520..120837)
FT                   /gene="metJ"
FT                   /locus_tag="YPD4_0098"
FT   CDS_pept        complement(120520..120837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metJ"
FT                   /locus_tag="YPD4_0098"
FT                   /product="transcriptional repressor protein MetJ"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57007"
FT                   /protein_id="ACY57007.1"
FT                   /translation="MAEWNGEYVSPYAEHGKKSKQVKKITVSIPLKVLKILTDERTRRQ
FT                   VNNLRHATNSELLCEAFLHAFTGQPLPNDEDLRKERSDEIPEAAKILMRELGVDPDTWE
FT                   Y"
FT   gene            121215..122204
FT                   /locus_tag="YPD4_0099"
FT   CDS_pept        121215..122204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0099"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57008"
FT                   /protein_id="ACY57008.1"
FT                   /translation="MTRKQATIAVRSGLNDDEQYGCVVPPIHLSSTYNFIDFNQPRTHD
FT                   YSRRGNPTRDVVQRALAELEGGAGAVMTSSGMSALHLVCTTFLQPGDLLVAPHDCYGGS
FT                   YRLFDSLSKRGAYRVLFVDQGDEAALNCALAEKPKLVLIETPSNPLLRVVDIAAICQAA
FT                   RAAGALTVCDNTFLSPALQQPLSLGADLVVHSCTKYLNGHSDVVAGAVIAKDPELVVEL
FT                   AWWANNIGVTGAAFDSYLLLRGLRTLSPRMAQQQRNADDIVRYLQQQPLVKKLYHPSLP
FT                   QHPGHEIACRQQSGFGAMLSFELDGDEQVMRRFLSALELFTLAESLGG"
FT   gene            122377..124812
FT                   /gene="metL"
FT                   /locus_tag="YPD4_0100"
FT   CDS_pept        122377..124812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metL"
FT                   /locus_tag="YPD4_0100"
FT                   /product="bifunctional aspartate kinase II/homoserine
FT                   dehydrogenase II"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57009"
FT                   /protein_id="ACY57009.1"
FT                   /translation="MNATAVAAAATGRQLHKFGGSSLADVKCYLRVANIMANYSHPGDL
FT                   MVVSAAGSTTNQLISWLKLSQNDRLSAHQVQQSLRRYQHDLINGLLPPEMAEPLISEFI
FT                   HDLERLAGLLDNKIDDVIYAEVVGHGEIWSARLMSALLNKLDMDAVWLDARRFLRAERA
FT                   AQPQIDESRSYPLLQQLMAQHPHQRLVVTGFISRNEAGETVLLGRNGSDYSATQVGALA
FT                   GAERVTIWSDVAGVYSADPRKVKDACLLPLLRLDEASELARLAAPVLHTRTLQPVSGSD
FT                   IDLQLRCSYQPEQGSTRIERVLASGLGAKIVTSHDDVCLIELQIASHHDFSLAQKEIDL
FT                   LLKRAQIKPLATGIHPDRNLLQLCYTSEVVNSALRVLEDAALPGKLSLREGLALVALVG
FT                   AGVSKNPLHSHRFYQQLKDQPVEFVWQAEDGISMVAVLRLGPTEHLIQGLHQSLFRAEK
FT                   RIGLMLFGKGNIGARWLELFAREQKSLSARSGFEFVLAGVVDSRRSLLSYDGLDASRTL
FT                   AFYNDEAKEQDEESLFLWMRAHPFDDLVVLDVTASPSLAEQYLDFASYGFHVISANKLA
FT                   GASSSNNYRQIRDAFAKTGRHWLYNATVGAGLPVNHTVRDLRDSGDSILAISGIFSGTL
FT                   SWLFLQFDGSVPFTELVDQAWQQGLTEPDPRVDLSGQDVMRKLVILAREAGYDIEPNQV
FT                   RVESLVPAGAESGSVDQFFENGEALNQQMIQRLEAAKEMGLVLRYVARFDANGKARVGV
FT                   EAVRTDHPLASLLPCDNVFAIESRWYRDNPLVIRGPGAGRDVTAGAIQSDLNRLSQLL"
FT   gene            125045..125938
FT                   /locus_tag="YPD4_0101"
FT   CDS_pept        125045..125938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0101"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57010"
FT                   /protein_id="ACY57010.1"
FT                   /translation="MSFFHANQREALNQSLSELQGQINVSFEFFPPRTSEMEDTLWSSI
FT                   DRLSTLKPKFVSVTYGANSGERDRTHSIIKGIKERTGLEAAPHLTCIDASPTQLRDIAI
FT                   DYWNSGIRHIVALRGDLPPNSGKPEMYACDLVGLLKDVGDFDISVAAYPEIHPEAKSAQ
FT                   ADLINLKRKIDAGANRAITQFFFDVESYLRFRDRCVATGIDVEIVPGILPVSNFKQLQR
FT                   FATMTNVRVPNWMTSIFDGLDNDPETRKMVGASVAMDMVKILSREGVKDFHFYTLNRAE
FT                   LSYAICHTLGGEALVF"
FT   gene            complement(126100..126885)
FT                   /locus_tag="YPD4_0102"
FT   CDS_pept        complement(126100..126885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0102"
FT                   /product="IS1661 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57011"
FT                   /protein_id="ACY57011.1"
FT                   /translation="MARSTYYYHASKPDGVIDDYADAVKAIGALSRRHAQRYGYRRMTV
FT                   ALRKEGFTLNHKTVRKLMNQHGLLSLIRRKKYRSYRADGGRASDNLLARNFTSEISGLK
FT                   WCTDVTEFRVGAQKLYLSVIQDLFNNEIISWHMSERAALILTCKTLEKALKVKGRKEGL
FT                   MLHSDQGWHYRTPMWRSMLVEAGIRQSMSRKGNCLDNAVMENFFSHLKAEMYHRKKYDS
FT                   ATVLKRDIVEYIHYYNTERISLKTGGMSPAEYRTQVEKQ"
FT   gene            complement(127058..127582)
FT                   /locus_tag="YPD4_0103"
FT   CDS_pept        complement(127058..127582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0103"
FT                   /product="IS1661 DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57012"
FT                   /protein_id="ACY57012.1"
FT                   /translation="MIGFGCYGFTAHLASDEPTAKGAISALNPRSWIFLSMIWRFGSMK
FT                   HPFSTRLAAVQHYLSGKATLRETARQFSVGKSPLTRWIRAFRRQGEAGLEHHLSRTYTP
FT                   EFRLCVVRYMMANRCSAADASAHFNIPNETIIQNWMKRYREGGKEALNPSKTGLLCQKI
FT                   NMSTIQNRSAR"
FT   gene            complement(127646..128404)
FT                   /gene="glpR"
FT                   /locus_tag="YPD4_0104"
FT   CDS_pept        complement(127646..128404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpR"
FT                   /locus_tag="YPD4_0104"
FT                   /product="glycerol-3-phosphate repressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57013"
FT                   /protein_id="ACY57013.1"
FT                   /translation="MKQTQRHDAIIELVRLQGYVSTEELVEHFAVSPQTIRRDLNELAD
FT                   QNKIHRHHGGAALPSSSVNAAYNDRKVMWSEEKARIAQRVASQIPDGATLFIDIGTTPE
FT                   AVAHALMNHKGLRVVTNNLNVATLLTAKEDFRLILAGGEVRTRDGGIIGEATLDFISQF
FT                   RLDYGILGISGIDMDGSLLEFDYHEVRTKRAIIENSRCVMLVTDHSKFGRNAMVNLGNM
FT                   NLIDYLFTDQQPPASVMKIIEQHEVQLELC"
FT   gene            complement(128439..129218)
FT                   /locus_tag="YPD4_0105"
FT   CDS_pept        complement(128439..129218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0105"
FT                   /product="peptidase, S54 (rhomboid) family protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57014"
FT                   /protein_id="ACY57014.1"
FT                   /translation="MATHHVALEIRPDAQGVEIWLADDEQLSAVQHELEQFLLDPLNPR
FT                   YQAASWQAGNVNSNLPYQRFSYLQTLRSQAGPLTLSVMVLCIAIYILMLITGDMAVMSW
FT                   LAWPYNSSQYLQIWRWVSHAFLHFSLLHILFNLMWWWYLGGQMEKRLGTSKLLVLTIVS
FT                   AVFSGWGQSLFSGANFGGLSGVVYALMGYVWLTGERAPERGISLPRGLMAFSVLWLIAG
FT                   YFDILGLSIANAAHVSGLIIGLLMAFWDTRNSARTVQ"
FT   gene            complement(129293..129727)
FT                   /gene="glpE"
FT                   /locus_tag="YPD4_0106"
FT   CDS_pept        complement(129293..129727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpE"
FT                   /locus_tag="YPD4_0106"
FT                   /product="thiosulfate sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57015"
FT                   /protein_id="ACY57015.1"
FT                   /translation="MFYGSLLAIIWIFIDDKLITMALLRIQSSLRVISSMEQFEATSVE
FT                   QAYLRWKEGKTALVDIRDPQSYEAGHAPGAFHLTNSSLHTFMQQTDFDQPVMVMCYHGN
FT                   SSKGAAQYLLQQGFDVVYSIDGGFEAWARSYPQDITSESR"
FT   gene            complement(129997..132708)
FT                   /gene="malT"
FT                   /locus_tag="YPD4_0107"
FT   CDS_pept        complement(129997..132708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malT"
FT                   /locus_tag="YPD4_0107"
FT                   /product="transcriptional regulator MalT"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57016"
FT                   /protein_id="ACY57016.1"
FT                   /translation="MLIPSKLSRPVRLQNTVVRDRLLVKLSSAANYRLTLINCPAGYGK
FT                   TTLIAQWAADQSNLGWYSLDESDNQSERFATYLIAAIQLATGGHCSKSEALSQKHQYAN
FT                   LSALFSQLFIELSNWDGPLYLVIDDYHLITNDAIHEAMRFFLRHQPENLTLIILSRTLP
FT                   SLGIANLRVRDQLLELGMQQLAFNHHEAQQFFECRLSSPLEQGDSSRLCDEVEGWVTAL
FT                   QLIALSSRQPNSSAQKSAKRLAGLNASHLSDYLVDEVLDQVDSKARAFLLRCSVLRSMN
FT                   DALIVRLTGEDNGQQLLEELERQGLFIHRMDDSAEWFCFHPLFATFLRQRCQWELALEL
FT                   PELHHAAAEGWMALGYPAEAIHHALAAGDVGMLRDILLQHAWSLFHHSELALLEQCLTA
FT                   LPYPLLVQNPELALLQAWLAQSQHRYSEVNTLLEQAELAMQERKIPVDEILRAEFGALR
FT                   AQVAINAGKPDEAEKLATDALKYLPMAHYYSRIVATSVTGEVHHCKGELARALPMMQQT
FT                   EQMARRHEAYHYALWALLQQSEILIAQGFLQAAYETQEKAFELIREQHLEQLPMHEFLL
FT                   RIRSQVLWSWSRLDEAEEAARKGVEILANYQPQQQLQCLAMLAKCSLARGDLDNANVYI
FT                   QRCEALQHGSQYHLDWITNADKPRVIHWQMTGDKVAAASWLRQTEKPGMADNHFLQGQW
FT                   RNIARVQIILGRFDEAEVVLDELNENARRLRLTSDLNRNLLLSNTLYWQTERKGEAQKA
FT                   LIESLTLANRTGFISHFVIEGEAMAQQLRQLIQLNALPELEQHRAQRILKDINQHHRHK
FT                   FAHFDEIFVDKLLTHPQVPELIRTSPLTQREWQVLGLIYSGYSNDQIANELDVAATTIK
FT                   THIRNLYQKLGVAHRQEAVQQAQRLLQMMGYV"
FT   gene            133026..133376
FT                   /locus_tag="YPD4_0108"
FT   CDS_pept        133026..133376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0108"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57017"
FT                   /protein_id="ACY57017.1"
FT                   /translation="MSQPMLKKDDFLAALTRQWQRFGLTSAQQMTPYQWWEAVSAALAE
FT                   QLSAQPAPSKPKNVQRHVNYISMEFLIGRLTANNLINLGWYDTVDALLAEQQVKLSDLL
FT                   EQETTQHWATGA"
FT   gene            133358..135430
FT                   /locus_tag="YPD4_0109"
FT   CDS_pept        133358..135430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0109"
FT                   /product="Glycogen/starch/alpha-glucan phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57018"
FT                   /protein_id="ACY57018.1"
FT                   /translation="MGNGGLGRLAACFLDSMATVEQPATGYGLNYQYGLFRQSFRECKQ
FT                   QEAPDNWQRESYPWFRHNAALAVDVGFGGNLVKQADGRQLWRPAFTLRGEAWDLPVLGF
FT                   RNGVTQPLRLWQATHQHPFDLTLFNDGKFLLAEQNGVEAEKLTKVLYPNDNHLAGKRLR
FT                   LMQQYFQCACSVADILRKHHLAGRKLAELPDYEVIQLNDTHPTIAIPEMLRVLLDEHQL
FT                   SWDAAWAITSKTFAYTNHTLMPEALECWDEKLVRSLLPRHFVIIKQINAQFKKLVNKQW
FT                   PGNDEVWAKLAVHHNKQVRMANLCVVSGFAVNGVAQLHSDLIIKDLFPEYYQLWPNKFH
FT                   NVTNGITPRRWLKQCNPALSGLIDDTLKVEWANDLDVLQDLEPYAEDPAFRQRYQQIKY
FT                   DNKVKLAHYVKRVMGLVINPDAIFDVQIKRLHEYKRQHLNLLHILSLYRQIRDNPALDI
FT                   APRVFLFGAKAAPGYYLAKNIIYAINQVADKINNDPIVKDRLKVVFIPDYRVSVAELMI
FT                   PAADVSEQISTAGKEASGTGNMKMALNGALTVGTLDGANVEIAEQVGDENIFIFGHTVD
FT                   QVKAILAKGYQPKKYVKADPHLKSILDELASGAFSQGDKQAFDMMLHSLLEGGDPYLVL
FT                   ADFASYCQAQKQIDALYRDKDEWTRRAILNTARVGMFSSDRSIRDYQQRIWQAKR"
FT   gene            135443..137539
FT                   /gene="malQ"
FT                   /locus_tag="YPD4_0110"
FT   CDS_pept        135443..137539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malQ"
FT                   /locus_tag="YPD4_0110"
FT                   /product="4-alpha-glucanotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57019"
FT                   /protein_id="ACY57019.1"
FT                   /translation="MDRKSLDQAATLAGIAASYINAHGKPQATLAETKEQLLAAMGRSL
FT                   GAHDTQTANTPLPVVKVFTFGSPMQLPMAGSGDYHWQLQTENGELHQGRISAKKTLTLP
FT                   ASLPLGYHRLILEQDLQQWQCSIIVAPKRCYEPDALLQGKKLWGACVQLYTLRSEHNWG
FT                   IGDFGDLKQMLEQVGERGGSFIGLNPIHALYPANPHSASPYSPSSRRWLNVIYIDINRV
FT                   EEFQQSEAAQRWWHQAETQQALAKSRESEWVDYPLVMQLKLTALRLSFPLFTARKAKDA
FT                   QVQAFRHFVEQGGSSLHQQAVFDALHAHLSEHDPMMWGWPVWPEKYRDGHSSAVADFCR
FT                   EHADEVTFYLWLQWLAASQFDDCFQSSQQRKMPIGLYRDLAVGVAEGGAETWCDRELYC
FT                   LKASVGAPPDILGPLGQNWGLPPMDPHVMVARAYQPFIDLLRANMTSCGALRIDHVMAL
FT                   LRLWWIPYGHTADQGAYVKYPVDDLLAVLALESQRHHCMVIGEDLGTVPVEIVGKLRDS
FT                   GVYSYKVLYFEHDSENIFRAPQSYPVQAMATITTHDLPTLRGYWQADDLTLGNKLGLYP
FT                   DQQILKQLYLDRERAKQGLLEGLHRYDCVPKKVGHKAALLSMSPVLNRGLQRYVADSAS
FT                   ALLGLQPEDWLDMAAPVNIPGTTDEYPNWRRKLSASLEEIFADSQINRLLKDLDKRRKN
FT                   VSVG"
FT   gene            complement(137868..138443)
FT                   /locus_tag="YPD4_0111"
FT   CDS_pept        complement(137868..138443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0111"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57020"
FT                   /protein_id="ACY57020.1"
FT                   /translation="MITITDAAQSHFAKLLANQEEGTQIRVFVINPGTPTAECGVSYCP
FT                   PDAVEATDTELKFEQLSAYVDELSVPYLQDAEIDFVTDQLGSQLTLKAPNAKMRKVDDS
FT                   APLMERVEYVLQSQINPQLAGHGGRVTLMEITPEGLAILQFGGGCNGCSMVDVTLKEGI
FT                   EKELLQKFPELKGVRDLTEHQRGEHSYY"
FT   gene            complement(138503..139204)
FT                   /locus_tag="YPD4_0112"
FT   CDS_pept        complement(138503..139204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0112"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57021"
FT                   /protein_id="ACY57021.1"
FT                   /translation="MLTTVSQCWLCQQPLYHNRHGICCYCQRHLPVLPPCCPCCGLPST
FT                   STFLRCGRCLIAPPRWHHMTFVGDYAPPLSGLIKQLKFGGAPQLAPVLARLLLLRWLRH
FT                   WRETQCRKSDKAIKPQRIVSVPLHHWRCWRRGYNQTDLLARPLAHWLGCDYTPLTLQRI
FT                   HATPPQQQLTAAQRRKNVRGIFRCAESVRGQHIALLDDVVTTGSTLNEIAHLLWAQGIA
FT                   SLQIWSVCRTL"
FT   gene            139291..140067
FT                   /gene="bioH"
FT                   /locus_tag="YPD4_0113"
FT   CDS_pept        139291..140067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioH"
FT                   /locus_tag="YPD4_0113"
FT                   /product="putative biotin biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57022"
FT                   /protein_id="ACY57022.1"
FT                   /translation="MKQLYWYTCGEGDCDLVLLHGWGLNSGVWHCIIDRLAPHFRLHLV
FT                   DLPGYGRSQDYGAMSLADMAERVAQQAPKQALWLGWSMGGLVASQIALSQPECVRGLIT
FT                   VSSSPCFTARDEWPGIKPEVLAGFQHQLSDDFHRTVERFLALQTLGTESSRQDARLLKS
FT                   VVLQHQMPDVEVLTGGLAILRTADLRTALAGFTLPFMRVYGHLDSLVPRKVASLLDSAW
FT                   PQTQSVVMQGAAHAPFISHPNDFAKLILNFAEENKK"
FT   gene            complement(140937..143252)
FT                   /gene="feoB"
FT                   /locus_tag="YPD4_0114"
FT   CDS_pept        complement(140937..143252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="feoB"
FT                   /locus_tag="YPD4_0114"
FT                   /product="ferrous iron transport protein B"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57023"
FT                   /protein_id="ACY57023.1"
FT                   /translation="MKALTIGLIGNPNAGKTTLFNQLTGARQRVGNWAGVTVERKEGHF
FT                   NTAQHQVTLVDLPGTYSLTTISEQTSLDEQIACHYILSGEADLLINVIDAVNLERNLYL
FT                   TLQLLELGIPCIVALNMLDIAESQHIEIDINTLSKKLGCPVIPLVSTRGRGIDELKNSI
FT                   DQFQPATCRTLVSYPPILLSEVDKLVAAMSDALPMQQRRWLALQILEGDIYSLNRAGVA
FT                   PSMVEQARQQLREQQHEDPALIIADARYQSIAHLCEAVGNSQQAEPNRLTQALDSVILN
FT                   RWLGVPIFLFVMYLMFVLAINIGGALQPIFDIGSAAIFIQGLQWVGHTLHFPPWLTIFL
FT                   AQGVGGGINTVLPLVPQIGMMYLFLSFLEDSGYMARAAFVMDRLMQALGLPGKSFVPLI
FT                   VGFGCNVPSIMGARTLDAQRERLITIMMAPFMSCGARLAIFAVFAAAFFGQDGASIVFS
FT                   LYLLGIAVAILTGLVLKYTIMRGEASPFVMELPVYHVPHLKSLLLQTWQRLKGFVLRAG
FT                   KVIVIASIFIGGLNSFSFNGKPVDSINDSALASVSKVLTPLLMPMGIHADNWQATVGLV
FT                   TGAMAKEVVVGTLNTLYTAEQINNDPFDAENFNLLDELAGAVDETWQGLKDTFSLSVLA
FT                   NPIEASKGDGEMTTGSMGMMSSKFGSSISAYSYLIFVLLYVPCVSVMGAIARETSRGWM
FT                   TFSILWGLNVAYSLATLFYQAATFRDHPQESLSIIVLVIVVNALILFGLRRARSRVTVR
FT                   LQNSEPANCCRSSGSNCH"
FT   gene            complement(144095..146470)
FT                   /locus_tag="YPD4_0115"
FT   CDS_pept        complement(144095..146470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0115"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57024"
FT                   /protein_id="ACY57024.1"
FT                   /translation="MNEPLSRIIASELQARPEQVISAIRLLDEGNTVPFISRYRKEVTG
FT                   GLDDIQLRQLESRLGYLRELEDRRQTILKSIEDQGKLTDQLAGAINATLSKTELEDLYL
FT                   PYKPKRRTRGQIAIEAGLEPLAERLWQDPQQDPEHTALAYVDADKGVADTKAALDGARY
FT                   ILMERFAEDATLLAKVRQYLWKNAHLVSKVVEGKEQEGAKFRDYFDHHEPIAQVPSHRA
FT                   LAMFRGRNEGVLQLALDPDPQFDEPPRESQGEQIIINHLDLRLNNAPADGWRKAVVNWT
FT                   WRIKVLLHLETELMSTLRERAEDEAINVFARNMQDLLMAAPAGMRATMGLDPGLRTGVK
FT                   VAVVDATGKLVAFDTIYPHTGQAAKAAAVVAALCIKHQVELVAIGNGTASRETERFFVE
FT                   LQQQYPAVTAQKVIVSEAGASVYSASELASQEFPDLDVSIRGAVSIARRLQDPLAELVK
FT                   IDPKSIGVGQYQHDVSQSQLAKKLDAVVEDCVNAVGVDLNTASVPLLTRVAGLTRMMAQ
FT                   NIVNWRDENGRFRNREQLLKVSRLGPKAFEQCAGFLRINHGDNPLDASTVHPEAYPVVE
FT                   RILAATEQALQDLMGNANALRNLNARDFTTERFGVPTVTDILRELEKPGRDPRSEFKTA
FT                   TFAEGVETLNDLTPGMILEGAVTNVTNFGAFVDIGVHQDGLVHISSLADKFVDDPHKVV
FT                   KAGDIVKVKVMEVDLQRKRIALTMRLDEQPGETHSRRSNNGTGSERTNNDNRGVNRPHN
FT                   DAKGHNAPNRAPAKGRSDSSSAGNSAMSDALAAAFKKR"
FT   gene            147004..147519
FT                   /gene="greB"
FT                   /locus_tag="YPD4_0116"
FT   CDS_pept        147004..147519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="greB"
FT                   /locus_tag="YPD4_0116"
FT                   /product="transcription elongation factor GreB"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57025"
FT                   /protein_id="ACY57025.1"
FT                   /translation="MAKSNYITREGWQALDRELHYLWREERPVVTQAVSEAAAMGDRSE
FT                   NAEYIYGKKRLREIDRRVRFLAKRLEVLKIVDPDPRQEGKVFFGAWVRVENEQEEQRIF
FT                   RLVGPDEFDPAKKWISIDSPVARALIGKQVDDEVTVQTPNGEATYWILEIRYRPFDEDR
FT                   PFNEDIDN"
FT   gene            147655..148374
FT                   /gene="ompR"
FT                   /locus_tag="YPD4_0117"
FT   CDS_pept        147655..148374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ompR"
FT                   /locus_tag="YPD4_0117"
FT                   /product="osmolarity response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57026"
FT                   /protein_id="ACY57026.1"
FT                   /translation="MQENHKILVVDDDMRLRALLERYLTEQGFQVRSVANAEQMDRLLT
FT                   RESFHLMVLDLMLPGEDGLSICRRLRSQSNPMPIIMVTAKGEEVDRIVGLEIGADDYIP
FT                   KPFNPRELLARIRAVLRRQANELPGAPSQEEAIIAFGKFKLNLGTREMFREDEPMPLTS
FT                   GEFAVLKALVSHPREPLSRDKLMNLARGREYSAMERSIDVQISRLRRMVEEDPAHPRYI
FT                   QTVWGLGYVFVPDGNKA"
FT   gene            148371..149723
FT                   /gene="envZ"
FT                   /locus_tag="YPD4_0118"
FT   CDS_pept        148371..149723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="envZ"
FT                   /locus_tag="YPD4_0118"
FT                   /product="osmolarity sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57027"
FT                   /protein_id="ACY57027.1"
FT                   /translation="MKWWRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQ
FT                   FNKVLAYEVRMLMTDRLQLEDGTLLEVPPAFRREIYRELGISLYTNAAAEESGLRWAQH
FT                   YKFLSDQMAQQLGGPTDVRVEVNKNSPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRY
FT                   TLAIMLLAVGGAWLFIRIQNRPLVELEHAALQVGKGNIPPPLREYGASEVRSVTRAFNQ
FT                   MAAGVKLLSDDRTLLMAGVSHDLRTPLTRIRLATEMMSEDDAYLSESINKDIEECNAII
FT                   EQFIDYLRTGQEMPTEPSDLNSVLGEVIAAESGYERVIETDLAEGEVLVDIHPLSIKRA
FT                   LTNMVVNAARYGNGWIKVSSGKELQRAWFQVEDDGPGIKPEDLKHLLQPFVRGDSARST
FT                   SGTGLGLAIVQRIIDAHAGSLEIGTSKRGGLRIRAYIPLPLDVKPKPPAVA"
FT   gene            complement(149858..151477)
FT                   /gene="pckA"
FT                   /locus_tag="YPD4_0119"
FT   CDS_pept        complement(149858..151477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pckA"
FT                   /locus_tag="YPD4_0119"
FT                   /product="phosphoenolpyruvate carboxykinase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57028"
FT                   /protein_id="ACY57028.1"
FT                   /translation="MSVKGITPQELAAYGIHNVSEIVYNPSYDLLFEEETKPTLEGYER
FT                   GTLTTTGAIAVDTGIFTGRSPKDKYIVRDAITQDTVWWADQGKGKNDNKPLSQEIWNHL
FT                   KGLVTEQLSGKRLFVVDTFCGANADTRLQVRFITEVAWQAHFVKNMFIRPSDEELARFE
FT                   PDFIVMNGAKCTNPQWKEQGLNSENFVAFNLTERMQLIGGTWYGGEMKKGMFSMMNYLL
FT                   PLKGIASMHCSANVGEKGDVAIFFGLSGTGKTTLSTDPKRKLIGDDEHGWDDDGVFNFE
FT                   GGCYAKTIKLSEEAEPDIYHAIKRDALLENVVVLADGTVDFNDGSKTENTRVSYPIYHI
FT                   DNIVKPVSKAGHATKVIFLTADAFGVLPPVSRLTANQTQYHFLSGFTAKLAGTERGVTE
FT                   PTPTFSACFGAAFLSLHPTQYAEVLVKRMQAVGAQAYLVNTGWNGTGKRISIKDTRAII
FT                   DAILNGEIDKAETFTLPIFDLAVPMALPGVNPDILDPRDTYADKAQWQEKAEDLAKRFA
FT                   TNFDKYTDTPAGAALVSAGPKI"
FT   gene            complement(151674..152555)
FT                   /gene="hslO"
FT                   /locus_tag="YPD4_0120"
FT   CDS_pept        complement(151674..152555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslO"
FT                   /locus_tag="YPD4_0120"
FT                   /product="Hsp33-like chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57029"
FT                   /protein_id="ACY57029.1"
FT                   /translation="MSNHDQLHRYLFANHAVRGELVSVNETYQQVLANHDYPPAVQKLL
FT                   GEMLVATSLLTATLKFDGDITVQLQGGDGPLTLAVINGNNRQEMRGVARVKGEISDDST
FT                   LQEMVGNGYLVITITPAQGERYQGVVALEGETIAACLENYFMQSEQLPTRLFIRTGHVA
FT                   DKAAAGGMLLQVLPAQERNEDEFDHLAQLTATIKAEELFTLPANEVLYRLYHQEEVTLY
FT                   EPQNVSFRCTCSRQRCADALVTLADDDVTEMLEQDGNIDMHCEYCGNHYLFDAVDIATL
FT                   KNGNSASSEQIH"
FT   gene            complement(152718..153125)
FT                   /gene="hslR"
FT                   /locus_tag="YPD4_0121"
FT   CDS_pept        complement(152718..153125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslR"
FT                   /locus_tag="YPD4_0121"
FT                   /product="heat shock protein 15"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57030"
FT                   /protein_id="ACY57030.1"
FT                   /translation="MKDKISPAESVRLDKWLWAARFYKTRAIARDMVDGGKVHYNGQRS
FT                   KPSKLVELHAEIRLRQGNDERTVRVLALHSQRRGAEEAQTLYEETEASIANREKVAQAR
FT                   KLNALTMPHPDRRPDKKERRNLIKFKQGEPE"
FT   gene            complement(153154..153834)
FT                   /locus_tag="YPD4_0122"
FT   CDS_pept        complement(153154..153834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0122"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57031"
FT                   /protein_id="ACY57031.1"
FT                   /translation="MPPDFNWQEIDTVLLDMDGTLLDLAFDSHFWLKLVPENLSQRRGI
FT                   PLEQAHKIIHDEYNAVQHTLNWYCFDYWRERLDLDIYAMTTDIGSRARLRQDTVPFLSG
FT                   LRQHGLQTILLTNAHPHSLAVKIEHTALDQHLDLLLSTHTFGYPKEDQRLWQAVTQHTG
FT                   LNPARTLFVDDSEAILDAAQTFGIRYCLGVENPDSSCADKTFHRHPAINDYRKLLPALQ
FT                   LRCE"
FT   gene            complement(153978..156125)
FT                   /locus_tag="YPD4_0123"
FT   CDS_pept        complement(153978..156125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0123"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57032"
FT                   /protein_id="ACY57032.1"
FT                   /translation="MSTIVLILALLLTSLIAVGLLWWLRFRRPHPITAALPFVKLTHRK
FT                   LTPEERVSIENYLRNQQNKHGFNTQPAFDSHALAASTSSTPMLVLTPQSDNVYSVTRAI
FT                   TRYGVASDEPNKWRYYLDSIEVHLPSAWEQYITQDNDVELIQTQTIPLVISLNGHTLNN
FT                   HQSENTYQPILPSVSKNASIRKEDSEHIELLNIRKETPEEYALHGPNGLKEACAICIAL
FT                   LLLFFALSGPTVTLPWLVIVAVSLTCWACWYLFRPLSEKDLREVHCLNGTPKRWGLFGE
FT                   SNQGQINNISLGIVDLIYPAHWGPYFVHDLGKKTHIDIYLNRQVVRQGAFLSLHDEMKM
FT                   FPLQRWGKNLTLIVGSLLVLVLLLIYVPLGLPLKLSVAWLQGAQSQQVTSVAALDKMPL
FT                   RIGDMLKAQGNGMCYVPPNIQNTRGFVFTPFDCSGIYWNTASPLPQPESETIEKAAALV
FT                   ETINKQLHPQGSDASVNPKLATAIEKSGMILLDDFSDIVLKTQALCSENTDCIRLKNAL
FT                   VNLGNAKNWSALVKRAQSGNLEGMNVLLRPISADVLENLINTAASSFVYRETHLATEAL
FT                   NSPPPGGFLITSDEGKQLVNHPAPTLPLFDYSALEQWRELQRLSALLLDTPFKAEGIIT
FT                   NITTDANGTRHIALHSEPDIVTLGRYLATSLLLLVLIFCLVVNMVLLIQRAMKNRRRMD
FT                   NIQRYYDDCFNQTLTPPPFLR"
FT   gene            156712..157257
FT                   /locus_tag="YPD4_0124"
FT   CDS_pept        156712..157257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0124"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57033"
FT                   /protein_id="ACY57033.1"
FT                   /translation="MKHLQKPKILKIETVACSRLFNVEAVELEFSNGVQRIYERMRPSN
FT                   REAVMIVPVIGNDLLLIREYAVGIEEYELGFPKGLIDPGEGVLEAANRELMEEVGYGAE
FT                   RFDFLAKLTMAPSYFSSKMNIVIAHGLYPQSLEGDEPEPLPQVRWPIANMMALLNEADF
FT                   REARNVSALFLAHTFLNQ"
FT   gene            complement(157393..159948)
FT                   /gene="mrcA"
FT                   /locus_tag="YPD4_0125"
FT   CDS_pept        complement(157393..159948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrcA"
FT                   /locus_tag="YPD4_0125"
FT                   /product="penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57034"
FT                   /protein_id="ACY57034.1"
FT                   /translation="MKFVKYFLILAVCCILLGAASIFGLYKYIEPQLPDVATLKDIRLQ
FT                   TPMQVYSAEGELIAQFGEKRRIPLTLNQIPPEMVHAFIATEDSRFYDHHGVDPVGILRA
FT                   VSIAMLSGRASQGASTITQQLARNFFLSPERTLMRKIKEAFLAIRIEQMLTKDEILELY
FT                   LNKIYLGYRAYGVGAAAQVYFGKEVHELTLSQIAMIAGLPKAPSTFNPLYSHDRAVARR
FT                   NVVLLRMLDEKYITQAQYDQARSEELVANYHVPQIAFSAPYLAEMVRQEMIKRYGENAY
FT                   TDGYQVYTTITRKLQLAAVDSLRANVLAYDMRHGYRGPSNVLWKVGESAWSREQIIDSL
FT                   KALPVYGPLLPAVVTEADAAQATAMLADGSNVTLPMVGIRWARPFKSDNAQGPVPKKAT
FT                   DVVQPGQQIWVRKVDDNWWLAQVPDVNSALVSIDPNNGAIKALVGGFDFNQSKFNRATQ
FT                   ALRQVGSNIKPFLYTAAMDKGLTLATILNDLPITRWDSGAGTDWRPKNSPPTYDGPIRL
FT                   RQGLGQSKNVVMVRAMRAMGVDYAAEYLQRFGFPAQNIVHSESLALGSASFTPLQLVRG
FT                   YAVLANGGYLVDPYFITKITDDVGNVLFETKPKVVCDNCNLPVIYGDTQRSVVLSDDNI
FT                   ENVATSQNQNASNVPMPELEQVTPAQTTLNSEQQYAPHVISTPLAFLMRDALNSNIFGE
FT                   PGWMGTGWRAGRDLKRKDIGGKTGTTNSSKDAWFSGYGPDTVTSVWIGFDDHRRNLGRS
FT                   TASGAIPDQISGAEGGAKTAQPAWNDFMKVALEGLPEKQVPPPPGIVSVVIDKQTGKLS
FT                   NGGPGSRSEYFIDGTQPTEHTVHEVGTTLMDNGQTHELF"
FT   gene            160068..160964
FT                   /locus_tag="YPD4_0126"
FT   CDS_pept        160068..160964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0126"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57035"
FT                   /protein_id="ACY57035.1"
FT                   /translation="MYSQYWQVGLDIQMEAIRALAVIRRRNGWQLRYWWHKILPSGVLR
FT                   EGILHQPDILSEQLKLLRKQLPRHISLRIALPAQRILQHTIHVPDRRLREPERDGFIKA
FT                   SASRLFPVNSQALALDYCRETVASSELLITAARQSEVQQWQACLEQAGLSSQVIDIAPC
FT                   ALRYMATATGLSGPYWLVHRLANEWLWVSSSDMPFHSGVVAIETECRTQENDIRLLSAL
FT                   LAQLNMRGAGEDGAPLPVYYSSVVKESLPENTRSWSPLTAFAHYQPPLPALPAAFTLAG
FT                   GLAVRAADSLSAAGAGY"
FT   gene            160964..161569
FT                   /locus_tag="YPD4_0127"
FT   CDS_pept        160964..161569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0127"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57036"
FT                   /protein_id="ACY57036.1"
FT                   /translation="MYQVNFLPWRIARQQARYRFWRNTMLIQGIGLALYLVVVLMQARS
FT                   EHKHRQGTAAALSQQQAALSQRQQQVQQAMAQLQRIKQHIQRYHQAHQPARGYSILLQQ
FT                   LSQQIPERCWLMALRQQGDVLSFEVISRDYATINAFLAMLGRQPLLVNVSLQGITQQDE
FT                   GGFRFVVHASWRDENHHVEGHHAEGHDIDGHHVAGDYE"
FT   gene            161562..162143
FT                   /locus_tag="YPD4_0128"
FT   CDS_pept        161562..162143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0128"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57037"
FT                   /protein_id="ACY57037.1"
FT                   /translation="MNKSLQRCMDRPGWQLCLWQWFFLSLLGVIAYGGLLRPTWQQRSE
FT                   AIAEVTKLQQHVEQQVSALAQLPSQVLIRQQINTLLSEKAWWQKPEILLAHQVGETIMP
FT                   FGGQVIRWQRYSGSEEAVVENAIAFRRWEATLRVSFYGLYHLFGQLSEIRSPVLVKVIS
FT                   LIGDGNALTVKLILTEYLTDDLGDFDVQDK"
FT   gene            complement(162540..162929)
FT                   /locus_tag="YPD4_0129"
FT   CDS_pept        complement(162540..162929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0129"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57038"
FT                   /protein_id="ACY57038.1"
FT                   /translation="MTGPPLRVRGNEALLDEALFGEILLDETLFDKTLFDEVLFDEALF
FT                   DNLLSDKWLLEERLCDGTPMSKRHPINKLINPLERFKCLFLPGKYTKLKFVRLHHQVLN
FT                   CLPAAGIKIVISLLPFNADHHQTIH"
FT   gene            162964..163506
FT                   /locus_tag="YPD4_0130"
FT   CDS_pept        162964..163506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0130"
FT                   /product="putative membrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57039"
FT                   /protein_id="ACY57039.1"
FT                   /translation="MQALADYRQLNLITTTGVGGNLSLRLIEVPWEQALAIILRMGRLK
FT                   AEREGTVMMVFTEQEIQERQQRTKQQAAPEALANLTLALQYANAEQVADSLDPLQGGLL
FT                   SPLGSVVADKRTNTLLIRDTPASLALLKNWLIEMDLPLQQVQLSAHIVTISSEDLQELG
FT                   VRWGMGEGKGYYRAQNQ"
FT   gene            163559..163873
FT                   /locus_tag="YPD4_0131"
FT   CDS_pept        163559..163873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0131"
FT                   /product="putative membrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57040"
FT                   /protein_id="ACY57040.1"
FT                   /translation="MARIGGRLLELELSALEQENQVDIIASPRLITSHQQTASIKQGSD
FT                   IPYTVSRGKKEAAAIEFKEAVLGMEVTPKILRNGKIILDLKISQNMPGITIKRGESEMC
FT                   "
FT   gene            164437..164958
FT                   /gene="aroK"
FT                   /locus_tag="YPD4_0132"
FT   CDS_pept        164437..164958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroK"
FT                   /locus_tag="YPD4_0132"
FT                   /product="shikimate kinase I"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57041"
FT                   /protein_id="ACY57041.1"
FT                   /translation="MAEKRNIFLVGPMGAGKSTIGRQLAQQLNMEFFDSDQEIERRTGA
FT                   DVGWVFDVEGEEGFRDREEKVINELTEKQGIVLATGGGSVKSRETRNRLSARGVVVYLE
FT                   TTIEKQLARTQRDKKRPLLQVDEPPREVLEALAKERNPLYEEIADVTIRTDDQSAKVVA
FT                   NQIINMLESN"
FT   gene            165015..166103
FT                   /gene="aroB"
FT                   /locus_tag="YPD4_0133"
FT   CDS_pept        165015..166103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroB"
FT                   /locus_tag="YPD4_0133"
FT                   /product="3-dehydroquinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57042"
FT                   /protein_id="ACY57042.1"
FT                   /translation="MEKITVTLGERSYPITIAAGLFNDPASFKPLKAGDQVMLVTNQTL
FT                   APLYLDSLRAVLEHGGIKVDQVILPDGEQYKSLSVMEQVFSALLEKPHGRDTTLVALGG
FT                   GVVGDLTGFAAACYQRGVRFIQVPTTLLSQVDSSVGGKTAVNHPLGKNMIGAFYQPASV
FT                   VVDLNCLKTLPPRELASGLAEVIKYGIILDAAFFDWLENNIDALLALDMSALAYCIRRC
FT                   CELKADVVAADEREESGARALLNLGHTYGHAIEAEMGYGVWLHGEAVAAGMVMAAQTSR
FT                   RLGQLSVSDVERIKKLLLRAGLPVCGPKEMAPESYLPHMMRDKKVLAGELRLVLPTAIG
FT                   KSEIRGGVAHDMVLASIADCRP"
FT   gene            166357..167346
FT                   /locus_tag="YPD4_0134"
FT   CDS_pept        166357..167346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0134"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57043"
FT                   /protein_id="ACY57043.1"
FT                   /translation="MDDLKLDDDLKPDSSDRRPTRSRKSPTGPKLAVSRQHMMIGIGIL
FT                   VLLLIIIAIGSALKAPTEHEASQQNPNVNAARDINLSDSSSLTSGNNSQPSIANNTSDG
FT                   HDASGVKNTAPPQDISAPPISPTPTEAAIPPSANSTTQRIELPGNMSDALSQTQGQVDT
FT                   LSQNISDAHTSTLPTAAATVAPSKGAKVPATRETITQPVQKQATKQPAVNHKNTATVAV
FT                   PPATSGTPKSGAASSRALSSAPSSHYTLQLSSASRSDTLNAYAKQQNLTDYHVYETKRD
FT                   GKPWYILVSGNYASSAEAKKAITTLPADVQAKKPWVKPVQQVQQDLKK"
FT   gene            167520..168245
FT                   /locus_tag="YPD4_0135"
FT   CDS_pept        167520..168245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0135"
FT                   /product="DNA adenine methylase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57044"
FT                   /protein_id="ACY57044.1"
FT                   /translation="MIEPFVGAGSVFLNTEFESYILADINNDLINLYNIVKLRTDDFVR
FT                   DARVLFTGDFNHSELFYQLRQEFNASTDAYRRALLFLYLNRHCYNGLCRYNLSGEFNVP
FT                   FGRYKKPYFPEAELYWFAEKSQNAVFVCEHYQETLLKAVQGAVVYCDPPYAPLSATANF
FT                   TAYHTNNFGIADQQNLARLAYQLSTESKVPVLISNHDTELTRNWYHQAASLHVVTARRT
FT                   ISRNILGRSKVNELLALYS"
FT   gene            168548..169225
FT                   /gene="rpe"
FT                   /locus_tag="YPD4_0136"
FT   CDS_pept        168548..169225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpe"
FT                   /locus_tag="YPD4_0136"
FT                   /product="ribulose-phosphate 3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57045"
FT                   /protein_id="ACY57045.1"
FT                   /translation="MKKYLIAPSILSADFARLGEDTAKVLAAGADIVHFDVMDNHYVPN
FT                   LTIGPMVCKALRDYGITAPIDVHLMVKPVDRIVPDFAKAGATYITFHPEASEHVDRTLQ
FT                   LIKESGCKAGLVFNPATPLSYLDYVMDKLDVILLMSVNPGFGGQSFIPETLNKLRQVRK
FT                   LIDDSGYDIRLEVDGGVKVENIRQIAAAGADMFVAGSAIFNQPDYAAVIDAMRNELAMA
FT                   ANG"
FT   gene            169218..169916
FT                   /gene="gph"
FT                   /locus_tag="YPD4_0137"
FT   CDS_pept        169218..169916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gph"
FT                   /locus_tag="YPD4_0137"
FT                   /product="phosphoglycolate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57046"
FT                   /protein_id="ACY57046.1"
FT                   /translation="MVKFKAIRGVAFDLDGTLVDSAPGLARAIDMALAHQGLPAAGEAL
FT                   VSTWIGNGADVLVERALHWAGREHNAQLVAQTRELFDHYYAKTVEQGSQLFPQVKATLA
FT                   QLAANGLPIGLITNKPTPFVAPLLTSLGISDYFSVIIGGDDVVVKKPHPAPLYLLLGKL
FT                   GLHAREMLFVGDSRNDIMAAQAAGCPCIGLTYGYNYGEAIATSHPDCVLAHFADLLPAI
FT                   GLPSLKDQEV"
FT   gene            169918..170958
FT                   /gene="trpS"
FT                   /locus_tag="YPD4_0138"
FT   CDS_pept        169918..170958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpS"
FT                   /locus_tag="YPD4_0138"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57047"
FT                   /protein_id="ACY57047.1"
FT                   /translation="MSEPMVLSKPTVSSKPIVFSGAQPSGELTIGNYMGALRQWVQMQD
FT                   DYDCIYCIVDLHAITARQDPALLRKRTLDTLALYLACGIDPKKSTIFVQSHVPEHSQLS
FT                   WALNCYTYFGELSRMTQFKDKSARYAENINAGLFDYPVLMAADILLYQTNQVPVGEDQK
FT                   QHLELSRDIASRFNNLYGDIFKIPEPFIPKAGARVMSLQDPTKKMSKSDDNRNNVIELL
FT                   EDPKSVVKKIKRAMTDSDEPALIRYDVEKKAGVSNLLDILSGVTGQSIPELEAQFTGQM
FT                   YGHLKGAVADAVSGMLSELQERYRTYREDEALLQDVMREGAAKARARAQVTLAKVYEAI
FT                   GFVAQP"
FT   gene            complement(171113..172525)
FT                   /gene="cysG"
FT                   /locus_tag="YPD4_0139"
FT   CDS_pept        complement(171113..172525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysG"
FT                   /locus_tag="YPD4_0139"
FT                   /product="siroheme synthase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57048"
FT                   /protein_id="ACY57048.1"
FT                   /translation="MDYFPIFCQLQHKACLLVGGGEIAERKARLLLDAGALVTVNACEF
FT                   TPQFHHWADQGQLSLISGEFVPELLADKWLVIAATDQLSVNALVYQSANQQRIFCNVVD
FT                   DPKRTSFIMPSIIDRSPIMIAVSSGGKAPVLARLLREKLEALLPQHLGQLAGNLRQRVK
FT                   QHFTVMTERRRFWEKLLTHDRLAQSLANNDHVQADQHVEQLFSAPLTDRGEVVLVGAGP
FT                   GDAGLLTLKGLQQIQQADVVVYDRLVSDEVMNLVRRDAERIFVGKQSGHHCVPQEQINQ
FT                   ILLQQAQSGKRVVRLKGGDPFIFGRGGEELEELAGYGIPFSVVPGITAASGCSAYSGIP
FT                   LTHRDHAQSVRLVTGHAKKEGQLDWANLAAEKQTLVFYMGLSQAGEIQQQLIQHGMPAT
FT                   TQVALVENGTSRHQRVVSGELSQLALLSQQVSSPSLIIVGSVVSLREKLNWFSSRHHDD
FT                   QPKVTECVAHVG"
FT   gene            complement(172613..173419)
FT                   /gene="nirC"
FT                   /locus_tag="YPD4_0140"
FT   CDS_pept        complement(172613..173419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirC"
FT                   /locus_tag="YPD4_0140"
FT                   /product="putative nitrite transporter"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57049"
FT                   /protein_id="ACY57049.1"
FT                   /translation="MYTDTINKCAANAARIVKLAKESPLGFWIGSAMAGAYVGLGIILI
FT                   FTLGNLIDPALRPLVMGATFGLALTLVIIAGSELFTGHTMFLTFGVKAGTIKSSQMWAV
FT                   LPQTWLGNLLGSVFVALLYYYGGGNLLSVDTSLVHTAALAKTTAPAMTLFFKGVLCNWL
FT                   VCLAIWMAIRVEGAAKFIAIWWCLLAFIASGYEHSVANMTLLALSWFGHHSEAYTLSGI
FT                   GHNLLWVTLGNTLSGAVFMGLGYWYATPRAQRPQPATINAPHSAKS"
FT   gene            complement(173622..173948)
FT                   /gene="nirD"
FT                   /locus_tag="YPD4_0141"
FT   CDS_pept        complement(173622..173948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirD"
FT                   /locus_tag="YPD4_0141"
FT                   /product="nitrite reductase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57050"
FT                   /protein_id="ACY57050.1"
FT                   /translation="MSQWIPLCPLNDILPGSGVCGLIKQQQVAVFRPYADEQVFAISNI
FT                   DPFAQASVLSRGLIAEHQGELWVASPLKKQHFRLRDGFCLEDEDRSVTHYDVRVRDGMV
FT                   QVNA"
FT   gene            complement(173945..176491)
FT                   /gene="nirB"
FT                   /locus_tag="YPD4_0142"
FT   CDS_pept        complement(173945..176491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirB"
FT                   /locus_tag="YPD4_0142"
FT                   /product="nitrite reductase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57051"
FT                   /protein_id="ACY57051.1"
FT                   /translation="MSKIKIAIIGNGMVGHRFIEDLLDKADKDQFDITVFCEEPRIAYD
FT                   RVHLSSYFSHHTAEELSLVREGFYEKQGVKVLVGERAITINRAEKVIHSNSGRSLYYDK
FT                   LVMATGSYPWIPPIKGSEGQDCFVYRTIEDLNAIEACTRRSKRGAVIGGGLLGLEAAGA
FT                   LKSLGVETHVIEFAPVLMAEQLDPMGGDQLRQKIERMGVRVHTGKNTQEIVHSGQNSRK
FT                   TMLFADGTQLEVDFIVFSTGIRPQDKLANQCGLATARRGGIAINDYCQTSDPDVYAIGE
FT                   CASWQERTFGLVAPGYKMAQVAADHLLGRENAFLGADMSAKLKLLGVDVGGIGDAHGRT
FT                   EGARSYVYLDESKEIYKRLVVSADNKTLLGAVLVGDTTDYGNLLQLALNNITLPENPDS
FT                   LILPAHAGNKPTIGVDSLPDSAQICSCFDVTKGDIIRAIGQGCQTVAALKSATKAGTGC
FT                   GGCIPLVTQVLNAELSKQGIEVNNHLCEHFAYSRQELYHLIRVEGIKTFTELREKYGKG
FT                   YGCEVCKPTVGSLLASCWNEYVLEPQHTPLQDTNDNFLGNIQKDGTYSIIPRSPGGEIT
FT                   PDGLLVVGQIAKEYNLYTKLTGSQRIGMFGAQKDDLPAIWARLIDAGFETGHAYAKALR
FT                   MAKTCVGSTWCRFGVGDSVGFGVALEHRYKGIRAPHKIKFGISGCTRECAEAQGKDVGI
FT                   IATENGWNLYVCGNGGMKPRHADLLAADLDEETLMRYLDRFMMFYIRTADKLQRTSVWL
FT                   ESLEGGIRYLQLVILEDKLGINDQLEAEIARLRDKVACEWKATVENPAAQVRFAHFINS
FT                   SLRDPNVQVVREREQHRPARPDERIPVRVLELEDNA"
FT   gene            176801..178111
FT                   /gene="codA"
FT                   /locus_tag="YPD4_0143"
FT   CDS_pept        176801..178111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="codA"
FT                   /locus_tag="YPD4_0143"
FT                   /product="cytosine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57052"
FT                   /protein_id="ACY57052.1"
FT                   /translation="MEALMAGQSVPNYSLTTVNNVRRIGLAGLWQITIAEGKISLIQPQ
FT                   PEQSLTGQGVLDAQGGLALPPFIEPHIHLDTTQTAGQPSWNQSGTLFEGIERWAERKAR
FT                   LTREDVKQRAWQTLKWQIANGIQHVRTHVDVSDPHLTALSAMLEVKEEVSPWVDMQIVA
FT                   FPQEGILSYPDGAALLEEALRLGADAVGAIPHFEFTREYGVESLHIAFALAQKYQRLVD
FT                   VHCDETDDEQSRFIETVAALALRENMGARVTASHTTAMHSYNGAYTSRLFRLLKLSGIN
FT                   FVANPLVNIHLQGRFDTYPKRRGITRVKEMLAAEINVCFGHDDVFDPWYPLGTANMLQV
FT                   LHMGLHICQLMGYEQINDGLNLITTHSAKTLNLADYGLQPGNRANLIILPAENGFDALR
FT                   RQVPVSYSIRHGVVIAKTQPAESRIYLGQEEIVDFRR"
FT   gene            complement(178196..179338)
FT                   /gene="tsgA"
FT                   /locus_tag="YPD4_0144"
FT   CDS_pept        complement(178196..179338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsgA"
FT                   /locus_tag="YPD4_0144"
FT                   /product="major facilitator family transporter TsgA"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57053"
FT                   /protein_id="ACY57053.1"
FT                   /translation="MSYALTGALVIVTGIVMGNIAEYFNLPIASMSNTFTFLNAGILIS
FT                   IFLNAWLMEIIPLKRQLVFGFILMLIAIAGLMVGHNLMIFSISMFIFGVVSGITMSIGT
FT                   FLVTHMYEGRQRGSRLLFTDSFFSMAGMIFPIAAAMLLARHIEWYWVYACIGLLYVGIF
FT                   VLTLCSEFPVLGHKATDQSKPVVKEKWGVGVLFLAIAALCYILGQLGFIQWVPEYATKT
FT                   FNMNISQAGQLVSNFWISYMIGMWIFSFILRFFDLQRIVTVLAAMATLAMYLFVSTDNP
FT                   AYLSYYILALGFVSSAIYTTLITLGSLQTKVSSPKLVNFILTCGTVGTMLTFVVTGPIV
FT                   ANNGVHAALETANGLYLAVFILCLALGFFTKHRSHGHVTH"
FT   gene            179866..181926
FT                   /locus_tag="YPD4_0145"
FT   CDS_pept        179866..181926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0145"
FT                   /product="putative membrane receptor protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57054"
FT                   /protein_id="ACY57054.1"
FT                   /translation="MISGKNKVCKKKLLACAVTSAISAFASNAIASNAIADTTSLAAMN
FT                   RSAINISSTHNSNKKLNDADVITVTAPLYSPLVVVTSPKVPRQPVPASDGTDYLRTIPG
FT                   FSLVRNGGTNGDVVFRGMFGSRLKILTDGAEILGTCPSRMDAPTSYISPESFDLLTVVK
FT                   GPQSVLWGPGVSAGTILFERERPHFDQSGVKGNASVLAGSNGRWDKNLDASLGNEQGYL
FT                   RMMGNQSRAADYKDGNNVRVPSQWDKWNADMALGWTPDTDTLLELSVGKGNGEARYGGR
FT                   GMDGSQFLRESLAARVEKSNIGEVLDKIEAKINYTYVDHIMDNKTLRTPPMMAMSSNLD
FT                   RRMLGGRVMGTWLWQDLKLDAGTDMQTNTHRKNKQGNWDKNARFMNNGVFGELTWAASE
FT                   QNKLISGARLDRHQVTNYTRAGEPTRSATLPAAFMRVEHNLANAPVMLYAGLGHTERFP
FT                   DYWELFSPKFGPAGSTSAFEGVKSEKTTQIDIGGQYSGEQFRGWLSAYIGRVNDFILFK
FT                   YDPKNLRISQADNINATIMGGEMGMEYALTPYWKADASLAYAWGENTRDNRPLPQIPPL
FT                   EARLGLTFEAGDWSSSALWRLVNSQHRVAINEGNVVGKDFSSSAGFGVLSANVAYKVNK
FT                   QVKLSSGIDNLLNKAYSEHLNLAGNSGFGYSVNTPLNEPGRTLWAKLNLTF"
FT   gene            complement(182027..183013)
FT                   /locus_tag="YPD4_0146"
FT   CDS_pept        complement(182027..183013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0146"
FT                   /product="LacI-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57055"
FT                   /protein_id="ACY57055.1"
FT                   /translation="MVTLEDVAVLAGVSRATVSRVVNGDTNVKALTREKVEQAVAVLGY
FT                   TPHPAARALASSQSNTLGLVTTSYRGGFFGALMDFVQTETESQGKQLLVTQGRDNADKE
FT                   WLAIQRLYNLRCDGLILHVRFLSDERLRQLAAANRPFVLLDRLVPDLEARCVTFDHHHA
FT                   SQMATQVLIDAGHRDIACISGSSQRQSSVLRIQGFLDAMQLAGLEPVACLEGVYDLESG
FT                   YLRADEILKQPRLPTAIYCCNEEMAIGALLAINKHGLQVPQDISLICYDSGERAPFVCP
FT                   ALTSVHFPIVEMAQYATQLLIDPLIPAVNFPPAIIMRDSVMPPKTAC"
FT   gene            complement(183262..184575)
FT                   /locus_tag="YPD4_0147"
FT   CDS_pept        complement(183262..184575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0147"
FT                   /product="putative glycosyl hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57056"
FT                   /protein_id="ACY57056.1"
FT                   /translation="MSTFKITIIGGGSSYTPELVDGLIQRIEQLPVTELALVDVEQGRQ
FT                   KVEIIAALTQRMLARHGLEQVKVSVHYSLDEAIRGARFVLTQFRVGQLPARAADERLGL
FT                   KYNLLGQETTGIGGFAKALRTIPVMLDIAANVERLAPDAWIINFTNPAGIVTEAVSRYT
FT                   KAKIIGLCNVPISMHHMIAKLLQAPYEDLQLRFAGLNHMVWVHEVLQRGKYVTADVLKM
FT                   LCDGASLSMNNIKEAPWPPEFLQAMGAIPCPYHRYFYQTQDMLAEEMAAAAERGTRAEQ
FT                   VMQVEKELFALYADPHLDTKPEQLSFRGGSFYSEVALELIRAIHNNLGTQLVVNTTNRG
FT                   AIRGLSDDSVVETNCIIDAKGAHPLTFGPLPVSMHGLTQQVKAYERLTIDAAVHGDRRS
FT                   ALLALVTNPLIANASIAQPLLEEVLQVNKPYLPQFSGL"
FT   gene            185091..185660
FT                   /gene="ppiA"
FT                   /locus_tag="YPD4_0148"
FT   CDS_pept        185091..185660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppiA"
FT                   /locus_tag="YPD4_0148"
FT                   /product="peptidyl-prolyl cis-trans isomerase A"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57057"
FT                   /protein_id="ACY57057.1"
FT                   /translation="MFKRTLVTFIALCSLSAVAPAALAAGEPHVLLTTSAGNIELELNS
FT                   QKAPISTQNFVDYVNNGYYNNTIFHRVIPGFMIQGGGFTADFKEKTPKTPIKNEADNGL
FT                   RNLRGTISMARTADKDSATSQFFLNVADNAFLDHGQRDFGYAVFGKVVKGMDVVEKISQ
FT                   VQTENVGPYQNVPVKPITILSAKVLP"
FT   gene            185986..187527
FT                   /locus_tag="YPD4_0149"
FT   CDS_pept        185986..187527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0149"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57058"
FT                   /protein_id="ACY57058.1"
FT                   /translation="MSNTLLIGKALVTEKTQPASRDLVILSALANRHGLITGATGTGKT
FT                   VTLQKMAEQFSRIGVPVFLADVKGDLSGIGAEGVNSEKLQARLAAIDVTDWQPQACPIV
FT                   PWDIFAEKGHPIRATISDLGPLLLGRLLDLNDVQSGVLQLVFKIADDNGLLLLDMKDLR
FT                   AIVQYVGDNAKQFRTQYGNITSASIGAIQRGLLTLEEQGANQFFGEPMLDIHDLMQTDS
FT                   HGQGVINLLAADRLINQPKLYAIFLLWLLAELFEQLPEVGDVEKPKLVFFFDEAHLLFT
FT                   DAPAALVDKVEQVVRLIRSKGVGIYFVTQNPLDIPDKILGQLGNRVQHALRAFTPRDQK
FT                   AVKAAAQTMRPNPAFSAEQVITELGVGEALISFLDEKGRPNVVERAMVIAPQSKMGALD
FT                   AAARNHAINHSPLYGRYEEMIDRESAYEKLSAGGFSTMGRAAEGEPSVPQQPTNQQGSG
FT                   GGLMGGLNDLLFGSSGPRGGKRDGIVQTAAKSMARDLGRQILRGVLGSITGGRKR"
FT   gene            187770..188345
FT                   /gene="pabA"
FT                   /locus_tag="YPD4_0150"
FT   CDS_pept        187770..188345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabA"
FT                   /locus_tag="YPD4_0150"
FT                   /product="para-aminobenzoate synthase component II"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57059"
FT                   /protein_id="ACY57059.1"
FT                   /translation="MLLLIDNYDSFTYNLYQYFCELGTEVMVKRNDELQLTDIEQLAPS
FT                   HVVISPGPCTPNEAGISLAVIRHFADKLPILGVCLGHQALGQAFGARVVRARQVMHGKT
FT                   SAICHSGQGVFRGLNQPLTVTRYHSLVIATDSLPGRFELTAWTERGGEMDEIMGIRHRT
FT                   LPLEGVQFHPESILSEQGHQLLDNFLKN"
FT   gene            188478..189695
FT                   /locus_tag="YPD4_0151"
FT   CDS_pept        188478..189695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0151"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57060"
FT                   /protein_id="ACY57060.1"
FT                   /translation="MTDKLAVNRNTFDQVILPVYAPAQFIPVKGKGSRVWDQQGTEYID
FT                   FAGGIAVTALGHCHPALVSALHQQGETLWHTSNVFTNEPALRLAQKLIAATFADRVFFA
FT                   NSGAEANEAAFKLARHYAIERHSPYKTKIIAFHNAFHGRTLFTVSVGGQPKYSDGFGPK
FT                   PADIIHVPFNDLAAVKAVMDDHTCAVVLEPIQGEGGITSATPEFLQGVRALCDQHNALL
FT                   VFDEVQSGMGRSGKLFSYMHYGVTPDILTTAKALGGGFPISAMLTTEEIASVMTVGTHG
FT                   TTYGGNPLACAVAEAALDVINTPEVLNGIEQRHGLFVQALQSINSKYDVFSDIRGMGLL
FT                   IGAELTAKYRGQAREFLAAAAANGLMILNAGPDVLRLAPSLVIELEDIQQGMARLEKAM
FT                   ASVIKG"
FT   gene            complement(189921..192041)
FT                   /locus_tag="YPD4_0152"
FT   CDS_pept        complement(189921..192041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0152"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57061"
FT                   /protein_id="ACY57061.1"
FT                   /translation="MKWQRLIYHPEVNYALRQTLVLCLPAALGFAIGDLRLGLMFSLIP
FT                   ACCNIASLDTPHQHFFRRLIIGGVLFTLSSFLTQQLLLWHIPLPVIMLGLALIVGVSGT
FT                   ISPLNGRLLPAALIAAIFSLSMVGRAPIWQAPLLCAVGTLWYGVFNWLWFRLCKDQPIR
FT                   EPLSQLYHLLADYCDAKYSRLTQHLEPEKAIPPLLDRQQGMMDKVNQLYQQFNLLHNTT
FT                   KKEQKRLLGLFQMALDLQEHITAALNQPEEMQDLIKKTPIEAVTQSNAQIISAQMRAIA
FT                   DDILYHRRTVEHFTAGVPLAELETIAQQNPDNPVAQFCYYHISHITQILSDRRPLYNRD
FT                   LMSSQLSQPFWPALVSYLSFKSSALRDAARIGVTLAVGSYIGVLINLPKPYWILLTIML
FT                   VMQNGYNATRVRIHHRALGTLVGLILAAGLLHLQMTEITTLGIMLLITLLSYLVQRKNY
FT                   GLAVVGRTITAVYILQLLTGEGANFLVPRLLDTLIGCALALGSALWLWPQWQSGLLRKN
FT                   AHQALEAYQTILRLLLTPHPDITQLDYERFNVNKASNTVLSSLNQAMQEPGFNSKYLAD
FT                   MRLWATHSELIVCHINEMTTLIRENPLTEVDSPSTGGHTLMSTKLAASYLQLCEMAIQL
FT                   CQQRLESDNLEDNDSVVQIPDMAPDTQASELERNLRRVLSHLNVMHTVSAMAWQQQPHH
FT                   GIWRSRKLRDNT"
FT   gene            complement(192127..192759)
FT                   /gene="crp"
FT                   /locus_tag="YPD4_0153"
FT   CDS_pept        complement(192127..192759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crp"
FT                   /locus_tag="YPD4_0153"
FT                   /product="cAMP-regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57062"
FT                   /protein_id="ACY57062.1"
FT                   /translation="MVLGKPQTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVK
FT                   GSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFR
FT                   QLIQVNPDILMRLSSQMANRLQITSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDG
FT                   MQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGTR"
FT   gene            193095..193502
FT                   /locus_tag="YPD4_0154"
FT   CDS_pept        193095..193502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0154"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57063"
FT                   /protein_id="ACY57063.1"
FT                   /translation="MQARVKWVEGLTFLGESASGHQVLMDGNSGDKAPSPMEMLLMSAG
FT                   GCSAIDVVSILQKGRNNVRDCEVKLTSERREEAPRLFTQINLHFIVSGKGLTDKVVERA
FT                   VDLSAEKYCSVALMLGKAATITHSFEVREVA"
FT   gene            193607..194005
FT                   /locus_tag="YPD4_0155"
FT   CDS_pept        193607..194005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57064"
FT                   /protein_id="ACY57064.1"
FT                   /translation="MANKNKISVACGAISLFVVASFSLFFSLTHYFNFFKMNDEVHFSW
FT                   AVSLLLSGSPLLFYLSVVSGGYIIGYEKIYNDRVGKILAYIAVLGMVFSLFFSFYVDSS
FT                   LKEAGYLKCERKSFIAPNKYVIDLKLCR"
FT   gene            complement(194183..195052)
FT                   /gene="prk"
FT                   /locus_tag="YPD4_0156"
FT   CDS_pept        complement(194183..195052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prk"
FT                   /locus_tag="YPD4_0156"
FT                   /product="phosphoribulokinase 1"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57065"
FT                   /protein_id="ACY57065.1"
FT                   /translation="MSTKHPVIAVTGSSGAGTTTTSLAFRKIFQQLDIRAAQIEGDSFH
FT                   RYTRPEMDAAIRKARDQGRHISYFGPEANDFGQLEQSVAEYSKHGTGRSRKYLHTYDEA
FT                   VPYNQIPGTFTPWEPLPEPTDVLFYEGLHGGVVTEHHDVAKHVDLLVGVVPIVNLEWIQ
FT                   KLVRDTGERGHSREAVMDSVVRSMDDYINYITPQFSRTHINFQRVPTVDTSNPFAAKAI
FT                   PSLDESFVVIHFRGLDHIDFPYLLAMLQGSFISNINTLVVPGGKMGLAMELIMAPLVQQ
FT                   LLEGKQIA"
FT   gene            complement(195434..196414)
FT                   /locus_tag="YPD4_0157"
FT   CDS_pept        complement(195434..196414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0157"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57066"
FT                   /protein_id="ACY57066.1"
FT                   /translation="MHETFRPLAGASNPHLQTLLPRLVRRHVQLSPYWQRLELPDGDFI
FT                   DLAWSENPELAREKPRVVLFHGLEGNFYSPYAHGLLRAWQAAGWLGVVMHFRGCSGEPN
FT                   RKSRIYHSGETEDANFFLHWLQETYGQVPTAAVGISLGGNMLACYLAKKGKNSGLRAAV
FT                   VVSAPLMLEPCADRMDQGFSRVYQRYLLNQLKLNATRKLLQYPNSLPVNLFQLKKLRRV
FT                   RDFDDAITAKIHGFNDAGDYYRRCSALPLLPQIRVPLLIIHAKDDPFMTAEVIPNIETL
FT                   PDNIDYQLTEHGGHVGFVGGSLKHPQMWLEQRIPAWLSPYLEQQS"
FT   gene            196516..197118
FT                   /locus_tag="YPD4_0158"
FT   CDS_pept        196516..197118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0158"
FT                   /product="putative ABC-transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57067"
FT                   /protein_id="ACY57067.1"
FT                   /translation="MELSLFLSMVGFLWVAAITPGPNNMLLTSTGANFGFMRSIWLMLG
FT                   IMLGMQSMLLLVAFGVGSLILIYPSLHLALKILGSLYLLWLAWKIATSAYEKLDTNVAP
FT                   AKPLRLYQGWLLQFLNPKAWLMGLGSVASFSMAGAAYNHSILMISLGMFMVNLVAGIIW
FT                   LGFGTLIGRLLGSRRAWFTFNISMGLLTAACVLLIWH"
FT   gene            197321..198382
FT                   /gene="tauA"
FT                   /locus_tag="YPD4_0159"
FT   CDS_pept        197321..198382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauA"
FT                   /locus_tag="YPD4_0159"
FT                   /product="putative taurine-binding periplasmic protein
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57068"
FT                   /protein_id="ACY57068.1"
FT                   /translation="MAITFSSATLAASRRSFLQLRTILLASLLPASLLLATSAQAVDVI
FT                   VAYQTSAEPAKVAQADNSFAKLSGANADWRKFDSGSSVVRALASGDVQIGNIGSSPLAV
FT                   AASQNVPIEVFLLASQLGSSEALVVKKEIKTPQDLIGKRIAVPFISTAHYSLLAALKHW
FT                   GIKPGQVTILNLQPPAIAAAWQRGDIDGAYVWAPAVSELAKTGTVLTDSAQVGQWGAPT
FT                   LDVWVVRKDFAKAHPEVVTAFARSALAAQAAYLNNPEQWLQNQAHLAPLSRLSGVPTEQ
FT                   VPALVKGNTYLPVAEQITQLGQPVDQAIRDTAEFLKQQGKIPQVASDYRDFVTDRFVKE
FT                   IQATPQSQATPQS"
FT   gene            198391..199158
FT                   /gene="tauB"
FT                   /locus_tag="YPD4_0160"
FT   CDS_pept        198391..199158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauB"
FT                   /locus_tag="YPD4_0160"
FT                   /product="putative taurine transport ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57069"
FT                   /protein_id="ACY57069.1"
FT                   /translation="MLNVSGLWAEYQGKPALQDVSLQIASGQLVVVLGPSGCGKTTLLN
FT                   LIAGFMTPSAGVITLDNIPVSGPSAERGVVFQNEGLLPWRDVVSNVEFGLQLAGMSKEQ
FT                   RRVTALKMLNRVGLAGFEHHFIWQLSGGMRQRVGIARALAVDPRLLLLDEPFGALDAFT
FT                   REQMQELLLTIWRDTGKQILLITHDIEEAVFLASELLLLSPGPGQVVERLSLNFGQRYA
FT                   EGEPCRAIKSDPEFIARREDVLGKVFQQREVLI"
FT   gene            199155..200009
FT                   /gene="tauC"
FT                   /locus_tag="YPD4_0161"
FT   CDS_pept        199155..200009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauC"
FT                   /locus_tag="YPD4_0161"
FT                   /product="putative taurine transport system permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57070"
FT                   /protein_id="ACY57070.1"
FT                   /translation="MSLHSTLRNQAINLPAADAPKKTPRRLPANQTLWISIATLASVVA
FT                   LWWAVTALQLIGPLFLPAPQQVLHQLWTIASPQGFMDATLWQHLAASLGRIFVALLAAV
FT                   VLGVPTGIAMGLNSNVRGVLDPLIEIYRPVPPLAYLPLMVIWFGIGETSKILLIYLAIF
FT                   APVTLAAVAGVRSVAHVRVRAARALGASRWQVLWFVVLPSALPEILTGIRIGLGVGWST
FT                   LVAAELIAATRGLGFMVQSAGEFLATDVVIAGISVIAIIAFGMELSLRAIQRRLTPWYG
FT                   EQQ"
FT   gene            200006..200854
FT                   /gene="tauD"
FT                   /locus_tag="YPD4_0162"
FT   CDS_pept        200006..200854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauD"
FT                   /locus_tag="YPD4_0162"
FT                   /product="putative taurine dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57071"
FT                   /protein_id="ACY57071.1"
FT                   /translation="MNERLIVTPLGPHIGALVENINIAHPLGDSQFEQLYHVLLKHQVL
FT                   FFRNQPITPLQQRDLAGRFGDLHIHPVYPHTQECEEIIVLDTADDNPPDNDNWHTDVTF
FT                   IETPPLGAILAAKQLPTTGGDTLWSSGIAAYDALSAPFKQLLAGLQAEHDFTKSFPEHK
FT                   HRTTPEEHQRWLQGKEKNPPLLHPVIRTHPVSGRQALFVNEGFTTRIIGLSDKESEALL
FT                   GFLFAHTTKPEFQVRWRWQQDDVAIWDNRVTQHYANADYLPQRRVMHRATILGDRPVFR
FT                   P"
FT   gene            complement(200867..201847)
FT                   /locus_tag="YPD4_0163"
FT   CDS_pept        complement(200867..201847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0163"
FT                   /product="putative sugar transferase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57072"
FT                   /protein_id="ACY57072.1"
FT                   /translation="MQRILVIRIDFLGDMVCTTALLHALKQRWPAAEIHVLANKYNQSV
FT                   LARNPDVSAVHTYVYSKQCERNQRPGRLMALFDRLALIWRLRRLGFDLLLIPNGGMNKN
FT                   SIQFAKQLNVADRRWHTAETEFDDRNPEHVATRPIRHEALSGFALMPELGRVDIETLKL
FT                   HVYPEPQLQAKWQADLGGKDRPRVGLFISNKSAQRRWSWDKWRQLALKLNAQAELLIFH
FT                   DPAEQPSEQQLAGLTARCLSTPSTDDLMAAMSQLDLVISADSAPVHIGSALQIPVVALF
FT                   ESRPEKYLRWYPLGVRHVLVHAGPQVEDIHVDAVESAARSLLTTD"
FT   gene            complement(201940..202929)
FT                   /locus_tag="YPD4_0164"
FT   CDS_pept        complement(201940..202929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0164"
FT                   /product="putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57073"
FT                   /protein_id="ACY57073.1"
FT                   /translation="MNSVDISVIVPVYNCANYLTDLLDSLRSQTGVSLEIIAVNDGSTD
FT                   HSLALLEQVAHIDSRLVIINQQNQGLSEARNVGIAKAKGNWVAFADGDDWLAPHALSTW
FT                   LQQVKQQKLDVLIGNGYQFSSNPERKPVTPLLGQQPWGATLNGQQWIILSVKQKEWPHY
FT                   AWLQLIRRDVISTHQLQFIRDMLHEDILWTTQLALVAQRIGFCATPFYGYRTNPDSITN
FT                   SPSMQALLRRANSYVDIINALVKIAASTKPPVRDALLSHANQESGHLLGLLRKKLPASP
FT                   QRTALAIRFITLGLRPALFRGVTNLHELWRAIRCSFLMGSYARQKRAE"
FT   gene            complement(203064..204443)
FT                   /locus_tag="YPD4_0165"
FT   CDS_pept        complement(203064..204443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0165"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57074"
FT                   /protein_id="ACY57074.1"
FT                   /translation="MDAVIWLEKWLKSYTGTLVLISHDRDFLDPIIDKILHIEQQTLNE
FT                   YTGNYSSFERQRATKLSQQQSMYQHQQEKVAHLQSYIDRFRAQATKAKQAQSRIKMLER
FT                   MELIAPAHVDNPFHFSFRTPESLPDPLLRMDKVSAGYGENTVLQSIKLNLVPGSRIGLL
FT                   GRNGAGKSTLIKLLAGTLEPQSGEIALSKGIKLGYFAQHQLEFLRADESPLQHMSRLAP
FT                   KESEQQLRDYLGGYGFQGDQVTDPTARFSGGEKARLVLALIIWQRPNLLLLDEPTNHLD
FT                   LDMRQALTEALIDFEGALVVVSHDRHLLRSTTDDLYLVHDGKVEQFDGDLEDYQQWLVD
FT                   SQRQQSQQDNPAKELSGNSAQQRKDQKRRDAEFRTQTQPLRKQIMTLEKQMDKLSTELA
FT                   AIEAQLADSALYDIARKADLTQCLLQQTQVKSKLEETEMQWLDVQEQLEILTKEFSDAD
FT                   I"
FT   gene            complement(204410..204937)
FT                   /locus_tag="YPD4_0166"
FT   CDS_pept        complement(204410..204937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0166"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57075"
FT                   /protein_id="ACY57075.1"
FT                   /translation="MLDNATATINPGQKVGLVGKNGCGKSTLLALLKGELSADGGNVTF
FT                   PNNWALAWVNQETPALDIPAIEYVIDGDREYRQLEAELQAANEKNDGHAIATVHGKLDA
FT                   IHAWTIQSRAASLLHGLGFSQEKLQQPVRSFSGGWRMRLNLAQALVCRSDLLLLDEPTT
FT                   WIWMPSSGWKNG"
FT   gene            205230..205781
FT                   /locus_tag="YPD4_0167"
FT   CDS_pept        205230..205781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0167"
FT                   /product="glutathione-regulated potassium-efflux system
FT                   ancillary protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57076"
FT                   /protein_id="ACY57076.1"
FT                   /translation="MMLQPPKVLLLYAHPESQDSVANRVLLQPVQQLEHVTVHDLYAHY
FT                   PDFFIDIHHEQQLLRDHQVIVFQHPLYTYSCPALLKEWLDRVLARGFANGVGGHALTGK
FT                   HWRSVITTGEQEGTYRIGGYNRYPMEDILRPFELTAAMCHMHWINPMIIYWARRQKPET
FT                   LASHAQAYVQWLQSPLTRGL"
FT   gene            205818..207593
FT                   /locus_tag="YPD4_0168"
FT   CDS_pept        205818..207593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0168"
FT                   /product="potassium-efflux system protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57077"
FT                   /protein_id="ACY57077.1"
FT                   /translation="MFLFAAVVAVPIAQRLGIGAVLGYLIAGIAIGPWGLGFIRDVDEI
FT                   LHFSELGVVFLMFIIGLELNPAKLWQLRRSIFGVGAGQVVITAAVLGALLYFTQFAWQA
FT                   AVIGGVGLAMSSTAMALQLMREKGMNRNEGGQLGFSVLLFQDMAVIPALALIPILAGNE
FT                   GGANDWVKIGLKIAAFAGMLIGGRYLLRPLFRYIVASGVREVFTAAALLVVLGSALFMD
FT                   ALGLSMALGTFIAGILLAESEFQHELEIAIEPFKGLLLGLFFISVGMALDLGVLFTHLL
FT                   DVLLGVLALVFIKSAILYGLARVFGLRRSVRLQFAGVLSQGGEFAFVLFSAAFSQRVLN
FT                   AEQLALLLVVVTLSMMTTPLLMQVIDRILVRRYNAQEESDEKPFVEDNDPQVIIVGFGR
FT                   FGQVIGRLLMANKMRITVLERDVSAVSMMRKYGYKVYYGDATELELLRAAGAEKAKAIV
FT                   ITCNEPEDTMALVHLCQQHFPNLHILARARGRVEAHELLQNGVKDFTRETFSSALELGR
FT                   KTLLELGMHPHQAYRAQQHFRRLDMRMLRELMPQHHGDVAQISRIKEARRELEDIFQRE
FT                   MLHESRQLDGWDEYE"
FT   gene            207925..208512
FT                   /gene="slyD"
FT                   /locus_tag="YPD4_0169"
FT   CDS_pept        207925..208512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="slyD"
FT                   /locus_tag="YPD4_0169"
FT                   /product="peptidyl-prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57078"
FT                   /protein_id="ACY57078.1"
FT                   /translation="MKVTKDLVVSLAYQVRTEDGVLVDESPVSAPLDYLHGHGSLIAGL
FT                   ENALEGHEAGDSFDVRVNADEGYGSYDENLVQRVPKDVFMGVDELEVGMRFLADTDQGP
FT                   VPVEITAVEDEHVVVDGNHMLAGQDLNFHVEVVAVREATEEELQHGHVHGEHDHHHEHG
FT                   DGCCGGHGHDDHEHEHEHGKGGCGKSGGCGCH"
FT   gene            209266..210066
FT                   /gene="fkpA"
FT                   /locus_tag="YPD4_0170"
FT   CDS_pept        209266..210066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fkpA"
FT                   /locus_tag="YPD4_0170"
FT                   /product="peptidyl-prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57079"
FT                   /protein_id="ACY57079.1"
FT                   /translation="MKSLFKVTLLATAMTLTLNTSTVFAADATSPVVTNSAFKNNDQQS
FT                   AYALGASLGRYMDNSLKEQEKLGIKLDKDQLIAGVQDAFANKSKLTDEEIEKTLQNFEA
FT                   RVKASAQAKMEQDAKENADKGAKYRDTFAKEKGVKKTASGLLYKVENAGTGDAPKDSDT
FT                   VVVNYKGTLADGTEFDNSYKRGEPLSFRLDGVIPGWTEGLKQIKKGGKITLVIPPELAY
FT                   GKAGVPGIPANSTLIFDVELLDVKAAAKADAQEQQPAVDTKAKK"
FT   gene            210320..211042
FT                   /locus_tag="YPD4_0171"
FT   CDS_pept        210320..211042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0171"
FT                   /product="DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57080"
FT                   /protein_id="ACY57080.1"
FT                   /translation="MSNSLLCSETSELDLLDERPFSQTDHEILKSYEVVVDGLAMLIGG
FT                   HCEIVLHSLEDLKNSAVRIANGEHTGRQIGSPITDLALRMLHDMAGADSSVSKAYFTRA
FT                   KSGVLMKSVTIAIRNRDQRVIGLLCINMNLDVPFSQIIQTFMPPETQEVPSSVNFASSV
FT                   DDLVAQTLEFTIEEVNADRNVSNNAKNRQVVLNLYEKGIFDIKDAINQVAERLNISKHT
FT                   VYLYIRQFKSGDLVGHER"
FT   gene            211042..211437
FT                   /locus_tag="YPD4_0172"
FT   CDS_pept        211042..211437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0172"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57081"
FT                   /protein_id="ACY57081.1"
FT                   /translation="MSALKYCLLVTGPAYGTQQASSAYQFAQAVVGAGHHLVSIFFYRE
FT                   GVLNANQLTAPASDEFDLVRAWQQLAAEQAVTLNVCVAAALRRGITDQHEAEQLNLAAA
FT                   NLQPGFTLSGLGALAEATLTCDRMVQF"
FT   gene            211437..211802
FT                   /locus_tag="YPD4_0173"
FT   CDS_pept        211437..211802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0173"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57082"
FT                   /protein_id="ACY57082.1"
FT                   /translation="MARKRIAFIFTQGPHGSSAGREGLDALLATSALSEDIGVFFISDG
FT                   VLQLLPQQQPEKILARNYIATFGVLPLYDVENCYLCERSLQQRGLSKMADWILDVTVLS
FT                   PADLRRELGTYDVVLTF"
FT   gene            212247..212621
FT                   /gene="rpsl"
FT                   /locus_tag="YPD4_0174"
FT   CDS_pept        212247..212621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsl"
FT                   /locus_tag="YPD4_0174"
FT                   /product="30S ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57083"
FT                   /protein_id="ACY57083.1"
FT                   /translation="MATINQLVRKPRSMKVAKSNVPALEACPQKRGVCTRVYTTTPKKP
FT                   NSALRKVCRVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDC
FT                   SGVKDRKQSRSKYGVKKPKA"
FT   gene            212718..213188
FT                   /gene="rpsG"
FT                   /locus_tag="YPD4_0175"
FT   CDS_pept        212718..213188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="YPD4_0175"
FT                   /product="30S ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57084"
FT                   /protein_id="ACY57084.1"
FT                   /translation="MPRRRVIGQRKILPDPKFGSELLAKFVNILMVDGKKSTAEAIVYT
FT                   ALETLAQRSGKDFLEAFEVALDNVRPTVEVKSRRVGGSTYQVPVEVRPVRRNALAMRWI
FT                   VDAARKRGDKSMALRLANELSDAAENKGSAVKKREDVHRMAEANKAFAHYRW"
FT   gene            213282..215390
FT                   /gene="fusA"
FT                   /locus_tag="YPD4_0176"
FT   CDS_pept        213282..215390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="YPD4_0176"
FT                   /product="elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57085"
FT                   /protein_id="ACY57085.1"
FT                   /translation="MARKTPIERYRNIGISAHIDAGKTTTTERILFYTGVNHKIGEVHD
FT                   GAATMDWMEQEQERGITITSAATTCFWSGMAKQFEPHHVNIIDTPGHVDFTIEVERSMR
FT                   VLDGAVMVYCAVGGVQPQSETVWRQANKYKVPRIAFVNKMDRMGANFLRVVGQLKSRLG
FT                   ANPVPLQLAIGAEEKFTGIIDLVKMKAINWNEADQGVTFEYEEIPADMAELAAEWHQNL
FT                   VESAAEASDELMDKYLGGEELTEEEIKKALRQRVLKSEIILVTCGSAFKNKGVQAMLDA
FT                   VIEYLPAPTDVESINGILDDGKDTPAVRHSDDKEPFSALAFKIATDPFVGNLTFFRVYS
FT                   GIVNSGDTVLNSVKSQRERLGRIVQMHANKREEIKEVHAGDIAAAIGLKDVTTGDTLCD
FT                   PNNPIILERMEFPEPVISVAVEPKTKADQEKMGMALGRLAKEDPSFRVWTDEESGQTII
FT                   AGMGELHLDILVDRMRREFNVEANVGKPQVAYRETIRETVKDVEGKHAKQSGGRGQYGH
FT                   VVIDMSPLPPGGVGYEFVNEIVGGSIPKEFIPAVDKGIQEQLKSGPLAGYPVVDVKVRL
FT                   HYGSYHDVDSSELAFKLAGSIAFKEGFKRAKPVLLEPIMKVEVETPEDYMGDVMGDLNR
FT                   RRGIIEGMEDTATGKTVRVKVPLSEMFGYATDLRSQTQGRASYSMEFLEYAEAPSNVAK
FT                   AVIEARGK"
FT   gene            215463..216647
FT                   /gene="tuf"
FT                   /locus_tag="YPD4_0177"
FT   CDS_pept        215463..216647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tuf"
FT                   /locus_tag="YPD4_0177"
FT                   /product="elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57086"
FT                   /protein_id="ACY57086.1"
FT                   /translation="MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGSAR
FT                   AFDQIDNAPEEKARGITINTSHVEYDTPARHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVAATDGPMPQTREHILLGRQVGVPYIIVFMNKCDMVDDEELLELVEMEVRELLSAYDF
FT                   PGDDLPVVRGSALKALEGEAEWEAKIIELAGYLDSYIPEPERAIDKPFLLPIEDVFSIS
FT                   GRGTVVTGRVERGIVKVGEEVEIVGIKDTVKSTCTGVEMFRKLLDEGRAGENVGVLLRG
FT                   IKREDIERGQVLAKPGSIKPHTTFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTG
FT                   TIELPEGVEMVMPGDNINMIVTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVIA"
FT   gene            216799..217308
FT                   /locus_tag="YPD4_0178"
FT   CDS_pept        216799..217308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0178"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57087"
FT                   /protein_id="ACY57087.1"
FT                   /translation="MRSGNCKCSTRNQKGVPMRDEKSLAHTRWNCKYHIVFAPKYRRQV
FT                   FYREKRRAIGSILRKLCEWKNVNILEAECCVDHIHMLLEIPPKMSVSGFMGYLKGKSSL
FT                   MLYEQFGDLKFKYRNREFWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGS
FT                   PFTGRK"
FT   gene            217769..218242
FT                   /gene="bfr"
FT                   /locus_tag="YPD4_0179"
FT   CDS_pept        217769..218242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bfr"
FT                   /locus_tag="YPD4_0179"
FT                   /product="bacterioferritin"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57088"
FT                   /protein_id="ACY57088.1"
FT                   /translation="MKGDKKIIAHLNKLLGNELVAINQYFLHARMFKNWGLMRLNDKEY
FT                   HESIDEMKHADKYIERILFLEGIPNLQELGKLNIGEDVEEMLKSDLALELSGATDLREG
FT                   IAYADSIHDYVSRDLLKEILVDEEEHIDWLETELSLIDRLGIQSYSQAQLAKD"
FT   gene            218657..218968
FT                   /gene="rpsJ"
FT                   /locus_tag="YPD4_0180"
FT   CDS_pept        218657..218968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="YPD4_0180"
FT                   /product="30S ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57089"
FT                   /protein_id="ACY57089.1"
FT                   /translation="MQNQRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTR
FT                   KERFTVLISPHVNKDARDQYEIRTHKRLVDIVEPTEKTVDALMRLDLAAGVDVQISLG"
FT   gene            219001..219630
FT                   /gene="rplC"
FT                   /locus_tag="YPD4_0181"
FT   CDS_pept        219001..219630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="YPD4_0181"
FT                   /product="50S ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57090"
FT                   /protein_id="ACY57090.1"
FT                   /translation="MIGLVGKKVGMTRIFTEDGVSIPVTVIEIEANRVTQVKSLENDGY
FT                   RAVQVTTGAKKANRVTKPEAGHFAKAGVEAGRGLWEFRLPEGQEFTAGQEISVEIFADV
FT                   KKVDVTGTSKGKGFAGTVKRWNFRTQDATHGNSLSHRVPGSIGQNQTPGKVFKGKKMAG
FT                   HMGDERVTVQSLDVVRVDAERNLLLVKGAVPGATGGNLIVKPAVKA"
FT   gene            219647..220252
FT                   /gene="rplD"
FT                   /locus_tag="YPD4_0182"
FT   CDS_pept        219647..220252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="YPD4_0182"
FT                   /product="50S ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57091"
FT                   /protein_id="ACY57091.1"
FT                   /translation="MELVMKDAPGALTVSETTFGRDFNEALVHQVVVAYAAGARQGTRA
FT                   QKTRAEVTGSGKKPWRQKGTGRARAGSVKSPIWRSGGVTFAAKPQDHSQKVNKKMYRGA
FT                   LKSILSELVRQDRLIIVEKFSVEAPKTKLLAQKLKDMALEDVLIVTGELDENLFLAARN
FT                   LYKVDVRDVAGIDPVSLIAFDKVVMTADAVKQVEEMLA"
FT   gene            220249..220551
FT                   /gene="rplW"
FT                   /locus_tag="YPD4_0183"
FT   CDS_pept        220249..220551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="YPD4_0183"
FT                   /product="50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57092"
FT                   /protein_id="ACY57092.1"
FT                   /translation="MIREERLLKVLRSPHVSEKASAAMEKNNTIVLKVAKDATKAEIKA
FT                   AVQKLFEVEVEDVNTLLVKGKSKRHGQRVGRRSDWKKAYVTLKEGQNLDFIGGAE"
FT   gene            220568..221392
FT                   /gene="rplB"
FT                   /locus_tag="YPD4_0184"
FT   CDS_pept        220568..221392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="YPD4_0184"
FT                   /product="50S ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57093"
FT                   /protein_id="ACY57093.1"
FT                   /translation="MAIVKCKPTSPGRRHVVKVVNPELHKGKPYAPLLEKLSKSGGRNN
FT                   NGRITTRHIGGGHKQHYRLVDFKRNKDGIPAVVERLEYDPNRSANIALVLYKDGERRYI
FT                   LAPKGLKAGDQIQSGVDAAIKAGNTLPMRNIPVGSTVHNVEMKPGKGGQLARSAGAYVQ
FT                   IVARDGSYVTLRLRSGEMRKVQADCRATLGEVGNAEHMLRVLGKAGASRWRGIRPTVRG
FT                   TAMNPVDHPHGGGEGRNFGKHPVTPWGVQTKGKKTRSNKRTDKFIVRRRSKK"
FT   gene            221700..222032
FT                   /gene="rplV"
FT                   /locus_tag="YPD4_0185"
FT   CDS_pept        221700..222032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="YPD4_0185"
FT                   /product="50S ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57094"
FT                   /protein_id="ACY57094.1"
FT                   /translation="METIAKHRHARSSAQKVRLVADLIRGKKVSQALETLTYTNKKAAG
FT                   LVKKVLESAIANAEHNDGADIDDLKVTKIFVDEGPSMKRIMPRAKGRADRILKRTSHIT
FT                   VVVSDR"
FT   gene            222050..222748
FT                   /gene="rpsC"
FT                   /locus_tag="YPD4_0186"
FT   CDS_pept        222050..222748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="YPD4_0186"
FT                   /product="30S ribosomal protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57095"
FT                   /protein_id="ACY57095.1"
FT                   /translation="MGQKVHPNGIRLGIVKAWNSTWYANTKEFADNLDSDFKVRQFLTK
FT                   ELAKASVSRIVIERPAKSIRVTIHTARPGIVIGKKGEDVEKLRKVVADIAGVPAQINIA
FT                   EVRKPELDAKLVADSITSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIA
FT                   RTEWYREGRVPLHTLRADIDYNTSEAHTTYGVIGVKVWIFKGEILGGMAAVEQPEPAAQ
FT                   PKKQQRKGRK"
FT   gene            222761..223171
FT                   /gene="rplP"
FT                   /locus_tag="YPD4_0187"
FT   CDS_pept        222761..223171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="YPD4_0187"
FT                   /product="50S ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57096"
FT                   /protein_id="ACY57096.1"
FT                   /translation="MLQPKRTKFRKMHKGRNRGLAQGTDVSFGEFGLKACGRCRLTARQ
FT                   IEAARRAMTRAIKRQGKVWIRVFPDKPITEKPLEVRMGKGKGNVEYWVALIQPGKVLFE
FT                   MAGVPEETAREAFKLAAAKLPVGTTFVTKTVM"
FT   gene            223797..224168
FT                   /gene="rplN"
FT                   /locus_tag="YPD4_0188"
FT   CDS_pept        223797..224168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="YPD4_0188"
FT                   /product="50S ribosomal protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57097"
FT                   /protein_id="ACY57097.1"
FT                   /translation="MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGIGDIIKITIKE
FT                   AIPRGKVKKGDVLKAVVVRTKKGVRRPDGSVIRFDGNACVILNNNSEQPIGTRIFGPVT
FT                   RELRNEKFMKIISLAPEVL"
FT   gene            224179..224493
FT                   /gene="rplX"
FT                   /locus_tag="YPD4_0189"
FT   CDS_pept        224179..224493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="YPD4_0189"
FT                   /product="50S ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57098"
FT                   /protein_id="ACY57098.1"
FT                   /translation="MAAKIRRDDEVIVLTGKDKGKRGKVKNVLSSGKVIVEGINLVKKH
FT                   QKPVPALNQPGGIVEKEAAIQVSNLALFNATTGKADRVGFRFEDGKKVRFFKSTSETIK
FT                   "
FT   gene            224508..225047
FT                   /gene="rplE"
FT                   /locus_tag="YPD4_0190"
FT   CDS_pept        224508..225047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="YPD4_0190"
FT                   /product="50S ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57099"
FT                   /protein_id="ACY57099.1"
FT                   /translation="MAKLHDYYKDEVVKQLMSQFGYDSVMQVPRVEKITLNMGVGEAIA
FT                   DKKLLDNAAADLAAISGQKPFITKARKSVAGFKIRQGYPIGCKVTLRGERMWEFFERLI
FT                   TIAVPRIRDFRGLSAKSFDGRGNYSMGVREQIIFPEIDYDKVDRVRGLDITITTTAKSD
FT                   DEGRALLAAFKFPFRK"
FT   gene            225061..225366
FT                   /gene="rpsN"
FT                   /locus_tag="YPD4_0191"
FT   CDS_pept        225061..225366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="YPD4_0191"
FT                   /product="30S ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57100"
FT                   /protein_id="ACY57100.1"
FT                   /translation="MAKQSMKAREVVRVKLANKYRAKREELKAIISGVNSSDEDRWDAV
FT                   LKLQSLPRDSSPSRQRNRCNQTGRPHGFLRKFGLSRIKVRETAMRGEIPGLKKASW"
FT   gene            225400..225792
FT                   /gene="rpsH"
FT                   /locus_tag="YPD4_0192"
FT   CDS_pept        225400..225792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="YPD4_0192"
FT                   /product="30S ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57101"
FT                   /protein_id="ACY57101.1"
FT                   /translation="MSMQDPIADMLTRIRNGQAANKVAVTMPSSKLKVAIANVLKEEGF
FT                   IEDFKIEGDTKPVLELALKYFQGKAVVESIQRISRPGLRIYKKKDELPKVMAGLGIAVI
FT                   STSKGVMTDRAARQAGLGGEIICYVA"
FT   gene            225807..226340
FT                   /gene="rplF"
FT                   /locus_tag="YPD4_0193"
FT   CDS_pept        225807..226340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="YPD4_0193"
FT                   /product="50S ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57102"
FT                   /protein_id="ACY57102.1"
FT                   /translation="MSRVAKAPVVIPAGVEVKLNGQVISIKGKNGELTRTVHSAVEVKQ
FT                   EENTLTFAPREGAVDGWAQAGTTRALLNSMVIGVTEGFTKKLQLVGVGYRAAVKGNVVN
FT                   LALGFSHPVDHELPAGITAECPTQTEIVLKGADKQVIGQVAADLRAYRRPEPYKGKGVR
FT                   YADEVVRTKEAKKK"
FT   gene            226350..226703
FT                   /gene="rplR"
FT                   /locus_tag="YPD4_0194"
FT   CDS_pept        226350..226703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="YPD4_0194"
FT                   /product="50S ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57103"
FT                   /protein_id="ACY57103.1"
FT                   /translation="MDKKAARIRRATRARRKLKELGATRLVVHRTPRHIYAQVIAPNGS
FT                   EILVAASTVEKAINEQLKYAGNKDAAAAVGKTIAERALEKGITKVSFDRSGFQYHGRVQ
FT                   ALADAAREAGLQF"
FT   gene            226718..227221
FT                   /gene="rpsE"
FT                   /locus_tag="YPD4_0195"
FT   CDS_pept        226718..227221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="YPD4_0195"
FT                   /product="30S ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57104"
FT                   /protein_id="ACY57104.1"
FT                   /translation="MSHIEKQAGELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGR
FT                   VGFGYGKAREVPAAIQKAMEKARRAMINVALNNGTLQHPVKGAHTGSRVFMQPASEGTG
FT                   IIAGGAMRAVLEVAGVHNVLAKAYGSTNPINVVRATIAALEDMKSPEMVAAKRGKSVEE
FT                   ILGK"
FT   gene            227407..227841
FT                   /gene="rplO"
FT                   /locus_tag="YPD4_0196"
FT   CDS_pept        227407..227841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="YPD4_0196"
FT                   /product="50S ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57105"
FT                   /protein_id="ACY57105.1"
FT                   /translation="MRLNTLSPAEGAKHAPKRVGRGIGSGLGKTAGRGHKGQNSRSGGG
FT                   VRRGFEGGQMPLYRRLPKFGFTSRKAMITAEVRLSELALVEGDVIDLNTLKAANVVGIQ
FT                   MEFVKVILSGEVNRAVTLRGLRVTKGARAAIEAAGGKIEE"
FT   gene            227849..228952
FT                   /locus_tag="YPD4_0197"
FT   CDS_pept        227849..228952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0197"
FT                   /product="preprotein translocase SecY subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57106"
FT                   /protein_id="ACY57106.1"
FT                   /translation="MAKQPGLDFQSAKGGLGELKRRLLFVIGALIVFRIGSFIPIPGID
FT                   ATVLAKLLEQQRGTIIEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPALAE
FT                   IKKEGEAGRRKISQYTRYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVS
FT                   LVTGTMFLMWLGEQITERGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLHFLLLLL
FT                   VAVLVFAVTFFVVFIERGQRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFAS
FT                   SIILFPATITSWFGGGTGWNWLTTISMYLQPGQPLYVLLYASAIIFFCFFYTALVFNPR
FT                   ETADNLKKSGAFVPGIRAGRANGEVHR"
FT   gene            229479..229835
FT                   /gene="rpsM"
FT                   /locus_tag="YPD4_0198"
FT   CDS_pept        229479..229835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="YPD4_0198"
FT                   /product="30S ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57107"
FT                   /protein_id="ACY57107.1"
FT                   /translation="MARIAGINIPDQKHTVIALTAIFGIGKTRSQAICVAAGIAEHVKI
FT                   SELSEEQIEKLRDEVAKYVVEGDLRREVTLSIKRLMDLGTYRGLRHRRGLPVRGQRTKT
FT                   NARTRKGPRKPIKK"
FT   gene            229852..230241
FT                   /gene="rpsK"
FT                   /locus_tag="YPD4_0199"
FT   CDS_pept        229852..230241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="YPD4_0199"
FT                   /product="30S ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57108"
FT                   /protein_id="ACY57108.1"
FT                   /translation="MAKAPIRARKRVRKTVSDGVAHIHASFNNTIVTITDRQGNALGWA
FT                   TAGGSGFRGSRKSTPFAAQVAAERCAEAVKEYGIKNLEVMVKGPGPGRESTIRALNAAG
FT                   FRITNITDVTPIPHNGCRPPKKRRV"
FT   gene            230272..230892
FT                   /gene="rpsD"
FT                   /locus_tag="YPD4_0200"
FT   CDS_pept        230272..230892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /locus_tag="YPD4_0200"
FT                   /product="30S ribosomal protein S4"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57109"
FT                   /protein_id="ACY57109.1"
FT                   /translation="MARYLGPKLKLSRREGTDLFLKSGVRAIDTKCKIEQPPGQHGARK
FT                   PRLSDYGVQLREKQKVRRIYGVLERQFRNYYKEAARLKGNTGANLLQLLEGRLDNVVYR
FT                   MGFGATRAESRQLVSHKAIMVNGRVVNIASYQVSPNDVVSIREKAKKQSRVKAALELAE
FT                   QREKPTWLEVDAVKMEGVFKRIPERTDLSADINEHLIVELYSK"
FT   gene            230918..231907
FT                   /gene="rpoA"
FT                   /locus_tag="YPD4_0201"
FT   CDS_pept        230918..231907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="YPD4_0201"
FT                   /product="DNA-directed RNA polymerase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57110"
FT                   /protein_id="ACY57110.1"
FT                   /translation="MQGSVTEFLKPRLVDIEQVSSTHAKVTLEPLERGFGHTLGNALRR
FT                   ILLSSMPGCAVTEVEIDGVLHEYSTKEGVQEDILEILLNLKGLAVRVQGKDEVILTLNK
FT                   SGIGPVTAADITHDGDVEIVKPQHVICHLTDENASINMRIKVQRGRGYVPASARIHSEE
FT                   DERPIGRLLVDACYSPVERIAYNVEAARVEQRTDLDKLVIEMETNGTIDPEEAIRRAAT
FT                   ILAEQLEAFVDLRDVRQPEVKEEKPEFDPILLRPVDDLELTVRSANCLKAEAIHYIGDL
FT                   VQRTEVELLKTPNLGKKSLTEIKDVLASRGLSLGMRLENWPPASIADE"
FT   gene            231948..232337
FT                   /gene="rplQ"
FT                   /locus_tag="YPD4_0202"
FT   CDS_pept        231948..232337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="YPD4_0202"
FT                   /product="50S ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57111"
FT                   /protein_id="ACY57111.1"
FT                   /translation="MRHRKSGRQLNRNSSHRQAMFRNMAGSLVRHEIIKTTLPKAKELR
FT                   RVVEPLITLAKTDNVANRRLAFARTRDNEIVAKLFNELGPRFASRAGGYTRILKCGFRA
FT                   GDNAPMAYIELVDRAASQAEVVAAE"
FT   gene            232775..233209
FT                   /gene="zntR"
FT                   /locus_tag="YPD4_0203"
FT   CDS_pept        232775..233209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zntR"
FT                   /locus_tag="YPD4_0203"
FT                   /product="zinc-responsive transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57112"
FT                   /protein_id="ACY57112.1"
FT                   /translation="MDNMLKIGQLAKLADVTPDTIRYYEKQGMMDHGERTDGGYRLYTD
FT                   QDLQRLRFIRYAKQLGFTLDTIAELLSIRIDPDHHTCQESKSIVDSRLSDVEGKIRELE
FT                   RMRDSLKRLSEACCGTSHATTYCSILEALEQGATEELIKV"
FT   gene            complement(233607..234020)
FT                   /gene="mscL"
FT                   /locus_tag="YPD4_0204"
FT   CDS_pept        complement(233607..234020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mscL"
FT                   /locus_tag="YPD4_0204"
FT                   /product="large-conductance mechanosensitive channel"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57113"
FT                   /protein_id="ACY57113.1"
FT                   /translation="MSFMKEFREFAMRGNVVDLAVGVIIGAAFGRIVSSLVADIIMPPL
FT                   GLLLGGVDFKQFHFVLRAAEGTIPAVVMNYGTFIQSIFDFVIVALAIFSAVKLMNKLRR
FT                   EKAEEEPATPPAPTTEEILLAEIRDLLKAQHTK"
FT   gene            complement(234159..235535)
FT                   /gene="trkA"
FT                   /locus_tag="YPD4_0205"
FT   CDS_pept        complement(234159..235535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkA"
FT                   /locus_tag="YPD4_0205"
FT                   /product="potassium transporter peripheral membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57114"
FT                   /protein_id="ACY57114.1"
FT                   /translation="MKIIILGAGQVGGTLAENLVGENNDITVVDIDSGRLRQLQDKFDL
FT                   RVVQGYGSHPRVLREAGAEDADMLVAVTNSDETNMIACQIAYSLFNTPNRIARIRSTEY
FT                   IREADKLFLPEAVPIDHLISPEQLVIDYIYKLIEYPGALQVVNFAEGKVSIAAVKAYYG
FT                   GPLVGNALSSLREHMPHIDTRVAAIFRQDRPIRPQGSTIIEAGDEVFFVAASQHIRAVM
FT                   SELQRLEKPYKRIMIVGGGNVGAGLALRLEKDYSVKLIERDQQRAAELAEMLHDTIVFY
FT                   GDASDQELLAEEHIEQVDVFIAITNDDEANIMSAMLAKRMGAKKAMVLIQRSAYVDLVQ
FT                   GSVIDIVISPQQATISALLGHVRKADIVSVSSLRRGVAEAIEAIAHGDESTSKVVGRMV
FT                   EDIKLPPGTTIGAIVRGDEVIIANSNSIIKQGDHVIMFITHKKFVPDVERLFQPSPFFL
FT                   "
FT   gene            complement(235591..236886)
FT                   /locus_tag="YPD4_0206"
FT   CDS_pept        complement(235591..236886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0206"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57115"
FT                   /protein_id="ACY57115.1"
FT                   /translation="MVMKNTYNLRSIAAKAISQVLDQGQSLSAVLPELQKNISDKDRAL
FT                   LQELCFGTLRVLPQLEWCIQQLMARPMTGKQRVFHYLIMVGLYQLIYTRIPPHAALAET
FT                   VEGATVLKRPQLKGLINGVLRQFQRQQVELLERAVNNDSHYLHPSWLLARIKQAYPAQW
FT                   QQILDANNQRPPMWLRVNRLHHSRSEYLELLTQADINAEPHPIYRDAVRLITPCAVNHL
FT                   PGFELGWVTVQDASAQGCVDLLDPQNGEQILDLCAAPGGKTTHILEAAPKAHVLAVDID
FT                   EQRLSRVKENLQRLQLQAVVRVGDGRAPDTWCGDQQFDRILLDAPCSATGVIRRHPDIK
FT                   WLRRDRDISELAQLQSEIIEAIWPKLKHGGVLVYATCSILPEENQQQIAAFLQRHPEAQ
FT                   LTETGTTAAPGKQNLPHPEDGDGFFYAKIIKK"
FT   gene            complement(236974..237921)
FT                   /gene="fmt"
FT                   /locus_tag="YPD4_0207"
FT   CDS_pept        complement(236974..237921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="YPD4_0207"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57116"
FT                   /protein_id="ACY57116.1"
FT                   /translation="MSDSLRIIFAGTPDFAARHLGALLSSQHKIVGVFTQPDRPAGRGN
FT                   KLTPSPVKILAEHHGIPVFQPKSLRPEENQHLVADLNADIMVVVAYGLILPAAVLAMPR
FT                   LGCINVHGSLLPRWRGAAPIQRSVWAGDEKTGITIMQMDIGLDTGAMLHKIECAIQPED
FT                   TSATLYDKLAQLGPQGLLITLQQLAAGTALAEVQNETQATYAEKLSKEEAKLDWTLSAT
FT                   QLERCIRAFNPWPVSYFIVDEQPIKVWQAQVLPAGEDAEPGTIIHADKHGIQVATADGV
FT                   LNITQLQPAGKKAMSAADLLNSRREWFIPGSQLV"
FT   gene            complement(237946..238458)
FT                   /gene="def"
FT                   /locus_tag="YPD4_0208"
FT   CDS_pept        complement(237946..238458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def"
FT                   /locus_tag="YPD4_0208"
FT                   /product="peptide deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57117"
FT                   /protein_id="ACY57117.1"
FT                   /translation="MSVLQVLHYPDERLRKIAAPVKEVNGEIQRIVDDMFETMYAEEGI
FT                   GLAATQVDVHQQIIVIDISENRDQRLVLINPELLEKSGETGIEEGCLSIPEQRALVPRA
FT                   EKVKIRALDRDGKPFELETDGLLAICIQHEMDHLIGKLFVDYLSPLKRQRIRQKLEKMA
FT                   KLNARAN"
FT   gene            238593..239714
FT                   /locus_tag="YPD4_0209"
FT   CDS_pept        238593..239714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0209"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57118"
FT                   /protein_id="ACY57118.1"
FT                   /translation="MLAAELWLRMTQVKGLGVVKRSALAKRLLASGDIHPGRLAAYGLD
FT                   SQQCHQFAQLSPRYIADTLEWLSDPNHHLLTYGEPGYPPRLVHIAGAPLVLFVSGELDV
FT                   LYRPQIAMVGSRHFSHYGEQWGRYFASELARTGLVITSGLAVGIDGICHQAALNIQGRT
FT                   IAVLGSGLENIYPQRHSRLAKEIEYQGGALVSEFLTTALPIAAHFPRRNRIISGLSDAV
FT                   LVVEATLKSGSLITARYAMDQGRDVFALPGPLGSASSEGTHWLIQQGAYLATSVKDVSE
FT                   QVSGSLQWLSLPEEVIISSPQEQVELPFADVLANVGDEVTPVDVVAERAGQPVQDIASK
FT                   LLELELAGWIAAVPGGYVRIRRAGHVRRSNLLI"
FT   gene            239686..240159
FT                   /gene="smg"
FT                   /locus_tag="YPD4_0210"
FT   CDS_pept        239686..240159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smg"
FT                   /locus_tag="YPD4_0210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57119"
FT                   /protein_id="ACY57119.1"
FT                   /translation="MFDVLIYLFETYMHNEPEMLVDQDKITDDLADAGFYREDINNALN
FT                   WLEVLADLQEGQKAPYLYTADPQALRIYTVEECRRLGAACRGFILFLEQIQVLQFDTRE
FT                   MVIDRIMALDSPEIDLEDLKWVVLMVLFNIPGYENAYKQMEELLFEVNDGYLH"
FT   gene            240257..240739
FT                   /locus_tag="YPD4_0211"
FT   CDS_pept        240257..240739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0211"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57120"
FT                   /protein_id="ACY57120.1"
FT                   /translation="MVIRSGGHGPFLGCSHYPDCQYIRPLKAQADGHVVKTLEGQPCPE
FT                   CGSDMMLRQGRFGMFIGCSQYPQCDHTEVIDKPDETSIDCPQCGQGKLLQRKSRFGKVF
FT                   HACNRYPDCQFTLNQPPIAGKCGYCHYPLLIEKRTARGIKRICASKLCGKAVASES"
FT   gene            240741..241313
FT                   /locus_tag="YPD4_0212"
FT   CDS_pept        240741..241313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0212"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57121"
FT                   /protein_id="ACY57121.1"
FT                   /translation="MNQQENNFVLADIVRALRQEEVIAYPTEAVFGLGCDPDSEKAVNT
FT                   LLALKQRPWQKGLILVAANYAQLEPYINDSMLNEIQRETLFSTWPGPITWVIPARVETP
FT                   QWLTGCFDSLAVRVSNHPLVQQLCAEYGKPLVSTSANLSGHEPCRTEEEVRIQFGPSLP
FT                   VLSGHVGGRLNPSEIRDALTGKRFRQG"
FT   gene            241322..242143
FT                   /gene="aroE"
FT                   /locus_tag="YPD4_0213"
FT   CDS_pept        241322..242143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroE"
FT                   /locus_tag="YPD4_0213"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57122"
FT                   /protein_id="ACY57122.1"
FT                   /translation="MDQKFAVFGNPISHSKSPRIHTLFSEQTGIEHRYGKVLAPSEAFE
FT                   NTLVSFFADGAQGANITTPFKERAYDQCDELTDRASLAGAVNTIKRLEDGRLLGDNTDG
FT                   IGLLSDLERQNLIRTTDHILLVGAGGAARGVILPLLSYGCTVVVTNRTHTRAQQLAKVF
FT                   NHIGDIDVCEMSELAGQRFDLVINATASGLHGEVPNLPAAILTSQTRCYDMFYQAGTTP
FT                   FLAWAQRLGLADYADGLGMLVGQAAHAFKLWHGVMPEITPVLAQLRSELGK"
FT   gene            complement(242198..242779)
FT                   /locus_tag="YPD4_0214"
FT   CDS_pept        complement(242198..242779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0214"
FT                   /product="transferase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57123"
FT                   /protein_id="ACY57123.1"
FT                   /translation="MGRWWRYKWITFHPSLTIRPYLHHSPTLGKRVMIDRSSVIIGNVI
FT                   LGDDVSVWPLVAIRGDVNQVIIGARSNIQDGSVLHVTHQSEHNPEGYPLIIGEDVTIGH
FT                   KAMLHGCTIGNRVLVGMGSILLDGTIIEDDVMIGAGSLITPGKRLVSGYLYVGSPAKQI
FT                   RPLTPLELEGLLYSAGNYVRWKDDYLAESK"
FT   gene            complement(242795..243574)
FT                   /locus_tag="YPD4_0215"
FT   CDS_pept        complement(242795..243574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0215"
FT                   /product="insertion sequence IS100, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57124"
FT                   /protein_id="ACY57124.1"
FT                   /translation="MMELQHQRLMALAGQLQLESLISAAPALSQQAVDQEWSYMDFLEH
FT                   LLHEEKLARHQRKQAMYTRMAAFPAVKTFEEYDFTFATGAPQKQLQSLRSLSFIERNEN
FT                   IVLLGPSGVGKTHLAIAMGYEAVRAGIKVRFTTAADLLLQLSTAQRQGRYKTTLQRGVM
FT                   APRLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQTFAGDAALTS
FT                   AMLDRILHHSHVVQIKGESYRLRQKRKAGVIAEANPE"
FT   gene            complement(243574..244596)
FT                   /locus_tag="YPD4_0216"
FT   CDS_pept        complement(243574..244596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0216"
FT                   /product="transposase for insertion sequence IS100"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57125"
FT                   /protein_id="ACY57125.1"
FT                   /translation="MVTFETVMEIKILHKQGMSSRAIARELGISRNTVKRYLQAKSEPP
FT                   KYTPRPAVASLLDEYRDYIRQRIADAHPYKIPATVIAREIRDQGYRGGMTILRAFIRSL
FT                   SVPQEQEPAVRFETEPGRQMQVDWGTMRNGRSPLHVFVAVLGYSRMLYIEFTDNMRYDT
FT                   LETCHRNAFRFFGGVPREVLYDNMKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFSPRLC
FT                   RPFRAQTKGKVERMVQYTRNSFYIPLMTRLRPMGITVDVETANRHGLRWLHDVANQRKH
FT                   ETIQARPCDRWLEEQQSMLALPPEKKEYDVHLDENLVNFDKHPRHHPLSIYDSFCRGVA
FT                   "
FT   gene            244655..245641
FT                   /locus_tag="YPD4_0217"
FT   CDS_pept        244655..245641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0217"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57126"
FT                   /protein_id="ACY57126.1"
FT                   /translation="MDHYCTVRYRSDTRKILRQALLTPNSTITFSAEKIEQQDRGSYIA
FT                   EKIALNITDESRVLGLLLTPKTKGPHPAIVLLHDHGSKFDIGKEKMIRPWGDSAKLASA
FT                   QAWSDKFFSGKFVGDELAKRGYVVFSIDSIGWGDRGPMSYERQQALASNFFNLGRSLAG
FT                   TMAYEDMRTVDFMTTLPSVDRKRIGVLGFSMGAYRAWQLAALSDQVAATAAISWFGNYK
FT                   GLMTPDNNVLRGQSSFYMLHPGIANKLDFPDIASLAAPRPMLLFNGGKDKLFPAQAVEQ
FT                   AYDKVHAIWRSQNAEPRLVTRSWPTLGHVFYQEQQDVVFLWLDRWLK"
FT   gene            complement(245715..247370)
FT                   /gene="actP"
FT                   /locus_tag="YPD4_0218"
FT   CDS_pept        complement(245715..247370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="actP"
FT                   /locus_tag="YPD4_0218"
FT                   /product="acetate permease"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57127"
FT                   /protein_id="ACY57127.1"
FT                   /translation="MKIRHWSALSLFVLPALAQAEALTGEVHRQPLNIQAIVMFLLFVG
FT                   GTLYITYWASKRTRSRQDYYTAGGRITGFQNGLAIAGDYMSAASFLGISALVYASGYDG
FT                   LIYSIGFLIGWPIILFLIAERLRNLGRYTFADVASYRLQQRPIRTLSACGSLVVVALYL
FT                   IAQMVGAGKLIQLLFGLNYHVAVVLVGILMVLYVLFGGMLATTWVQIIKAVMLLSGATF
FT                   MAIMVMKSVNFNFNTLFSEAVKVHPKGLSIMSPGGLVSDPISALSLGLALMFGTAGLPH
FT                   ILMRFFTVSDAKEARKSVFYATGFIGYFYILTFIIGFGAILLVGPNQTFKDAAGALLGG
FT                   NNMAAVHLANAVGGSFFLGFISAVAFATILAVVAGLTLAGASAVSHDLYASVIKKGKAN
FT                   ERDELRVSKITVIILGIVAIGLGILFENQNIAFMVGLAFSIAASCNFPIIIISMYWDKL
FT                   TTRGAMIGGWLGLSTAVILMILGPTIWVTILGHEKPIYPYEYPALFSMIAAFVGTWFFS
FT                   ITDNSETGKQERLLFKSQFVRSQTGLGASKGGAH"
FT   gene            complement(247367..247678)
FT                   /locus_tag="YPD4_0219"
FT   CDS_pept        complement(247367..247678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0219"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57128"
FT                   /protein_id="ACY57128.1"
FT                   /translation="MNDSIYQEIEDNPRFQELVKKRSRFAWLLSLITLTMYVAFIFLIA
FT                   FEPQWLGTPIYTGSSVTRGIPVGVGLIVTSFILTGIYVIRANGEFDRLTAEIIREVKQ"
FT   gene            complement(247735..249693)
FT                   /gene="acs"
FT                   /locus_tag="YPD4_0220"
FT   CDS_pept        complement(247735..249693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acs"
FT                   /locus_tag="YPD4_0220"
FT                   /product="acetyl-coenzyme A synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57129"
FT                   /protein_id="ACY57129.1"
FT                   /translation="MSQIHKHPIPAAIAEHALITPEKYQHYYQQSVQNPDEFWGEQGKI
FT                   IDWIKPYKTVKNTSFDPGHVSIRWFEDGTLNLAANCLDRHLAERGDQTAIIWEGDDPNQ
FT                   SKTVTYKQLHHDVCQFANVLKSLGVKKGDVVAIYMPMVPEAAVAMLACARIGAVHSVIF
FT                   GGFSPDAVAGRIIDSHSKLVITADEGIRAGRAIPLKKNVDEALKNPAITSIKNVVVFQR
FT                   TGNASYWEDGRDVWWHDLIKEASADCPPEEMNAEDPLFILYTSGSTGKPKGVVHTTGGY
FT                   LVYAALTFKYVFDYHPGDIYWCTADVGWVTGHSYLLYGPLACGAITLMFEGVPNYPGVN
FT                   RLSQVVDKHKVNILYTAPTAIRALMAEGDKAIEGTKRDSLRIMGSVGEPINPEAWEWYY
FT                   NKIGNSKCPIVDTWWQTETGGFMITPLPGATELKAGSATRPFFGVQPALVDNLGNPQEG
FT                   VAEGNLVITDSWPGQARTLFGDHERFEQTYFSTFKGMYFSGDGARRDEDGYYWITGRVD
FT                   DVLNVSGHRLGTAEIESALVAHPKIAEAAVVGVPHNIKGQAIYAYITLNHGEEPTPELY
FT                   TEVRNWVRKEIGPLATPDILHWTDSLPKTRSGKIMRRILRKIATGDTSNLGDTSTLADP
FT                   SVVEKLLEEKQSMQTPS"
FT   gene            250594..251910
FT                   /gene="gltP"
FT                   /locus_tag="YPD4_0221"
FT   CDS_pept        250594..251910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltP"
FT                   /locus_tag="YPD4_0221"
FT                   /product="proton glutamate symport protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57130"
FT                   /protein_id="ACY57130.1"
FT                   /translation="MKSIKISLAWQILIALVLGILVGAVLHNQIESREWLVSNILSPAG
FT                   DIFIRLIKMIVVPIVISTLIVGIAGVGDAKKLGRIGLKTIIYFEVITTIAIIIGITLAN
FT                   VFQPGVGIDMSALTVVDISQYEKTTEQVQSGSHSLVSTILSLIPANVFASMAKGDMLPI
FT                   IFFSVLFGLGLSSLPKETKEPLLNVFKAVSESMFKVTHMIMRYAPIGVFGLISVTVANF
FT                   GFASLIPLAKLVILVYAAILFFALVILGTVARLCKLRIWILIRILKDELILAYSTASSE
FT                   TVLPRIIEKMEAYGAPKAITSFVVPTGYSFNLDGSTLYQSIAAIFIAQLYGIELSIGQE
FT                   IILVLTLMVTSKGIAGVPGVSFVVLLATLGSVGIPLEGLAFIAGVDRILDMARTALNVV
FT                   GNALAVLVIAKWENQFDDKKAKAYEKTLFAVEQTPANQS"
FT   gene            complement(252088..252720)
FT                   /locus_tag="YPD4_0222"
FT   CDS_pept        complement(252088..252720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0222"
FT                   /product="putative two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57131"
FT                   /protein_id="ACY57131.1"
FT                   /translation="MNTKLLIVDDHELIIHGIKNMLAAYPRYLIVGQADNGLEVYNLCR
FT                   QTEPDMVILDLGLPGMDGLDVIIQLLRRWPALKILTLTARNEEHYASRTFNSGALGYVL
FT                   KKSPQQILMAAIQTVAIGKRYIDPALDASMVIKLTQGSDNTPPVLTPRERQILKLITEG
FT                   SCNRVIAAQLSISQKTVETHRLNMMKKLDVHKVAELIHWSYRLGLNV"
FT   gene            complement(252733..255552)
FT                   /locus_tag="YPD4_0223"
FT   CDS_pept        complement(252733..255552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0223"
FT                   /product="two-component sensor/regulator"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57132"
FT                   /protein_id="ACY57132.1"
FT                   /translation="MGKASSLVTRLTLLMGVTLTVIWLILIATTAFFSYENTRQILINE
FT                   LTHMASMRADLSNHQFEGAERDAASLISRRESLQSTSPLPEISIKHYDSYYIPFNLDSC
FT                   NINQHKNDLWIIQAYGTAGQTYYLDSFIIKQKEGIVLFPPQKSSSDYLNQRRKDLLLLP
FT                   KFPTHNNIYWGAPTYTPQGGWHVSVAVCDKVGTLAGFALKLNDLIAYNHPVEQRDINLL
FT                   LDKNGELLPISQQATSSNQLHEILNQLKNSKLHDGWQQTPDYLVLRTQLKGPGWQQLVI
FT                   YPRMGFAWEALKPALYQLPFALAILLLLTSVLSLLLRYYLAIPLWNFINIIGATGPQAM
FT                   EPRLPINRIDELGHIARAYNNLLDTLNEQYDTLEMKVKERTLALAEAKRAAEQANRRKS
FT                   DHLTTISHEIRTPLNGALGAVELLQNTPLDAGQMRLAETAHQCSLSLLAIINNLLDFSR
FT                   IESGQMTLSLEKTALLPLLDQAMLTIHSQALSKSLALSTFISANIPLELELDTLRLRQI
FT                   LVNLLGNAVKFTPQGRIQLRVRRQNQTLCFTVEDTGCGIDVQHQQTIFQPFMQTSDHEQ
FT                   GTGLGLAIADNLAKMMGGHLTVFSEPGQGSCFSLCLPFNAITPPMPFHGELFAPQRLHA
FT                   QLSAWGMTCQPELANQPSRHFVDNALCYLPGRLYAKLKQYLQGAETEALKSLPLQPWQM
FT                   HILLVDDSETNRDITGMMLQQLGHQVTRADSGTTALAIGRQHRFDLVLMDIRMPVLDGL
FT                   ATTARWRHDPANIDSHCMITALSANASPDEQIKTSQAGMNHYLSKPVTLGQLAEMLDLT
FT                   AQFQLERGVDLSPQLSEPQPLLDLADSALSLKLYQSLQVLIQQAKDAIENLPVLSHTLH
FT                   TIKGCAGQAGLIELQDAVIQLEHALDTHETLTQQEIIQLDEIIHVLLQPPTTCESTFII
FT                   SQGQSLMVK"
FT   gene            255724..257295
FT                   /locus_tag="YPD4_0224"
FT   CDS_pept        255724..257295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0224"
FT                   /product="possible type III secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57133"
FT                   /protein_id="ACY57133.1"
FT                   /translation="MIVGLRQKPYLNLRNYKWMSLIYIMRKITGLILLFFATLLPYGKF
FT                   SYVKAIPWQGEPFFIYSRGMTVSELLKDLGMNYGIPVVISSEINEHFTGKIRDKTPEKI
FT                   LSELAGRYNITWYYDGETLYFYPVQSIKREFISPDGLAANTLVKYLQRGDVLAGKNCAI
FT                   KAIPHLDTLEVKGVPICIERVKSVSKMLSEQVRHQNQNKETVKVFPLKYASAADSDYQY
FT                   RDQNVRLPGLVSVLRELNQGNNLPLAGGNQPDGNQASSPVFSADPRQNAVIIRDRQANM
FT                   PIYRSLITQLDQRPIQIEISVTIIDVDAGDISQLGVDWSASASIGGTGVSFNSTFAKNN
FT                   AEGFSTVIGDTGNFMVRLNALQKNSRARILSQPSVVTLNNIQAVLDKNVTFYTKLQGEK
FT                   VAKLESVTSGSLLRVTPRMIETEGVQEVLLNLNIQDGQQQASTNSNEPLPEIRNSDIST
FT                   QATLQVGQSLLLGGFIQDTQIESQNKIPLLGDIPLLGGLFRSTDKQSHSVVRLFLIKAV
FT                   PVNAGE"
FT   gene            257297..258511
FT                   /locus_tag="YPD4_0225"
FT   CDS_pept        257297..258511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0225"
FT                   /product="putative type-III secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57134"
FT                   /protein_id="ACY57134.1"
FT                   /translation="MTTVFKLRLLNGDLNGLELILPEGEFTLGEQGCDVLLPLSDGNIV
FT                   TLCVNEYQVMIQVAEEVWINGAQHDLHTPLPLLQSIEIAGLVFVLGEQTDILSGIKVTH
FT                   RARFPLLVWLAIAICVPLSLLFVFLFWLTTQPETLRASIPADVPTQLAERLREPALQGI
FT                   KGTWLADGSVTLSGHCASSSMMEPLQHFLLRNHIAFRNQLVCDDRLIASVSDLLHQHGY
FT                   HDIEVRIGDEPGNIVIYGAVQMGDQWLTVQDTLAAVSGLKGWLVVNAHSGQIQQLVERL
FT                   RAAGLLGFLSMTESNKELAISGVLSSEQQQQLKETLAALSQQQPGFPSVRYQNIPASDR
FT                   TDQFLPAKVVSYGGNTQSAFVRLANGGRLQQGSVLANGYKVVFIGEQGLTLLKANNLVH
FT                   IPMDF"
FT   gene            258925..259545
FT                   /locus_tag="YPD4_0226"
FT   CDS_pept        258925..259545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0226"
FT                   /product="putative AraC-family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57135"
FT                   /protein_id="ACY57135.1"
FT                   /translation="MIADEQASASAFANSAITSILCYPIDLFPIYQDLARRTLPLNKGH
FT                   LPHAVNDKYKVLPANVEIIQAAEELINIERVASLRFLYLYCLGIDNVYFSKLLDSIVGT
FT                   NNELLEFFEKNRLNPWSVSRYANELGISTRKLNFLFYEKFGMSAKQWLLDQRLKKGCEL
FT                   LLSTRLRVADIAMECGFSNHAHFSDSFRRRFQQCPSHMRSLIE"
FT   gene            260361..261092
FT                   /locus_tag="YPD4_0227"
FT   CDS_pept        260361..261092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0227"
FT                   /product="type III secretion system apparatus lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57136"
FT                   /protein_id="ACY57136.1"
FT                   /translation="MKSLRQMLAIVLMTLSLSGCDMELYSGLSEGEANQMLALLMLHQI
FT                   NAEKQIEKSGMVGLTVDKRQFINAVELLRQNGFPRQRFITVDELFPANQLVTSPTQEQA
FT                   KMVFLKEQQLENMLSHMDGVIHADVTVAMPMSVDGKNPLPHTASVFIKYSPEVNLQSYQ
FT                   SQIKGLVRDAVPGIDYAKISVVMQPANYRFSASEAEQQQGPQTTVQWLLRHVGMVQNMV
FT                   GVAFISLIVLMFVGWFYYRRR"
FT   gene            261267..261860
FT                   /locus_tag="YPD4_0228"
FT   CDS_pept        261267..261860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0228"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57137"
FT                   /protein_id="ACY57137.1"
FT                   /translation="MAFSPSIDVQYLHQLAWRPAQFAHPLWLAAVGVNPENYGYGRSRA
FT                   LDSALNGMLIQRRKFPQQRLPAVLNPRQQRQIAQRQRLPALCLALGVVSLQCDDYLRLR
FT                   RYRQVLSPLLNDDDIQQIIGMGYRGQWQASLSPQQLPDVALRLGQSLACQVRSNNIIWQ
FT                   AVSILLPPNPRALCLSRSMQAQTEAWLSRLERLL"
FT   gene            261857..262504
FT                   /locus_tag="YPD4_0229"
FT   CDS_pept        261857..262504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0229"
FT                   /product="putative type III secretion system apparatus
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57138"
FT                   /protein_id="ACY57138.1"
FT                   /translation="MNPFHLEIEKYGYPLPPGVVIPAAYLAEAMHSQDLLAQANAQAAE
FT                   ILQAAEQARVLLLDQAAEQADALISQAREQMETALLAQHVRWLVGAEQLESLLITQVRH
FT                   RILAAITTVVTTWSGEQPMSQILIQRLGDQAEKMAQQGELTLRVHPQHLPAVTTALGER
FT                   LRCVGDTEMAADQAQLSSPMLQLTLSLHHHLSQLVLWLQQSPDLFDEENVYE"
FT   gene            262497..264545
FT                   /locus_tag="YPD4_0230"
FT   CDS_pept        262497..264545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0230"
FT                   /product="secretion system apparatus protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57139"
FT                   /protein_id="ACY57139.1"
FT                   /translation="MSKSALVRGLTMITARQDIFLAVMLLVAVFMMILPLPTTMVDLLI
FT                   AINLAFSVILLMISIYLRDPLEFSVFPSLLLITTLYRLALTISTTRLVLLQHDAGEIVE
FT                   AFGQFVVGGNLAVGMIIFTIITVVQFIVITKGSERVAEVSARFSLDGMPGKQMSIDGDM
FT                   RAGAIDSVEAKRLRERVQKESRLFGAMDGAMKFVKGDAIAGIIVILINIIGGITIGVMQ
FT                   HKMSAEEAMNTYAVLSIGDGLCAQIPSLLISITAGIIVTRVPGSNKQSLANELAVQVGR
FT                   QPDALWLAAAILTVFALLPGFPFLIFITLAAAVAAPAFLLYRKNRRISQDGRANGGSEE
FT                   GGATGQRMTPGAVPLMLHCASNLHHPHLGRDIDGLRWRWFEHLGVPLPEVEIRCDPTLA
FT                   ENTLSVQVYQERVLEVVLPPDSLLLTRPCSSLVTNNQVLGAKMGSFDWLDAKQAMQART
FT                   LGIPYVEGHQRIITCLTRVFERYTAEFIGVQETRYLMDAMEGRYGELVKELQRQIPVGK
FT                   VAEILQRLVEENISIRDLRTIFGALVVWAPKEKDIVMLTEYVRIALRRHLCRRFSHNKT
FT                   WISVLRLGDGVEHLIRDSIRQTSSGTYSALEERQSLLILNKIKNAFAENQDAVLLTTLD
FT                   VRRFVRKIIERDLFVLPVLSWQELGDEMNLKVAGTIELIGDELDETA"
FT   gene            264532..265869
FT                   /locus_tag="YPD4_0231"
FT   CDS_pept        264532..265869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0231"
FT                   /product="flagellum-specific ATP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57140"
FT                   /protein_id="ACY57140.1"
FT                   /translation="MKLPDIARLTPRLQQQLTRPSAPPEGLRYRGPIVEIGPTLLRASL
FT                   PNVAQGELCRIEPQGMLAEVVSIEQEMALLSPFASSDGLRCGQWVTPLGHMHRVQVGAD
FT                   LAGRILDGLGAPIDGGPPLTGQWRELDCPPPSPLTRQPVEQMLTTGIRAIDGILSCGEG
FT                   QRIGIFAAAGVGKSTLLSMLCADSAADVMVLALIGERGREVREFLEQVLTPEARARTVV
FT                   VVATSDRPALERLKGLSTATTVAEYFRERGLKVLLLADSLTRYARAAREIGLAAGEPPA
FT                   AGSFPPSVFANLPRLLERTGNSDRGSITAFYTVLVEGDDMNEPVADEVRSLLDGHIVLS
FT                   RRLAGAGHYPAIDIAASVSRIMPQIVSAGQLAMAQKLRRMLACYQEIELLVQIGEYQAG
FT                   EDLQADEALQRYPAICAFLQQDHSLTRDPDTAHLDTTLEHLAQVVG"
FT   gene            265866..266267
FT                   /locus_tag="YPD4_0232"
FT   CDS_pept        265866..266267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0232"
FT                   /product="type III secretion system apparatus protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57141"
FT                   /protein_id="ACY57141.1"
FT                   /translation="MNHSQQRTLQRLLALRQRQERRLRQQLGQLRREQQQQEQQLENGR
FT                   RRHQQLCQQLQQLAQWCGMLTPREADEQKVLRQAVYQAERQAKKQLNAWVAQGRQQVSA
FT                   IERQQARLRRNQREQEKLRMLTEDESNRY"
FT   gene            266248..266646
FT                   /locus_tag="YPD4_0233"
FT   CDS_pept        266248..266646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0233"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57142"
FT                   /protein_id="ACY57142.1"
FT                   /translation="MSRIDIEGALPPLREQGYSKERSTHWDHERQRQQFARCFSSPLPR
FT                   IQNIACTVAGYDDNGLMETHYRIVSGPLCGTKVSVSMTAHGLRIVLSNTESKLIERLQR
FT                   IQNRWQRQLHQLGFPCLLEVTCADESDA"
FT   gene            266624..267586
FT                   /locus_tag="YPD4_0234"
FT   CDS_pept        266624..267586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0234"
FT                   /product="type III secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57143"
FT                   /protein_id="ACY57143.1"
FT                   /translation="MLTNLTPELRALSTLIGSGRQTAGVSVALTEIDGEGVYLPLHYGG
FT                   QECGLWLSQSCWQHWLNTTLATDNPQLLAAELVIAMANWAVTPLLALFTDLVVLAESPQ
FT                   KRSLPKQWAVTVAFELEGQPIIGVLQDWPQAALADTLSHWPCEAVTAPDLLWQSGLVAG
FT                   WCHLSLRQLQQLRPGEGLRLSMAAELDKEACWLWHHASPQIYIKLEGGNRMTIQQINEA
FT                   SDPLACGSRAESPPLAAVQLEDLPQTLVMEIGRLTLPLGEIKQLAVGQTLACQTHCYGE
FT                   VNICLNGQSVGRGSLLRCDEKLVVRIAQWGLQNGENIME"
FT   gene            267713..268363
FT                   /locus_tag="YPD4_0235"
FT   CDS_pept        267713..268363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0235"
FT                   /product="putative type III secretion apparatus protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57144"
FT                   /protein_id="ACY57144.1"
FT                   /translation="MELLNSSYQLIALLFMLSVLPLLVVMGTAFLKLSVVFSLLRNALG
FT                   VQQVPPNIAIYGLALVLTIFIMAPVGLDVQARLQNEELSNDIGALAHQIDQNALVPYRD
FT                   FLQRNTDIEQVTFFNDIVQNKWPERYRDSVKPDSLLILMPAFTLSQLNEAFKIGLLLFL
FT                   PFVAIDLIVSNILLAMGMMMVSPMTLSLPFKLLVFVLVDGWSLVLGQLVGSYL"
FT   gene            268892..269449
FT                   /locus_tag="YPD4_0236"
FT   CDS_pept        268892..269449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0236"
FT                   /product="type III secretion apparatus protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57145"
FT                   /protein_id="ACY57145.1"
FT                   /translation="MVMGFVAALPFWAMNMAGFLIDTLRGATMSTLFNPGMGVESSLFG
FT                   VLFTQILTVLFLISGGFNQVLAALYGSYDSLPIGQGIQPAADLLLFLQTEWQMMFELCL
FT                   CFALPALLVMVLADLSLGLINRSARQLNVFFLAMPIKSALALFLLLISLPYGLHHYLSR
FT                   MSDTEQKIGTLIPLIKGGNDVH"
FT   gene            269439..269858
FT                   /locus_tag="YPD4_0237"
FT   CDS_pept        269439..269858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0237"
FT                   /product="type III secretion apparatus protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57146"
FT                   /protein_id="ACY57146.1"
FT                   /translation="MSTEKNEKPTPKRLKEAKEKGQVVKSVEITSGVQLVALVIYFLLT
FT                   GYSLVEQAKALIRSSIIQLQQPLTLALARIGAECMTVLMHIVVVLGGALIVVTIIAGIA
FT                   QVGPLLATKAVSFKGERITPFKMLNNFSHCAACLS"
FT   gene            269858..270505
FT                   /locus_tag="YPD4_0238"
FT   CDS_pept        269858..270505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0238"
FT                   /product="type III secretion apparatus protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57147"
FT                   /protein_id="ACY57147.1"
FT                   /translation="MKSLLKVGVLTLIFGYLLMQYAPSFGYLTHCGSRCALPVFSTLMG
FT                   WLLGSLIACYLVFSLMDYAFQRYTIMKQLKMSHDEVKREYKDSNGDPHIKQKRRQLQHE
FT                   VQSGSFATNVRRSTAVVRNPTHFAVCLIYHPEETPLPIVIEKGHDEQAALIVSLAEQSG
FT                   IPVVENIALARALHRDVACGDTIPEQFFEPVAALLRMALELDYQPSSDDPPR"
FT   gene            270888..272102
FT                   /locus_tag="YPD4_0239"
FT   CDS_pept        270888..272102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0239"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57148"
FT                   /protein_id="ACY57148.1"
FT                   /translation="MSWPEFKSQYLVRFWAPLPAVIAAGILATYYFGLTGTFWAVTGEF
FT                   TRWGGHIMQLFGAQPQEWGYFKVIGLEGTPLDRIDGMMIIGMFAGCIAAALWANNIKLR
FT                   KPQHTIRIAQALVGGIIAGFGARLAMGCNLAAFFTGIPQFSLHAWFFALATAAGSYFGA
FT                   KFTLLPLFRIPIKLQKVTAASPLTQHPARAARRFRLGMVVLVLALGWSLIELFRQPKLG
FT                   IAMLCGIGFGLLIERAQICFTSAFRDLWITGRTHMAKAIILGMAVSTLGIFSYVQLGVE
FT                   PKILWAGPNAVIGGLLFGFGIVLAGGCETGWMYRAVEGQIHYWWVGLGNIIGATLLAYY
FT                   WDDFAPALATNYDKVNLLETFGPMGGLLVTYLMLALAFAAMLWWEKRFFRKQKATTSAL
FT                   IKESL"
FT   gene            complement(272446..273429)
FT                   /locus_tag="YPD4_0240"
FT   CDS_pept        complement(272446..273429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0240"
FT                   /product="LysR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57149"
FT                   /protein_id="ACY57149.1"
FT                   /translation="MSIDENTFAFSAKINNHAIYKHLENFIKIVECNSLSIAAHKLNIT
FT                   PSSTSRSLAQLEEKLGVVLLKRTTRSIVLTDAGDYLFHQARQLLLDLDETLVNTHSFYN
FT                   HPQGQLKITCSIAFGVCHLMHLFSQYKETNSDVCLSVDLNDQLVNLNEEHFDIALRITS
FT                   IPPPNFAIRRICTINWVYCGSKEYLMKRGVPATIEDLEQHDCLVNPNVSDAWLYKSTEG
FT                   ESVPLKIKNTVQANSSLGLLHAALHHQGIVCLPTYMLGDYITSGKLVPILLDYNAKDKE
FT                   YGLYALYYPSKYNDPKIRSFIDFMLDELSMDVPWDKWRADYQISLS"
FT   gene            273599..274885
FT                   /locus_tag="YPD4_0241"
FT   CDS_pept        273599..274885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0241"
FT                   /product="putative transmembrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57150"
FT                   /protein_id="ACY57150.1"
FT                   /translation="MSEISSSKSELKKLYKSVPFTQYDVGWVILCIGMAIGSGIVFMPV
FT                   QVGIKGIWVFIAAVIISYPAIYLLQNLYLRTLSESDNCTDYTSVITQYLGKNWGVGLGI
FT                   AYFLMLLHGMFSYSLAVTFDSASYIKTFGLTEGLLSDSIWYGLIILTVLVAIAAQGEKI
FT                   LFKVSGPMVCVKFGIIVVLGVVMVPYWDFNNISAFPELFSFLRDVLLTLPFTLFSILFV
FT                   QILSPMNIAYRKVESDKRIATYRAIRANRVAYIILAVAVLFFAFSFTFSISHEQAVSAF
FT                   EQNISALAIAAQVIPGSIVRIMTALLNIFAILTAFLGIYLGFQEAIKGIVVNIISRFIP
FT                   EENINQKVLHIGVCVGVILTLWLWVSTRFSILFFLQLGGPLFGVVSCLIPCYLVYKVPV
FT                   LHKLKGPTIWFISFFGILLCLSPFFKFFE"
FT   gene            274931..276112
FT                   /gene="metC"
FT                   /locus_tag="YPD4_0242"
FT   CDS_pept        274931..276112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metC"
FT                   /locus_tag="YPD4_0242"
FT                   /product="cystathionine beta-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57151"
FT                   /protein_id="ACY57151.1"
FT                   /translation="MNKKDISSFGISTQITQLGRNPQEQTGFVNTPIYRGSTVIFNTVD
FT                   DIVNNRAVFNYGTAGTPTIANLESAWTALAGAAGTVISPSGLGVIALALLTTLKAGDHL
FT                   LMPDSVYKPTRLLCAGLIARMGVETTYYDPLIGAEIETLMKPNTSTLFLESPGSQSFEI
FT                   QDIPMMTAITKRRGIATIIDNTWASPLFFAAHKHGCDLSLEAGTKYLGGHSDLLMGLVS
FT                   ANEQWWPKLRETYDSMAMLPGAEDCFLALRGLRTLHLRIKEAEKRGLEMAQWLKERPEV
FT                   LRVLHPAFPDCPGHEFWKRDFTGSSGLFSIVLKPEFTQKGLAEMLDNMSIFAMGFSWGG
FT                   YESLVIPFDCSEYRTVTKWNPGGLTIRLQIGLEDMEDLKEDLAQGFIRLASNS"
FT   gene            complement(276254..277054)
FT                   /gene="tauB"
FT                   /locus_tag="YPD4_0243"
FT   CDS_pept        complement(276254..277054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauB"
FT                   /locus_tag="YPD4_0243"
FT                   /product="putative taurine transport ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57152"
FT                   /protein_id="ACY57152.1"
FT                   /translation="MVDMAVTPVALLEASHLHYHVQQQALINDVSLHIASGEMVAIIGP
FT                   NGAGKSTLLRLLTGYLSPSHGECHLLGQNLNSWQPKALARTRAVMRQYSELAFPFSVSE
FT                   VIQMGRAPYGGSQDRQALQQVMAQTDCLALAQRDYRVLSGGEQQRVQLARVLAQLWQPQ
FT                   PTPRWLFLDEPTSALDLYHQQHTLRLLRQLTRQEPLAVCCVLHDLNLAALYADRIMLLA
FT                   QGKLVACGTPEEVLNAETLTQWYQADLGVSRHPESALPQIYLRQ"
FT   gene            complement(277047..278051)
FT                   /gene="hmuU"
FT                   /locus_tag="YPD4_0244"
FT   CDS_pept        complement(277047..278051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmuU"
FT                   /locus_tag="YPD4_0244"
FT                   /product="hemin transport system permease protein HmuU"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57153"
FT                   /protein_id="ACY57153.1"
FT                   /translation="MNGRVQPRLMLGFLLILLVILALGSANMGALSLSFRTLWNTSTND
FT                   AMWHIWLNIRLPRVLLAVVVGCALAVSGTIMQGLFRNPLADPGLLGISSGAALCVGLII
FT                   VMPFSLPPLLALYSHMVGAFIGSLAISTIIFTLSRWGHGNLARLLLAGIAINALCGAAV
FT                   GVLTYISDDQQLRQFSLWSMGSLGQAQWSTLLVASSLILPTCILGLLQARQLNLLQLGD
FT                   EEAHYLGVNVRQAKLRLLLLSAILIGAAVAVSGVIGFIGLVVPHLIRMRIGADHRWLLP
FT                   GAALGGACLLLTADTLARTLVAPAEMPVGLLTSLLGGPYFLWLILRQREQRSG"
FT   gene            complement(278048..278887)
FT                   /gene="hmuT"
FT                   /locus_tag="YPD4_0245"
FT   CDS_pept        complement(278048..278887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmuT"
FT                   /locus_tag="YPD4_0245"
FT                   /product="hemin-binding periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57154"
FT                   /protein_id="ACY57154.1"
FT                   /translation="MRLRLLSLPFILSLCAPLLPLNTLAAERIVTIGGDVTEIAYALGA
FT                   GDEIVARDSTSQQPQAAQKLPDVGYMRTLNAEGILAMKPTMLLVSELAQPSLVLTQIAS
FT                   SGVNVVTVPGQTTPESVAMKINAVATALHQTEKGQKLIEDYQQRLAAVNKTPLPVKVLF
FT                   VMSHGGLTPMAAGQNTAADAMIRAAGGSNAMQGFSRYRPLSQEGVIASAPDLLLITTDG
FT                   VKALGSSENIWKLPGMALTPAGKHKRLLVVDDMALLGFGLETPQVLAQLREKMEQMQ"
FT   gene            complement(278884..279921)
FT                   /gene="hmuS"
FT                   /locus_tag="YPD4_0246"
FT   CDS_pept        complement(278884..279921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmuS"
FT                   /locus_tag="YPD4_0246"
FT                   /product="hemin transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57155"
FT                   /protein_id="ACY57155.1"
FT                   /translation="MNASLYQQYVQAKAEHPGKYARDLATLMGISEAELTHSRVGHDAK
FT                   RLQSDARALLAALESVGEVKAITRNTYAVHEQVGRYENQHLNGHAGLILNPRALDLRLF
FT                   LNQWASAFTLTEETRHGVRHSIQFFDHQGDALHKVYVTEQTDMSAWEALLAQFIIPENP
FT                   ALQLEPLSTPEAVEPTADDATVDSEWRAMTDVHQFFQLLKRNNLTRQQAFRAVGDDLAY
FT                   QVDNNSLTQLLHIAQQDQNEIMIFVGNRGCVQIFTGLIEKVTPHNEWINVFNQRFTLHL
FT                   IETAIAESWITRKPTKDGFVTSLELFAADGTQLAQLYGQRTEGQPEQNQWREQIARLIN
FT                   KDIAA"
FT   gene            complement(280040..281233)
FT                   /locus_tag="YPD4_0247"
FT   CDS_pept        complement(280040..281233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0247"
FT                   /product="hemin receptor precursor"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57156"
FT                   /protein_id="ACY57156.1"
FT                   /translation="MTNRSTIQRDAQLRYNIKPLDQEWLNATAQVYYSEVEINARPQGS
FT                   AEEGREQTTEGVKLENRTRLFIESPASHLLTYGTETYKQEQTPGGATESFPQAKIRFSS
FT                   GWLQDEITLRDLPVSILAGTRYDNYSGSSDGYADVDADKWSSRGAISITPTDWLMLFGS
FT                   YAQAFRAPTMGEMYNDSKHFAIPIRPGLTLTNYWVPNPNLKPETNETQEYGFGLRFSDL
FT                   LMAEDDLQFKVSYFDTKAKDYISTRVDMQAMTTTSVNIDQAKIWGWDASMSYKTALFNW
FT                   DLAYNRTRGKNQNTDEWLDTINPDTVTSIVDVPVANSGFSVGWIGTFANRSSRVSSSTP
FT                   QAGYGVNDFYVSYKGQEAFKGMTTTMLLGNVFEKEYYTPQGIPQDGRNVKFFVSYQW"
FT   gene            complement(281230..282069)
FT                   /locus_tag="YPD4_0248"
FT   CDS_pept        complement(281230..282069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0248"
FT                   /product="hemin receptor precursor"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57157"
FT                   /protein_id="ACY57157.1"
FT                   /translation="MLRSTSDRFRWSSLSLAIACTLPLATQAADTTTTQTSSKKHSTDT
FT                   MVVTATGNERSSFEAPMMVTVIEGNAPTSQTAATAADMLRQVPGLTVTGSGRTNGQDVV
FT                   MRGYGKQGVLTLVDGVRQGTDTGHLNSTFLDPALVKRIEIVRGPAALLYGSGALGGVIA
FT                   YETVDAADMLQPGQNSGYRVYSSAATGDHSFGLGASAFGRTDDLDGILSFGTRDIGNIR
FT                   QSNGFNAPNDETISNVLAKGTWQIDSIQSLSANLRYYNNSAIEPKNPQTSAPSIPMS"
FT   gene            complement(282484..283134)
FT                   /locus_tag="YPD4_0249"
FT   CDS_pept        complement(282484..283134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0249"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57158"
FT                   /protein_id="ACY57158.1"
FT                   /translation="MRPWLIFGAGRGVGAHLLALANQHADSASNPRPVTLLIRNQQQAE
FT                   ELRNKGLTVVCGDACDPASVREACQLAGEDAAIISTLGNNNANYQGNRLIIDTAEQLGL
FT                   KRMLLVTSIGCGDSWPTLSPAARAAFGQAVREKSLAESWLQTSNLIYTLIRPGGLLDQP
FT                   ATGNAIRLQTEAHGMVTRADVAHHISQMIEDPATYYQAYALIEPGLARKVKMN"
FT   gene            complement(283168..283677)
FT                   /locus_tag="YPD4_0250"
FT   CDS_pept        complement(283168..283677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57159"
FT                   /protein_id="ACY57159.1"
FT                   /translation="MNRSPLAEFLATQPDGTLEQIAQDYQVSVLDVVRALPERVLVGAE
FT                   HFDRIWDSMTEWGDVTTLVHTADVILEHKGPLPSGTHRHGYFNLRSKQGLSGHIRAQNC
FT                   QAIALLERPFMGMATASVQFFNQQGEVMFKVYVGRDEHRQLRADGLAAFHQLAQQLLIE
FT                   DPTLVK"
FT   gene            complement(283710..285023)
FT                   /locus_tag="YPD4_0251"
FT   CDS_pept        complement(283710..285023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0251"
FT                   /product="coproporphyrinogen III oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57160"
FT                   /protein_id="ACY57160.1"
FT                   /translation="MNIDLMPYYAQPGPLPFPKRWATMPWRDSRPLPAESLQDSWQSLL
FT                   QKALPRNKRLLYLHIPFCATHCTFCGFYQNPLQSGSTERYTDYLLRELSMEADSPLLQG
FT                   GPIHAIYFGGGTPSALSAQQLHSIISQLRKSLPLAPDCEITVEGRIFNFDDERIDACLE
FT                   AGANRFSIGVQTFNTRIRQRMGRKADRDQAIRFLTDLATRDRAAVVCDLMFGLPHQTPE
FT                   IWQEDLAIVRQLPLDGVDLYALNLLPTTPLAKSVENNRVELPTLAQQCDFYCSGADSLA
FT                   QAGWHQLSNSHWARTTRERNLYNLLIKQGADCLALGSGAGGSLQGHAYMQHRSLDNYYR
FT                   LIDSGQKPLMMMTQASGEHPWRAKLQSGIEVGRLDLSELIADPYPLMPLISQWYQSNLL
FT                   KDNSFCLRLTDSGRFWASNIMQALQNIIPSLITAESHS"
FT   gene            complement(285364..286164)
FT                   /locus_tag="YPD4_0252"
FT   CDS_pept        complement(285364..286164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0252"
FT                   /product="putative methylenetetrahydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57161"
FT                   /protein_id="ACY57161.1"
FT                   /translation="MERKLSFEMNSAKNEKEMENIFKLIEFTDTLDPIYYTVNTEIGSS
FT                   VWSDTYRTVIELREKTDVPLIPHITINNKKEREIMQIIEKYINVGICEFFVIRGDKHVY
FT                   DQDNPINYGVELIELIRRSHKHIGIKTSLYPDFHKETTEVKEEIDWNERKYQLGVNEFI
FT                   SQLTLNTNALDFLSHWVDKERPFTPSIMPLGNFSFIEKFTSSNSIDYPLWIKKFANSKS
FT                   NSNEDKENIGIEIIRFLCREYLNQRERLHVFTLNKVDVMKKIFQ"
FT   gene            complement(286479..286967)
FT                   /locus_tag="YPD4_0253"
FT   CDS_pept        complement(286479..286967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0253"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57162"
FT                   /protein_id="ACY57162.1"
FT                   /translation="MLLSTKQFRHYTLALLLASGKPVDADDIYDKLSCSGPTLTRALKE
FT                   LRETYNAEIRYSKSTHSYQLTEKGTLTPKVLRHIKDAIASHMIIKSHEELVASHVILDK
FT                   EKKRSISLSLRMSVIRKIDRVVNQLEITRSEAVEILVNTYISELMLSVSQPPKGKKSV"
FT   gene            complement(287364..288323)
FT                   /locus_tag="YPD4_0254"
FT   CDS_pept        complement(287364..288323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0254"
FT                   /product="putative ATP/GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57163"
FT                   /protein_id="ACY57163.1"
FT                   /translation="MKSTPSAYALGATLYMPATRTDIADIIIHNKISGLRSLVICLEDA
FT                   VSEDDVPLAISQLSTLLGTLAVEKKRDGSAHWPLIFVRPRHEAMGLALITRFNLSAING
FT                   FVLPKFTQASITTWWEIMKETHLCMMPTLETEDVFDVAKMSTLARELENHPSRQRIVAL
FT                   RIGGNDLMSVISMRRSRKLTLYDGPMGYVIKMLVSVFCPKNFALTAPVCEQIDNPQLLE
FT                   TELALDIAHGLVGKTAIHPSQIEVIQRALMVDTHDHADALRILNSTQAVFKSQGAMCEP
FT                   STHKRWAAAILERAQYYGIMPDFTAMAVRDAPRKHQSG"
FT   gene            complement(288323..289402)
FT                   /locus_tag="YPD4_0255"
FT   CDS_pept        complement(288323..289402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0255"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57164"
FT                   /protein_id="ACY57164.1"
FT                   /translation="MHDITPFSGSYLPDDIQFLLKPIQIEMTPVEVKEKLIQSGARHYS
FT                   DMLSQEPAPTEHHLTLFARALDQGATRMAREVVMLAKALINRFGDTPIVLASLVRAGVP
FT                   LGVMLHHTLRALGKTSFHYGISIIRDRGIDEVALSYIEQKHGTEGLVFVDGWTGKGAIT
FT                   GELTRSLQGRPGYPELPRLVVLADPCGCSWLSATDDDWLIPFGIMGAPVSGLVSRSLWS
FT                   EKGLHGCVHCEHLQEFECSQLLVNTVADCRQQLDLSQIPAAEWDYQQNAALRIQSHQVV
FT                   KKMAEQFEINSVNRIKPGIAEATRAVLRRVPDHVLVRHIDDPDVSLLVYLAKQKKIAIK
FT                   EVGNELGQYRAITIIKKVI"
FT   gene            complement(289395..290207)
FT                   /locus_tag="YPD4_0256"
FT   CDS_pept        complement(289395..290207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0256"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57165"
FT                   /protein_id="ACY57165.1"
FT                   /translation="MNKPVFLCDLDDTLFQTRRKMVDELDLPPFRVGALDRSLTPRSFM
FT                   TEEQSMLVDWLLEHAEFIPVTARGTEEISRVNIPFSSWAITTHGAVILTPDRQPDAGWQ
FT                   DTVLTNLQPYRDRLIAMESRINDMMAERGLNAWCRINYEYGDTPVYFVMKHRDSTQIAE
FT                   LYAFNDQLESLFSTDGFYIHRNSNNIAWLPVCIEKGLATTYLLDKLRHEHGAFPVLGFG
FT                   DSLSDFSFMRHCHWFGMPAKSQFSQALTSHLFDNTTFNKNNVNGDNDA"
FT   gene            complement(290200..291336)
FT                   /locus_tag="YPD4_0257"
FT   CDS_pept        complement(290200..291336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0257"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57166"
FT                   /protein_id="ACY57166.1"
FT                   /translation="MMTTQPPVYRRELSGGTLTVIPNSSNIPLDSLFDIAERRNPKRAF
FT                   LFVSKVLGRHIPVSPATMRNVYRQLAERFPADLPGPVLFIGMAETAVGLAAGVFQELRG
FT                   TVAEPVFLTSTRHPVDGDLLCEFKENHSHATDHLLYLPSDPVLRARLQRARSVVLIDDE
FT                   ATTGNTFINLLQALRDANLNGLEKVVAVTLTDWSGSALTERCPLPVTTVSLITGEWNWS
FT                   PIPDAPVPVMPACNVTARGKVAITDKQNWGRLGMDETRADIGHKVHVLAGEKVLVLGTS
FT                   EFVWQPFLLAERLEHAGANVKFSSITRSPIAQGHAINSIIAFSDNYGLGIPNFLYNVAH
FT                   QHFDRIIVCVETPAESIDPTLIEQLRTVAPCVEVIAYE"
FT   gene            complement(291348..292409)
FT                   /locus_tag="YPD4_0258"
FT   CDS_pept        complement(291348..292409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0258"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57167"
FT                   /protein_id="ACY57167.1"
FT                   /translation="MKKNIWFMGGLSSQRDIISGVKNTSELHGNAIQVFASHHQHRYEI
FT                   LEKADVAFIEPSDLDTKMAFIRHIVKAFDIEAIHTGRSCLWFEQHRAAIEGLGVKLTTG
FT                   AQCPATFTLADNKVEYAAYMAQKGLPVVPSIQIASPDELREWLANPPFDTEKLCIKPVT
FT                   GIYGMGFWKLDQSISAMDCFDRTDNRVVHPDLYLAALERTEKMQPMVLMPYLPGPESSV
FT                   DMLVEKGKVIAAVARRKEGSVQHLHQSGAAFELAKSSAELMQADGLVNVQTRCDHHGQP
FT                   LLLEINLRPSGGIDYTRHSGVNLPGLFALRQLDLMSQDEVSSQAVAHFKPVSVRAMTDA
FT                   LPFPAELQNLTHF"
FT   gene            292685..293278
FT                   /gene="terZ"
FT                   /locus_tag="YPD4_0259"
FT   CDS_pept        292685..293278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="terZ"
FT                   /locus_tag="YPD4_0259"
FT                   /product="tellurium resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57168"
FT                   /protein_id="ACY57168.1"
FT                   /translation="MISLSKNQTISLAKESSALSRVQFGLGWDPVKKKKSFLGGLFGGG
FT                   SASDSIDLDASCVMLSQAGKPVDTVSFRHLTSKCRSVQHTGDNLTGEGDGDDEVINVDL
FT                   SRLPAEVEYLAFTVNSFRGQTFNEVENAFCRVVDQTGKELARYVLTEQGSHTGIVISSL
FT                   RRNNGQWDFTAHGRACRGRTIEDMMSEIIETVVR"
FT   gene            293278..293910
FT                   /locus_tag="YPD4_0260"
FT   CDS_pept        293278..293910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0260"
FT                   /product="tellurite resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57169"
FT                   /protein_id="ACY57169.1"
FT                   /translation="MNLMPGGNAPVASQTLTVRVLSGASVDVSAFRLYASGKVRGDTDM
FT                   VFYGQPVTDDSTIRLSGQGVNTAFSVNLQAINHDVQKIAFTATCDGNQTLSQLGNLSIQ
FT                   VELNGSVLMKGDVETQGRQEAALILGELYRRNTEWKFRFVAQGFNGGLKPLAEHFGVVV
FT                   EDEPAAPTPVPTPVSTPVANRAASRQTDQSEQGVSDKRKTGHQPDKT"
FT   gene            293864..294463
FT                   /gene="terA"
FT                   /locus_tag="YPD4_0261"
FT   CDS_pept        293864..294463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="terA"
FT                   /locus_tag="YPD4_0261"
FT                   /product="putative tellurite resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57170"
FT                   /protein_id="ACY57170.1"
FT                   /translation="MSLTKEKPVISLTKRDDFGEIRVNLNWHRGGGAPAKGFLQGIFNS
FT                   NKGIDLDLGAFVALNDGSRGVIQALGNNFGSYHSEPYVQLQGDDRTGDVSDGEWMHING
FT                   REWKHVKEVLIFAFIYEGVPSWGSTDGIVTINVPGQAPIETQMNEGNDRKNMCAVARLV
FT                   NESGNIKVERINRYFSGHKEMDEAFGWGFRWKAGSK"
FT   gene            294496..294951
FT                   /gene="terB"
FT                   /locus_tag="YPD4_0262"
FT   CDS_pept        294496..294951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="terB"
FT                   /locus_tag="YPD4_0262"
FT                   /product="tellurite resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57171"
FT                   /protein_id="ACY57171.1"
FT                   /translation="MSFFNKVKNAISAGRTELTNQVGRFKNRKFMEGTVAVCAHISMAS
FT                   NGAGPEEKQKMIMFIKQSPELSVFDTNEVIEFFNKLVTSYEFDADIGKGEAMKYIMALK
FT                   SQPEAAQLALRVGIAVAKSDGVFDEMEEAAAREICVTLGFVPADFQL"
FT   gene            294973..296010
FT                   /gene="terC"
FT                   /locus_tag="YPD4_0263"
FT   CDS_pept        294973..296010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="terC"
FT                   /locus_tag="YPD4_0263"
FT                   /product="tellurium resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57172"
FT                   /protein_id="ACY57172.1"
FT                   /translation="MESTHIGFPIETVAVFILLSVGAICIDLFMHRHDKPISLKSAALW
FT                   SLFWVAIAFVFAGFLYLHHGAEAASLFVTGYALEKVLSIDNLFVMMAIFSWFAVPDRLR
FT                   YRVLYWGIIGAIVFRGIFVAIGTGLLMLGPWVEVVFAIVVAWTAVMMLRKGDDDDAIED
FT                   YSQHIAYRLVKRFFPIWPKLRGNAFILSQKEVDAELAKPENADVQVGRKGGVARYATPL
FT                   MLCLAVVELSDVMFAFDSVPAVIAVSREPLIVYSAMMFAILGLRTLYFVLEALKQYLVH
FT                   LEKAVIVLLFFIAAKLGLNASDHFFNHGYDISANVSLFVVIGVLAIGIVASFLFPEKDS
FT                   KEGQH"
FT   gene            296074..296652
FT                   /gene="terD"
FT                   /locus_tag="YPD4_0264"
FT   CDS_pept        296074..296652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="terD"
FT                   /locus_tag="YPD4_0264"
FT                   /product="tellurium resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57173"
FT                   /protein_id="ACY57173.1"
FT                   /translation="MGVSLSKGGNVSLSKEAPTMTNVLIGLGWDARSTDGQDFDLDASA
FT                   FLLTANGKVRNDADFIFYNNLKSSDGSVMHTGDNRTGEGEGDDESLKIKLPLIPADVDK
FT                   IVFVVTIHDAQARRQSFGQVANAFIRLVNDDNGVEIARYDLSEDASTETAMLFGELYRH
FT                   NAEWKFRAVGQGYAGGLSSVCAQYGINAS"
FT   gene            296836..297411
FT                   /gene="terE"
FT                   /locus_tag="YPD4_0265"
FT   CDS_pept        296836..297411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="terE"
FT                   /locus_tag="YPD4_0265"
FT                   /product="tellurium resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57174"
FT                   /protein_id="ACY57174.1"
FT                   /translation="MAVSLVKGGNVSLTKEAPTMNIAVVGLGWDARVTDGSEFDLDASV
FT                   FMVGENGKVLSDQHFIFFNNKVSPCGSVVHQGDNRTGAGDGDDEQIKIDLKKVPADVKK
FT                   IIFSVTIYDAEARKQNFGMVSNSFMRVVNEDNSAEIARFDLSEDASTETAMIFGELYRN
FT                   NDEWKFKAVGQGFAGGLSALASQHGVSV"
FT   gene            298124..298762
FT                   /locus_tag="YPD4_0266"
FT   CDS_pept        298124..298762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0266"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57175"
FT                   /protein_id="ACY57175.1"
FT                   /translation="MKKPLTQIAILSSLVVSISAASAAVPTAELKVVGTMTVPSCTVVS
FT                   PDAGIYDIGKLSSSLVKPGTTVTVLAQINKTWTVNCDANTYLNFTPVDNRVGSSSDGSA
FT                   AAFGLGKINDTGKIGYYTVQMRNATVDGKKSGVFTASSASFSQADTSYLNRGQRTGWAA
FT                   GANTQNSGKVFVADLLVTPVLAGTNTMNGAITEDAKIDGSLTMNFAFGI"
FT   gene            299013..301391
FT                   /locus_tag="YPD4_0267"
FT   CDS_pept        299013..301391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0267"
FT                   /product="putative outer membrane fimbrial usher protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57176"
FT                   /protein_id="ACY57176.1"
FT                   /translation="MVARCINLQCIAFLFSFFPTLAFPVTEEGEVVFDIETLERLGYSA
FT                   ELAKFFSGQDRFLPGQHDVTIIINASKTYRIAATFDSEGKLCMDKALLMALKLRNTESD
FT                   GSCENMEARWPGMVVKLFPGQFRVEITLPQEAFDPEMEGSEYQQGGHALLLNYNIFGQR
FT                   VESNNSRFNLVQGQFEPGINFKNWVLRNRGSYSYNQGVSQYYNQETSALRAVESLKSVV
FT                   QLGEFGLVGNTFSGLPVTGIQLYSDNAQRDDTQLIVPIEGIANTNATIEIRQRGRVIYR
FT                   TIVAPGPFSLSNISNFSSGVNTDVSIIEEDGTQQNFTVTSALDINAEQQASIYQLAVGR
FT                   YRDMFTGEDRPSPLLLSGEMSFNPAATFYMTSAGLLSSGYQNIRVQNLYSGWDQAWFSA
FT                   AASYANTKDAGQGYQFSVQNQMTINGNFGVSWSSVYGSANYWLPDDALSSSNNLNDLMF
FT                   GKLKNATSVAVSWVHPRWGAFSYALSNNMYYQASGRTYHIFSISEQFGRATTILSSQLS
FT                   SQGQNSLYVGINMPLGNGTLSGRVQRNNGNVALGSTYQGRWGDNKDYSVGISGDNRQRR
FT                   INGSMNIRTAYSQLTGGVSQATNNSRSAYLSSRGSVAYVNNTFATSSSSVGDTFAVVNI
FT                   PNQPGLRVSSPSSGIAITDYAGIALLPLVRPYTASKVQISTQTLPLNIRLNNTSADLLM
FT                   TRGSVATHHFETTETRQLLLTIRGSDGEMLPIGANVLDEKGNFLGTIIGDGNFMLENKA
FT                   IGVTLRVKANNRDECRVNYREPEKFDPDVLYEVADAVCQ"
FT   gene            301463..302206
FT                   /locus_tag="YPD4_0268"
FT   CDS_pept        301463..302206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0268"
FT                   /product="putative fimbrial chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57177"
FT                   /protein_id="ACY57177.1"
FT                   /translation="MQNFPTHHRDIGATIIYVNSVNRFNIFFVFTLLILLSSWSAVSYA
FT                   SFKLESTTVILQESEARTSFTIDNISSNPILLVTKLTDLDGKSFSKQILISPPVTRINA
FT                   GQSQQVNFVLKKGSVLNNEVLLKASFEGVEQVPGNAAVMPIRQEIGFLIQPSAVPQIRM
FT                   PWQTLVFSISGNNLVIKNPGKHVVRLGPQIILVPSNEVVALGNPYIMPETSKLFPITSS
FT                   PTAVKVTPLSRYGFVQTEVTLPVTR"
FT   gene            303664..304983
FT                   /locus_tag="YPD4_0269"
FT   CDS_pept        303664..304983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0269"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57178"
FT                   /protein_id="ACY57178.1"
FT                   /translation="MMHTENNSPSGLIPLPDWYPVAFSHLDAMEYASVTRLWHHEPVLR
FT                   DLVDELDKRNPGLITFTHCPHCHSADICPGTRPEEYRCRTCHRCSSPYTHTPFFDLHHA
FT                   RHSRLYAVLVTLWGTWQVEDAAWLSDCKSKQIWKQYCHRLKPILALIGGRAVTHTPRYL
FT                   RGFTPGQQGLHCPACASTQLVYSETMPVGNPEVHCQVCQTDFVMYPDIPKGIDPFAVNT
FT                   PQYDIPLPRWFSRLFSHASQAQYQHLREVWQREPVLREAVDRLDAQNPEQGAVYACPYC
FT                   QNKHISPRKTASSIEGYYCPACDNPFTATTGTVFTRMRQEHFWRLYAVLVMLWTQWRPT
FT                   QIFELCQLRSVHPFLTYHKRLAPLLAEFDGAPITPYPRNLLGFTPGQQGVCCVYCQSTK
FT                   LITEGITVMPLDNPYICCLDCGQRFMLRVWRKQVKSNEKK"
FT   gene            305992..308049
FT                   /locus_tag="YPD4_0270"
FT   CDS_pept        305992..308049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0270"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57179"
FT                   /protein_id="ACY57179.1"
FT                   /translation="MKIIDKNVSTYETLQKGFNLRWPPNVEQGAETIYICTTPDEVFAA
FT                   TNTALAAGNRITVRSGGHCYEGFVSNKLSTERLSIIDLGEMSGLDYDEDKTITSLWDAN
FT                   KNTYRFKSLTGNQNWNGYVSLYKRSGRTIPGGSCYSVGVGGHISGGGYGLLSRLHGLTV
FT                   DWVTGVDILVPVGNAHRLAFRHVRADSVSEVDRELLMACCGAGGGNFGIIIAYYFDDLP
FT                   KAPQKAYWIPLTYPWSSLKATFPAFLKAYWQWFADNDVNATSTKEGVGNGGLFTLLKLN
FT                   HIDASDNVVLAIQYTGPNGQVGGANDIPLNDFIEKMNAAAGMTPTIYDDFILPNIPPFK
FT                   HLYPGRKIGRTVDESASMDWLHVTQMINGSGSNQRGKYKSDYQIKQFSDEMCHALLTHL
FT                   TTATADKRFNQSLVQIDSYGGAINSRGIGATAVSQRNSLLKAQYQTYWTNEADDQTHLT
FT                   WIRNIYAAVHNGKPAPPEFEGCYINYPDIDMKYTDSGEEDPNWLNLYYGWDTQLIKRLI
FT                   ALKARIDPNNIFHHELSIPLVTELPKAPVNLHSTGQTTTSISLMWGSSIGALPVASYAI
FT                   YRDGHEVKLLNGTQTSAEDAGLQPNTEYRYFVAAGDEHGNLSVPSNVLTVSTQGTHPAW
FT                   VLNGSYAVGDVVSNLGKLWRCIQSHVAYDPLWAPGTNGGITLWAGYTAGR"
FT   gene            complement(308393..312202)
FT                   /locus_tag="YPD4_0271"
FT   CDS_pept        complement(308393..312202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0271"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57180"
FT                   /protein_id="ACY57180.1"
FT                   /translation="MHIQFREPISTSPAQPDAGRQHLFSRVPAAVMNPITLAIIVAFST
FT                   LVLPQTAWAACNSSGVGTYVCEGENNTAISLFGTDIAVETRPGFGITEHEITDSALSLT
FT                   GSGTISYLDTNSSALDTDSRYSLYIKNDTLITEQSASINVQSNGSISSGVYIDNQSSDD
FT                   STIRVDLSGILSSSLSGAPALSIFSSAGNDSTIILNTHAISGVTGIQSDNNSQNGATIT
FT                   HVDVTGDINVENSGVSIRNAANGGTSIINFNSKSINTEYNSFYIQNTNYVGGVITDINI
FT                   DGDISSANSQAARIYNYTNGGLASLRFRANNVTGSTGLYIDNSSQNGAVTDIILTGDLT
FT                   ATSGSALQANAYSDEGNIETAIKLNNVYSLYDALNISDYTRSGNILHDLDISGTITAEN
FT                   GTGIKVMGAAGEGSSTMLINVNNITSSSQSLDINNYNFLGSAFSAITATGHLTAEWGQG
FT                   AMLQTHSSLGDATTLIHFNDITAMSSGISLINEANQGTSTADITVTGQINVSHGEGITL
FT                   NALTTDGRTLVNVDVNNIASEYDAIRLYNYNYNDNYATGVDDGTGADNGTSTIDLITRG
FT                   ALVSQQGYGINIETNTADTYVTVGGLVHGGNGTAIGIHRLDNIQTSATLELQSGYALEG
FT                   VTQALVFTGSYAEINDAALDLANSHLVLGGAGDAAFDLTRIDNREEAILDGDPNRITGF
FT                   GTLTKTNNSIWTLTGANMADGDANAFLSANIAGGILVLDNATLGLTPDAGALTGATVNR
FT                   LSAADIAADPTRVATETGALTLAEGGALSSLGDSVLSGNLISAGGILLSNHYTGGNGAA
FT                   TDDRLTVTGTYFGENNGSGEGAWLALDTVLGDDDSATDRLVINGDATGTTSVRVNNAGG
FT                   LGDKTLNGINLITVDGLAQDDTFLLAGDYVTTDGYQAVVAGAYAYTLQADGEAATAGRN
FT                   WYLSSELMLTEGVRYQVGVPLYEQYPQVLAALNTLPTLQQRVGNRYGAPGALADLNFDD
FT                   NQWAWGRIEGSHQVTDPARSTSGSQREIDVWKLQTGIDVPLYQSQGGSLLTGGVNFTYG
FT                   KAKADIHSFFGDGRINSAGYGLGTSLTWYGNNGVYVDGQLQTMWFDSDLSSRTAGHAVA
FT                   SGNNGRGYTSAIEAGKGYTLSHGLSLTPQMQVTYSRVDFDTFRDPFDSEVSLQEGDSLR
FT                   GRLGVSLNKETTWSAKDGTTRRSHIYSHLDLHNEFLNGSKVQVSGVEFATRDERQSVGL
FT                   GAGGTYEWQNGRYAVYGNVNLLGATRNISDNYAVGGTIGARVSW"
FT   gene            313034..313558
FT                   /gene="ubiC"
FT                   /locus_tag="YPD4_0272"
FT   CDS_pept        313034..313558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiC"
FT                   /locus_tag="YPD4_0272"
FT                   /product="putative chorismate--pyruvate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57181"
FT                   /protein_id="ACY57181.1"
FT                   /translation="MFIGDASILKPIQWCATEHPELPADIADWLMELGSMTRRFEQHCQ
FT                   RVHVEPQRECFITRDALGEEAEHLPVSQRYWLREIVLFGDNVPWLLGRTVIPEETLSGP
FT                   DRALVDLGTLPLGRYLFSGDALTRDYIHVGRQDNLWARRSLLRLSGNPLLLTEVFLPAS
FT                   PLYTHCDSIPK"
FT   gene            313724..314590
FT                   /gene="ubiA"
FT                   /locus_tag="YPD4_0273"
FT   CDS_pept        313724..314590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiA"
FT                   /locus_tag="YPD4_0273"
FT                   /product="4-hydroxybenzoate octaprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57182"
FT                   /protein_id="ACY57182.1"
FT                   /translation="MKGSTVHTKWQAYCRLMRIDKPIGSLLLLWPTLWALWLAGRGIPE
FT                   AKILVVFVLGVFFMRAAGCVVNDYADRHIDGFVKRTASRPLPSGTISEKESKILFVVLI
FT                   LLSFGLVLTLNSMTIWLSLAALALAWIYPFMKRVTHLPQVVLGAAFGWSIPMGFAAVSE
FT                   SLPLVCWLLLLANICWTVAYDTQYAMVDRDDDLRIGVKSTAILFGQHDKLIIGLLQLAT
FT                   LLLMVAIGWLMNLGGAFYWSILLAGALFTHQQKMIAQREREPCFRAFLNNNYVGLVLFL
FT                   GILISYW"
FT   gene            complement(314771..317248)
FT                   /gene="plsB"
FT                   /locus_tag="YPD4_0274"
FT   CDS_pept        complement(314771..317248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsB"
FT                   /locus_tag="YPD4_0274"
FT                   /product="glycerol-3-phosphate acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57183"
FT                   /protein_id="ACY57183.1"
FT                   /translation="MSGWRKIYYKLLNLPLKLLVKSKVIPADPVSELGLDPSRPILYVL
FT                   PYNSKADLLTLRAQCLAQDLPDPLIPLEIDGVQLPSHVFIENGPRVFRYYVPKQESVKL
FT                   FHDYLDLHRNNPALDIQMLPVSVMFGRSPGREGHGTPHLRVLNGVQKFFAVLWLGRDSF
FT                   VRFSTTVSLRRMASEHGTDKTIAHKLARVARMHFSRQRLAAVGPSLPARQDLFKKLLAS
FT                   KAIEKAVADEARSKKISHEKAQQNAITLMEEIAANFSYEAVRLSDRVLSWTWNRLYQGI
FT                   NVHNAERVRQLAQDGHEIVYVPCHRSHMDYLLLSYVLYHQGLVPPHIAAGINLNFWPAG
FT                   PIFRRLGAFFIRRTFKGNKLYSTVFREYLGELFTRGYSVEYFVEGGRSRTGRLLEPKTG
FT                   TLSMTIQAMLRGGTRPITLVPIYIGYEHVMEVGTYAKELRGAIKEKENLLQMLRGLRKL
FT                   RNLGQGYVNFGEPLPLTTYLNTHVPQWRDAIDPIEAQRPSWLTPAVNDLANQIMVRINN
FT                   AAAANAMNLCSTALLASRQRSLTREQLLEQLDCYLQLMRNAPYAKDTTVPDKTPEELLN
FT                   HALNMNKFEVEKDTIGDIIILPREQAVLMTYYRNNIQHLLILPSLIASMVMYHRRITRT
FT                   ELLHKISMIYPMLKAELFLHYSKEQLPETLDTLIDELARQQLICDKGSELVLNPARIRP
FT                   LQLLAAGVRETLQRYAITLSLLSATPSINRGALEKESRIMAQRLSVLHGINAPEFFDKA
FT                   VFSTLVATLREEGYISDSGDAIQEHTLEVYNMLSALMTPEVKLTIESVSMPAETSNQPE
FT                   APETPEPEGKTES"
FT   gene            317376..317747
FT                   /gene="dgkA"
FT                   /locus_tag="YPD4_0275"
FT   CDS_pept        317376..317747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dgkA"
FT                   /locus_tag="YPD4_0275"
FT                   /product="diacylglycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57184"
FT                   /protein_id="ACY57184.1"
FT                   /translation="MANQSTGLTRIYKAAGYTVKGLTAAWNNEAAFRQESVAAVIAIIL
FT                   AFWLDVGAIARILLICSVVLVLIVEVINSAIEAVVDRIGSEFHALSGRAKDMGSAAVFL
FT                   TILMALFVWITVLWQHVAR"
FT   gene            317872..318480
FT                   /gene="lexA"
FT                   /locus_tag="YPD4_0276"
FT   CDS_pept        317872..318480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lexA"
FT                   /locus_tag="YPD4_0276"
FT                   /product="LexA repressor"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57185"
FT                   /protein_id="ACY57185.1"
FT                   /translation="MKALTTRQQEVYDLVRDHLAQTGMPPTRAEIAQRLGFRSPNAAEE
FT                   HLKALARKGVIEIVSGASRGIRLLMEEEEGLPLIGRVAAGEPLLAQQHIEGHYKVDPSL
FT                   FKPGADFLLRVNGMSMRDIGILDGDLLAVHKTQDVRNGQVVVARIDDEVTVKRLKKQGN
FT                   IVHLLPENSEFQPIVVDLREQSFTIEGLAVGVIRNGDWI"
FT   gene            complement(318682..319200)
FT                   /locus_tag="YPD4_0277"
FT   CDS_pept        complement(318682..319200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0277"
FT                   /product="regulator"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57186"
FT                   /protein_id="ACY57186.1"
FT                   /translation="MNMMNPINQEKLLAQAESLCQQRNVRLTPQRLEVLRLMAQQPGAI
FT                   SAYDLLDLLRVAEPQAKPPTVYRALDFLLEQGFIHRVESANSYVLCHHFEEPTHTSALF
FT                   ICDRCKIVTERPTVGIEEALAQLAKQSGFTLRHSVVEAHGLCTECGVVEACESHDDCEH
FT                   DHSIVVKKK"
FT   gene            319446..320483
FT                   /locus_tag="YPD4_0278"
FT   CDS_pept        319446..320483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0278"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57187"
FT                   /protein_id="ACY57187.1"
FT                   /translation="MHEAQTFSSTPATKPQYPLQRFSVAPMLDWTDRHCRYFHRLLTKQ
FT                   ALLYTEMVTTGAIIHGKADYLAYSEQDHPVALQLGGSDPQALAHCAKLAEQRGYNEINL
FT                   NVGCPSDRVQNGRFGACLMGEADLVADCIKAMRDAVAIPVTVKTRIGIDQLDSYEFLCE
FT                   FVQTVAERGECEIFTIHARKAWLSGLSPKENREVPPLDYERVYQLKRDFPALTIAINGG
FT                   VKTLAEAKEHLKHLDGVMMGREAYQNPGILTQVDRELFDPNAPVVDSVKAIEALYPYIE
FT                   QELSQGAYLGHITRHILGIFQGIPGARQWRRHLSENAHKPGAGVSVVEEALALVSPSYY
FT                   ESVGG"
FT   gene            complement(321571..322554)
FT                   /gene="qor"
FT                   /locus_tag="YPD4_0279"
FT   CDS_pept        complement(321571..322554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qor"
FT                   /locus_tag="YPD4_0279"
FT                   /product="quinone oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57188"
FT                   /protein_id="ACY57188.1"
FT                   /translation="MAKHIQFTTTGGPDVLQYLEFTPSDPAPHEVQVENKAIGINYIDT
FT                   YVRSGLYPPAHLPSGLGTEAAGIVSKVGAAVSSVKVGDRVVYAQSALGAYSEVHNVPAD
FT                   KIALLPEQISFEQAAASFLKGLTAYYLLRQTHEIKPGEVFLFHAAAGGVGLIACQWAKA
FT                   LGAKLIGTVGSDEKAQLAKAAGAWATINYRTENIAQRVAELTEGEKVGVVYDSVGKSTW
FT                   EASLDSLKRRGLLVSFGNASGPVTGVNLGILNQKGGIYVTRPSLNVYVANRQELESASQ
FT                   QLFSMITSGAINVDVAQAQQFPLRDAQRAHETLEGRQTTGSSLLIP"
FT   gene            322886..324292
FT                   /gene="dnaB"
FT                   /locus_tag="YPD4_0280"
FT   CDS_pept        322886..324292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaB"
FT                   /locus_tag="YPD4_0280"
FT                   /product="replicative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57189"
FT                   /protein_id="ACY57189.1"
FT                   /translation="MAAKKPTNKMTEPRDRQMEGLKLPPHSLEAEQSVLGGLMLDNERW
FT                   DNVSERVASKDFFSRPHRRIFTEMQRLLENSKPIDLITLSESLEQKGDLDSVGGFAYLA
FT                   ELSKNTPSAANIGAYADIVRERAVVREMISVANEIADAGYDPQGRSSEDLLDLAESKVF
FT                   QIAESRASKDEGPKSVDRILEDTVARIEQLYQRPHDGVTGVSTGFTDLDKKTAGLQKSD
FT                   LIIVAARPSMGKTTFAMNLCENAAMMQDKPVLIFSLEMPGDQIMMRMLASLSHVDQTRI
FT                   RTGQLDDEDWARISSTMGILMEKRNMYIDDSSGLTPTEVRSRARRIFREHGGLSLIMID
FT                   YLQLMRVPSLSDNRTLEIAEISRSLKALAKELQVPVVALSQLNRSLEQRADKRPVNSDL
FT                   RESGSIEQDADLIMFIYRDEVYHENSDEKGIAQIILGKQRNGPIGSVRLKFNGQWSRFD
FT                   NYAGPQYDDE"
FT   gene            324389..325468
FT                   /gene="alr"
FT                   /locus_tag="YPD4_0281"
FT   CDS_pept        324389..325468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alr"
FT                   /locus_tag="YPD4_0281"
FT                   /product="alanine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57190"
FT                   /protein_id="ACY57190.1"
FT                   /translation="MKAATAVIDRHALRHNLQQIRRLAPQSRLVAVVKANAYGHGLLAA
FT                   AHTLQDADCYGVARISEALMLRAGGIVKPILLLEGFFDAEDLPVLVANHIETAVHSLEQ
FT                   LVALEAATLSAPINVWMKLDTGMHRLGVRPDQAEAFYQRLSACRNVIQPVNIMSHFSRA
FT                   DEPEVAATQQQLACFDAFAAGKPGKQSIAASGGILRWPQAHRDWVRPGIVLYGVSPFDA
FT                   PYGRDFGLLPAMTLKSSLIAVREHKAGESVGYGGTWVSERDTRLGVIAIGYGDGYPRSA
FT                   PSGTPVWLNGREVSIVGRVSMDMISIDLGPESTDKVGDEALMWGAELPVERVAACTGIS
FT                   AYELITNLTSRVAMEYLGE"
FT   gene            325654..326847
FT                   /gene="tyrB"
FT                   /locus_tag="YPD4_0282"
FT   CDS_pept        325654..326847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrB"
FT                   /locus_tag="YPD4_0282"
FT                   /product="aspartate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57191"
FT                   /protein_id="ACY57191.1"
FT                   /translation="MFQNVDAYAGDPILSLMESFKADNRAHKVNLSIGLYYNEQGEIPQ
FT                   MQAVDAAEAQLSTQPHGTPVYLPMEGLQSYRTAIQQLLFGHDHPMLVQQRVATIQTVGG
FT                   SGALKVGADFLNHYFPDSQVWVSDPTWENHVAIFSGAGFKVNTYPYFDNDKLAVKFDPM
FT                   LATLQQLPARSIVLLHPCCHNPTGSDLTNAQWDRLIDVVKERELIPFLDIAYQGFGAGL
FT                   NEDAYAIRAMAAVGLPCLISNSFSKIFSLYNERVGGLSVVCESDEAAGRVLGQLKATVR
FT                   RNYSSPPNFGAQVVSKVLNDTVLRAQWQAEVEQMRLRILDMRHTLVEALKASLPERNFD
FT                   YLLQQRGMFSYTGFSEAQVESLREEFGVYLIASGRMCMAGVNHQNVEQVAVAFAAVQ"
FT   gene            327374..327733
FT                   /locus_tag="YPD4_0283"
FT   CDS_pept        327374..327733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0283"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57192"
FT                   /protein_id="ACY57192.1"
FT                   /translation="MNHSALLEYCLSKPGAEQCEHEQWQTNQIKVADVMFAMVGNIGGR
FT                   PSISLKSSPKLAERLREQHPEIVPSEHLNKTHWNTVFLDGKLPNSQFYTLIDHSYQLVL
FT                   QGLPEQRRQDLSSHL"
FT   gene            complement(327826..330669)
FT                   /gene="uvrA"
FT                   /locus_tag="YPD4_0284"
FT   CDS_pept        complement(327826..330669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrA"
FT                   /locus_tag="YPD4_0284"
FT                   /product="excinuclease ABC subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57193"
FT                   /protein_id="ACY57193.1"
FT                   /translation="MDNIEVRGARTHNLKNINLIIPRDKLIVVTGLSGSGKSSLAFDTL
FT                   YAEGQRRYVESLSAYARQFLSLMEKPDVDHIEGLSPAISIEQKSTSHNPRSTVGTITEI
FT                   HDYLRLLFARVGEPRCPDHDVPLAAQTVSQMVDNVISQPEGRRLMLLAPVVKDRKGEHT
FT                   KILENLAAQGYIRARIDGEVCDLSDPPKLELQKKHTIEVVVDRFKVREDLAQRLAESFE
FT                   TALALSGGTAVVADMDDPHVEELLFSANFACPICGYSMRELEPRLFSFNNPAGACPTCD
FT                   GLGVQQFFDPDRVLQNPELSLAGGAIRGWDRRNFYYFQMLRSLAEHYKFDIEAPFNSLD
FT                   SAVQQAVLYGSGKDTIEFKYINDRGDTTVRRHPFEGVLHNMERRYKETESSAVREELAK
FT                   FISNRSCASCSGTRLRREARYVFVENTTLPEISELSIGHALSFFQNMKLSGQRAQIAEK
FT                   ILKEIGDRLKFLVNVGLNYLSLSRSAETLSGGEAQRIRLASQIGAGLVGVMYVLDEPSI
FT                   GLHQRDNERLLETLIHLRNLGNTVIVVEHDEDAIRAADHVIDIGPGAGVHGGEVVAEGT
FT                   VDDIMAAPASLTGQFLSGKRSIAIPEKRVSADPSKVLKLIGATGNNLKDVTLTLPVGLF
FT                   SCITGVSGSGKSTLINDTLYSIAQRQLNGATITEPAPYREIQGLEHFDKVIDIDQSPIG
FT                   RTPRSNPATYTGIFTPIRELFAGVPESRTRGYTPGRFSFNVKGGRCEACQGDGVIKVEM
FT                   HFLPDIYVPCDHCKGKRYNRETLEVKYKGKSIHEVLAMTIEEAREFFDAVPALARKLQT
FT                   LIDVGLSYICLGQSATTLSGGEAQRVKLSRELSKRGTGQTLYILDEPTTGLHFADIQQL
FT                   LAVLHQLRDQGNTIVVIEHNLDVIKTADWIVDLGPEGGSGGGEILVSGTPETVAECAAS
FT                   HTARFLKPMLQRKPQTV"
FT   gene            331127..331675
FT                   /gene="ssb"
FT                   /locus_tag="YPD4_0285"
FT   CDS_pept        331127..331675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /locus_tag="YPD4_0285"
FT                   /product="single-strand DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57194"
FT                   /protein_id="ACY57194.1"
FT                   /translation="MASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKQ
FT                   TGEQKEKTEWHRVVLFGKLAEVAGEYLRKGSQVYIEGALQTRKWQDQSGQERYTTEVVV
FT                   NVGGTMQMLGGRQGGGAPAGGGAAPQDGGAQGGWGQPQQPQGGNQFSGGQASRPAQPAP
FT                   AAPQGGNEPPMDFDDDIPF"
FT   gene            complement(331921..332235)
FT                   /locus_tag="YPD4_0286"
FT   CDS_pept        complement(331921..332235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0286"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57195"
FT                   /protein_id="ACY57195.1"
FT                   /translation="MIRKAFVMAVNPDAHAEYQRRHTPIWPELESVLKAHGAHHYSIFL
FT                   DETRNLLFGVVEIESEERWNAVAQTAECQRWWQHMADVMPSHPDNSPVSQALREVFYLE
FT                   "
FT   gene            complement(332249..333397)
FT                   /locus_tag="YPD4_0287"
FT   CDS_pept        complement(332249..333397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0287"
FT                   /product="probable alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57196"
FT                   /protein_id="ACY57196.1"
FT                   /translation="MSFMLALPKISLHGTGAIGDMVKLLSDKQWGKALIVTDGQLVELG
FT                   LLDSLFAAMAQYQLPYGLFGEVFPNPTEELVQAGFAAFTQHQCDYLIAFGGGSPIDTAK
FT                   AIKILTANPGPSTAYSGVGKVKQTGVPLIAINTTAGTAAELTSNAVIIDSQRQVKEVII
FT                   DTNLIPDIAVDDPSVMLNIPASVTAATGMDALTHAVEAYVSLGAHTLTDHSALESIRLI
FT                   SQWLPLAVADGKNLQAREMMACGQYLAGMAFNSAGLGLVHALAHQPGATHNLPHGVCNA
FT                   ILLPVIEEYNRPQATRRFARIAQAMGVDTQDMSDEQASHQAIAAIRQLSLQVGIPAGFS
FT                   ALGIEESDIEGWLDKALADPCAPCNPRSADREQIRTLYLQAL"
FT   gene            complement(333464..334288)
FT                   /gene="rhaD"
FT                   /locus_tag="YPD4_0288"
FT   CDS_pept        complement(333464..334288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhaD"
FT                   /locus_tag="YPD4_0288"
FT                   /product="rhamnulose-1-phosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57197"
FT                   /protein_id="ACY57197.1"
FT                   /translation="MQAILSSWFIQGMIKATSDMWHKGWDERNGGNISLRLLAEEVEPY
FT                   RRDFYQQPRKVELTQPAPELANSWFLVTGSGKFFRNVELNPAENLVLLQVSNDGMAYHI
FT                   HWGLTQGGLPTSELAAHFQSHIVRMQVSGGTNRVIMHCHATNLIALSYVQKLENASFTR
FT                   LLWEGSTECLVVFPDGIGIVPWMVPGTDGIGTQTAEQMREHSLVLWPFHGIFGSGPTLD
FT                   DAFGLIDTAEKSAEIMVKVLSMGGKKQTISREQLIALAARFDVTPMAAALDA"
FT   gene            complement(334344..335558)
FT                   /locus_tag="YPD4_0289"
FT   CDS_pept        complement(334344..335558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0289"
FT                   /product="L-rhamnose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57198"
FT                   /protein_id="ACY57198.1"
FT                   /translation="MTNSIEQAWDLAKQRFAAVGVDVDAALTRLDTLPVSMHCWQGDDV
FT                   TGFEDPDGVLTGGIQATGNYPGKARNATELRSDLELALALIPGPKRLNLHAIYLESDTP
FT                   VARNKIEPRHFSHWVAWAKKHQLGLDFNPSCFSHPLSADGFTLSHADPEIRQFWIEHCQ
FT                   ASRRVSAYFGEQLGTPSVMNIWIPDGMKDTPIDRLAPRQRLLSALDEVISEKLNPAHHI
FT                   DAVESKLFGIGAESYTVGSNEFYMGYAASRQTALCLDAGHFHPTEVISDKISSAMLYVP
FT                   RLLLHVSRPVRWDSDHVVLLDDETQAIASEIIRHNLFDRVHIGLDFFDASINRIAAWVI
FT                   GTRNMKKALLRALLEPTDRLRQLELRGDYTARLALLEEQKSLPWQAIWEGYCQRNDVPV
FT                   DAALA"
FT   gene            complement(335555..337012)
FT                   /gene="rhaB"
FT                   /locus_tag="YPD4_0290"
FT   CDS_pept        complement(335555..337012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhaB"
FT                   /locus_tag="YPD4_0290"
FT                   /product="rhamnulokinase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57199"
FT                   /protein_id="ACY57199.1"
FT                   /translation="MVAIDLGASSGRVMLASYYPGQQQLTLREVCRFTNQIKSIDGSDV
FT                   WDIDAIEQSIREGLSQLDSEGIALDSIGIDSWGVDFVLLDKQGKRIGQPVSYRDSRTQG
FT                   VMARAQQTLGSNAIYRRTGIQFLPFNTLYQLRALSEQQPHLLADVAHLLLIPDYLHYRL
FT                   TGQLNWEYTNASTTQLLNIETGDWDSDLLAYAGVPAHWFAKPGKPGNTIGYWHSANGQQ
FT                   VPVVAVATHDTASAVLAAPLIDADAAYLSSGTWSLMGFESGTPLTHQQAQCSNITNEGG
FT                   AEGRYRVLKNIMGLWLLQRATDELQIDDLPQLIEQAARQPACRSLINPNDSRFINPPNM
FT                   CREIQNACREHQFPVPNTAAQLARCIFDSLAMLYRQVAQELATLRGRPISHLHIVGGGC
FT                   QNQFLNQLCADACGLNVSMGPVEASTLGNIGSQLISLGEVADVTHYRRIVANNFPLHHL
FT                   SPHDNSDFAAHWLQFQSLSQLPKELCI"
FT   gene            337439..338260
FT                   /gene="rhaS"
FT                   /locus_tag="YPD4_0291"
FT   CDS_pept        337439..338260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhaS"
FT                   /locus_tag="YPD4_0291"
FT                   /product="L-rhamnose operon regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57200"
FT                   /protein_id="ACY57200.1"
FT                   /translation="MTVLHSIDFFSSSSAPVAIEARAPQSAFPEHHHDFYEIVIVEEGA
FT                   GVHVFNGNPYTLSRGCVCFVRDHDRHLFESTDDLFLTNVLFRAPDAFRFLSGVGHFLPR
FT                   ECDGVYPSHWRVNGQVLQQIKCLIACLEHAPKSDQVEDIALHESVFMQLLVKLWQGCQT
FT                   QVGDDQEGRLYQLLDWLQNNYSEAVEWPELADRFALPLRTLHRQLKNKTGMTPQRYLTR
FT                   LHLLQARHQLCYSDNSVTDIAYLCGFGDSNHFSTLFKREFSQSPRDLRSQL"
FT   gene            338393..339265
FT                   /gene="rhaR"
FT                   /locus_tag="YPD4_0292"
FT   CDS_pept        338393..339265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhaR"
FT                   /locus_tag="YPD4_0292"
FT                   /product="L-rhamnose operon transcriptional activator"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57201"
FT                   /protein_id="ACY57201.1"
FT                   /translation="MRAPLLLESRDYLLSEQMPVAVTNRYPQETFVEHTHQFCEIVIVW
FT                   RGNGLHVLNDHPYRITCGDVFYIQAADHHSYESVHDLVLDNIIYCPERLHLNAQWHKLL
FT                   PPLGPEQNQGYWRLTTQGMAQARPIIQQLAQESRKTDSWSIQLTEVLLLQLAIVLKRHR
FT                   YRAEQAHLLPDGEQLDLIMSALQQSLGAYFDMADFCHKNQLVERSLKQLFRQQTGMSIS
FT                   HYLRQIRLCHAKCLLRGSEHRISDIAARCGFEDSNYFSAVFTREAGMTPRDYRQRFIRS
FT                   PVLPAKNEP"
FT   gene            complement(339414..340448)
FT                   /gene="rhaT"
FT                   /locus_tag="YPD4_0293"
FT   CDS_pept        complement(339414..340448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhaT"
FT                   /locus_tag="YPD4_0293"
FT                   /product="L-rhamnose-proton symport protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57202"
FT                   /protein_id="ACY57202.1"
FT                   /translation="MNNAIILGIIWHLVGAASAACFYAPFKQVKKWSWETMWSIGGLVS
FT                   WLILPWTVSYLLLPDFWQYYGSFSIATLLPVFLFGAMWGIGNINYGLTMRYLGMSMGIG
FT                   IAIGITLIIGTLMTPILQGRFDVLLGTPGGRMTLLGVFVALIGVAIVSYAGLLKERAMG
FT                   IQAEEFNLKKGLILAVMCGIFSAGMSFAMDAAKPMHEAASALGINSLYVALPSYVIIMG
FT                   GGAIINLSYCFIRLATLKNLSVKADFSVAKPLLITNILFSALAGLMWYLQFFFYAWGHA
FT                   KIPQQYDYMSWMLHMSFYVLCGGIVGLLLKEWKCSTKKPVAVLCIGCLVIILAANIVGL
FT                   GMAA"
FT   gene            complement(341304..341729)
FT                   /locus_tag="YPD4_0294"
FT   CDS_pept        complement(341304..341729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0294"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57203"
FT                   /protein_id="ACY57203.1"
FT                   /translation="MRYLLSLSVFLIVSLNPAFAEWTGDNVEGMHSGMIINKFHSGQVD
FT                   GKPYFCIEAFKPSTTITACSVKDTSIWGASYNTLYDQAMYYYTTGKRIRVYYAPDVWTN
FT                   NSFVRALTANALVGFSTCISESSCFGPDRKKHKFTVH"
FT   gene            342156..344711
FT                   /locus_tag="YPD4_0295"
FT   CDS_pept        342156..344711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0295"
FT                   /product="enhancing factor"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57204"
FT                   /protein_id="ACY57204.1"
FT                   /translation="MRQVTKSKKIKILPYPEWLVKAGMSKGIDHDRQHLGIILAAGEMI
FT                   KVRQVNAEYKEKLKLYLLNDNKNTQRSISFNTDWIELSVDAISVPFINTPYSDGIIPEI
FT                   VFEYPDTSKLLPVYEKGEDESIFFESWDKQNAEFGVVESEYVIILIPEVSKDRLKSFST
FT                   SGGIDTVLGFYQDIFSFNNSLAGLSFEPQRYSDGNTRNRYFAKADKGGGGAAYYSNNWI
FT                   ASSSGSINTFWLSPNATNWGCLHEIAHGYQGGFIDDKYFSTREVWNNIYAACYQDVMLG
FT                   AEKFNKGWLYNFGKQKEVEKSILNNINNGKEVNAWGERSKLYFIMLMLEKAGVNCFTHF
FT                   NQIYRERKNTDQSVGSVLDMLSNSFATVENRVDVTLFLQMVGGHISKNQYQRNLFSHAK
FT                   AVYPLNQLLQGDELTAVKKTLDLNSELSLVDVDSIEFTDIKSNLTLQFSIDDFAQIYGE
FT                   ELLILNGDNYVYNQSIMDKKQTLYNLPVGAYTLRIPTGRNKKYAPQINYLIVKNEDSQT
FT                   QVDFVHRIGSPIVSQKISLQGLNDYTFATIFFDQENDTVSVDITKTKPHYHFPGMYARI
FT                   RIKDKDNNELLNEVITGTNQSLSKNDFPLSSCYVIDIFHKEPGRVKLTPAYKGVIDNKS
FT                   SYNEFIITPYGLQNIKLNNDPKVFLLENIKSAAEMLRSHPIMWHANFSEAKDNIYLAID
FT                   IFPSPQKEGLLEQYADCISSYYEKPNEDLGNAFSFIFKGINDREFLTTKLNLVTKKLEV
FT                   KIVSGTPHSGFKRTYAVLRYFNADGNELLNLDIIGSKKQAGQEWVFPISGYGGEKLYLQ
FT                   HVEPKNRLVITNIMQGIRLSSRTSIQTYEIESLGLSRCT"
FT   gene            complement(345145..345220)
FT                   /locus_tag="YPD4_t2"
FT   tRNA            complement(345145..345220)
FT                   /locus_tag="YPD4_t2"
FT                   /product="tRNA-Phe"
FT   gene            complement(345365..345940)
FT                   /locus_tag="YPD4_0296"
FT   CDS_pept        complement(345365..345940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0296"
FT                   /product="putative TetR-family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57205"
FT                   /protein_id="ACY57205.1"
FT                   /translation="MQREQVLSNALNLLEQQGLANTTLEMLAKALSVEVSDLTRFWPDR
FT                   EALLYDCLRYHSQQIDTWRRQLQLDETLSPQQKLLARYQTLSEQVQNQRYPGCLFIAAC
FT                   SFYPDTEHPIHQLAEQQKQASLHYTKALLQEMDADDADMVAQQMELILEGCLSKLLIKR
FT                   QLADVEVAKCLAEDILTVAQCRKNGALS"
FT   gene            346360..348375
FT                   /locus_tag="YPD4_0297"
FT   CDS_pept        346360..348375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0297"
FT                   /product="oxidoreductase, Fe-S subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57206"
FT                   /protein_id="ACY57206.1"
FT                   /translation="MNPFIVADAESCIGCRSCEVACVVAHHEGQFPDKPEYFTPRVKVF
FT                   KGDQCATAVFCHHCEDAPCASTCPNGAIVELNNRVQVIQEKCIGCKTCMIACPFGMMTV
FT                   VTETVQPASHRLADVYRRTEAQKCDLCLDQPDGPACIKTCPTQALTLVDQQYLLHQQQQ
FT                   KRQHMALNEHNGRLFSRAVVQAASASSNKSIRDATPVNLLQRPRAPRLEPKKIPLAERK
FT                   TGFAEIYLPFTESQIHEQAERCLECGDKTICQWTCPLHNAIPKWISLAHQGRIHEAAEL
FT                   SHQTSSLPEVCGRVCPQDRLCEQSCTLNDHDGAVTIGQIERHITETALATGWRPDLSQV
FT                   KPSGKRVAIIGAGPAGLGCADILVRNGITPVVFDRYPEIGGLLTFGIPAFKLEKSVMTR
FT                   RREIFTEMGVEFCLNTEIGRDITMENLLHDFDALFLGVGTYRSMRSGLENEDAQGVYDA
FT                   LPFLIGNTQHLMGYTANGAHPYVSMQDQRVVVLGGGDTAMDCVRTSLRQGASRVVCAYR
FT                   RDEKNMPGSKREVKNAREEGAEFMFNLQPMSIVVDESGQVTGIKMVRTEMGQADAQGRR
FT                   QALPITGSEHLIPADAVIMAFGFSPHRMSWLAEHNVVLDKQGRVVAPTISGYPYQTSNP
FT                   KIFAGGDIVRGADLIVTAIAEGRKAAESIAYYLNVL"
FT   gene            348398..348955
FT                   /gene="hydN"
FT                   /locus_tag="YPD4_0298"
FT   CDS_pept        348398..348955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hydN"
FT                   /locus_tag="YPD4_0298"
FT                   /product="4Fe-4S ferrodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57207"
FT                   /protein_id="ACY57207.1"
FT                   /translation="MNRFVIADMTQCIGCRTCEIACVVAHSADNKVSTLMPEQFHPRLS
FT                   VMKSFAVSTPILCHQCEDAPCENACPNGAIITGSHGVQLLASRCIGCKTCMLVCPFGAM
FT                   SIIERPADGQQAADSQPVMASGSGRAQAHKCDLCHQRESGPACIEVCPTNALKLVTPGV
FT                   LEALQREKQLRAARGSAPGIAR"
FT   gene            348978..351125
FT                   /gene="fdhF"
FT                   /locus_tag="YPD4_0299"
FT   CDS_pept        348978..351125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdhF"
FT                   /locus_tag="YPD4_0299"
FT                   /product="formate dehydrogenase H"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57208"
FT                   /protein_id="ACY57208.1"
FT                   /translation="MKKILTVCPYCGSGCKLNLLVEDGEIVGAEPADGVTNQGALCLKG
FT                   YYGWDFLNDTRLLTPRLTTPLLRRQRGEAFQPVSWEAAIAFITAKLSAIKERHGPDAIM
FT                   MTGSSRGPGNEANYVMQKFARAAIGTNNIDCCARLCHGPSVAGLQQTLGNGAMSNSIGE
FT                   IENTDCILVFGYNAADSHPIVARRILKAKNKGAKLIVCDPRHIETARIADQWLPLKNGA
FT                   NMALVNAFIHVLIEEKLYDANYVRDHTRGFDELKAGVAAYRPEDVEPITGLSAKAVRQA
FT                   MRTYAAAPAATLLWGMGVTQWGQAVDVVKGLSSLALLTGNLGRPNVGVGPVRGQNNVQG
FT                   ACDMGVLPNTFPGYEKVTDSEARARFAHAWGVAELPAHVGYSITDVPHKVAEGKLKAYY
FT                   VFGEDPIQTEPDLAAMRAAFAALDLVVVQDIFMTKTAELADVVLPATSWGEHEGVYTSA
FT                   DRGFQHFNKAIEPKGDVKPDWEIISLISTAMGYPMAYQNTQQIWDEMRGLCPPFAGVTY
FT                   EKLAGLGYVQWPCPTEDHPGTPYLYTDNQFATADGKGLLSCAPWQPPHEQTDSDYPLAL
FT                   CTVREVGHYSCRSMTGNCGTLKILADEPGYVQIHPEDASYLGVIDQALIWISSRRGKVI
FT                   ARASVTERANRGAVYMTYQWWIGACNELTVDHVDPVSKTPEFKHCAVKVEAISDQTAAE
FT                   QYVEQQYSQLKKRLSDAAVVP"
FT   gene            complement(351187..352974)
FT                   /gene="dsbD"
FT                   /locus_tag="YPD4_0300"
FT   CDS_pept        complement(351187..352974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbD"
FT                   /locus_tag="YPD4_0300"
FT                   /product="thiol:disulfide interchange protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57209"
FT                   /protein_id="ACY57209.1"
FT                   /translation="MAQRFITLILLLCSVLLAPHSAQSSLFGENASFGTKNSQSRFIPV
FT                   DQAFAFDFHQQGDQLNLSWQIHPGYYLYRQQIKIVPQQAALGAFTLPEGITHHDEFYGE
FT                   VEIFKQQLTLKIPITQAAEQASVSVTYQGCAEAGFCYPPETRVIPLDVVVAASTASGTA
FT                   AVNSSATVNPPATTQPEGDATPVPSTLPFSPLWALLIGIGIAFTPCVLPMYPLISAVIL
FT                   GREKPHSQRRILILAVVYVQGMALTYTLLGLVVAAAGLQFQAALQHPYVLIGLSVLFVL
FT                   LALSMFGLYSLQLPSSLQTRLTQWSNSQRGGSLAGVFAMGALAGLICSPCTTAPLSAIL
FT                   LYIAQSGNMLAGGGTLYLYALGMGIPLVVVTLFGNKLIPRSGPWMQYVKEAFGFVILAL
FT                   PVFLLERVLGDVWGLRLWSLLAVAFFGWAFVLSLKAHAGWVRVCQLLLLAALLIVARPL
FT                   QDWAFNGNTQQNAVKHINFQPVANLPQLQAVLAQAQGKPVMLDLYADWCVACKEFEKYT
FT                   FSDDKVQRQLANTLLLQADVTANNAEHATLLKKFNVLGLPTILFFDSQGNEITAARVTG
FT                   FMDAAQFLQHLQNTPAVTK"
FT   gene            complement(353493..354794)
FT                   /gene="dcuA"
FT                   /locus_tag="YPD4_0301"
FT   CDS_pept        complement(353493..354794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcuA"
FT                   /locus_tag="YPD4_0301"
FT                   /product="anaerobic C4-dicarboxylate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57210"
FT                   /protein_id="ACY57210.1"
FT                   /translation="MIAVELVIVLLAIFLGARLGGIGIGFAGGIGVLVLAIIGVKPGSI
FT                   PFDVISIIMAVIAAISAMQVAGGMDYLVQQTEKLLRKNPKHITILAPLVTYFLTIFAGT
FT                   GNISLSALPVIAEVAKEQGIKPCRPLSTAVVSAQIAITASPISAAVVYMSSVMEGQGVS
FT                   YLHLLMIVIPSTLCAVFVMSLIVSWCFSSKLSDDPIYLKRLEEGLVTLRGDTVKVIKPR
FT                   AKTSVLLFLAGVLCVVAYAIINSPSVGLVETPLMNTTNAILIIMLSVATITTLVCSVDT
FT                   DSILNSSTFKAGMSACICILGVAWLGDTFVQHNLEWIKETAGSLIQAHSWLLAVIFFFC
FT                   SALLYSQAATAKALMPMALALNVSPLAAIASFAAVSGLFILPTYPTLVAAVQMDDTGTT
FT                   RIGRFVFNHPFFIPGTIGVALAVCFGFVMGGLVL"
FT   gene            complement(354914..356200)
FT                   /locus_tag="YPD4_0302"
FT   CDS_pept        complement(354914..356200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0302"
FT                   /product="aspartate ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57211"
FT                   /protein_id="ACY57211.1"
FT                   /translation="MVMVKKAAAMANKELHTIPRKIADIIIQACDEVLDKGKCMDQFPV
FT                   DVFQGGAGTSLNMNTNEVLANIGLELMGHQKGEYQYLNPNDHLNKCQSTNDAYPTGFRI
FT                   AVYASILKLIDAINQLGEGFGRKSKEFEKILKMGRTQLQDAVPMTLGQEFRAFQVLLNE
FT                   ETKNLQRTAELLLEVNLGATAIGTALNTPEGYSQLAVQKLAEISGLACVPAEDLIEATS
FT                   DCGAYVMVHSALKRLAVKMSKICNDLRLLSSGPRTGLNEINLPELQAGSSIMPAKVNPV
FT                   IPEVVNQVCFKVIGNDTCITMAAEAGQLQLNLMEPVIGQAMFESIHILTNACYNLLEKC
FT                   INGITANKEVCERYVFNSIGIVTYLNPFIGHHNGDIVGKICAETGKNVREVVLERGLLT
FT                   EAELDDIFSVENLMHPAYKAKRYTDENEQ"
FT   gene            356773..357375
FT                   /locus_tag="YPD4_0303"
FT   CDS_pept        356773..357375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0303"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57212"
FT                   /protein_id="ACY57212.1"
FT                   /translation="MIKIKENTVRWLPFALIFLLAYIEISIFIKVAAVLGVPITLLLVI
FT                   ISSCVGISLVRNQGIKTFIQMQQKLAAGESPAAEMIKSVSLVLAGILLLIPGFFTDFLG
FT                   LLLLLPWVQKTLTLKLMPHLNIYRGGSFGGAGFGNGGFGNDSFGNRHGSGPMSGGDTFD
FT                   GEFQRKDDDRFTVEHRPDKNEQVANSRSNDDSFKDDK"
FT   gene            357970..359616
FT                   /gene="groEL"
FT                   /locus_tag="YPD4_0304"
FT   CDS_pept        357970..359616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groEL"
FT                   /locus_tag="YPD4_0304"
FT                   /product="chaperonin GroEL"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57213"
FT                   /protein_id="ACY57213.1"
FT                   /translation="MAAKDVKFGNDARIKMLRGVNILADAVKVTLGPKGRNVVLDKSFG
FT                   SPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQSIITEGL
FT                   KAVAAGMNPMDLKRGIDKAVIAAVEELKKLSVPCSDSKAIAQVGTISANSDSTVGELIA
FT                   QAMEKVGKEGVITVEEGSGLQDELDVVEGMQFDRGYLSPYFINKPETGSIELESPFILL
FT                   ADKKISNIREMLPVLEAVAKAGKPLLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPGF
FT                   GDRRKAMLQDIATLTAGTVISEEIGLELEKTTLEDLGQAKRVVINKDTTIIIDGVGDEA
FT                   AIQGRVAQIRQQIEDATSDYDKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDA
FT                   LHATRAAVEEGVVAGGGVALIRAAHAIAGLKGDNEDQNVGIKVALRAMESPLRQIVVNA
FT                   GEEASVIANKVKAGEGSFGYNAYTEEYGDMIAMGILDPTKVTRSALQYAASIAGLMITT
FT                   ECMVTDLPRDDKGADMGAGGMGGMGGMGGMM"
FT   gene            360240..360638
FT                   /locus_tag="YPD4_0305"
FT   CDS_pept        360240..360638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0305"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57214"
FT                   /protein_id="ACY57214.1"
FT                   /translation="MRINVLLRSHILLKSNVLLKIKTLLGLSAVLVLAGCSSSNTLSSA
FT                   GEQVKFSDTQPGSECQLVGQVTGTQSNWLSGQGGESSSMRGAANDLRNKAAAMGGNVIY
FT                   GATSPSETFLSSFAPLESKMVGQVYKCP"
FT   gene            complement(360923..361927)
FT                   /locus_tag="YPD4_0306"
FT   CDS_pept        complement(360923..361927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0306"
FT                   /product="iron-sulfur cluster-binding protein, KamA family"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57215"
FT                   /protein_id="ACY57215.1"
FT                   /translation="MPIREDWLQQLADVITDPDELLRILFLNEHPHLQQGSGARRLFPL
FT                   RVPRAFVARMQPGNASDPLLLQVLTAREEFITAPGFTHDPLDEQRSVVPGLLHKYRNRA
FT                   LLLVKGGCAVNCRYCFRRHFPYQDNQGNKANWLQALDYIRQHPELDEIIFSGGDPLMAK
FT                   DHELSWLLDQLEDIKHIRRLRIHTRLPVVIPARITATLCQRLGSSRLQVLMVTHINHAN
FT                   EIDPPLRDSMARLKQAGVTLLNQSVLLRGVNNDADVLATLSNALFDAGILPYYIHVLDK
FT                   VQGAAHFMVDDDEARQLMKGLLSRVSGYLVPRLTREVGGEPSKTPLDLRLTQN"
FT   gene            361987..362553
FT                   /gene="efp"
FT                   /locus_tag="YPD4_0307"
FT   CDS_pept        361987..362553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="efp"
FT                   /locus_tag="YPD4_0307"
FT                   /product="elongation factor P"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57216"
FT                   /protein_id="ACY57216.1"
FT                   /translation="MASYYSNDFRPGLKIMFEGEPYAVESSEFVKPGKGQAFARVKMRR
FT                   LLTGGRVEKTFKSTDSLEGADVNDMNLTYLYNDGEFWHFMNNETYEQLQADAKAVGDNG
FT                   KWLIDQAECIVTLWNGQPIAVTPPNFVELEIVDTDPGLKGDTAGTGGKPATLSTGAVVK
FT                   VPLFVQVGEIIKVDTRSGEYVSRVK"
FT   gene            362653..363114
FT                   /gene="sugE"
FT                   /locus_tag="YPD4_0308"
FT   CDS_pept        362653..363114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sugE"
FT                   /locus_tag="YPD4_0308"
FT                   /product="suppresses groEL, may be chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57217"
FT                   /protein_id="ACY57217.1"
FT                   /translation="MAVFCYLGLAILPLIIEHDNVSRLSLCWLGRPSYASVFRGRPRLS
FT                   EVVTMAWIILVIAGLLEVIWAIGLKYSHGFSRLTPSIITLVAMAASVFLLAYAMKSLPA
FT                   GTAYAVWTGIGAVGTAILGIVLLGESASLARILSLGLILAGIIGLKLAS"
FT   gene            complement(363279..363635)
FT                   /gene="frdD"
FT                   /locus_tag="YPD4_0309"
FT   CDS_pept        complement(363279..363635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frdD"
FT                   /locus_tag="YPD4_0309"
FT                   /product="fumarate reductase subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57218"
FT                   /protein_id="ACY57218.1"
FT                   /translation="MNQVPKRSDEPIFWGLFGAGGMWGAIIAPVIILLVAILLPLGAFP
FT                   GDALSYERILAFCQSFIGRVFLLLMIILPLWCGLHRIHHAMHDLKIHVPAGKWVFYGLA
FT                   AILSVVTFIGVLTL"
FT   gene            complement(363652..364044)
FT                   /gene="frdC"
FT                   /locus_tag="YPD4_0310"
FT   CDS_pept        complement(363652..364044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frdC"
FT                   /locus_tag="YPD4_0310"
FT                   /product="fumarate reductase subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57219"
FT                   /protein_id="ACY57219.1"
FT                   /translation="MTTKRKAYVRTMAPNWWQQLGFYRFYMLREGTSIPAVWFSVLLIY
FT                   GVFALKSGPAGWEGFVSFLQNPLVLFLNILTLFAALLHTKTWFELAPKAVNIIVKSEKM
FT                   GPEPMIKALWVVTVVASAIILAVALL"
FT   gene            complement(364061..364795)
FT                   /gene="frdB"
FT                   /locus_tag="YPD4_0311"
FT   CDS_pept        complement(364061..364795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frdB"
FT                   /locus_tag="YPD4_0311"
FT                   /product="succinate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57220"
FT                   /protein_id="ACY57220.1"
FT                   /translation="MTDMKVLKMEVMRYNPERDSEPHFETFEVPYDEQTSLLDALGYIK
FT                   DNLAPDLSYRWSCRMAICGSCGMMVNKVPKLACKTFLREYTAGMKVEALGNFPIERDLV
FT                   VDMTHFIESLEAIKPYIIGNERLPKDGPNKQTPAQMAKYHQFSGCINCGLCYAACPQFG
FT                   LNPEFIGPAAITLAHRYNLDNRDHGKKERMPQLNGKNGVWSCTFVGYCSEVCPKHVDPA
FT                   AAIQQGKIDSAKDFMIAMLKPQ"
FT   gene            complement(364788..366611)
FT                   /gene="frdA"
FT                   /locus_tag="YPD4_0312"
FT   CDS_pept        complement(364788..366611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frdA"
FT                   /locus_tag="YPD4_0312"
FT                   /product="fumarate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57221"
FT                   /protein_id="ACY57221.1"
FT                   /translation="MQTFNADLAIIGAGGAGLRAAIAAAEANPQLKIALISKVYPMRSH
FT                   TVAAEGGSAAVTQDHDTFDYHFHDTVAGGDWLCEQDVVDHFVHSCPEEMAQLEIWGCPW
FT                   SRKEDGSVNVRRFGGMKIERTWFAADKTGFHMLHTLFQTSLKYPQIQRFDEHFVLDILV
FT                   DEGQARGVVAMNMMEGTRVQIRANAVIMATGGAGRVYRYNTNGGIVTGDGMGMAFHHGV
FT                   PLRDMEFVQYHPTGLPGSGILMTEGCRGEGGILVNKDGYRYLQDYGMGPETPLGEPKNK
FT                   YMELGPRDKVSQAFWHEWRAGRTVATPRGDVVYLDLRHLGEKKLLERLPFICELAKAYV
FT                   GVDPVKEPIPVRPTAHYTMGGIETNPQCETRIKGLFAVGECSSVGLHGANRLGSNSLAE
FT                   LVVFGRVAGEQAALRAMESGPANGSALDAQTRDVETRLSNLMKQEGTENWSKIRDEMGL
FT                   SMEEGCGIYRTPELMQKTVDKLAELKERFKRVKITDHSSVFNTDLLYTIELGYGLDVAE
FT                   CMAHSALNRKESRGAHQRLDEGCTERDDVNFLKHTLAFHTPGGAPRIEYSDVKITKLVP
FT                   AKRVYGGEATAQDAKDAKDAQDLKDKEQAND"
FT   gene            367069..368046
FT                   /locus_tag="YPD4_0313"
FT   CDS_pept        367069..368046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0313"
FT                   /product="lysyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57222"
FT                   /protein_id="ACY57222.1"
FT                   /translation="MSDTASWQPSAPIANLLKRAAIMAEIRRFFADRGVLEVETPTMSQ
FT                   ATVTDIHLVPFETRFVGPGAADGLTLYMMTSPEYHMKRLLAAGSGPIYQLGRSFRNEEA
FT                   GRYHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQILDCNSAETLSYQQAFLRHLNIDPLS
FT                   AEKAQLREVAAKLDLSNIADTEEDRDTLLQLLFTVGVEPYIGRDKPAFIYHFPASQASL
FT                   AEISTEDHRVAERFEVYFKGIELANGFRELTDGDEQLQRFEQDNRNRAKRGLPQNPIDM
FT                   NLIAALKQGLPDCSGVALGVDRLVMLALNAERLSDVIAFPVNIA"
FT   gene            complement(368167..371508)
FT                   /locus_tag="YPD4_0314"
FT   CDS_pept        complement(368167..371508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0314"
FT                   /product="membrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57223"
FT                   /protein_id="ACY57223.1"
FT                   /translation="MRPIISWSFGLLLSFFLLMPLHAATQPNEEQVRQELKLAESNKTT
FT                   PNQAEIVQALQGALSWLADAKESDIRAQQYQKAIDDFPKLTRELRQQLAQEGDKPLPVP
FT                   SNLSTSDLEQQVLQVSSQLLELNRLSQQEQDRAREISESLGQLPQQQSEARRMLAEIGP
FT                   RIQSQSNPSTPVAQAQLTLLQAEAVARKAKVNELELSQLSANNRQELSRLQVELYKKRE
FT                   ARVQAQLQSLRNNLNNQRQQAAEQALERTELLAEQGGDLPESITQQLQRNRELSQALNQ
FT                   QVQRIDLISSQQRQAVAQTQQVRQALNTIREQAQWLGVSTALGETLRAQVARLPEMPKS
FT                   QQLDRDMAQLRVQRLQYEDMLEKLQQQKTTLKQDDGTPLTPDQQRILDAQWRTQSELLN
FT                   SLLSGYDTQILELTKLKVANSQLVDALNGVREATHRYLFWVADVSPISLSYPLAVAQDL
FT                   TRLLSLDTLSQLSGAFVMMMTNQETLLPIIAALLFVGFSVSSRRHYHAFLERASSRVGK
FT                   VTQDHFSLTLRTVFWSILMALPLPVLWAALGYGLQNAWSYPMAIAIGNAVTATVPVLWV
FT                   FMISASFAHPHGLFITHFRWSPTQVARAMRFYRLSVWLIVPLMMALITFENYNDREFAG
FT                   TLGRLCFILLCIALSLVTNSLKRAGIPLYLDKKGSGENMINVALWGLLLSAPLIAALAS
FT                   ALGYLTTSQALLARLETSVAIWFFLLVVYHIIRHWMLIQRRRIAFDRAKQRRADILAQR
FT                   ARGEEDSPHSNSTEGSIDVEEPIIDLDVISAQSLRLVRSILTMIALVSVIVLWSEIHSA
FT                   FGFLENIRLWDVSSTINGIESVQPITMGSLLIAVLVLIITAQLVRNLPALLELALLQHL
FT                   DLTPGTGYAISTITKYLVILFGGLLGFSLLGIEWAKFQWLVAALGLGLGFGLQEIFANF
FT                   VSGLIILFEKPIRIGDTVTIRDLTGSVTKINTRATTISDWDRKEIIVPNKAFITEQFIN
FT                   WSLSDSITRVVLTVPAPAETSSEEVTNVLMTAAQRCTLVLDTPPPEVYLVDLQQGIQIF
FT                   ELRIYAAEMGHRMPLRHEIHQLILAGYREHGITLPFPPFQARLETLGRGTGRTISSGRS
FT                   RTPGSL"
FT   gene            complement(371550..372431)
FT                   /gene="psd"
FT                   /locus_tag="YPD4_0315"
FT   CDS_pept        complement(371550..372431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psd"
FT                   /locus_tag="YPD4_0315"
FT                   /product="phosphatidylserine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57224"
FT                   /protein_id="ACY57224.1"
FT                   /translation="MLDSIKIKLQYLLPKQGLTQLAGWGANKQGGWLTQLVIKAFARYY
FT                   KVDMKEAQDPEFSAYRTFNEFFVRPLRAGVRPVVAEENLLAQPADGAISQLGAIREGQI
FT                   LQAKGHNYSLEALLAGNYLLAAEFQNGQFVTTYLAPRDYHRVHMPCDGVLREMIYVPGD
FT                   LFSVNPLTAANVPNLFARNERVICIFDTAFGPMAQILVGATIVGSIETVWAGTITPPRE
FT                   GVIRRWTYPQAGCEGAITLEKGQEMGRFKLGSTVINLFAEGKVYFAPQLNSGAVTRMGE
FT                   VLAEAVPTTPSY"
FT   gene            complement(372756..373808)
FT                   /locus_tag="YPD4_0316"
FT   CDS_pept        complement(372756..373808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0316"
FT                   /product="ribosome-associated GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57225"
FT                   /protein_id="ACY57225.1"
FT                   /translation="MSKNKLSKGQQRRVQANHQRRLRTDRKPELDDSQLGDAQEGIVIS
FT                   RFGQHADVEAVDGTQHRCNIRRTIKSLVTGDRVVWRPGLQAQEGVRVKGIVEAVHERTS
FT                   VLTRPDLYDGVKPIAANIDQIVIVSAILPELSLNIIDRYLVACETLEVEPLIVLNKIDL
FT                   LDADGRKFVDGMMDIYRRIGYDVLEVSSQTREGMEAFENALTGRISIFAGQSGVGKSSL
FT                   LNALLPPTDNEILVNTVSGNSGLGQHTTTAARLYHFQHGGDVIDSPGVREFGLWHLAPE
FT                   QITQGFVEFRDYLGHCKFRDCSHTNDPGCALREAVEQGKIAEERFDNYHRILESMEQAK
FT                   PRKTSDSDEK"
FT   gene            374008..374553
FT                   /gene="orn"
FT                   /locus_tag="YPD4_0317"
FT   CDS_pept        374008..374553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="orn"
FT                   /locus_tag="YPD4_0317"
FT                   /product="oligoribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57226"
FT                   /protein_id="ACY57226.1"
FT                   /translation="MAENQNNLIWIDLEMTGLDPERDRIIEIATLVTDANLNILAEGPV
FT                   LAVHQSAEQLGLMDEWNVRTHTGSGLVERVKASPFNDRDAELQTIEFLKQWVPAGVSPI
FT                   CGNSVGQDRRFLFRYMPELEAYFHYRYVDVSTLKELARRWKPEILAGFKKQNTHQALDD
FT                   IRESVAELAYYREHFIQS"
FT   gene            375111..375186
FT                   /locus_tag="YPD4_t3"
FT   tRNA            375111..375186
FT                   /locus_tag="YPD4_t3"
FT                   /product="tRNA-Gly"
FT   gene            375278..375353
FT                   /locus_tag="YPD4_t4"
FT   tRNA            375278..375353
FT                   /locus_tag="YPD4_t4"
FT                   /product="tRNA-Gly"
FT   gene            complement(375665..376900)
FT                   /locus_tag="YPD4_0318"
FT   CDS_pept        complement(375665..376900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0318"
FT                   /product="putative iron-sulfur cluster-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57227"
FT                   /protein_id="ACY57227.1"
FT                   /translation="MAHPLDLNQLAQHIKQWGQSLGFQQVGICDTDLTAEEPRLQAWLD
FT                   KQYHGEMAWMARHGMLRARPHELLPGTLRVISVRMNYLPAKAAFASTLNNPELGYVSRY
FT                   ALGRDYHKLLRQRLKKLGDQIQHYCLEQNNLDRHDLELHDLEQHDSERQGQPEQHTASE
FT                   INFRPFVDSAPIMERSLAAKAGIGWVGKHSLILNRDAGSWFFLGELLIDLPLPVDKPQE
FT                   EQCGRCVACMTTCPTGAIVAPYTVDARRCISYLTIELEGAIPEEFRPLMGNRIYGCDDC
FT                   QLICPWNRFSQLTDEDDFSPRAVLHTPQLLDLFAWNEEKFLRVTEGSAIRRIGHLRWLR
FT                   NISVALGNAPYLDSIVLALETRRGLHPMLDEHIEWAISQQLARRATQAVEVQLPQKKRL
FT                   IRAIEKGLPRDA"
FT   gene            376899..378413
FT                   /locus_tag="YPD4_0319"
FT   CDS_pept        376899..378413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0319"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57228"
FT                   /protein_id="ACY57228.1"
FT                   /translation="MTDHSKKQTRVSLPHSVFSADWVRQNEAAAAAHFSLTLFDLMVRA
FT                   GNAAFELAHKQYPIARHWLILCGHGNNGGDGYIVANRALAAGIDVTLIACPGNRPLPAE
FT                   AKEAQSQWLAIGGVIHQPDTQWPQDIDLIIDGLLGIGLRAAPQGIYETLIDMANRHRAA
FT                   KVALDIPSGLCADNGAALGSVLRADHTLTFVALKPGLLTGQARDWVGQLHYDDLGLATW
FT                   LDTQSAQIERITADHLPQWLKPRRPCAHKGDYGRLLLVGGDRGFGGAIRMAGEAALRSG
FT                   AGLVRVLTHFEHVAPILAARPELMVQALTAETLEQSMQWADVLVVGPGLGQSDWSRNAL
FT                   KRLQQSDKPTLWDADALNLLALNPHRRQNWVLTPHPGEAARLLGCRVVDIESDRLLSAR
FT                   NIVKQYGGVVVLKGAGTLIANEQGEMAIADVGNAGMASGGMGDILSGIIGGLIAQKLAL
FT                   YDAACAGCVVHGVAADKLAEVQGTRGLLATDLLPVIPKYINPELAK"
FT   gene            378424..378894
FT                   /locus_tag="YPD4_0320"
FT   CDS_pept        378424..378894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57229"
FT                   /protein_id="ACY57229.1"
FT                   /translation="MKELVLLLPDEAATVALGATLAQAFGGASVIYLFGDLGAGKTTFS
FT                   RGFLQALGHNGHVKSPTYTLVEPYTLTPRPVYHFDLYRLADPEELEFMGIRDYFDPQAI
FT                   CLVEWPQQGAGFLPQADVELHLTYQAAGREARLVAISEAGADVLRRLAAVQG"
FT   gene            379034..380815
FT                   /locus_tag="YPD4_0321"
FT   CDS_pept        379034..380815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0321"
FT                   /product="putative N-acetylmuramoyl-L-alanine
FT                   amidase-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57230"
FT                   /protein_id="ACY57230.1"
FT                   /translation="MIIGLLTLSLFALPPAFAMKLTDIKVTNGASESKVTLSFDGKPIY
FT                   AFFSLNSPERVVLDVRQSGNISGLPLEFSGQNLLKRIRSSTPKDEQSTRLVLELTQKVK
FT                   TRAVTQQSGNNYTVVLTMTAVASAPVRQAQASLNQTNTPSPNAGRVVPQVTSKDSVAKN
FT                   PFNNKPVVVVSSENVTTNTARPIKTVSAANSSRVVVAIDAGHGGQDPGAIGQNGLKEKN
FT                   VTISIARRLEALLNRDPMFKPVLTRNGDYFISVMGRSDVARKQGANVLISIHADAAPNR
FT                   SATGASVWVLSNRRANSEMGNWLEQHEKQSELLGGAGDVLANTASDPYLSQAVLDLQFG
FT                   HSQRVGYDVATKVLRELQTVGDIHKRKPEHASLGVLRSPDIPSLLVETGFISNSTEERL
FT                   LGSSAYQEKIAQAIYKGLRSYFLANPLQSDPKVESRPLIETAAVDSSTQRSGISQPEPI
FT                   VNNISSNAQSGRSSATLPAGKSKIHNVQRGETLSGIASQYGVSMAVLRQNNTLKNDVVW
FT                   VGQRLKVPASGSTVTAVKPKTAAVAKSKPIKHQVKRGDTLSAIAARYGVSMSEIERVNK
FT                   IKSGNVQLGQTLTIPQS"
FT   gene            380831..382738
FT                   /gene="mutL"
FT                   /locus_tag="YPD4_0322"
FT   CDS_pept        380831..382738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutL"
FT                   /locus_tag="YPD4_0322"
FT                   /product="DNA mismatch repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57231"
FT                   /protein_id="ACY57231.1"
FT                   /translation="MPIQILPPQLANQIAAGEVVERPASVVKELVENSLDAGATRIDID
FT                   IERGGAKLIRIRDNGCGISKDDLALALARHATSKISSLEDLEAILSMGFRGEALASISS
FT                   VSRLILTSRTAEQSEAWQAYAEGRDMAVTIKPAAHPVGSTLEVLDLFYNTPARRKFMRT
FT                   EKTEFGHIDEVVRRIALARFDVAINLNHNGKLIRQYRAAPDPAQHERRLASICGPAFLQ
FT                   HALAIAWQHGDLNIHGWVADPAASHTLSEMQYCYVNNRMMRDRLINHAIRQAYQDRLND
FT                   AQQPAYVLYLDIDPHQVDVNVHPAKHEVRFHQARLVHDFIYQAVTAVLQQTNAPILNIS
FT                   EEGEVDAPRWQQENRVAAGTNKYAQPEAAKSSAAEQAVARERSSARERAAPAYKEDHPY
FT                   QKQQGELYRQLLQPSAAAKPATSPAAIPASSVSSPSIPVQRITQAEEPLHGDNYSFGRV
FT                   LTVFPPCYALIEYQGGVALLSLAVAERWLKQAQLSPPEEGLRPQPLLIPLKITLDKNEI
FT                   AACQNHEKLLITMGIELSVEQGRATLRAVSLPLRQQNLQKLIPELLGYLSQHEEISPDT
FT                   LATWLARHLGSEHEVWNVSQAIQLLTEVERLCPQLVQSPPAGLLQPIDIKAALATLTHE
FT                   "
FT   gene            382731..383672
FT                   /gene="miaA"
FT                   /locus_tag="YPD4_0323"
FT   CDS_pept        382731..383672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="miaA"
FT                   /locus_tag="YPD4_0323"
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57232"
FT                   /protein_id="ACY57232.1"
FT                   /translation="MNDIENLDRPPAIFIMGPTASGKTALSIALRQRLPVELVSVDSAL
FT                   IYRGMDIGTAKPSAQELALAPHRLIDIRDPAESYSAADFRKDALKEMADITAAGRIPLL
FT                   VGGTMLYFKALLDGLSPLPSADPQVRQRIEQQASELGWGALHQQLAVIDPVAAARIHPN
FT                   DPQRLSRALEVFFISGKTLTELTKISGETLPYRVHQFAIAPASRELLHQRIELRFHQML
FT                   DAGFEAEARVLFDRGDLHTDLPAIRCVGYRQMWSYLSGEIDYNDMVYRGVCATRQLAKR
FT                   QMTWLRGWSSVQWLDSDKPGEALDSVIQVVSA"
FT   gene            383788..384093
FT                   /gene="ymr"
FT                   /locus_tag="YPD4_0324"
FT   CDS_pept        383788..384093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ymr"
FT                   /locus_tag="YPD4_0324"
FT                   /product="RNA-binding protein Hfq"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57233"
FT                   /protein_id="ACY57233.1"
FT                   /translation="MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVIL
FT                   LKNTVSQMVYKHAISTVVPSRPVSHHSNTPSGSTNNYHGSNPSAPQQPQQDSDDAE"
FT   gene            384192..385478
FT                   /gene="hflX"
FT                   /locus_tag="YPD4_0325"
FT   CDS_pept        384192..385478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflX"
FT                   /locus_tag="YPD4_0325"
FT                   /product="GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57234"
FT                   /protein_id="ACY57234.1"
FT                   /translation="MFDRYEAGEQAVLVHIYFSQNKDTEDLREFEALVSSAGVEALQIV
FT                   TGSRKAPHPKYFVGEGKAEEIADAVKASGASVVLFDHALSAAQERNLERLCQCRVIDRT
FT                   GLILDIFAQRARTHEGKLQVELAQLRHIATRLVRGWTHLERQKGGIGLRGPGETQLETD
FT                   RRLLRDRISLILSRLERVAKQREQGRRARTRADIPTVSLVGYTNAGKSSLFNKITAADV
FT                   YAADQLFATLDPTLRRINVADVGDTVLADTVGFIRHLPHDLVAAFKATLQETRQASLLL
FT                   HIIDAADPRVAENMAAVDTVLAEIEADEIPTLLVMNKIDLLDDFVPRIDRNEDNLPVRV
FT                   WLSAQTGAGIPLLFQALTERLSGEIAHFELRLPPQAGRLRSRFYQLQAIEKEWIDEDGN
FT                   VGMVVRMPIVDWRRLCKQEQELVSYIQNN"
FT   gene            385719..386978
FT                   /gene="hflK"
FT                   /locus_tag="YPD4_0326"
FT   CDS_pept        385719..386978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflK"
FT                   /locus_tag="YPD4_0326"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57235"
FT                   /protein_id="ACY57235.1"
FT                   /translation="MAWNQPGNNGQDRDPWGSSNNNGGNSGGNNNKGGRDQGPPDLDDI
FT                   FRKLSKKLSSLGGKGSGSGGNGASHGPGFSGRVVGIAVVAVVVIWAASGFYTIKEAERG
FT                   VVTRLGKLSHIVQPGLNWKPTFIDEVVPVNVEAVRELAASGVMLTSDENVVRVEMNVQY
FT                   RVTDPAAYLFSVTNPDDSLRQATDSAVRGVIGKYTMDKILTEGRTIVRSDTQRVLEETI
FT                   RPYQMGITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIREAEAYTNEVQPRANGQA
FT                   QRLLEDARAYAARKVLEAQGEVAGFAKLLPEYKAAPEITRERLYIETMEKVLGKTNKVL
FT                   ANDKGNNLMVLPLDQMLRGQGAANKVDGNKDTSLIRLNPAPSSQQTGASNSNTSSGSGS
FT                   IMDQRRVNAQRDTSTRVGRE"
FT   gene            386982..387986
FT                   /gene="hflC"
FT                   /locus_tag="YPD4_0327"
FT   CDS_pept        386982..387986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflC"
FT                   /locus_tag="YPD4_0327"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57236"
FT                   /protein_id="ACY57236.1"
FT                   /translation="MRKSFLLIVVVVLIALFASLFVVEEGQRGIVLRFGKVLRDSDNKP
FT                   LVYAPGLHFKIPFIETVKRLDARIQTMDNQADRFVTNEKKDLIVDSYLKWRISDFSRYY
FT                   LATGGGDVSQAEVLLKRKFSDRLRSEIGRLNVRDIVTDSRGRLTSDVRDALNTGSVGDE
FT                   AATTEADDAIASAAARVEQETRGKQPAVNPNSMAALGIEVVDVRIKQINLPAEVSDAIF
FT                   QRMRAEREAVARRHRSQGQEEAEKLRATADYEVTRTLAEAERQARITRGGGDAEAARLF
FT                   AEAFSQDPDFYAFIRSLRAYENSFSSGNDVMVLSPDSDFFRYMKSPDNSSKRP"
FT   gene            388446..389756
FT                   /gene="purA"
FT                   /locus_tag="YPD4_0328"
FT   CDS_pept        388446..389756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="YPD4_0328"
FT                   /product="adenylosuccinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57237"
FT                   /protein_id="ACY57237.1"
FT                   /translation="MIFEMGKNVVVLGTQWGDEGKGKVVDLLTERAKYVVRYQGGHNAG
FT                   HTLVINGEKTVLHLIPSGILRENVISIIGNGVVLAPDALMKEMTELEARGVPVRERLLL
FT                   SEACPLILPYHVALDNAREKARGAKAIGTTGRGIGPAYEDKVARRGLRVSDLFNKETFA
FT                   IKLKEIVEYHNFQLVHYYKEAAVDYQKVLDDVLAIADILTAMVVDVSELLDNARKQGEL
FT                   IMFEGAQGTLLDIDHGTYPYVTSSNTTAGGVATGSGLGPRYVDYVLGIVKAYSTRVGAG
FT                   PFPTELNDETGEFLRKQGNEYGATTGRSRRTGWLDIVAVRRAVQINSLSGFCMTKLDVL
FT                   DGLKEVKLCVGYRMPDGREVDTTPLAAEGWEGIEPIYETMPGWSETTFGVKEHSKLPQA
FT                   ALNYIQRVEELTGVPIDIISTGPDRDETMILRDPFDA"
FT   gene            390086..390550
FT                   /locus_tag="YPD4_0329"
FT   CDS_pept        390086..390550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0329"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57238"
FT                   /protein_id="ACY57238.1"
FT                   /translation="MGVSRVNGYSGVYVQLTSFTDYGLRALIYMASLPDGQMTSISQVT
FT                   EVYGVSRNHMVKIINQLSRVGLVTAVRGKNGGIRLGKPADQILIGDVVRQMEPLTLVNC
FT                   SSDFCHITPACRLKQVLNQAVQSFLKELDNYTLADMVKDNSPLYKLLLVE"
FT   gene            390791..392518
FT                   /locus_tag="YPD4_0330"
FT   CDS_pept        390791..392518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0330"
FT                   /product="ribonuclease R"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57239"
FT                   /protein_id="ACY57239.1"
FT                   /translation="MSQDPFLEREAEKYESPIPSREFILAHLAKRETPASREELANELN
FT                   LTGEEPLEALRRRLRAMERDGQLVFTRRQCYALPERLDLLRGTVIGHRDGYGFLRVEGS
FT                   KDDLYLSAEQMKMAIHGDVVLAQVVGADRKGRREARIVRVLVPKTSQIVGRYFTDAGTG
FT                   FVVPDDSRLSFDILIPAEATCGARMGFVVVVELTQRPTRRTKAVGKIVEVLGENMGTSM
FT                   AVDIALRTHEIPHTWPPQVEKQVADLKEQVPEEAKKGRVDLRDLPLVTIDGEDARDFDD
FT                   AVYCEKKRGGGWRLWVAIADVSYYVRPQTALDDEARSRGNSVYFPSQVIPMLPEVLSNG
FT                   LCSLNPQVDRLCMVCEMTISSQGKLSSYKFYEAVMSSHARLTYTKVWRIIDGEESLREQ
FT                   YKPLVPHLEELHAMYKVLDQARAERGGIAFETEEAKFIFNAERRIERIEPTVRNDAHKL
FT                   IEECMILANIAAARFVEKHEEPALFRVHDRPSDDHIVALRSVLNELGLTLGGGLKPQPK
FT                   DYSVLMDEISDRPDHEMLQTMLLRSMKQAVYDPENGVTLVWRWLLMATSPHLFVVTLI"
FT   gene            392521..393324
FT                   /gene="rnr"
FT                   /locus_tag="YPD4_0331"
FT   CDS_pept        392521..393324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnr"
FT                   /locus_tag="YPD4_0331"
FT                   /product="ribonuclease R"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57240"
FT                   /protein_id="ACY57240.1"
FT                   /translation="MHRAIKYQLAKEHGNLKDRWTPTGGWHSDFEDMLQLGQHCSMTER
FT                   RADEATRDVADWLKCDFMLDQVGNVFTGIIASVTGFGFFVRLDDLFIDGLVHVSSLDND
FT                   YYRYDNIGQRLIGESSGVVYRLGDTVEIRVDAVHMDERKIDFALVSSTRKPRGEGKTAR
FT                   DKAKNNGQRTLRSNSAGRGSSSGSSRRDGAPTAGGQKRPRRAKKPVNFEPDSAFRPDAA
FT                   AAKPDDKALAEKKAKAKAKRASAKTKKIAAATKAKRAKKKTTSDQ"
FT   gene            393443..394183
FT                   /locus_tag="YPD4_0332"
FT   CDS_pept        393443..394183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0332"
FT                   /product="putative methylase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57241"
FT                   /protein_id="ACY57241.1"
FT                   /translation="MSEIIYGIHAVKALLERDPQRFLEVFILKGRDDRRLQPLIAELEA
FT                   AGLVIQVASRQWLDSQVEGGVHQGIVARVREGRQYQENDLPALLESVETPFLLVLDGVT
FT                   DPHNLGACLRSADAAGVHAVIVPRDRSAQLNAIAKKVASGAAENVPLIKVTNLARTLRV
FT                   LQEHNVWIVGTAGEADHTLYQSKMTGPMALVMGAEGEGMRRLTREHCDELISIPMAGSV
FT                   SSLNVSVATGVCLFEVVRQRGLKA"
FT   gene            394401..396044
FT                   /gene="aidB"
FT                   /locus_tag="YPD4_0333"
FT   CDS_pept        394401..396044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aidB"
FT                   /locus_tag="YPD4_0333"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57242"
FT                   /protein_id="ACY57242.1"
FT                   /translation="MGKGMDWQTHLVFNQPEPLSNSNLFLSDLALREAVVREHAGWDGE
FT                   NLSLIGLQLGSLESLELGRLANAHPPELLRYDGAGQRLGQVRFHPAWHVLMQGLIHHRV
FT                   HNLPWQEDARNGSFVARAARFILHAQVDAGALCPITMTFGAIPLLQQTLPPLFQNWLSP
FT                   LLSDRYDPHLSLGNQKRGLLIGMGMTEKQGGSDVLSNTTRAEPLSIRGQGEVYRLIGHK
FT                   WFFSVPQSDAHLVLAQAEGGLSCFFLPKILPDGTHNAIRFERLKEKLGNCSNASSEVEF
FT                   DNATAWLLGEEGDGIRQILKMGGYTRFDCALGSHGLMRRAFSVALYHALQRQVFGKALV
FT                   EQPLMRQVLSRMALRLEGHTALLLRLARAWEASGEVHEQIFSRLLTPAAKYRVCGQGSA
FT                   FVAEAMEVLGGIGYCEQSELPRLYREMPVNSIWEGSGNIMCLDVLRTLRKLPTAVEMLQ
FT                   QEFYPVRGQNRLFDRAWRQLQQRLKNPKEEQGRALTQQLFDLCCASQLLRFASPRLADA
FT                   WCRMTLDHRDQYMLPEAVCARLLERATGAH"
FT   gene            complement(396116..396427)
FT                   /locus_tag="YPD4_0334"
FT   CDS_pept        complement(396116..396427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0334"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57243"
FT                   /protein_id="ACY57243.1"
FT                   /translation="MINIKRTIAFLLLTLGLSGCNAFNITPVPPPAIQPYAQEITRAQS
FT                   LRLQKVGTVSAQVYGSPGDVETEIQRRANASGAPYYLIVMISDSVYPGIWYANALLYR"
FT   gene            complement(396767..397429)
FT                   /locus_tag="YPD4_0335"
FT   CDS_pept        complement(396767..397429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0335"
FT                   /product="transposase/IS protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57244"
FT                   /protein_id="ACY57244.1"
FT                   /translation="MDFLEHLLHEEKLARHQRKQAMYTRMAAFPAVKTFEEYDFTFATG
FT                   APQKQLQSLRSLSFIERNENIVLLGPSGVGKTHLAIAMGYEAVRAGIKVRFTTAADLLL
FT                   QLSTAQRQGRYKTTLQRGVMAPRLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILT
FT                   SNLPFGQWDQTFAGDAALTSAMLDRILHHSHVVQIKGESYRLRQKRKAGVIAEANPE"
FT   gene            complement(397401..398567)
FT                   /locus_tag="YPD4_0336"
FT   CDS_pept        complement(397401..398567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0336"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57245"
FT                   /protein_id="ACY57245.1"
FT                   /translation="MVTFETVMEIKILHKQGMSSRAIARELGISRNTVKRYLQAKSEPP
FT                   KYTPRPAVASLLDEYRDYIRQRIADAHPYKIPATVIAREIRDQGYRGGMTILRAFIRSL
FT                   SVPQEQEPAVRFETEPGRQMQVDWGTMRNGRSPLHVFVAVLGYSRMLYIEFTDNMRYDT
FT                   LETCHRNAFRFFGGVPREVLYDNMKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFSPRLC
FT                   RPFRAQTKGKVERMVQYTRNSFYIPLMTRLRPMGITVDVETANRHGLRWLHDVANQRKH
FT                   ETIQARPCDRWLEEQQSMLALPPEKKEYDVHLDENLVTSTNTPCIIHSPSTTHSAEEWR
FT                   DDGTATSTTDGARRAVATGKPYKRSACAVTTGSRPGMELYGLPGASAS"
FT   gene            398701..400764
FT                   /locus_tag="YPD4_0337"
FT   CDS_pept        398701..400764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0337"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57246"
FT                   /protein_id="ACY57246.1"
FT                   /translation="MVQDSSALASFFRSHIAKNNQYSPDWGKHYRQLVEQVQAEKPNFS
FT                   ADTIRQIWYERSNGISSLRQGGMSQFEFETAQKQLLALTRQMADECTQENYDRVIERLV
FT                   KLKTDGILNKVYWALCHRAFAALYPSKITNVVNVSNFFSSYNYCNNHFQLDLSEDQEWF
FT                   ARNLDLKKVLHRALGDDVDPIELNMSLWHLYTQVIQKKNDIGLIGSETALPEDEQDEEV
FT                   TTPQLPKNTILYGPPGTGKTYCTIELAVRACEPAAYSLQEGKEENEKRRELKKVYDRLI
FT                   AEKRVRFITFHQSFGYEEFIEGLRAETTDDGNVRYEVKAGIFKQICEDAAFGHAGVQQK
FT                   LDEALARLQERLSESGSITLETLQGKAFQLAYKSQTTFGIFPSQSKKEDLGQGYNAYLK
FT                   NISLVYQNPQAKVHNPSYVRSILNYLIKQEGLPSNPQESVSEKRQNYVLIIDEINRGNI
FT                   SKIFGELITLIETSKRAGEPEALSVILPYSSSSFSVPNNLYLIGTMNTADRSLTALDTA
FT                   LRRRFEFEAMLPDITVLKETVVKGIDLPRLLQTLNDRIEVLYDREHTLGHAFFIPVVQV
FT                   KEDEDLAFERLKRIMRNKVLPLLEEYFYNDWQKIRMVLGDNQKSGNPQLQFVCEVKDQK
FT                   QFADLFGNNGTEDLHDIGASFHLAPEDDKVWDNPLAWQQIYAPHKGNPVSGE"
FT   gene            400761..402077
FT                   /locus_tag="YPD4_0338"
FT   CDS_pept        400761..402077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0338"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57247"
FT                   /protein_id="ACY57247.1"
FT                   /translation="MKSRKDFTVFEYGHLISDKDSGRINNAVSLPPQLFEWLEQRCLKD
FT                   DADNTHRLLTLGSRGGVKTLQVKNYAGVISLPGNAFIEVLPKTGRRDENIDIARQQLLM
FT                   MLRTLKSFRHIATSASRVRTSKMPLMDVFIQQFIDSVQQIVRQGLKRDYLRQQDNLPWM
FT                   KGKLRVSAQISKNCVHRDRFQVEFDDYSSERPENRILKTAIDKIRRQISNPQLLLQVNS
FT                   LQVHFDDITPVGDVRIAFDQVRLDRHMRHYELALAWARLILMGQSPHCMQGDANAISLL
FT                   FPMEAVFESFVTAWMRHRYNDNWHVKAQVDSHTLVRLNGKGVFKLRPDIHLRPRGENGD
FT                   QAMICDVKWKMVESGKATLEQSQADLYQMLAYGVNYQEGIGDMLLIYPSHEGFSQPLPY
FT                   PYEFSHQKENPLRLWVVPFFIGDSLQSSDLRFPDGKILI"
FT   gene            403101..404426
FT                   /locus_tag="YPD4_0339"
FT   CDS_pept        403101..404426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0339"
FT                   /product="modification methylase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57248"
FT                   /protein_id="ACY57248.1"
FT                   /translation="MNDIDKDNMLLNKVISNSKGDKAYWSFKGRAKRQYCHALIQYPAM
FT                   MVPAMQGELIDAVLEIDSNVTSIIDPFVGSGTTLGEAMRRGLDFVGMDINPLSILACEV
FT                   KSGPLYIDSFKEKFIFLLDKIRADLRVDIAVQIKNIDKWFTKEVQLDLSKIYRAIQDES
FT                   SKWARKVFWLCMSNTVRTVCNSRSSTFKLHIKSFNQIENIPNTLEVFTKNIEKSIVALC
FT                   EQKNILTEMGSLKRSISKSKIKIIHADTSKKMKKNIQCDLLVSSPPYGDNNTTVTYGQF
FT                   SYLSLKWIDEKDIDNLKIKGLLETQNKIDSSSLGGSLKGANEKMELLKYKSPTLLNTVK
FT                   EISKVNSENVKKLITFIFDLDLALDNALLYLRKNAYMIWTLGNRRISNIEVPLDRIMRE
FT                   ILEYKGCVFIHQIEREILSKRMAMKNSIANTMDKELILIMRK"
FT   gene            404476..405198
FT                   /locus_tag="YPD4_0340"
FT   CDS_pept        404476..405198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57249"
FT                   /protein_id="ACY57249.1"
FT                   /translation="MVSTSLKFGGKIIEELSQKIPSSLFALNELVKNSYDAFSPDVTIT
FT                   VIPSELKIIISDYGNGMSVDEIHSLFHISKSTKKYGCEVSQNGIKRIVQGSKGLGFLSA
FT                   FKFGDKVEWKTCQNGICSVFSVKKSDLIYKDDVSGIKIPITTDSSNKNGTEIRIFTNQQ
FT                   DMDELLSDLSDEKIARKLAASMLDESFNVKIKIENKDKIISTSKLKSFLFECEQSQLFY
FT                   VKYNFSKEEIEFFHKGDK"
FT   gene            405170..406543
FT                   /locus_tag="YPD4_0341"
FT   CDS_pept        405170..406543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0341"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57250"
FT                   /protein_id="ACY57250.1"
FT                   /translation="MSFFIRGINKTPFPIDRTDYSINIELIIFLFDKGKNTKSISNLYK
FT                   RLHDNALYPLVYINNNLFNNTIIFDPDLLRKKSSGASLPQMIGYVSIQSQNKNIEFNSD
FT                   RTYFVDNSITKNLVNSLKKLNETIQTKGSDLKNELKVGTPSSLTGKSYPTEDVTSIRNK
FT                   PASISIDRKKTIKFHIPSEQIDLNEYIYAVKDSSGNDINKNDVVTSIEGSVTNSRILEA
FT                   IEEPCELRVVFRYEDSVTGLVSADVFLCFEKKISNISGSKEEKSLFTIQSASGYTVNTG
FT                   TVSSIIYAIDKLYSLRERDGFLPLIACSIRSVFEISQDKLFRTHRFLFPTFKTKIFTPE
FT                   TNKEMKDKLLGNIIHIIFLVKKNPKLLTKIAERLDISYSTFTNSLNLDEFKSAVKYSHI
FT                   GAHQSTKFLSKPKIEVCADTCGLFAVICDVLINMKKNDIIDLNATIVNEADLNNFFRI"
FT   gene            407815..409203
FT                   /locus_tag="YPD4_0342"
FT   CDS_pept        407815..409203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0342"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57251"
FT                   /protein_id="ACY57251.1"
FT                   /translation="MIKQMRQQGAYIKLQEQANALAHIQALNFESIDLPTAQRQLEELQ
FT                   ARLDRLTHPQSDIAIAKAALDEAEARQKELERQYQQEVTACAGLKKDLERAAMLSRKVH
FT                   NIAKQGMTGALQALGAAHFPQVAPEQLDDIQDIEREHARQLQGRLNEVNDRLQRLREEL
FT                   IKRMSDAKKEDTGALSEVGRELDDIPNYLARLQTLTEEALPEKLKRFQEYLNRSSDDGV
FT                   TQLLSHIDHEVALIEERLEALNDTMRRVDFQSGRYLCLIAKPVVHDSMRTLLRAQRQLN
FT                   SARFVDDDGESQYKALQALVGLLKDACERNRTQGARALLDPRFRLEFAVSVIERETGSV
FT                   IETRTGSQGGSGGEKEIIASYVLTASLSYALCPDGRTKPLFGTIILDEAFSRSSHVVAG
FT                   RIIAALREFGLHAVFITPNKEMRLLRHHTRSAIVVHRRGPDSSLVSLSWEDLNEHHQQR
FT                   NRAI"
FT   gene            409200..410354
FT                   /locus_tag="YPD4_0343"
FT   CDS_pept        409200..410354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0343"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57252"
FT                   /protein_id="ACY57252.1"
FT                   /translation="MKSPIDIGRQLARQWHQSKVRSERLLTPGCWPLQLPIGKPSAKIF
FT                   TANTQAVQRHVEVWRQVSIGLVEWESVSYRASLTPVSIPVRWCLRPPSEWINAASNRQV
FT                   SQEFQHLEQLVAQVDKSFHALLINQRALWLHKDPHEVITAANLACKLTPGCAQGRPLRL
FT                   LSESGVDTKFFERNYSLLTKLLDERFEGEASGQGLATFLDAFEESSHWVLVTPLAPGIL
FT                   PFNMSKVTTTELTSVDLPCSRILIVENEHCIHQLPQLPDTIAILGSGLDLQWLISPNLK
FT                   SKSIGYWGDMDTWGLLMLARARAFQPAITALLMGRLLFEHYASGSAVAEPVNAQQAVPE
FT                   GLHHHEADFYRYLLSQPRGRLEQEYLPRDVVEMALTEWVGHISL"
FT   gene            complement(410500..411546)
FT                   /locus_tag="YPD4_0344"
FT   CDS_pept        complement(410500..411546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0344"
FT                   /product="M48 peptidase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57253"
FT                   /protein_id="ACY57253.1"
FT                   /translation="MIVEGYYQYPGRAAREAARLLLNEIGDNVTLLRDGEQHYFSLSQL
FT                   NVSSSLGSIPLNLTFPDGGRFVPSDDALFRKWLYQQRSPGVVHRLERHKSGVLLTLLIT
FT                   PLLILAYIYWLLPWASSEIALRIPTTAEQKLGEHSLEWLQQSGFKPSALPAERQEAIQQ
FT                   LFLQVMPPQMRQERTPLKLVLMTAPTTANAFMLPDGTMVISDDLIKLTTSDDALAAVML
FT                   HEMGHHAHRHSMQMVVRSSLVALTFMWMTGDVNGIGDTLLQSAAFIHEMQFSRTIESEA
FT                   DSWAIAEMQREKRSLLAMEDIYHALQQTTTPEEAETRAGIPEWLSSHPDMPARLDVIRA
FT                   AREKMAQE"
FT   gene            complement(411557..412753)
FT                   /locus_tag="YPD4_0345"
FT   CDS_pept        complement(411557..412753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0345"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57254"
FT                   /protein_id="ACY57254.1"
FT                   /translation="MADNASQNKSLHRVAFKGEGGEYFSIWLVNLLLTIITLGVYSAWA
FT                   TVRRRRYFYGNTELNGDRFDYHAEPIEILKGRLMVIGGVILFYILLAIAPTLGLLVALV
FT                   LLALIPWIIIRSWRYNAIMTSYRGVRFNYHCQTGQAYWALLFCPLLLILGLYAVIIVMA
FT                   MFLGSVASTPSTAITLIVVSAILLVPLLAVINGIVSTLQHSLYVNNLYFGNSSFISTLK
FT                   KSAFIKIAFFSVLIFIPFFFVAMMFAGAFFADLFQSALNGSIANENKTAMLIIQNASNL
FT                   LFMMLMLLLGTMVSSSYRIVAQRNYLFSQTTLQGDIKLRSSMKLLSYMGLLMTNSLITV
FT                   CSLGLATPIAEVRHARYMANATEIEGDLSLLNIHAHQDTANSALAEEAVQALDLGTGF"
FT   gene            413459..413995
FT                   /locus_tag="YPD4_0346"
FT   CDS_pept        413459..413995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0346"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57255"
FT                   /protein_id="ACY57255.1"
FT                   /translation="MPIPERLTPGKATKNRTQRLLKLLDEISSTLEDNGDQENDRVREL
FT                   ILQWNEIACREHDFHEFRDFHAYTSKDDFIISAQRKAKYIEDFQYIESIELVNVIAQAE
FT                   GTEPDIHYAVDLLDKNFPDGDASDLIFWPNYWFQDENMLHIELTPEETVGYLMARSGRT
FT                   LQGAPEIELRYPYYN"
FT   gene            413997..414872
FT                   /locus_tag="YPD4_0347"
FT   CDS_pept        413997..414872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0347"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57256"
FT                   /protein_id="ACY57256.1"
FT                   /translation="MTIKLISQLTALVSEPNSIHHVYFAKSLRAAPLLAQQVNFPRMEL
FT                   IIEGSQAMIWDRLYDDFHHKDEYIMHRGDILFIPSGGWNIPQWEQPVITLSILFGKQSL
FT                   GFSLLSWDGESVVHKEMESVLRRGPRVGAYILQALNEMSLMQREQTTVQLIVRSLISHC
FT                   IDLLRNQVKTPSRSQTLFESIREYIERNYSEPLTRESVAHVFHISPNYLSHLFRNAGNI
FT                   GFNESVNSARLENAKILLKFYEMKIKEVANVCGFIDSNYFCRLFRKETELTPSEYRQQY
FT                   RSNMMERDVI"
FT   gene            complement(414865..415209)
FT                   /locus_tag="YPD4_0348"
FT   CDS_pept        complement(414865..415209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0348"
FT                   /product="PTS system, IIB component"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57257"
FT                   /protein_id="ACY57257.1"
FT                   /translation="MTIKLVAVTACVSGVAHTYMVAERLDKLCLQLKWQLKVETQGALG
FT                   VEYSLTEDDILQADAVILINDVAIKEQERFQNCRCVQADIQTFLCHPEKILAATKKVIS
FT                   SPKTVSIVIK"
FT   gene            complement(415302..415622)
FT                   /locus_tag="YPD4_0349"
FT   CDS_pept        complement(415302..415622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0349"
FT                   /product="PTS system, IIB component"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57258"
FT                   /protein_id="ACY57258.1"
FT                   /translation="MTNIIAITACPSGVAHTYMAAEALERAARAKGWECKVETQGSIGV
FT                   ENKLTAEDVAAADMVILTKDIGILFEERFAGKVIVRIAVSDAVKRADAIMDKIAAYLEK
FT                   NT"
FT   gene            complement(415963..417045)
FT                   /locus_tag="YPD4_0350"
FT   CDS_pept        complement(415963..417045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0350"
FT                   /product="PTS system, IIC component"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57259"
FT                   /protein_id="ACY57259.1"
FT                   /translation="MKELINILKNTRQHLMTGVSYMIPFVVAGGILLALSVMLYGKGAV
FT                   PEVASDPNLKKLFDIGVVGLTLMVPFLAAYIGYAIADRAALAPAAIGAWVGASFGAGFF
FT                   GAIIAGLLGGIIVFYLKKISVPKTLRSVMPIFVIPIVGTLLTAGIMMWGLGEPIGILTA
FT                   NLTQWLQGMQQGSVILLAIIMGLMLAFDMGGPVNKVAYAFMLICVAQGVYTLVAVAAVA
FT                   IATPPLGMGLATLIGRKYYSVEEREAGKAAMLMGCVGITEGAIPFAAADPLRVIPANMI
FT                   GSACAAVTAVLFGVQCYAAWGGLIVLPVVDGKLGFVVALLVGMVVTALIANLLKRFTAQ
FT                   KQPGRSSAEGDVNMDFDIKN"
FT   gene            417539..419968
FT                   /locus_tag="YPD4_0351"
FT   CDS_pept        417539..419968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0351"
FT                   /product="phosphocarrier, HPr family"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57260"
FT                   /protein_id="ACY57260.1"
FT                   /translation="MGDGKSVLSLIAANILLGDECQVTIEGEDEQVAFERLSIFIEHEL
FT                   PHADPILPKREESAEWEPLPASLAHLHPTLLRARSVSPGTACGKLLSLIRADLNALGDL
FT                   PVAQGIEREQQMLADGVAQLGKAWESLLVANSSTAANSSTTENNSTTENNSTTRAIREV
FT                   HRSLLRDGTFRQRLLSHIVAGESCATAIVATAAYFSQQLALAANTYLRERELDIRDVSF
FT                   QLLQQIYGEQRFPSQQALSEDSLCIADELTPSQFLALDKRYLKGLLLGRGGSTSHTVIL
FT                   ARSFNIPTLVGVDAAALQPYINQSLQIDGELGLVVCLLDEPVRRYYRQEQWLHDQLREQ
FT                   QSRYQNMPGRTLDGVRMVVAANITHAVEVEGAFNQGAESIGLFRTEILYMDRAAAPSEE
FT                   ELYTLYAQALGAAKGKPIIIRTIDIGGDKPVSYLNIPAESNPFLGYRAVRIYHEFLSLF
FT                   HTQLRAILRASMHGPLKIMIPMISSMEEILWVKDQLAEVKQSLRISHLQFDETVPLGMM
FT                   LEVPSVMFIIDQCCEEMDFLSIGSNDLTQYLLAVDRDNAKVSEHYHCLPPALLRALDYA
FT                   VCEVHRHGKWIGLCGELAAKDSVLPLLVAMGLDEISMSASFIGATKARLAKLDRGECRL
FT                   LLNRVMACRTSREVEYLLVQYDGEQRDEPLIIPECITLGADWRSKEEVIKGMVDNLLLA
FT                   GRCRYPRKLAADVWAREALFSTGLGFGFAIPHAQSEHIEQSTISVAKLAKPVNWGEEDA
FT                   LFVMMLTLNKQASGDQHMRIFSKLARRIMHEGFRDALVSAGTAQQVEMLLKHELEL"
FT   gene            complement(420030..420521)
FT                   /locus_tag="YPD4_0352"
FT   CDS_pept        complement(420030..420521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0352"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57261"
FT                   /protein_id="ACY57261.1"
FT                   /translation="MDNIHRLFLALAFSAPLVTGAAHANSLLDSVKSTAEQYGKSAGSS
FT                   SSLPSMSSLTNLLNGGDKALSAGTMNNATGILQYCVQNNVLSSDGTTAIKDQLMSKLGI
FT                   SGTEAAKSTDYEEGLGGLLKTSEGKSVNLNDLGTGQITEKIKTKACDLVLKQGKSFLLK
FT                   "
FT   gene            complement(421176..422051)
FT                   /locus_tag="YPD4_0353"
FT   CDS_pept        complement(421176..422051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0353"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57262"
FT                   /protein_id="ACY57262.1"
FT                   /translation="MADLDDIKDGKDFGIGIPQQNPAFTLKGSGSLDWGMQSRLARIFN
FT                   PKTNRTVMLAFDHGYFQGPTTGLERIDINIAPLFEYADVLMCTRGILRSVVPAAANRPV
FT                   VLRASGANSILTYLSNEAVAVAMEDAVRLNACAVAAQVYIGTEHEHQSIKNIIQLIDQG
FT                   MRYGMPTMAVTGVGKDMVRDQRYFSLASRIAAEMGAQVIKTYYVDSGFERIAAGCPVPI
FT                   VIAGGKKLPERDALEMCYQAIDQGASGVDMGRNIFQSDAPIAMLKAVHAIVHKNENAAA
FT                   AYQLFLHEQN"
FT   gene            complement(422107..423126)
FT                   /locus_tag="YPD4_0354"
FT   CDS_pept        complement(422107..423126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0354"
FT                   /product="putative periplasmic solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57263"
FT                   /protein_id="ACY57263.1"
FT                   /translation="MRTQRLKKLALVCALGFACITTAQAAERIAFIPKLVGVGFFTSGG
FT                   KGAVDAGKALGVDVTYDGPTEPSVSGQVQLINNFVNQGYNAIVVSAVSPDGLCPALKRA
FT                   MQRGVKILTWDSDTKPECRSVYINQGTPNQLGSMLVDMAANQVKKEQAKVAFFYSSPTV
FT                   TDQNQWVNEAKKKIQQEHPGWEIVTTQFGYNDATKSLQTAEGILKAYADLDAIIAPDAN
FT                   ALPAAAQAAENLKRANVAIVGFSTPNVMRPYVERGTVKEFGLWDVVNQGKISVYVANEM
FT                   LKKGDLNVGDKIDIPNIGVVEVSPNRVQGYDYEAKGNGIVLLPQRVIFTKENISKYDF"
FT   gene            complement(423185..424186)
FT                   /locus_tag="YPD4_0355"
FT   CDS_pept        complement(423185..424186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0355"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57264"
FT                   /protein_id="ACY57264.1"
FT                   /translation="MNLYRRYGWELTLAALLVLEILLFGLSNSRMLDINVLLFSTSDFI
FT                   CIGIVALPLTMVIVSGGIDISFGSTIGLCAIFLGIVFQAGVPMSVAIPLTVLVGALCGL
FT                   INAGLILYTGVNPLVITLGTLYLFGGSALLLSGLSGATGYEGIGGFPAAFTDFANQTLF
FT                   GLPIPLVIFMLCVLLFWLLMHRTHSGRHVFLIGQSSRVARYSALPIARTLCMLYAMTGV
FT                   ASAISAILLVSYFGSARSDLGASFLMPAITAVVLGGANIYGGSGSILGTALAVLLVGYL
FT                   QQGLQMIGTPNQISSALSGALLILVVVGRSISLHRHLIYEWLQRRRSRKASA"
FT   gene            complement(424183..425238)
FT                   /locus_tag="YPD4_0356"
FT   CDS_pept        complement(424183..425238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0356"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57265"
FT                   /protein_id="ACY57265.1"
FT                   /translation="MLKFIQNNREGTALLAILTLFALLGIIDRNYFSLQTFTMIFSSAQ
FT                   ILILLAIGATLVMLTRNIDVSVGSITGLCAVTVGMALNAGFGLAASCLFALLVGMVAGF
FT                   FNGILVTWLRIPAIVATLGTLGLYRGLMLLLTGGKWIEGLPADLKSLSTPILFSISPIG
FT                   WLTMLLILAMAWLLGKTAFGRSFYATGDNLQGARQLGVRTDSLRIFAFSMNGVMAALAG
FT                   IVFASQIGFIPNQTGNGLEMKAIAACVLGGISLLGGTGTIIGAILGAFLLTQIDSVLVL
FT                   LRLPAWWNDFIAGLVLLGVLVFDGRLRCAVERNIRQQKYARFTAQAIISDKKPTVSDNN
FT                   PAASNKKKAAL"
FT   gene            complement(425232..426815)
FT                   /locus_tag="YPD4_0357"
FT   CDS_pept        complement(425232..426815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0357"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57266"
FT                   /protein_id="ACY57266.1"
FT                   /translation="MPHTVATPPPLLQVRGISKQFSGVVVLKSIDFTLQPGQVHALLGG
FT                   NGAGKSTLMKIIAGILPPDTGVIEMNGQPCFNLTPAKAHQLGIYLVPQEPMLFANLSVQ
FT                   ENILFRLPKHQADKKKMAQLLKNLGCHLDLSVSAGSLEVADQQLVEIMRGLIRDSHILI
FT                   LDEPTASLTPAETHRLFSQIRMLLQQGVGVVFISHKLPEIRQLADWVSVMRDGGIALSG
FT                   ATADFSTEDMIQAMTPEAQKGALTDSQKLWLELPGNRRAQSHAQSQQPVIHVHDLSGEG
FT                   FAHISFHVQAGEILGLAGVVGAGRTELAETLYGLRPASTGNVILEEVNITAMKTANRLA
FT                   AGLVYLPEDRQASGLYLDAPLSWNVCALAHDRQGLWTQPAQEAAVLERYRRALNIKFSH
FT                   LEQPVRTLSGGNQQKLLIAKCLEANPLLLIIDEPTRGVDVSARSDIYQLIRSIAEQQVA
FT                   IIFISSDLEEVVQMADRVLVMHQGEINGALSGAAMNVDTIMHMAFGEHRSASEPQGGTA
FT                   SSAENKGASC"
FT   gene            427467..428147
FT                   /locus_tag="YPD4_0358"
FT   CDS_pept        427467..428147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0358"
FT                   /product="transcriptional regulator, sorC family"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57267"
FT                   /protein_id="ACY57267.1"
FT                   /translation="MASLSISSRLGIGAAHLLMALIQPQQLLAVGFGETTMCALQHLSG
FT                   FIASQQVRLVTLSGGVGSYMTGIGQLDAACQVSIIPAPLRASNAHVADTFRQENSVRDV
FT                   MLAACAADIAVVGIGSVNQQKEATILRSGYISEGEQLMFSRKGAVGDILGYFIQADGAL
FT                   VPDMQIHQELIGISLADLTTIPTVIGVAGGVEKADVIVAALRGRYVNALVTDEVTARAI
FT                   INLL"
FT   gene            428318..429910
FT                   /locus_tag="YPD4_0359"
FT   CDS_pept        428318..429910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0359"
FT                   /product="putative carbohydrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57268"
FT                   /protein_id="ACY57268.1"
FT                   /translation="MSQLDTTTPSGDYLMALDAGTGSVRAVIFDLNGNQIAAGQAEWLH
FT                   LPVPDVPGSMEFDLTTNWQLTCQCIRQALHLAKLPASAIRAVAACSMREGIVLYDRSGT
FT                   PIWACANVDARASREVSELKELHNNGFELEVYQCSGQTLALSAMPRLLWLAHYRPDIYR
FT                   QAGTLTMISDWLANMLSGELAVDPSNAGTTGMLDLVTRNWQPNLLEMAGLRADILSPVK
FT                   ETGTLLGHVTAKAAQECGLLAGTPVVMGGGDVQLGCLGLGVVHAGQTAVLGGTFWQQVV
FT                   NLPQPIIDPNMNTRINPHVIPGMVQAESISFFTGLTMRWFRDAFCAEEKLLAQRLGIDT
FT                   YSLLEDMAARVPAGAYGVMPIFSDVMRFKSWYHAAPSFINLSLDPEKCNKATLFRALEE
FT                   NAAIVSACNLAQIAEFSGVKASSVVFAGGGAKGKLWSQILADVTGVPVKVPVVKEATAL
FT                   GCAIAAGVGVGLYEALDKTGERLVRWEREYIPNTEHKALYQAAKTNWQAVYTDQLGLVD
FT                   CGLTTSLWKAPCL"
FT   gene            430256..431419
FT                   /locus_tag="YPD4_0360"
FT   CDS_pept        430256..431419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0360"
FT                   /product="putative lipopolysaccharide heptosyltransferase
FT                   III"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57269"
FT                   /protein_id="ACY57269.1"
FT                   /translation="MINTSNKTASPAGQLSAPASQTGASHLPEVLRNKEHVARILVIKL
FT                   RHFGDVLLTTPLLSTLKANYPQAKIDVLLYGGTQDMLRENKAINHTFIVDRGLKHAGLK
FT                   AQISGEKALFSALKKQHYDLILNLSDQWRAAAYCRLLKPTFSIGFHYPKRDNWLWRYCH
FT                   STLVEIPNAAERHTVLNNLDILSPLQLTDIRTDVTMSYGPHDIERAKQLCQQHNIEHYI
FT                   LIQPSARWKFKTWASESFSELINHLTQQGETVLLTGSKDQAELDYIAEIIAGCTQPEKV
FT                   INLSGQLALPELAVLIDNAKLFIGVDSVAMHMAAALQTPAVVLFGPSNLNQWHPWQAPH
FT                   TLLWAGNYRTLPHPNEIDTDTTDRYLNAIPVSDVIDAVDSWRVAKGN"
FT   gene            431467..432699
FT                   /locus_tag="YPD4_0361"
FT   CDS_pept        431467..432699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0361"
FT                   /product="putative O-antigen biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57270"
FT                   /protein_id="ACY57270.1"
FT                   /translation="MTTLSPAIPVNRRSEMLCSIAALLLGISMPTNNQLMSVSLVLIII
FT                   SLIINRKSLDFKPLLTSPLVYLPAAMFVLLALSLLYQNNSYGPDMVGKYKKLLYILPLA
FT                   LFFMNQPRLIKLFCTGFLVANAVILAGSLAVGVLHIPLSGVDPTNPTIFKLQITQNFFM
FT                   ALAALLWLVLAFQHQGWKRWGYSVLVVAASYSILFLVLGRTGYVALIVGLGVWLFFSLG
FT                   NRQRLTLVVLGALAFAALIFIPNKATDRIVQGVDEIKVCMAASATDAADACNSSMGQRS
FT                   AFVVEAARLIKESPILGHGAGGFYYENKEVDYKVNNPHNQYLLETIQSGVIGLFLFLAW
FT                   VICCYRVIWQQTPALRNVLLAVLTSYMACNFFNSFLLDSSEGHLFMIFVAVLAGYSVSG
FT                   SQSIAGKRLPT"
FT   gene            433878..434876
FT                   /locus_tag="YPD4_0362"
FT   CDS_pept        433878..434876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0362"
FT                   /product="multidrug resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57271"
FT                   /protein_id="ACY57271.1"
FT                   /translation="MRPVKIFMVEDSGQNGTRYFPARLQAGDETQLSFKRGGQLQELLV
FT                   REGEQVKKGQKIAMLNDTDLSLRVRDRQSTFNLARDQFNRFNTLQGRSAVSRADLDIRR
FT                   AEMESAQAALDIARKELSDATIIAPFDGIIANVNVRNHQVMAAGQPVATLSALDTLDVV
FT                   FSVPERLFTTLDISNRNYKPTVLLNHMPGREFIAEYKEHTTSTTSASQTFQVTLTMKRP
FT                   ADMPLLSGISGRVRINSGNLSGTDHPTIIVPVEAVFNPDHAQLNDARVWVIKNDNDQMH
FT                   VEERKVQVGQLVENGIQVTSGLADGEQIVAAGTGELRPQQVVRAWVRERGL"
FT   gene            434876..437962
FT                   /locus_tag="YPD4_0363"
FT   CDS_pept        434876..437962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0363"
FT                   /product="putative multi-drug efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57272"
FT                   /protein_id="ACY57272.1"
FT                   /translation="MKLTDNFINNNTRIWLTILLLGIGGIIAYLNIGRLEDPAFTIKTA
FT                   VVVTRYDGASAQQVEEEVTLPLENAIQELSYVDDVTSISSAGLSQITINIRAQYGANEL
FT                   PQIWDELWRKISDNSVRLPPGASAPMVNDDFGDVYGFFFSLTGDGYSNQDLRNFAEQLR
FT                   RELVLVPGVGKVGIVGILPEEVQVEISRAQMTAAGITPQQLSDLLSRQNVVSDAGQLQV
FT                   GSESIRLHPTGEFQSVQELGNLLVSQPGSPKSVYLRDIATVTQGFGHSPTNIYRANGQP
FT                   ALALGISFAPNVNVVNVGNAIKSRLAQLEGERPSGMHINVFYDQSKEVEGAVNGFILNF
FT                   LLALLIVVVTLLIFMGVRSGVVIAISLALNVLGTLLIMWLFNIELQRVSLGALIIALSM
FT                   LVDNAIVVVEGVVVGRQRGDSISTAIGNVVKRSKMPLLGATIIAILAFAPIGLSNDATG
FT                   EYCKSLFQVLLISLMLSWITALTLTPVFAKWAFQNQKQPEADADKPVKQPYDGWLFRYY
FT                   RVVLNKLLQHRSITLVLLAALLVASVIGFGHVRQSFFPPSNTPIFFVDIWLPYGTDISY
FT                   TEDIAAKIEQHIKQQKNVADTMTTIGQGAMRFMLTYNGQRHYPNYAQVMVRTEQLEQIP
FT                   GLIDEIESYMHDEYPQVDAQIKRIMFGPSNNSSIEARFIGPDPDVLRTLAAQAEQAIIA
FT                   DPMADGARHDWQDRSKMIRPQFSDYLGRELGVDKREVDGTLRMSFGGLPVGLYRDGTRL
FT                   IPIVLRTPDSERLNAERLNDVMVWSQARQAFIPIDNVVTSFETEWEDPLIMRLDRKRTL
FT                   TVQTDPTHQGGETSSELLQRIKPGVEAITLPRGYELEWGGDYESTKEAQRGIFISLPIA
FT                   FLLMFVVTVLMFSSVRNALAIWLTVPLALIGVTFGFLLTGIPFGFMALLGLLSLSGMLI
FT                   RNGIVLVEEIGLQRQEKPLREAIIDASTARLRPIMLTAFTTVLGLAPLLSDAFFQSMAV
FT                   VIMFGLGFATVLTLLVLPVIYSSMNPEPKEKIHDEPVSE"
FT   gene            439458..440543
FT                   /locus_tag="YPD4_0364"
FT   CDS_pept        439458..440543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0364"
FT                   /product="putative pectinesterase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57273"
FT                   /protein_id="ACY57273.1"
FT                   /translation="MPINALSKTLLLGLISFAALGEVSAAQYNAVVSAMAQGDEFSSIN
FT                   AALQSAPPDSSPFVIFLKKGVYTERLEVNRDNVTLKGEERDTTVIGANTAAGMLNPQGT
FT                   KWGTSGSSTVLVNAANFTAENLTIRNDFDFPANQAKAEGDPTKLKDTQAVALLLAEKSD
FT                   KARFRQVKLEGYQDTLYSKTGSRSYFTDCDISGHVDFIFGSGVTVFDRCNIIARDRRDI
FT                   SPPYGYITAPSTQNTAPYGLIVLNSRLTKEPGVPAKSFALGRPWHPTTAFDDGRYADPA
FT                   AIGQAVFINTVMDDHIYGWDKMSGKDKQGEKVWFYPQDSRFFEANNQGPGAEINEGRRQ
FT                   LSAEQLKAFTLPMIFPDWTVQ"
FT   gene            complement(441084..442256)
FT                   /gene="hmsT"
FT                   /locus_tag="YPD4_0365"
FT   CDS_pept        complement(441084..442256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmsT"
FT                   /locus_tag="YPD4_0365"
FT                   /product="HmsT protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57274"
FT                   /protein_id="ACY57274.1"
FT                   /translation="MQSKLNMNSHSYDQFLKSKHRLSLLLFLFLNASSAIFSMLSSSPK
FT                   TPAVTFPVVMIAVISLSAAAYLIFISKNDTGRNNYVDKNNYVDKSNHVDKNNYANKLNL
FT                   FSILIGLLWAWQIILKYEYLETNEDNYLLLSLFTIFFISTIALSDNFLAFCLHTAPSAI
FT                   TVILLDDFHNIFRIIFTIMLPLIGFSLHHLMLRRTDNFTRKLVDHLSNEREKFSDLSMI
FT                   DPLTSLYNRRGLESKLETLLSQSPGNHYVLLLDIDHFKAYNDNYGHTMGDQALVRISAA
FT                   IRDAVRSRDIVVRYGGEEFLVLLTHVSEEYANQLAERVRQRVLGLDIPHVFNHKVSTTV
FT                   TLSAGISPLQAYDLAASLKAADEALYRAKRNGRNNIEFAKDELSNVQSSP"
FT   gene            442505..442837
FT                   /gene="proP32"
FT                   /locus_tag="YPD4_0366"
FT   CDS_pept        442505..442837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proP32"
FT                   /locus_tag="YPD4_0366"
FT                   /product="Permeases of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57275"
FT                   /protein_id="ACY57275.1"
FT                   /translation="MILVMIIIIIWVGIIMITSTLAAYRSWGITGLLSRGMSSGWGILL
FT                   PFTLLPVLGWVDISIGQLRILIVVAMLATVSMLYHVRLRHFLLLPSCLALLGGLVALML
FT                   MHGGVS"
FT   gene            complement(443007..443093)
FT                   /locus_tag="YPD4_t5"
FT   tRNA            complement(443007..443093)
FT                   /locus_tag="YPD4_t5"
FT                   /product="tRNA-Leu"
FT   gene            complement(443350..444393)
FT                   /gene="rsmC"
FT                   /locus_tag="YPD4_0367"
FT   CDS_pept        complement(443350..444393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsmC"
FT                   /locus_tag="YPD4_0367"
FT                   /product="16S ribosomal RNA m2G1207 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57276"
FT                   /protein_id="ACY57276.1"
FT                   /translation="MSALTPASEVILRHSDEFIARHVLFAGDLQDALPAQFDAAGVRVH
FT                   TNQYHHWQLLSNTLEENVQFGLLATAETLAACDTLIYYWPKSKQEAQFQLANLLSILPV
FT                   GTDIFVVGENRSGVRSAEEMLADFAQLAKIDSARRCGLYHGRLDKQPEFDADAWWESYQ
FT                   VGGVTVKTLPGVFSRDSLDSGSHLLLSTFNEPFKGSVLDVGCGAGVLASVLAQQSPKIK
FT                   WTLSDVSAAAIEASRATLAVNNIEAQVIASNVYSDIKGRFEMIISNPPFHDGIQTSLTA
FT                   AEMLIRGATAHLHVGGKLRIVANSFLPYPALLDAAFGSHEVLAQNGRFKVYQATVGRPP
FT                   RDPKKKR"
FT   gene            444506..444943
FT                   /gene="holD"
FT                   /locus_tag="YPD4_0368"
FT   CDS_pept        444506..444943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holD"
FT                   /locus_tag="YPD4_0368"
FT                   /product="DNA polymerase III subunit psi"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57277"
FT                   /protein_id="ACY57277.1"
FT                   /translation="MASRRDLLLQQLGITQWVLRRPAVLQGEIAIHLPEDTRLLIVAQQ
FT                   LPEHGDPLLCDVLRSLGLTPHQVYALTPDQVAMLPEDTQCNSWRLGISEPLAVAGAQLH
FT                   SPELAGLYQDAGAKRALWQQICHYEADFYPDASRSGHSIPN"
FT   gene            445020..445331
FT                   /gene="rimI"
FT                   /locus_tag="YPD4_0369"
FT   CDS_pept        445020..445331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimI"
FT                   /locus_tag="YPD4_0369"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57278"
FT                   /protein_id="ACY57278.1"
FT                   /translation="MSIGQEMAGFAITQIVLDEATLFNIAIDPQYQRQGYGRLLLEHLI
FT                   EQLEARNIVTLWLEVRASNARAIALYESLGFNEVSVRRNYYPSANGREDAIMMALPMA"
FT   gene            445510..447099
FT                   /gene="prfC"
FT                   /locus_tag="YPD4_0370"
FT   CDS_pept        445510..447099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfC"
FT                   /locus_tag="YPD4_0370"
FT                   /product="peptide chain release factor 3"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57279"
FT                   /protein_id="ACY57279.1"
FT                   /translation="MSPSEYALEVAKRRTFAIISHPDAGKTTITEKVLLFGHAIQTAGT
FT                   VKGRGSSHHAKSDWMEMEKQRGISITTSVMQFPYGGCLVNLLDTPGHEDFSEDTYRTLT
FT                   AVDCCLMVIDAAKGVEDRTRKLMEVTRLRDTPILTFMNKLDREIRDPMEVLDEVERELN
FT                   IACSPITWPIGCGKSFKGVYHLHKDETYLYQSGKGHTIQEVRIVKGLNNPDLDVAVGED
FT                   LAKQFRQELELVQGASHEFDHEAFLSGDLTPVFFGTALGNFGVDHMLDGLVEWAPAPMP
FT                   RKTDTRVVVASEEKFTGFVFKIQANMDPKHRDRVAFMRVVSGRFEKGMKLRQVRTKKDV
FT                   VISDALTFMAGDRSHVEEAYAGDIIGLHNHGTIQIGDTFTQGEDMKFTGIPNFAPELFR
FT                   RIRLRDPLKQKQLLKGLVQLSEEGAVQVFRPLSNNDLIVGAVGVLQFEVVSSRLKSEYN
FT                   VEAVYESVNVSTARWVECHDVKKFEEFKRKNELNLALDGGDNLSYIAPTMVNLNITQER
FT                   YPDVIFRKTREH"
FT   gene            447426..448040
FT                   /gene="osmY"
FT                   /locus_tag="YPD4_0371"
FT   CDS_pept        447426..448040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="osmY"
FT                   /locus_tag="YPD4_0371"
FT                   /product="osmotically inducible protein Y"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57280"
FT                   /protein_id="ACY57280.1"
FT                   /translation="MKSTQFSRSVMAVVLGSALISGSVLAEDTLLNKAASTVDSTGAKI
FT                   DSSMKKVDNYMSDSAVTAKVKSALLEEKSLKSTDISVETSNGVVTLSGFLNSQAEIETA
FT                   VEIAGNVEGVKSVSDKLHVKDQKSQSVSEYAGDAATTSSVKAKLLADDIVPSRKIKVET
FT                   TDGVVQLSGDVENKAQSERAESIAKAVNGVKSVKNDLNIKP"
FT   gene            448445..449713
FT                   /locus_tag="YPD4_0372"
FT   CDS_pept        448445..449713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0372"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57281"
FT                   /protein_id="ACY57281.1"
FT                   /translation="MGYRIPITLGNIEPLAYKPYQPGKMALVCEGGGQRGIFTAGVLDE
FT                   FHRARFNPFDLMIGTSAGAQNLSAFICGQPGYARRVITRYTTTANFFNPLRFVRGGNLI
FT                   DLDWLVDITSQQYPLAFDHAEQYLHQGREFLMCACRSDDFEPTYISPTRENWLTAIKAS
FT                   SAIPGLYRQGVELDGVSYLDGGISDAIPVEEAYRRGAETIVVIRTVPSQAHYTPQWFKR
FT                   IEQWLSESSLQQLVRIMQQHERSYHRIQQFIEKPPGDVRIFEIFPSKPLASKALGSGAV
FT                   ALNRDYHLGRRCGRYFLATIGRWLLPRESLGDSDKTSISLSRHIIQPQNIIQTPNVFQT
FT                   KNINQLNNTYDYSGSKERFTAVFSTEPSVTLSDLTAPSEVQATAAQINEPLDPTSLTVV
FT                   DTEQAEANSLPVDITLPPNLTKK"
FT   gene            449729..450538
FT                   /locus_tag="YPD4_0373"
FT   CDS_pept        449729..450538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0373"
FT                   /product="metalloenzyme"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57282"
FT                   /protein_id="ACY57282.1"
FT                   /translation="MRTPDKPMPYFIDTHCHFDFPPFTGDEAASLACAAEANVRQLIVP
FT                   SVKAAYFSRILALADRYPPLFAALGLHPLYIAEHEDADLAALASHLADKPPKLVAIGEI
FT                   GLDLYMDEPQFPHQLVILNMQLELAKQHDLPVILHSRRSHDPLAAALRKAALPRAGVIH
FT                   GFAGSLAQAQAFIRLGYYIGVGGTITYKRAQKTRHVMASLPLSSLLLETDAPDMPLASF
FT                   QGQANRPERAANVFAALCELRPEPADEIAAELMCNSQRLFSLPPLRP"
FT   gene            451073..452344
FT                   /locus_tag="YPD4_0374"
FT   CDS_pept        451073..452344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0374"
FT                   /product="putative Na+ dependent nucleoside
FT                   transporter-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57283"
FT                   /protein_id="ACY57283.1"
FT                   /translation="MLMSLVGMAVLILIAVLLSSNARAINLRTVIGAFIIQVVIGALVL
FT                   YVPVGRRILGGMSEGVANVIAYGNEGISFIFGGLVSDKMYEVFGGGGFVFALRVLPVIV
FT                   FFSSLIAVLYYLGVMQIVIKVLGGGLQKLLGTSRTESLSATANIFVGQTEAPLVVRPYI
FT                   ATMTQSELFAVMCGGLASVAGSVLAGYAQMGVPLEYLIAASFMAAPGGLLFAKLMVPET
FT                   EQTHDKVDAIALIAEEDRPANVIDAAASGAASGMQLALNVGAMLLAFIALIALLNGILG
FT                   GIGGWFDYPQLSLELILGWVFSPIAYLIGVPWSEAMVAGSFIGQKIIVNEFVAFMNFGQ
FT                   YLQADELVKAAGLQVLSEHTKAIISFALCGFANLSSVAILLGGLGSMAPNRRHDIARFG
FT                   LKAVAAGTLSNLMSATIAGFFLAL"
FT   gene            452905..453717
FT                   /gene="deoC"
FT                   /locus_tag="YPD4_0375"
FT   CDS_pept        452905..453717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoC"
FT                   /locus_tag="YPD4_0375"
FT                   /product="deoxyribose-phosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57284"
FT                   /protein_id="ACY57284.1"
FT                   /translation="MLESFMTDLTACAHLNDYAKRALSLMDLTTLNDDDTDEKVIALCH
FT                   QAKSPAGNTAAICIYPRFIPVARKALREQGTPEIRIATVTNFPHGNDDVAIALAETRAA
FT                   IAYGADEVDVVFPYRALMAGNDKIGFELVKTCKEACAAANVLLKVIIETGELKQAHLIR
FT                   QASEIAIKAGADFIKTSTGKVPVNATLESADIMIRTIRELGVGETVGFKPAGGVRTAED
FT                   AAQFLQLADQLMGEGWADARHFRFGASSLLASLLTTLGHQSNANSSGY"
FT   gene            453745..454380
FT                   /locus_tag="YPD4_0376"
FT   CDS_pept        453745..454380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0376"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57285"
FT                   /protein_id="ACY57285.1"
FT                   /translation="MHSRLKACCVAISESACGRLSSHIPVKQGDALFLAQEIIRKKRDG
FT                   QPLSEEEIRFFINGIRDNVVSEGQIAALAMTIYFHDMSMPERVALTMAMRDSGTVLNWK
FT                   SLNLNGPLVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHTGGTLDKLEAIPG
FT                   FDIFPDDNAFRKIIMLVWRLSAKPARWPLPISVFTRPAILRQQSILFH"
FT   gene            454377..455156
FT                   /locus_tag="YPD4_0377"
FT   CDS_pept        454377..455156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0377"
FT                   /product="Thymidine phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57286"
FT                   /protein_id="ACY57286.1"
FT                   /translation="MITASILAKKLAEGLDALVMDVKVGSGAFMPTYSLSADLAQAIVG
FT                   VANGAGCKTTALLTDMNQVLASSAGNGVEVREAVRFLTGEYRNPRLLEVTMALCVEMLL
FT                   SGGLAHDEADARAKLQAVLDNGKAAEVFGRMVAAQKGPADFVERYDSYLPVATLSKPVF
FT                   AEQTGIITAMDTRALGMAVVALGGGRRRATDPIDYSVGLTEMARLGTRVDGQQPLAVIH
FT                   ANNEDDWQQAAEVVRAAITLGNNTPEETPVIYRRITE"
FT   gene            455288..456511
FT                   /gene="deoB"
FT                   /locus_tag="YPD4_0378"
FT   CDS_pept        455288..456511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoB"
FT                   /locus_tag="YPD4_0378"
FT                   /product="phosphopentomutase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57287"
FT                   /protein_id="ACY57287.1"
FT                   /translation="MKRTFIMVLDSFGIGASADAKKFGDEGADTLGHIAEACARGEANV
FT                   GRSGPLTLPNLSRLGLGKAAEESTGTFPVGLDKNADIIGAYGYASELSSGKDTPSGHWE
FT                   IAGVPVLFDWGYFSDVENSFPQELLDKLVKRANLPGYLGNCHSSGTVILDQLGEEHMKT
FT                   GKPIFYTSADSVFQIACHEETFGLDRLYELCEIAREELTDGGYNIGRVIARPFIGDKPG
FT                   HFQRTGNRHDLAVEPPAPTMLKKLVDEKGGEVVSIGKIADIYAQVGITQKVKATGLDAL
FT                   FDATIEEMKKAGDNTIVFTNFVDFDSSYGHRRDVAGYAAALELFDRRLPELMALIKEDD
FT                   ILILTADHGCDPTWPGTDHTREHIPVLVYGPKVKPGSLGHRETFADIGQTVAAYFGLSP
FT                   MDYGKNML"
FT   gene            456636..457355
FT                   /gene="deoD"
FT                   /locus_tag="YPD4_0379"
FT   CDS_pept        456636..457355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoD"
FT                   /locus_tag="YPD4_0379"
FT                   /product="purine nucleoside phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57288"
FT                   /protein_id="ACY57288.1"
FT                   /translation="MATPHINAEMGDFADVVLMPGDPLRAKFIAETFLQDVREVNNVRG
FT                   MLGFTGTYKGRKISVMGHGMGIPSCSIYAKELITDFGVKKIIRVGSCGAVRTDVKLRDV
FT                   VIGMGACTDSKVNRMRFKDHDYAAIADFEMTRNAVDAAKAKGVNVRVGNLFSADLFYTP
FT                   DPQMFDVMEKYGILGVEMEAAGICGVAAEFGAKALTICTVSDHIRTGEQTTAAERQTTF
FT                   NDMIEIALESVLLGDNA"
FT   gene            complement(457467..458168)
FT                   /gene="smp"
FT                   /locus_tag="YPD4_0380"
FT   CDS_pept        complement(457467..458168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smp"
FT                   /locus_tag="YPD4_0380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57289"
FT                   /protein_id="ACY57289.1"
FT                   /translation="MARAKLKFRLHRTAIVLICLALLVLLMQGASYFSLSHQLARSEQV
FT                   EELAQTLAKQVAFSLSPIMDSGDDNIDSQKVDAILQQLTQSSRILDASVYQIDGTLVAS
FT                   AGENVKVRDRLALDGKRPGSYFNHQIVEMIAGNSGPSGFLRMTLDTHVLATESKQVDNT
FT                   TNLLRLMILVALAVGIILARTLLQGRRSRWQQSPYLLTANIPVKEEDESEDDTPEALVG
FT                   QAETDHKPADK"
FT   gene            458400..459380
FT                   /gene="serB"
FT                   /locus_tag="YPD4_0381"
FT   CDS_pept        458400..459380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serB"
FT                   /locus_tag="YPD4_0381"
FT                   /product="phosphoserine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57290"
FT                   /protein_id="ACY57290.1"
FT                   /translation="MSNSLTYCDLPSEIYQWPGLPLSLSGDEVMPLDYRAGHTGWLLYG
FT                   RKLDKQRITDFQRQLGAAMVIVSAWCVEDYQVIRLAGSLTPRIKTLADESGLDVAPLGA
FT                   IPHLRTPGLLVMDMDSTAIQIECIDEIAKLAGVGDEVAAVTERAMQGELDFSASLRQRV
FT                   AALKGADANILKQVRDDLPLMPGLVSLVRKLQALDWHVAIASGGFTYYAEYLRDKLRLV
FT                   HVAANELEIKDGKLTGCVLGPIVDAQYKADTLIKLAEKLNIPLAQTIAIGDGANDLKMM
FT                   QVAGLGLAFHAKPKVYAKAKVAIRHGDLLSVLCILTGSLKHESGK"
FT   gene            459468..460850
FT                   /gene="radA"
FT                   /locus_tag="YPD4_0382"
FT   CDS_pept        459468..460850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="YPD4_0382"
FT                   /product="DNA repair protein RadA"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57291"
FT                   /protein_id="ACY57291.1"
FT                   /translation="MAKAPKRAFVCNECGADYPRWQGQCSACNAWNTITEVRLAAVASS
FT                   SRNDRFVGYAGDAGVSRVQKLSDISLEELPRFSTGFLEFDRVLGGGVVPGSAILIGGNP
FT                   GAGKSTLLLQTLCKLSENMKTLYVTGEESLQQVAMRAHRLGLPTAGLNMLSETSIEQIC
FT                   LIAEQEQPRLMVIDSIQVMHMADIQSSPGSVAQVRETAAYLTRFAKTRGVAIVMVGHVT
FT                   KDGSLAGPKVLEHCIDCSVMLDGDGDSRFRTLRSHKNRFGAVNELGVFAMTEQGLREVS
FT                   NPSAIFLSRGDEVTAGSSVMVVWEGTRPLLVEIQALVDHSMMSNPRRVAVGLEQNRLAI
FT                   LLAVLHRHGGLQMSDQDVFVNVVGGVKVTETSADLALLMSLVSSLRDRPLPQDLVVFGE
FT                   VGLAGEIRPVPSGQERISEAAKHGFKRAIVPYANMPKKPLPNMQVFGVKKLADALAVLE
FT                   DL"
FT   gene            461009..462280
FT                   /gene="nadR"
FT                   /locus_tag="YPD4_0383"
FT   CDS_pept        461009..462280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadR"
FT                   /locus_tag="YPD4_0383"
FT                   /product="nicotinamide-nucleotide adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57292"
FT                   /protein_id="ACY57292.1"
FT                   /translation="MLQFDYLKTAIKQKGCTLQQVAEASGMTKGYLSQLLNDKIKSPSA
FT                   QKLEALHRFLGLEFPRREKKVGVVFGKFYPLHTGHIYLIQRACSQVDELHVILCHDEPR
FT                   DRELFENSSMSQQPTVSDRLRWLLQTFKYQKNIHIHSFDEHGIEPYPHGWDVWSRGVKA
FT                   FMNEKGIVPSFIYSSESQDAPRYREQLGIETILIDPQRSFMNISGRQIRRDPFRYWDYI
FT                   PTEVKPFFVRTVAILGGESSGKSTLVNKLANIFNTTSAWEYGREYVFSHLGGDEMALQY
FT                   SDYDKIALGQAQYVDFAVKYANKVAFIDTDFVTTQAFCKKYEGREHPFVQALIDEYRFD
FT                   LVILLENNTPWVADGLRSLGSDRDRKSFQNLLEQMLRDNNIEYVHVESADYDARFLRCV
FT                   ELVQQLLAADPQRLARPSVLTDAR"
FT   gene            462398..463567
FT                   /locus_tag="YPD4_0384"
FT   CDS_pept        462398..463567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0384"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57293"
FT                   /protein_id="ACY57293.1"
FT                   /translation="MRLIGSLSGWEITMGENIWVWQQKKWPNFYWDEALIQPQLRHARF
FT                   KLGQLLGENRTNTSAENATKTLDILLANIIASSKIENEPLNIRSVRSSLAKRLGMILED
FT                   NYPTSDRTDGLAAMMLDAINECKADLTLERLYQWHEWLFPNDLWSLTPMKAGQLRGQEP
FT                   MQVVSGRIGKETVHFEAPPQAILFDEIEQFISWFNLSRSDSFLDPLLRAAIVHFWFVTL
FT                   HPFEDGNGRITRALTDMALSQADSQSIHLYAMSVAILDNREAYYAILEQGQRGNLDITP
FT                   WLLWFIATLEQSLDQASKGIEHTLAKTSFWLKHNGSGLSAEQVKVLNRLLDGGENGFSA
FT                   GINASQYQKVAKVSKATATRHLADLLARECIEKLPGGGRSTRYQAKYPD"
FT   gene            complement(463713..464744)
FT                   /locus_tag="YPD4_0385"
FT   CDS_pept        complement(463713..464744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0385"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57294"
FT                   /protein_id="ACY57294.1"
FT                   /translation="MAITHDRYFLDNVAGWILELDRGEGIPWEGNYSSWLEQKNARLAQ
FT                   EASSEAARRKSIEKELEWVRQNPKGRQAKGKARLARFEELNSVEYQKRNETSELFIPPG
FT                   PRLGDKVLEVEHLSKSYGDRLLIDDLTFALPKGAIVGIIGPNGAGKSTLFRMLSGQEQP
FT                   DSGTISLGDTVQLASVDQFRDNMDDSKTVWEEVSGGQDIMKIGNFELPSRAYVGRFNFK
FT                   GVDQGKRIGELSGGERGRIHLAKLLQVGGNMLLLDEPTNDLDIETLRALENALLEFPGC
FT                   AMVISHDRWFLDRIATHIIDYQDEGKVEFFEGNFTEYEEWKKRTLGAEALEPHRIKYKK
FT                   MTK"
FT   gene            complement(464744..465376)
FT                   /locus_tag="YPD4_0386"
FT   CDS_pept        complement(464744..465376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0386"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57295"
FT                   /protein_id="ACY57295.1"
FT                   /translation="MAQYVYTMHRVGKVVPPKRHILKNISLSFFPGAKIGVLGLNGSGK
FT                   STLLRIMAGLDTEIEGEARPQLGIKIGYLPQEPKLNLEQTVRESVEEAVGEVKRALTRL
FT                   DEVYALYADPDADFDKLAKEQGELEAIIQSHDGHNLDNQLERAADALRLPPWDAKIANL
FT                   SGGERRRVAICRLLLEKPDMLLLDEPTTWMQNLWPGWSASCMTTKAL"
FT   gene            complement(465559..466065)
FT                   /locus_tag="YPD4_0387"
FT   CDS_pept        complement(465559..466065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0387"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57296"
FT                   /protein_id="ACY57296.1"
FT                   /translation="MQKMQNKRLIQRIWVSFLAMGLMLLVGCQAKPQGLTPDQIAALQE
FT                   QGFKLTDNGWEFGLANKVLFDSDVKKLNSEGMQTVQKIGRILSDVGIKHMRVDGHTDSV
FT                   GKDDYNQQLSYQRALAVADTLATVGIPKSNIDVRGRGKLEPVADNRTSKGRAENRRVAI
FT                   IITAS"
FT   gene            complement(466071..467372)
FT                   /locus_tag="YPD4_0388"
FT   CDS_pept        complement(466071..467372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0388"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57297"
FT                   /protein_id="ACY57297.1"
FT                   /translation="MNTIKNQSMKPKKNHNSAEKLPTLAGVLRRIHLSVAIVSVVTACI
FT                   FLTVAALFALRVYVDHNLHLIARAISYTTEAAVVFGDNVEANELLALIASNEEVAEAKI
FT                   IDKHNRQIAYWALPDDGPIHHMEQIVARWILPAPVVLPMFHAGDEIGKIVIVGHGGSLL
FT                   RFLLQGLAGMLACLTVSTLVALFLSRRMLLGIVGSLKRITEVAHNVSRHRSFGQRVPSA
FT                   KVAELNELSNDFNGLLEELEVWQKHLTQENDSLAYRAAHDSLTGLANRTFFEGRLSRTL
FT                   NDCQPGEHTAVLFLDGDHFKDVNDNYGHAAGDLVLTTIAVRIRALLRETDLVARLGGDE
FT                   FAVLLTPIHNLDDVLTIADHIIDSMALPIILAEGCEITVSLSIGIAVYPDHAQTPEKLL
FT                   QRADEAMYQAKKNFRSGKRIFAYQPNTTNTESLG"
FT   gene            complement(467369..467992)
FT                   /locus_tag="YPD4_0389"
FT   CDS_pept        complement(467369..467992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0389"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57298"
FT                   /protein_id="ACY57298.1"
FT                   /translation="MTTATCATNRVSDEHHEPPHRRIVRSRWWGVYLFLLSLLVAVPTP
FT                   LLAASNINADILRERSDAAARMVLGIISYSRWPVAPPVIRLCVISPTDYAEMLFNPALM
FT                   ETTHPVQTQRYSLPNNSLNSKCDVVYLGHIELQQRQQLSIQLNGTPILTISEDYNECTF
FT                   GSVFCLLLNDKQVSFKVNMDALARGGVRIHPSVLQLARKKANAR"
FT   gene            complement(468367..471093)
FT                   /locus_tag="YPD4_0390"
FT   CDS_pept        complement(468367..471093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0390"
FT                   /product="putative cation-transporting P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57299"
FT                   /protein_id="ACY57299.1"
FT                   /translation="MQNSSNPKSASPPPEGKAWYQLTVEESLQHLNSREEGLSQKEAQE
FT                   RLAQYGPNALPARKTKHPLLQFLAHFNDVLIYILLAAALVKGLMGHSVDTIIILCVAVI
FT                   NALIGFIQENKAEKSLKSIQNMLSSKAVVIRDGKAQTIDAQNLVPGDIVTLRPGDKIPT
FT                   DLRLLEAHNLQIEEAILTGESTVVEKQIGVIENESVIGDRKNLLFSGTTISAGTAKGVV
FT                   IASGGDTELGHINQMMATVESTRTPLLQQMDRLGKAIFILILVMMAILFVFAFILRDLP
FT                   VDELLLALISLAVASVPEGLPAIISIILSLGVQAMARNRAIIRKLPTVETLGAMTVVCS
FT                   DKTGTLTMNEMTVKAVILADHCYRVEGESYEPVGNIYPEGREQQAELDTNKALKTFITA
FT                   VNLCNDSQIQQNEQGHWTITGGPTEGALKVLAAKSGIKLDHVTQHGKIPFDSAYKYMAT
FT                   SHQVQSDNSIFLTGAPDVLFTFCQQELTDSGVAPFRRDYWEAEMARYAKQGLRMVAAAF
FT                   RPTDQPVNELDHKDIQQGMVFVGIAGMMDPPRPEAIDAIATCQQAGIRVKMITGDHQET
FT                   AMAIGAMLGIGNGTDSITGSQLEHMDDQQLAEAAVRYDIFARTSPEHKLRLVKALQEKG
FT                   EIVGMTGDGVNDAPALKQADVGIAMGIKGTEVTKEAADMVLSDDNFATIASAVEEGRRV
FT                   YDNLKKTILFVLPTNLAQGLLIIFAILAGAVIPLTPLQILWMNMATSTTLSFGLAFEPA
FT                   EKGIMRRKPRDPSRHVLDGHAIWRIGFVGTLIACSAFALEAYLEPRGYSTEFIRTVLMQ
FT                   TLVTAQWIYMFNCRVMDRFPLNKEVFVNKGLWLVSGVLVLLQLAIIYLPFMNTAFGTAP
FT                   LPAYYWGITLLVAIAIFIIVEIEKWVIGRFKGMNNPV"
FT   gene            471663..473582
FT                   /locus_tag="YPD4_0391"
FT   CDS_pept        471663..473582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0391"
FT                   /product="putative soluble lytic murein transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57300"
FT                   /protein_id="ACY57300.1"
FT                   /translation="MGKWRYLAIGVCLMTTSGVTFADSLDAQRQRYQQVKLAWDSNQMD
FT                   TVAQLMPTLRDYPLYPYLEYRQLTQDLSQVSTAQVKDFLNRHPTLPPAKSLPSRFVNEL
FT                   ARREDWRGLLTFSPTAPKPVAARCNYYYAKWATGEQSVAWEGASEIWLNGQSLPGSCDK
FT                   LFSVWQQAGHQTPLATLARMKLALKEGNASLVSYLLKQLPADYQTMGTALAKLQSDPSS
FT                   VESFARTVGPTDFTRSATTIAFTRLARQDVENARLMIPSLVRLQKMSDSEKLELEEAVA
FT                   WRLMGNDATYEQAKWRDQVALRSHSTSLLERRIRMSLGSGDRQGLATWLARLPAEAQDK
FT                   DEWRYWRASLLLEQGKKAEGEAILRSLTKERGFYPMVAAQKLNIPYPIKVQVAAKPDVS
FT                   LAQRPEIARVRELMYWNMDNQARAEWSYLVASRSKAEQEALARYAFDQKWADLSVQATI
FT                   VAKLWDHLEERFPMAWTKEFRQFTEDKGITPSYAMAIARQESAWNPKAQSPVGATGLMQ
FT                   VMPRTAEHTVKRNNIAGYLNSSQLLDPVTNIEIGTYYLEEVYQQFGRNRILSSAAYNAG
FT                   PSRVNTWLGNSGGQVDAVAFIESIPFSETRGYVKNVLAYDAFYRHFMNRPAKVLSDAEW
FT                   QRRY"
FT   gene            473818..474210
FT                   /locus_tag="YPD4_0392"
FT   CDS_pept        473818..474210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0392"
FT                   /product="Trp operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57301"
FT                   /protein_id="ACY57301.1"
FT                   /translation="MTKQFLTDEKQVSDSLNRQTAGNPYSAADPALSAEDNQHWLSFVA
FT                   LLQNAITQDLHLPLLQLMLTPDERTALGTRVRIIEELMRGELSQRELKSQLGAGIATIT
FT                   RGSNSLKTAPPQLKSWLEAQLLANKR"
FT   gene            complement(474207..474749)
FT                   /locus_tag="YPD4_0393"
FT   CDS_pept        complement(474207..474749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0393"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57302"
FT                   /protein_id="ACY57302.1"
FT                   /translation="MYHVIAATTNPAKINAITLAFDDVYGPGQYRIEGVNVDSGVPLQP
FT                   IGSTETRIGARQRVKNARQVRPEADFWVGIEAGIEDNMTFAWMVVEHLQARGESRSASL
FT                   MLPDIILQGIRQGRELGDEMAVLSGISNVKQQGGAIGIFTQGKLTRTSVYHQALLLALV
FT                   PFHNEIYQRPSPSKPAI"
FT   gene            474843..475490
FT                   /gene="gpmB"
FT                   /locus_tag="YPD4_0394"
FT   CDS_pept        474843..475490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpmB"
FT                   /locus_tag="YPD4_0394"
FT                   /product="phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57303"
FT                   /protein_id="ACY57303.1"
FT                   /translation="MLQVYLVRHGETLWNAARRIQGQSDSPLTEIGIRQAHLVAQRVRN
FT                   QGITHIISSDLGRTQQTAKIIADACGLTMVTDPRLRELNMGVLENRPIDSLTPEEEQWR
FT                   KQMVNGTEGARIPEGESMTELGRRMHAALDSCLELPAGSKPLLVSHGMALGCLLSTLLG
FT                   LPAHAERRLRLRNCSLSRVDYQESPWLASGWVIESAGDTAHLDMPALDELQR"
FT   gene            complement(475487..476353)
FT                   /locus_tag="YPD4_0395"
FT   CDS_pept        complement(475487..476353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0395"
FT                   /product="putative right origin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57304"
FT                   /protein_id="ACY57304.1"
FT                   /translation="MDQASIIRDLLSWLESHLDQPLALDNVAAKAGYSKWHLQRMFKDV
FT                   TGNAIGAYIRARRLSKAAVALRLTSRPILDIALQYRFDSQQTFTRAFKKQFAQTPALYR
FT                   RAEDWHSSGICPPIRLGTYTLPQPEFITLPEQHLVGITQSYSCTLEQISTHRAELRLHF
FT                   WQQYLGDADQLPPVLYGLHHSRPNPEKDDEQEIFYTTAIEPQHIPCNVPEGQPVILQGG
FT                   EYVQFSYDGPLDGLQNFILTLYGTILPQLALIRRRGYDIERFYPQGRPKDGPPATLKCD
FT                   YFIPIRR"
FT   gene            476579..477046
FT                   /locus_tag="YPD4_0396"
FT   CDS_pept        476579..477046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0396"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57305"
FT                   /protein_id="ACY57305.1"
FT                   /translation="MKKSWIFLGCLLSLGAITAQAEEIGSVDTVFKLLGPDHKIVIEAF
FT                   DDPDVKNVTCYISRAKTGGIKGGLGLAEDTADAAISCQQVGPIELSDKIKNKKSEGAVV
FT                   FQKRTSLVFKKLQVVRFYDPKRNSLVYLTYSDRIVDGSPKNAISAVPIMPW"
FT   gene            complement(477220..477936)
FT                   /gene="arcA"
FT                   /locus_tag="YPD4_0397"
FT   CDS_pept        complement(477220..477936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcA"
FT                   /locus_tag="YPD4_0397"
FT                   /product="aerobic respiration control protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57306"
FT                   /protein_id="ACY57306.1"
FT                   /translation="MQTPHILIVEDEIVTRNTLKSIFEAEGYVVYEANDGAEMHHILSE
FT                   NDINLVIMDINLPGKNGLLLARELREQASVALMFLTGRDNEVDKILGLEIGADDYITKP
FT                   FNPRELTIRARNLLSRTMNLSSVGEERRLVESYKFNGWELDINSRSLVSPTGEHYKLPR
FT                   SEFRAMLHFCENPGKIQSRGELLKKMTGRELKPHDRTVDVTIRRIRKHFESTPDTPEII
FT                   ATIHGEGYRFCGDLEE"
FT   gene            479040..480641
FT                   /locus_tag="YPD4_0398"
FT   CDS_pept        479040..480641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0398"
FT                   /product="bifunctional aspartokinase/homoserine
FT                   dehydrogenase I"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57307"
FT                   /protein_id="ACY57307.1"
FT                   /translation="MRVLKFGGTSVANAERFMRVADIIESNARQGQVATVLSAPAKITN
FT                   HLVAMIDKMVAGQDISPNISDAERIFAELLRGLADTQPGFDYDRLKALVGHEFAQLKHL
FT                   LHGISLLGQCPDSINASIICRGEKLSIAIMEALFQAKGYHVTVINPVEKLLAQGHYLES
FT                   TVDITESTRRIGASGIPSDHIILMAGFTAGNDKGELVVLGRNGSDYSAAVLAACLRADC
FT                   CEIWTDVDGVYTCDPRTVPDARLLKSMSYQEAMELSYFGAKVLHPRTIAPIARFQIPCL
FT                   IKNTSNPQAPGTLIGGESIDEDSPVKGITNLNNMAMINVSGPGMKGMVGMAARVFAVMS
FT                   RSGISVVLITQSSSEYSISFCVPQGELLRARRALEDEFYLELKDGVLDPLDVMEHLAII
FT                   SVVGDGMRTLRGISARFFSALARANINIIAIAQGSSERSISVVVNNDAVTTGVRVCHQM
FT                   LFNTDQVIEVFVIGVGGVGGALIEQIYRQQPWLKQRHIDLRVCGIANSKAMLTNVHGIA
FT                   LITGVRNWLKFRSRLT"
FT   gene            480647..481498
FT                   /locus_tag="YPD4_0399"
FT   CDS_pept        480647..481498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0399"
FT                   /product="bifunctional aspartokinase/homoserine
FT                   dehydrogenase I"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57308"
FT                   /protein_id="ACY57308.1"
FT                   /translation="MIRLVKEYHLLNPVIVDCTSSQAVADQYADFLTDGFHVVTPNKKA
FT                   NTSSMNYYRQMRAAATKSCRKFLYDTNVGAGLPVIENLQNLLNAGDELMRFTGILSGSL
FT                   SFIFGKLDEGMSLSEATRQAKALGYTEPDPRDDLSGMDVARKLLILAREAGYKLELADI
FT                   EVESVLPASFDASGDVDTFLARLPSLDAEFTRLVANAAEQGKVLRYVGVIEDGRCKVRM
FT                   EAVDGNDPLYKVKNGENALAFYTRYYQPIPLVLRGYGAGNDVTAAGVFADLLRTLSWKL
FT                   GV"
FT   gene            481501..482430
FT                   /gene="thrB"
FT                   /locus_tag="YPD4_0400"
FT   CDS_pept        481501..482430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrB"
FT                   /locus_tag="YPD4_0400"
FT                   /product="homoserine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57309"
FT                   /protein_id="ACY57309.1"
FT                   /translation="MVKIYAPASIGNVSVGFDVLGAAVSPIDGTLLGDCVSVTAAERFS
FT                   LHNEGRFVSKLPDDPKQNIVYQCWERFCQEMGKEIPVAMVLEKNMPIGSGLGSSACSVV
FT                   AGLMAMNEFCGQPLDKVTLLGMMGELEGRVSGSIHFDNVAPCYLGGMQLILEQEGYISQ
FT                   DVPGFSDWLWVMAYPGIKVSTAEARAILPAQYRRQDCITHGRNLAGFIHACHTQQPDLA
FT                   AKMMKDVIAEPYRTQLLPGFAAARQAAQDIGALACGISGSGPTLFAVCNDQATAQRMAG
FT                   WLQNHYLQNDEGFVHICRLDTAGARLLG"
FT   gene            482434..483723
FT                   /gene="thrC"
FT                   /locus_tag="YPD4_0401"
FT   CDS_pept        482434..483723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrC"
FT                   /locus_tag="YPD4_0401"
FT                   /product="threonine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57310"
FT                   /protein_id="ACY57310.1"
FT                   /translation="MKLYNLKDHNEQVSFAQAIKQGLGKQQGLFFPLELPEFELTEIDK
FT                   LLDLDFVTRSSRILSAFIGSEIAPDVLTKRVQAAFEFPAPVAQVENDIAVLELFHGPTL
FT                   AFKDFGARFMAQMLAEVAGDQPVTILTATSGDTGAAVAHAFYGLKNVRVVILYPRGKIS
FT                   PLQEKLFCTLGGNIHTVAIDGDFDACQALVKQAFDDEELKTALSLNSANSINISRLLAQ
FT                   ICYYFEAVAQLPQEARNQLVISVPSGNFGDLTAGLLAKSLGLPVKRFIAATNANDTVPR
FT                   FLVNGQWQPKPTVATLSNAMDVSQPNNWPRVEELYRRKIWQLKDLGHGAVSDKTTKDTM
FT                   RELAGLGYISEPHAAIAYRVLRDQLQDGEFGLFIGTAHPAKFKESVEAILGQELPLPKP
FT                   LAVRAQLPLLSHDLPADFAQMRAFLMALPK"
FT   gene            complement(484540..485316)
FT                   /locus_tag="YPD4_0402"
FT   CDS_pept        complement(484540..485316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0402"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57311"
FT                   /protein_id="ACY57311.1"
FT                   /translation="MLIIISPAKTLDYQSPLATTKFSQPEMLDKSQALIEICRELTPAQ
FT                   ISSLMGISDKLAGLNAARFSEWQPDFTPANARQAILAFKGDVYTGMQAESFSEADFDFA
FT                   QQHLRMLSGLYGLLRPLDLMQPYRLEMGTKLANPRGKDLYAFWGDQITEKLNQALELQG
FT                   DNILINLASDEYFKAVKPAKLSGSLIKPVFLDEKNGKYKIISFYAKKARGLMSRFIIQN
FT                   KLTKPEQLVDFNLEGYEFDAGLSAKNELVFKRAEQH"
FT   gene            485848..486801
FT                   /gene="talB"
FT                   /locus_tag="YPD4_0403"
FT   CDS_pept        485848..486801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="talB"
FT                   /locus_tag="YPD4_0403"
FT                   /product="transaldolase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57312"
FT                   /protein_id="ACY57312.1"
FT                   /translation="MTDKLTSLRQITTVVADTGDIAAMKLYQPQDATTNPSIILNAAQI
FT                   PEYRKLIDEAIAWAREQSSDHAQQIVDATDKLAVNIGLEILKLIPGRISTEVDARLSYD
FT                   TVASVAKAKRLIKLYNEAGISNDRILIKLASTWQGIRAAEQLEKEGINCNLTLLFSFAQ
FT                   ARACAEAGVFLISPFVGRILDWYKANGDQKEFAPSEDPGVVSVTEIYQYYKKHGYKTVV
FT                   MGASFRNLGEIIELAGCDRLTIAPSLLKELAESEGPVERKLAYTGEIQAKPAPLTEAEF
FT                   YWQHNQDPMAVDKLADGIRKFAIDQGKLEKMISDLL"
FT   gene            487089..487676
FT                   /gene="mogA"
FT                   /locus_tag="YPD4_0404"
FT   CDS_pept        487089..487676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mogA"
FT                   /locus_tag="YPD4_0404"
FT                   /product="molybdenum cofactor biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57313"
FT                   /protein_id="ACY57313.1"
FT                   /translation="MNILRIGLVSVSDRASSGIYQDKGIPALEEWLTSALTTPFEVETR
FT                   LIPDEQSLIEQTLCELVDEMGCHLVLTTGGTGPARRDVTPDATLAIADRQMPGFGEQMR
FT                   QISLHYVPTAILSRQVGVIRKQALIINLPGQPKSIKETLEGVKDAQSNVVVAGIFASVP
FT                   YCIQLLDGPYIETNTDVVVAFRPKSAIIDIKD"
FT   gene            487804..489192
FT                   /locus_tag="YPD4_0405"
FT   CDS_pept        487804..489192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0405"
FT                   /product="putative transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57314"
FT                   /protein_id="ACY57314.1"
FT                   /translation="MSQDHNSSQVGSSQIDSSQHHVDQQHNHNRRLNKQDYKTLTLAAL
FT                   GGALEFYDFIIFVFFAAVIGDLFFPADMPEWLRQVQTFGIFAAGYLARPLGGIIMAHFG
FT                   DLVGRKKMFTLSILLMALPTLAIGMLPTYATIGITAPLLLLLMRVLQGAAIGGEVPGAW
FT                   VFVAEHVPRKRIGIACGTLTAGLTAGILLGSLVATVMNTTLGHQAILEGGWRIPFFLGG
FT                   IFGLFAMYLRRWLQETPIFKEMQARKTLAEELPLKSVVVNHKKEVVVSMLLTWLLSAGI
FT                   VVVILMTPTYLQKQFNVPPELALQANSLAIIALVIGCVVAGLAIDRFGASKTFIVGSLM
FT                   LAMSTWSFYHTNLTNPSQLFPHYMLAGFCVGIVGAVPYVMVRAFPAEVRFTGISFSYNV
FT                   AYAIFGGLTPILVTLWMKSSAMAPAYYMLVLSLVGLLLGIYLRNDINSEVKVQMPKRVM
FT                   NGVN"
FT   gene            complement(489262..491709)
FT                   /locus_tag="YPD4_0406"
FT   CDS_pept        complement(489262..491709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0406"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57315"
FT                   /protein_id="ACY57315.1"
FT                   /translation="MKKTNKLLISIVSAISFSAYSNDINDAKVCFYELENFSGESFCAY
FT                   EGESQSTINNDFDKKIKSISIPPGMVITLYDGIDFTGKKKKLKNDVNLDGMKSFGLYNK
FT                   ISSYHIDPAVCFYTEDNFQGDSTCLAASQHIDLYSDAEGFANSNRTVLPIHNDSIQSIK
FT                   VPLGMMTTIYKNDQFNAPFFELTENINLETLKTLAMDNQLTSLKASEKKGLYCDQKCII
FT                   LEKHEINLPEVFGEYWHDSRLVNKQVILSFNSQENGINDDYKINLTNGPSVRILKNEII
FT                   FSDYNMITKFSFDRIDKFDKLSFILQIEKDIVQVQYIQTLDDQLIDLSPIISFKWTHMI
FT                   DDTPTLTIKNKNTDKPLILNKSIITADTGDQNWEKRDIENTSQIICAFTPFLNLYNYIV
FT                   QGTCRQLDGIIFKADQYFNSNTKGKTLHIAGKSFPLKPDLLTELNNDGLHENKMLLTYI
FT                   DNVNNNQSLSLPAVAKTCMVSIHSILSTRQTRQIRPACIDWTLEIMTDFTLLFGSSLRT
FT                   WNTEYFGRIIQSIITTGNTGVAVENTEIEKRLSHAVKKAIMSQSIDSTLDHIKTAFDYA
FT                   QLNYFDYSLFYVSEDTPSQVEQLPLGIYELLLPSFIYRPIPPIIIENSERVEQHELAFE
FT                   IEILPSLFPEDARPSDTEIEHARELRQKISETIAQWGQQYQGAHAIDDVDQEVNADENA
FT                   ALSQLLHAGHIVTGIIHRRLILNRPGEIYVVVKLRGEIIAIVLADRFNNRDEVELVASA
FT                   TLPDYVLSPDSEGTVRGAGTAAVYELARYLQQQGAKTLFSETISQPSARVKQKVGFTFK
FT                   SEF"
FT   gene            complement(491998..492609)
FT                   /locus_tag="YPD4_0407"
FT   CDS_pept        complement(491998..492609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0407"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57316"
FT                   /protein_id="ACY57316.1"
FT                   /translation="MNTIKLANPGPLGLMGFGMTTVLLNLHNAGFFPLSSVILSMGIFY
FT                   GGLAQILAGLLEYKKGNTFAATAFTSYGAFWLSLVGLLMLPKMGLADATDAQFLGVYLG
FT                   LWGIFTLFMFIGTLPANRALQFVFGSLTILFALLAVGNFTDNHTLLMFAGFEGIICGAS
FT                   AIYLAMAEVLNEQYGRTILPIGEPLPIGEPSQTLETQAVM"
FT   gene            492983..494893
FT                   /gene="dnaK"
FT                   /locus_tag="YPD4_0408"
FT   CDS_pept        492983..494893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="YPD4_0408"
FT                   /product="molecular chaperone DnaK"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57317"
FT                   /protein_id="ACY57317.1"
FT                   /translation="MGKIIGIDLGTTNSCVAIMDGTKARVLENSEGDRTTPSIIAYTQD
FT                   GETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEEAQRDKDIMPYKIIAADNGDAWLE
FT                   VKGQKMAPPQISAEVLKKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGL
FT                   EVKRIINEPTAAALAYGLDKEVGNRTIAVYDLGGGTFDISIIEIDEVDGEKTFEVLATN
FT                   GDTHLGGEDFDSRLINYLVEEFKKDQGMDLRTDPLAMQRLKEAAEKAKIELSSAQQTDV
FT                   NLPYITADGSGPKHMNIKVTRAKLESLVEDLVNRSIEPLKVALQDAGLSVSDIQDVILV
FT                   GGQTRMPMVQKKVADFFGKEPRKDVNPDEAVAIGAAVQGGVLSGEVKDVLLLDVTPLSL
FT                   GIETMGGVMTPLITKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAQDNKSLGQFN
FT                   LDGIQPAPRGMAQIEVTFDIDADGILHVSAKDKNTGREQKITIKASSGLNEEEIQKMVR
FT                   DAEANAEADRKFEELVQTRNQADHLIHGTRKQLEEAGDKLPAEDKTAIEEAMKGLEAAL
FT                   KGEDKAEIEAKTQALVQVSGKLLEMAQQQQAAAGGDAGDTSAKKEDDVVDAEFEEVKDK
FT                   K"
FT   gene            495005..496144
FT                   /gene="dnaJ"
FT                   /locus_tag="YPD4_0409"
FT   CDS_pept        495005..496144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="YPD4_0409"
FT                   /product="chaperone protein DnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57318"
FT                   /protein_id="ACY57318.1"
FT                   /translation="MAKRDYYEVLGVSRDAEEREIKKAYKRLAMKFHPDRQSEDKNAEE
FT                   KFKEAKEAYEILTDAQKRAAYDQYGHAAFEQGGMGGGGFGGGGGGADFSDIFGDVFGDI
FT                   FGGGRRQQRASRGSDLRYNMDLTLEEAVRGVTKEIRIPTLDECDVCHGSGAKPGSSPVT
FT                   CPTCHGAGQVQMRQGFFTVQQACPHCHGRGQIIKDPCNKCHGHGRVEKSKTLSVKIPAG
FT                   VDTGDRIRLSGEGEAGEHGAPSGDLYVQVQVKAHPIFEREGNNLYCEVPINFAMAALGG
FT                   EIEVPTLDGRVKLKIPAETQTGKMFRMRGKGVKSVRGGSQGDLLCRVVVETPVSLSEKQ
FT                   KQLLRELEESFVGAAGEKNSPRAKSFLDGVKKFFDDLTR"
FT   gene            496387..497364
FT                   /locus_tag="YPD4_0410"
FT   CDS_pept        496387..497364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0410"
FT                   /product="sodium-proton antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57319"
FT                   /protein_id="ACY57319.1"
FT                   /translation="MTNIIRQFLRQEAAGGLILIIAAAIALLMANSALQGVYQSFLDIP
FT                   VSIKIASLDISKPLLLWINDGLMAVFFLMIGLEVKRELMEGSLAGRDKAVFPAIAALGG
FT                   MLAPALIYLLFNGADEVTRQGWAIPAATDIAFALGVMALLGNRVPTGLKVFLLALAIID
FT                   DLGVIIIIALFYTQQVSLQSLGIAAAAIALLAYMNWRGVGKTSAYLLVGLVLWVCILKS
FT                   GVHATLAGVIVGFMIPLHTQDQRSPSESLEHGLHPWVAYLILPLFAFANAGVSLQGVSL
FT                   SGLTSLLPMGIATGLFIGKPLGIFTFSWLAVKLGIAKLPVRNKF"
FT   gene            497702..498601
FT                   /gene="nhaR"
FT                   /locus_tag="YPD4_0411"
FT   CDS_pept        497702..498601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaR"
FT                   /locus_tag="YPD4_0411"
FT                   /product="transcriptional activator protein NhaR"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57320"
FT                   /protein_id="ACY57320.1"
FT                   /translation="MRMSHINFNHLYYFWQVCKEGSVVGAAEALFLTPQTITGQIKALE
FT                   GRLGGKLFKRRGRGLVPSELGQLVFRYADKMFMLSQEMLDIVNYRKESHLLFDVGVADA
FT                   LSKRLVSQVLETAVVEHEKIHLRCFESTHEMLLEQLSQHKLDMILSDCPVDSSQQEGLF
FT                   SVKLGECSVSFYCRQPVPDLPFPASLQQKRLLIPGRRSMLGRKLLNWINSKGLKVEVLG
FT                   EFDDAALMNAFAVYHDAIFVAPTIYAADTYANDSEIIEIGRLDNVQEEYYVIFAERMIQ
FT                   HPAVQRVCNKDFSALFNC"
FT   gene            499461..500348
FT                   /locus_tag="YPD4_0412"
FT   CDS_pept        499461..500348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0412"
FT                   /product="riboflavin biosynthesis protein: riboflavin
FT                   kinase and FMN adenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57321"
FT                   /protein_id="ACY57321.1"
FT                   /translation="MLTIGNFDGVHRGHQALLEQLKREGQRLGLPVMVMIFEPQPLELF
FT                   AADKAPARLTRLRDKAKYLAQAGVDYLLCVKFDPRFAANTAQAFVAQLLVEKLGVKFLT
FT                   VGDDFRFGAGRQGDFQLLQQAGAEFGFDVISTDSFCDGGLRISSTAIRQALHDDDLVLA
FT                   ETLLGHPYSISGRVVHGDELGRTIGFPTANLPLKRLVAPVKGVYAVDVYGLGSTPLYGV
FT                   ANIGTRPTVAGVRQQLEVHLLDVTMDLYGCHIDVVLRAKLRNEQRFASLEALKQQIAND
FT                   VVTARTFFGLKTPV"
FT   gene            500380..503196
FT                   /gene="ileS"
FT                   /locus_tag="YPD4_0413"
FT   CDS_pept        500380..503196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /locus_tag="YPD4_0413"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57322"
FT                   /protein_id="ACY57322.1"
FT                   /translation="MSDYKNTLNLPETGFPMRGDLAKREPDMLKRWYEQDLYGIIRAAK
FT                   KGKKTFILHDGPPYANGNIHIGHSVNKILKDIIVKSKGMAGYDSPYIPGWDCHGLPIEL
FT                   KVEQLIGKPGEKVSAAEFRTACRKYAAEQVEGQKKDFIRLGVLGDWDHPYLTMDFKTEA
FT                   NIIRALSKIIDNGHLHKGAKPVHWCTDCGSSLAEAEVEYYDKTSQSIDVRFNAVDTATV
FT                   AAKFGVSAVNGPISLVIWTTTPWTLPANRAISLNAEYLYQLVQVEGECLILAADLVESV
FT                   MKRAGITQWAVLGSCTGSDLELLRFTHPFMGFDVPAILGDHVTLDAGTGAVHTAPGHGP
FT                   DDFVIGQKYGLEVANPVGPNGCYLAGTYPTLDGLFVFKANDVVVELLREKGALLHVEKL
FT                   LHSYPCCWRHKTPIIFRATPQWFISMDQKGLRKQSLQEIKGVQWIPDWGQARIETMVAN
FT                   RPDWCISRQRTWGVPMSLFVHKETEQLHPRSIELMEEVAKRVEQDGIQAWWDLDPAEIL
FT                   GADAADYVKVPDTLDVWFDSGSTHSSVVDVRPEFGGHSPDMYLEGSDQHRGWFMSSLMI
FT                   ATAMKGKAPYRQVLTHGFTVDGQGRKMSKSIGNTISPQDVMNKLGGDILRLWVASTDYT
FT                   GEIAVSDEILKRSADSYRRIRNTARFLLANLNGFDPAQHQVKPEEMVVVDRWAVGRAQA
FT                   AQAEIMEAYENYDFHLVVQRLMQFCSVEMGSFYLDIIKDRQYTAKGDGIARRSCQTALF
FT                   HIAEALVRWMAPIMSFTADEIWNHLPGERQQYVFTEEWYDGLFGLAGNESMNDTFWAEL
FT                   LKVRGEVNKVLEQARSDKRIGGSLEAAVTLYAEPELAARLNSLQDELRFVLLTSAAKVA
FT                   AYADAGNDAQQSELIAGLKITFNKADGEKCPRCWHYTQDVGLVAEHAELCGRCVTNVAG
FT                   DGEERKFA"
FT   gene            503196..503705
FT                   /gene="lspA"
FT                   /locus_tag="YPD4_0414"
FT   CDS_pept        503196..503705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lspA"
FT                   /locus_tag="YPD4_0414"
FT                   /product="signal peptidase II"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57323"
FT                   /protein_id="ACY57323.1"
FT                   /translation="MNKPICSTGLRWLWLAVVVVILDISSKQWVMAHFALYESVPLIPF
FT                   FNLTYAQNFGAAFSFLADKSGWQRWFFAGIAIGISVVLMVMMYRSTAKQRLINCAYALI
FT                   IGGALGNLYDRLVHGAVNDFLDFYINNWHFPTFNLADVAICIGAALVIFEGFLSPVEKN
FT                   AVNNDE"
FT   gene            503698..504231
FT                   /gene="slpA"
FT                   /locus_tag="YPD4_0415"
FT   CDS_pept        503698..504231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="slpA"
FT                   /locus_tag="YPD4_0415"
FT                   /product="FKBX-type 16KD peptidyl-prolyl cis-trans
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57324"
FT                   /protein_id="ACY57324.1"
FT                   /translation="MSDMSEFVQDTESVQNTGTVKTTTAVQNNGAVLVHFTLKLEDGST
FT                   AESTRTHGKPALFRLGDNSLSDALEQQLLGLTVGDKHAFTLRPEDAFGVENPDLIQYFT
FT                   PRDFAETGVPDAGTIMLFSSRDGSEMPGVVREVAEESITVDFNHPLAGHSVSFELEILE
FT                   IDPQQEVVYADIAG"
FT   gene            504212..505165
FT                   /gene="lytB"
FT                   /locus_tag="YPD4_0416"
FT   CDS_pept        504212..505165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lytB"
FT                   /locus_tag="YPD4_0416"
FT                   /product="4-hydroxy-3-methylbut-2-enyl diphosphate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57325"
FT                   /protein_id="ACY57325.1"
FT                   /translation="MQILLANPRGFCAGVDRAISIVERAIEMYGAPIYVRHEVVHNRYV
FT                   VESLCERGAIFIEEISEVPDGSILIFSAHGVSQAVRAEARSRNLTMLFDATCPLVTKVH
FT                   MEVARASRKGKEAILIGHAGHPEVEGTMGQYSNPNGGMYLVESPDDVWQLNVKDENNLC
FT                   FMTQTTLSVDDTSAVIDALNTRFPKIVGPRKDDICYATTNRQEAVRNLANDADIVLVVG
FT                   SKNSSNSNRLAELVQRMGKPAYLIDSAADIQEFWLQGAKCIGVTAGASAPDILVQQVIA
FT                   RLKDLGAGESIELSGREENIVFEVPKELRVEVKQID"
FT   gene            505496..506005
FT                   /locus_tag="YPD4_0417"
FT   CDS_pept        505496..506005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0417"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57326"
FT                   /protein_id="ACY57326.1"
FT                   /translation="MRSGNCKCSTRNQKGVPMRDEKSLAHTRWNCKYHIVFAPKYRRQV
FT                   FYREKRRAIGSILRKLCEWKNVNILEAECCVDHIHMLLEIPPKMSVSGFMGYLKGKSSL
FT                   MLYEQFGDLKFKYRNREFWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGS
FT                   PFTGRK"
FT   gene            506458..507279
FT                   /gene="dapB"
FT                   /locus_tag="YPD4_0418"
FT   CDS_pept        506458..507279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapB"
FT                   /locus_tag="YPD4_0418"
FT                   /product="dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57327"
FT                   /protein_id="ACY57327.1"
FT                   /translation="MTDSTIRIAIVGAGGRMGRQLIQAVTQMEGVVLGAAIERKGSTLV
FT                   GSDAGELAGVGLLNVIVGDDLSQLTDNFDVLIDFTRPEGTLEHLAICRQHRKAMVIGTT
FT                   GFDEAGKAAISEAAADIGIVFAANFSVGVNVVLKLLEKAAKVMGDYTDIEIIEAHHRHK
FT                   VDAPSGTALAMGEAIADAMGRSLKDCAVYSREGYTGERKPGTIGFATVRAGDIVGEHTA
FT                   MFADIGERVEITHKATSRMTFAHGAVKSAIWLGKHDNGLFDMRDVLNLNEL"
FT   gene            507752..508927
FT                   /gene="carA"
FT                   /locus_tag="YPD4_0419"
FT   CDS_pept        507752..508927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carA"
FT                   /locus_tag="YPD4_0419"
FT                   /product="carbamoyl-phosphate synthase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57328"
FT                   /protein_id="ACY57328.1"
FT                   /translation="MIKSALLVLEDGTQFHGRAIGAEGTAVGEVVFNTSMTGYQEILTD
FT                   PSYSRQIVTLTYPHIGNVGTNASDEESSAVHAQGLVIRDLPLIASNYRNEEGLSEYLKR
FT                   HNIVAIADIDTRKLTRLLREKGAQNGCIIVGELSDAALALEKAKAFPGLKGMDLAKEVT
FT                   TKEMYQWLQGSWTLEGDLPAAKQPEDLPFHVVAYDYGVKRNILRMLVDRGCRLTVVPAQ
FT                   TPAEDVLKLNPDGIFLSNGPGDPEPCDYAITAIKRFLETDIPVFGICLGHQLLALASGA
FT                   KTVKMKFGHHGGNHPVKDLDASCVMITAQNHGFAVDETSLPSNLRTTHVSLFDGSLQGL
FT                   HRTDKAAFSFQGHPEASPGPHDAAPLFDHFIELIEAYRASSVSLNCSNSHK"
FT   gene            508943..512176
FT                   /gene="carB"
FT                   /locus_tag="YPD4_0420"
FT   CDS_pept        508943..512176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carB"
FT                   /locus_tag="YPD4_0420"
FT                   /product="carbamoyl-phosphate synthase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57329"
FT                   /protein_id="ACY57329.1"
FT                   /translation="MPKRTDIKSILILGAGPIVIGQACEFDYSGAQACKALREEGYRVI
FT                   LVNSNLATIMTDPEMADATYIEPIHWEVVRKIIEKERPDAVLPTMGGQTALNCALELER
FT                   QGVLAEFGVTMIGATADAIDKAEDRRRFDIAMKKIGLDTARSGIAHNMEEALAVAADVG
FT                   FPCIIRPSFTMGGTGGGIAYNREEFEEICERGLDLSPTKELLIDESLIGWKEYEMEVVR
FT                   DKNDNCIIVCSIENFDAMGIHTGDSITVAPAQTLTDKEYQIMRNASMAVLREIGVETGG
FT                   SNVQFSVNPKNGRLIVIEMNPRVSRSSALASKATGFPIAKIAAKLAVGYTLDELMNDIT
FT                   GGRTPASFEPSIDYVVTKIPRFNFEKFAGANDRLTTQMKSVGEVMAIGRTQQESLQKAL
FT                   RGLEVGATGFDPKVSLDDPEALTKIRRELKEAGAERIWYIADAFRAGMSVDGVFNLTNV
FT                   DRWFLVQIEELVRLEESVAELGINGLTAEFMRHLKRKGFADARLAKLVGAAESEVRKLR
FT                   YKYGLHPVYKRVDTCAAEFSTDTAYMYSTYEEECESNPTSDRPKVMVLGGGPNRIGQGI
FT                   EFDYCCVHASLALREDGYETIMVNCNPETVSTDYDTSDRLYFESVTLEDVLEIVRIEKP
FT                   QGVIVQYGGQTPLKLARELEAAGVPIIGTSPDAIDRAEDRERFQQAVNRLGLKQPANAT
FT                   VATIEQAVEKATGLGYPLVVRPSYVLGGRAMEIVYDEIDLRRYFQNAVSVSNDAPVLLD
FT                   RFLDDAVEVDVDAICDGERVLIGGIMEHIEQAGVHSGDSACSLPAYTLSKEIQDVMRQQ
FT                   VEKLAFELCVRGLMNVQFAVKNNEVYLIEVNPRAARTVPFVSKATGMPLAKIAARVMVG
FT                   QSLAEQGMLEEIIPPYYSVKEVVLPFNKFPGVDPILGPEMRSTGEVMGVGRTFAEAFSK
FT                   AMLGSQSGMKKSGRALLSVREGDKHRVVDLAAKLLKQGFELDATHGTAVVLGEAGINPR
FT                   LVNKVHEGRPHIQDRIKNGEYTYIVNTTAGRQAIEDSKLIRRSALQYKVHYDTTLNGGF
FT                   ATAMALNADPTDQVISVQEMHAKIKNMKA"
FT   gene            complement(512404..513072)
FT                   /locus_tag="YPD4_0421"
FT   CDS_pept        complement(512404..513072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0421"
FT                   /product="LysE type translocator"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57330"
FT                   /protein_id="ACY57330.1"
FT                   /translation="MLSGVIIARLLHSHSVIKMLETSLFVATLATLGMISPGPDFFLVI
FT                   KNAARYRRTAAMTTAVGVILGVATHMSYCVAGLAVVITTTPWLFNLLKYAGACYLIWIG
FT                   IQALLSRGESKFSIDNTAQHPISLKAAFLQGYLCNLLNPKATLFFLAVFTQILQIDSGV
FT                   GEKLWYASIIWILAAIWWPLLVILIQSAPVRRGLAKTQKVVDKVLGGLLIGLGIKVALG
FT                   "
FT   gene            513342..514142
FT                   /locus_tag="YPD4_0422"
FT   CDS_pept        513342..514142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0422"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57331"
FT                   /protein_id="ACY57331.1"
FT                   /translation="MSLENVINGDVPHHQQRDITRLCIKCALLLLQHGAESMLVEQLSA
FT                   RLGMALGMDSVESSISANAVVLTTISQGNCLTSTRKNTDRGINMQVVTEVQHIVILAEH
FT                   RLLDAKDVEKRFENIKPLRYPRWLVVIMVALSCGCFSKLNGGGWDAFSISFVASGLAMF
FT                   VRQSLTARHMNPLINFCITAFVATSASGLLMRLPFFEQASSVAMAASVLLLVPGFPLIN
FT                   AVADMFKGHVNTGLARWAMASLLTLSTCIGVVFAMALWGLRGWA"
FT   gene            514139..514594
FT                   /locus_tag="YPD4_0423"
FT   CDS_pept        514139..514594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0423"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57332"
FT                   /protein_id="ACY57332.1"
FT                   /translation="MSLLWALLQDMVLAAIPALGFAMVFNVPVRALRYCALLGAIGHGS
FT                   RMLMIHFGMNIELASLVASIMIGINWSRWLLAHPKVFTVAAVIPMFPGISAYTAMISVV
FT                   EISHLGYSEALMSTMVTNFLKASFIVGALSIGLSLPGLWLYRKRPGV"
FT   gene            514744..515226
FT                   /gene="folA"
FT                   /locus_tag="YPD4_0424"
FT   CDS_pept        514744..515226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folA"
FT                   /locus_tag="YPD4_0424"
FT                   /product="dihydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57333"
FT                   /protein_id="ACY57333.1"
FT                   /translation="MIISLIAALAADRVIGMENAMPWHLPADLAWFKRNTLNKPVIMGR
FT                   KTFESIGRPLPGRLNIVISSQPGTDERVTWAASIEEALAFAGNAEEVMVMGGGRVYKQF
FT                   LDRANRMYLTHIDAEVGGDTHFPDYEPDEWESVFSEFHDADEANSHSYCFEILERR"
FT   gene            515387..515896
FT                   /locus_tag="YPD4_0425"
FT   CDS_pept        515387..515896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0425"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57334"
FT                   /protein_id="ACY57334.1"
FT                   /translation="MRSGNCKCSTRNQKGVPMRDEKSLAHTRWNCKYHIVFAPKYRRQV
FT                   FYREKRRAIGSILRKLCEWKNVNILEAECCVDHIHMLLEIPPKMSVSGFMGYLKGKSSL
FT                   MLYEQFGDLKFKYRNREFWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGS
FT                   PFTGRK"
FT   gene            516779..517243
FT                   /locus_tag="YPD4_0426"
FT   CDS_pept        516779..517243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0426"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57335"
FT                   /protein_id="ACY57335.1"
FT                   /translation="MKKSMLFLSLMLSAPYIMANELSSCPNKSEINYQQGGYTTPDGKW
FT                   FGASVGVENSGDVRHFLYVKYIPYNAFNMDIGRLNNCTYALASGSVDMYFYDERALALE
FT                   GVFVSLIGHMFWEKTTTSGKESYICTASSVNDCTFTRLDDDVVDDYKNRQ"
FT   gene            complement(517333..518202)
FT                   /gene="apaH"
FT                   /locus_tag="YPD4_0427"
FT   CDS_pept        complement(517333..518202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apaH"
FT                   /locus_tag="YPD4_0427"
FT                   /product="diadenosinetetraphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57336"
FT                   /protein_id="ACY57336.1"
FT                   /translation="MSTYLIGDIHGCLDELLALLAQVNFDPQQDTLWLTGDLVARGPAS
FT                   LDVLRYVRSLGPAVRMVLGNHDLHLLAVYAGISRNKPKDRITPLLDAPDADELINWLRR
FT                   QPVLQVDDQLKLIMAHAGITPQWDIETAKMCAREVEAVLSSDSYPLFLDAMYGDMPNNW
FT                   SPELTGLARLRFSTNALTRMRFCFPNGQLDMICKDTPENAPAPLKPWFDLPRLVDPEYS
FT                   IIFGHWASLEGKGVPEGIYGLDTGCCWGGDLTLLRWDDKRYFTQRAFKAEAEINNNNGF
FT                   AAGEAVQH"
FT   gene            complement(518219..518596)
FT                   /gene="apaG"
FT                   /locus_tag="YPD4_0428"
FT   CDS_pept        complement(518219..518596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apaG"
FT                   /locus_tag="YPD4_0428"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57337"
FT                   /protein_id="ACY57337.1"
FT                   /translation="MIEQPRICVQVHSIYVETQSIPEEERFVFAYTVTVRNLGRSNVQL
FT                   LGRYWLITNSNGRQTEVQGEGVIGEQPLILPGNEFQYTSGAVLETPLGTMEGHYEMIDH
FT                   LGQAFRTVIPVFRLAIPALIH"
FT   gene            complement(518610..519428)
FT                   /gene="ksgA"
FT                   /locus_tag="YPD4_0429"
FT   CDS_pept        complement(518610..519428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="YPD4_0429"
FT                   /product="dimethyladenosine transferase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57338"
FT                   /protein_id="ACY57338.1"
FT                   /translation="MNNRVHQGHFARKRFGQNFLNDQFVIDSIVSAIHPVPGEAVVEIG
FT                   PGLGALTEPVAARMDHMTVIELDRDLAARLASHPQLKDKLTIHQQDAMKVNFSELSEQA
FT                   GQPLRVFGNLPYNISTPLMFHLFSYTDAIRDMHFMLQKEVVNRLVAGPNSKTYGRLTVM
FT                   AQYYCNVIPVLEVPPTAFTPAPKVDSAVVRLIPHVQMPHPVGDVRMLSRITTQAFNQRR
FT                   KTVRNSLGDLFTSEQLIELGIDPILRAENISVAQYCKLANWLSAQSTPQK"
FT   gene            complement(519421..520416)
FT                   /gene="pdxA"
FT                   /locus_tag="YPD4_0430"
FT   CDS_pept        complement(519421..520416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxA"
FT                   /locus_tag="YPD4_0430"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57339"
FT                   /protein_id="ACY57339.1"
FT                   /translation="MHNHNNRLVITPGEPAGVGPDLAITLAQQDWPVELVVCADPALLL
FT                   ARASQLNLPLQLREYQADQPAIAQQAGSLTILPVKTAVNVVPGKLDVGNSHYVVETLAK
FT                   ACDGAISGEFAALVTGPVQKSIINDAGIPFIGHTEFFADRSHCQRVVMMLATEELRVAL
FT                   ATTHLPLLAVPGAITQASLHEVITILDNDLKTKFGITQPQIYVCGLNPHAGEGGHMGHE
FT                   EIDTIIPALNTLRQQGINLIGPLPADTLFQPKYLQHADAVLAMYHDQGLPVLKYQGFGR
FT                   AVNITLGLPFIRTSVDHGTALELAATGTADVGSFITALNLAIKMINNSNE"
FT   gene            complement(520400..521704)
FT                   /gene="surA"
FT                   /locus_tag="YPD4_0431"
FT   CDS_pept        complement(520400..521704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="surA"
FT                   /locus_tag="YPD4_0431"
FT                   /product="survival protein SurA precursor (peptidyl-prolyl
FT                   cis-trans isomerase)"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57340"
FT                   /protein_id="ACY57340.1"
FT                   /translation="MKNWRTLILGLVICANTAFAAPQEVDKVAAVVDNGVVLQSDIDGL
FT                   LQSVKMNAQQSGQQVPDDSTLRHQILERLIMDNIQLQMAKKMGITITDQALDKAIADIA
FT                   AQNRMTLAQMRSRLAADGLSYDTYREQIRKEMLTSEVRNNEVRRRITILPQEVESLAKQ
FT                   MGNQVSGDTELNLSHILIPLPENPTQQQVDQAEDLANKLVADIKGGADFGKLAIANSAD
FT                   SQALKGGQMGWGKLQELPSLFAERLQSAHKGEIVGPIRSGVGFHILKVNDMRGADQTIS
FT                   VTEVNARHILLKPSPMMTDEQARAKLEAAAAEIKSGKTSFATIAKEISQDPGSAMQGGE
FT                   LGWASPDIYDPAFRDALMKLKKGEISAPVHSSFGWHLIQLVDTRQVDKTDAAQKERAYR
FT                   MLFNRKFAEEAQTWMQEQRAAAYVKILDGSNAQPQ"
FT   gene            complement(521772..524024)
FT                   /gene="imp"
FT                   /locus_tag="YPD4_0432"
FT   CDS_pept        complement(521772..524024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="imp"
FT                   /locus_tag="YPD4_0432"
FT                   /product="organic solvent tolerance protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57341"
FT                   /protein_id="ACY57341.1"
FT                   /translation="MLGVPTYDQPLVTGDPNQLPVRINADKTEANYPDNALFTGNVIVQ
FT                   QGNSTLTANQVELTQVQKPGEVIPLRTVTATGDVNYDDPQIKLKGPKGWSNLNTKDTDM
FT                   DKGKYQMVGRQGRGDADLMKLRDQSRYTILKNGTFTSCLPGDNSWSVVGSEVIHDREEQ
FT                   VVEVWNARFKIGKVPVFYSPYMQLPVGDKRRSGFLIPNAKFTSNNGFEFLLPYYWNIAP
FT                   NFDATITPHYMERRGLQWQNEFRYLLAPGSGTMALDWLPNDRIYTGPDGTDKNATRWLY
FT                   YWGHSGVMDQVWRFNINYTRVSDPAYFTDLTSQYGSTTDGYATQIFTAGYANENWNATL
FT                   SSKQFQVFTAAGNSNAYRAQPQLDMNYYKNDVGPFDMHVYGQAAKFTSVNPTNPEASRF
FT                   HIEPTVNLPLSNSWGSINTEAKLLATHYQQDIPASFADNASNPKLKDSVNRVLPQFKVD
FT                   GKVVFDRSMDWATGFTQTLEPRAQYLYVPYRNQDDIYIYDTTLMQSDYSGLFRDRTYSG
FT                   LDRIASANQVSTGLTSRIYDDARVERFNVSVGQIYYFSRSRTGNTEAIDNSNATGSLVW
FT                   AGDTFWRINDQLGLKGGAQYDTRLGSLTLGNAIMEYRKDADRMIQLNYRYASPKYIQAA
FT                   VPKVYNPDYQQGISQVGTTASWPIADRWAIVGAYYYDTKAKQPASQLVGLQYNTCCWAV
FT                   NLGYERKITGWNAQGQTSKYDNKIGFNIELRGLSGGHSLGTAQMLNSGILPYQSAF"
FT   gene            524299..525132
FT                   /gene="djlA"
FT                   /locus_tag="YPD4_0433"
FT   CDS_pept        524299..525132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="djlA"
FT                   /locus_tag="YPD4_0433"
FT                   /product="Dna-J like membrane chaperone protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57342"
FT                   /protein_id="ACY57342.1"
FT                   /translation="MRYWGKLLGLVLGVMYAPGVVGALLGLLVGHMVDRALGAKRRGFF
FT                   ADQQTRQSLFFRTTFQVMGHLTKAKGRVTEVDIQLASQLMDRMQLHGAARTAAQQAFRE
FT                   GKESHFPLRKALQEFRRVCFGRFDLIRIFLEIQLQAAFADGSLHPNERQVLYVIAEELG
FT                   ISRGQFDQFLRMFDGGRQFGGHGGWQGQQGGYSQSGYQRASQGPTLEDACKVLGVNSSD
FT                   DSVAIKRAYRKLMGEHHPDKLVAKGLPPEMMEMAKQKAQEIQAAYDLIKREKGFK"
FT   gene            complement(525430..526050)
FT                   /gene="rluA"
FT                   /locus_tag="YPD4_0434"
FT   CDS_pept        complement(525430..526050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rluA"
FT                   /locus_tag="YPD4_0434"
FT                   /product="ribosomal large subunit pseudouridine synthase A"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57343"
FT                   /protein_id="ACY57343.1"
FT                   /translation="MIVLYQDKHIMVVNKPSGLLSVPGRAPENKDSVMTRVQNDFPTAE
FT                   SVHRLDMATSGVIVVALTKAAERELKRQFREREPKKTYIARVWGHLAQDEGLIDLPLIC
FT                   DWPNRPKQKVCYETGKSAQTEYQVISRDDDGSTRVKLSPITGRSHQLRVHMLAMGHPIL
FT                   GDGFYAHPEAKAMASRLQLHAQQLCITHPEFGTPMHFKCEAEF"
FT   gene            complement(527273..527935)
FT                   /locus_tag="YPD4_0435"
FT   CDS_pept        complement(527273..527935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0435"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57344"
FT                   /protein_id="ACY57344.1"
FT                   /translation="MKNTLTNGGGIPDDSELIQSELDLNAEKKWGVMKYIDPYNSDPTN
FT                   VFWSLKLSNRSVRVKLSNTGNVKGGYTWGDMSNLPGVKHQRLLMHDNTLCVKIFSQNGY
FT                   FQLFIESADALKDDSNLYIYIPLNLESDVFAKNIELLQSIVNHKIEVECKEEQYLGLLK
FT                   TIDDRKQGFSHRDIASEIFGKELVKNEWSADSWVRAKIRYRIKKANALINYGYLNFL"
FT   gene            528346..529359
FT                   /locus_tag="YPD4_0436"
FT   CDS_pept        528346..529359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0436"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57345"
FT                   /protein_id="ACY57345.1"
FT                   /translation="MILKRMDNNMSDIFPQALFGVEYDPAYGEIESILSQLDESADPLS
FT                   RPHEPPQINWHHISEQANKLLEQCFDLRVMLWFIRANIHIKGISALYDGFMRINAQTQD
FT                   TDVVIYPQSEEPPLNSGHAAALGWLSTAQCIAELKTARLTEEHPYILQDLITTEALPNG
FT                   QERYFVTSSTLFLTVNNYFQQNGLPDLKDQLTKVDMLLEQIESYANQSTESYQLHCEQL
FT                   RIFLKNNISQLAQLNAPEHDDPETVYQKIDSHESLDTQSFNSNDKSIRSRQEIIMMLDR
FT                   ILEYFQHYEPSHPAPIFIRRTKEMIGMDFYSIVEEILPEAVITLKQFTGKTNLPFR"
FT   gene            529370..529930
FT                   /locus_tag="YPD4_0437"
FT   CDS_pept        529370..529930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0437"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57346"
FT                   /protein_id="ACY57346.1"
FT                   /translation="MAKDASSQKFIGRNNAPRVQIEYDVEIYGSNKKVELPFVTGVMAD
FT                   LSGHRAKPLPAVEDRKFLTFDQDNFDARMRAIKPRLKFYVDNTLSEDNELLDIELDFES
FT                   MDDFSPGSLARRIPQMEKLLEARTHLAELITYMDGKTSAEEVVKQLLEQPDFLQNLATD
FT                   AQGTISKLSQDDDVLVEDDDGEK"
FT   gene            529930..531441
FT                   /locus_tag="YPD4_0438"
FT   CDS_pept        529930..531441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0438"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57347"
FT                   /protein_id="ACY57347.1"
FT                   /translation="MENMQKAQLNDTPDINVDLAENELDDILKRSFRPRTDEASATVRR
FT                   AIGTLAAYANKGQVKVNRDVVLTIESLVAEIDEKLSDQMNLILHHKEFQKLESAWRGLS
FT                   YLVDNTDANETLKIRVLNISQDELGKTLRRYRGSAWDQSPIFKQVYEHEYGQFGGEPFG
FT                   CMIGDYEFDHSPQSVALLTELAKVAAAAHCPFITSSSPSIMQMNNWRELGNPRDIGKIF
FT                   TTPEYAPWRRLRESNDSRYLVLTLPRFLSRLPYGAKNHPIDDFAFEEVVSPHASEDFTW
FT                   ANAAYAMGVNINRAFNEYGWCSRIRGIESGGSVEELPAYAFPSDEGGYELTCPTELAIS
FT                   DRRENELSNAGFLPLVYRKNSDFAAFIGSCTLHAPANYDDPDATANARLSARLPYIFAT
FT                   CRFAHYLKCIVRDKIGSFRSRDDMQLWLNDWVMNYVDGDPSISTEATKAKRPLAAAEVQ
FT                   VEDVEDDPGFYRAHFYLRPHYQLEGMTVSLRLVSKLPSNKESEKK"
FT   gene            531604..532122
FT                   /locus_tag="YPD4_0439"
FT   CDS_pept        531604..532122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0439"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57348"
FT                   /protein_id="ACY57348.1"
FT                   /translation="MAALVDYFLHIEGVDGESPDQQYNGWIQVQAWQWAEENAGRWGLG
FT                   GGGGSGKVEMKDFEFRMVSNKASPKLFLMCAIGEHIPQAKLVCRKSGQGQQDFLIVTFS
FT                   NCLVSSFKTVGNMPLGKGDAVFTDTVLPTDAISLNFARIEVEYKEQQPDGSMGAVIKAG
FT                   YDLKLNSRI"
FT   gene            532196..532639
FT                   /locus_tag="YPD4_0440"
FT   CDS_pept        532196..532639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57349"
FT                   /protein_id="ACY57349.1"
FT                   /translation="MDISAPILFDKLSLRHEHVRLPHWREVIVRDIESLLNDSAHSARL
FT                   KLKKYPHCEASVLNYGLPSLSQQVPVITDLLELARHIQRIIATFESRLDPRSIKVVPLI
FT                   NKGETWVLAILFDIHARCNLPGEEHLVNLRIALDYSYGMVRVL"
FT   gene            532672..534516
FT                   /locus_tag="YPD4_0441"
FT   CDS_pept        532672..534516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0441"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57350"
FT                   /protein_id="ACY57350.1"
FT                   /translation="MPNESFLALYNEELRYLREDGQRFAHMHPQVAQHLGLHADGVLDP
FT                   FVERLLEGTAFLSSRIQQRLNNEHPEFALQMLGRLAPLWYTPLPSIATIAMVPDLTSPQ
FT                   WHSRVVLPKGSRVTLSDSSLNNRLANFSTGRTLKIQPLVIENAECASTPPAYLPLSVAS
FT                   QLQAGQAHLRLRLTTQGVASLSELDFAPMNLTLAGGIIQSNQLITTLLNNTLHIVLWAN
FT                   TDGKPLVKVLTKEHLRQGGLDEQEALLPVAISEMPGNRLLREYFAAPSRFFDLELHGLN
FT                   DFLQQGDGIHTFEVLFVLDQRPLHLIDRVTGNDFRLFATPIINLFKRRCSPVLINGEHT
FT                   EYPVIVDPLNPRLYEVHHVLGVNGLLSEGGSVQFSSLHGHARFDDDDKMAGYSIRRRRD
FT                   FTDKNHQKNSPLPHDSLFIALSPGTSGIDIDHVKSLSIEAMVCERHLIPSQLQHPEFKL
FT                   EIALPVGQIEMLRHPAKPQGVPNIDQAWRALQLIANNPLRYALPDVTDCSPLLKDWLSI
FT                   FCQHEEASQHKRITSLTHASVAHNFERHTAPGPIAWSRGVEATLDFNSSHHSDKGAFLF
FT                   ARILHHALSEYCELGQTLRLHMQVDGETFAKWGPVNYG"
FT   gene            534509..535492
FT                   /locus_tag="YPD4_0442"
FT   CDS_pept        534509..535492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0442"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57351"
FT                   /protein_id="ACY57351.1"
FT                   /translation="MASLQTLKNTFLPGISASQDFFELLRRIERATPEQGRLGTQRDRS
FT                   HLRLRIIQPADMGFAPREVSDIRQTLNTHQHLAEITIFCRHFGLFAPYGPLPIHVTEHA
FT                   RNEALAKRNQAFEHFAGILSQRMAILHYRSWAQMHVAVGHDRASANPFMNHVRQIAGLT
FT                   PQQALNSHVDRVRRCFPGVYLPGRGSLRKLQEILSLYFSVPIRVEARKGLWIDDSRNIE
FT                   SQRMGRLGNTRIGSRFFDVQHSLVLSIGPVSDPQYLDFQRNSKRINTLVQICHDFVRHR
FT                   MVLDVQLIIQTSPNMACRLGGGTLSRHSWLKPGSALSIQPIYRTVT"
FT   gene            535510..538098
FT                   /locus_tag="YPD4_0443"
FT   CDS_pept        535510..538098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0443"
FT                   /product="Clp ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57352"
FT                   /protein_id="ACY57352.1"
FT                   /translation="MYQRERLFNRLGTFAYKTFVEATRLCRSYRHEYVELEHWLKILMD
FT                   QQRGDIPALLTHYGLSQTVISTQLDRIIQHMPVTKASVQDLSSRLESVVEGGLVLSQLM
FT                   ASPSPIRTSHILLALLQDTQHQRWLYRLCDEFKKLPVPQVAEEYEGLLVNSIEQTSEVQ
FT                   RGDALVTETDSSSSKEAHAALNKWCNDLTQQARDGEIDPVIGREAELRQVIDILLRRRQ
FT                   NNPILVGEAGVGKTAVVEALARKLASGDVPPLLQGARLLSLDLGRMQAGASMRGEFESR
FT                   LKSLIDGISQSDTPVILFCDEAHTLVGAGGQAGTGDAVNLLKPMLARGALRMIAATTWS
FT                   EYKQFIEPDAALTRRFQRVLIGEPNESTAVDMLRAIAPHFAQHHNVTIRDGAIHAAVRL
FT                   SLRNLPSRQLPDKAISLLDTACARVALSQYAQPQAIEQLSAQLDVLKTEHQYLVREKQL
FT                   GEAVDQRLDDVQTQIQAFEHELTALQSRHLHEQQLVREVLPEGEGSGMMTENARWGELM
FT                   ALQEASPLVYPWVDEQSIAAVLSDWTGIPSGKMLQDDIECVLNLEQRLGDHIFGQRNAI
FT                   KEISQAIRIARAGIQSQERPLGIFLLAGSTGTGKTETANVLVETLYGGAHNLITFNMSE
FT                   FQEAHTLSTLKGAPPGYVGYGKGGKLTEAVRRKPYSVILLDEFDKAHADIQDAFYQVFD
FT                   KGWMEDAEGRRVSFRQCFILLTCNQGAEEIEQAYLTANDIKPGALKPLVYDALLRRFAP
FT                   ALLARVNIIPYIPLDQDALAQIASHHLARLQTRLWDEIGATLVTEGDIPGWIASRVCSH
FT                   PNHGRAVEELLRQTLLPAVGNEVLKRRHEAEPLREIRLIVEETELSIEFA"
FT   gene            538202..540550
FT                   /locus_tag="YPD4_0444"
FT   CDS_pept        538202..540550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0444"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57353"
FT                   /protein_id="ACY57353.1"
FT                   /translation="MQLIEIENEVLSGQDAFPLSFKTQEKVSGNPSYQLVFQVAEADLD
FT                   LVSLLGEIIKVRIELPDSAGYRTFFTYVIAGADEGQRQDKFVYSLELSTWTWFLMQNRN
FT                   CRIFQDLNIIDIIEQVFSKYNFADYRFDIVGNYRLREYCVQFAETDFDFVNRLMEDEGV
FT                   WYYFEHNEDKHTLVMTDQQQFPVLEGHYAELSFLPDSEEMRAIREGIQRIQRSQRIHSS
FT                   EIVLRDFDFLNPRNTLQTHIEESRQHLQGVPLEWYDYAAGYTDPQHGESIARLRLEAIQ
FT                   SNGQLLSGESNATGLVPGRSFALVQHPDNNRNRGFKLISCDYSFVQDGPDSASQGRNVA
FT                   CKFKALNDDVVYRPQCVTPPPKVPGVQSATVVGARESEVHTDKFARIRVHFHWDRYKTT
FT                   EDDSSCWIRVVQAWAGKGWGVLAMPRVGQEVLVNYVDGDLDRPMVTGIVYNGENPPPYR
FT                   LPDHINYSGFVSRSLRFGQPQHASQLTFDDNRGNERIMLHAERDLQRTVERNSATAVGQ
FT                   DKYDTVERTATEWINNHISYKDFSFSVTGMSVSATGISVSTTGTSLSVTGMSTSVTGVS
FT                   VGFTLIGTSFTGVSTSFTGVGTSFTGASNSLTGVSNSMTGCSSSFTGTSNSMTGSSHSM
FT                   TGMSTSITGHSMSQTGSSSSITGDSTSFTGSSVSSTGSSVSTTGVSTSTTGSSTSTTGC
FT                   SVSTTGSSTSTTGNSVSMTGNSTSTTGCSISTTGSSIGTVGSSISTTGSSVSTTGSSIS
FT                   TTGLSVSYTGAQYSDVGVDLKTVGMQSKN"
FT   gene            540563..541135
FT                   /locus_tag="YPD4_0445"
FT   CDS_pept        540563..541135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0445"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57354"
FT                   /protein_id="ACY57354.1"
FT                   /translation="MRIIRPQQLVVLKSSYQIGHESHMGISVVAGCYLSKPEHMVTESQ
FT                   IWQAWKAAPLSFRMLDSAEPKPFAEFLLAGHAGIGEEVTSLSAEVSVGSLTRRWCIEGE
FT                   SNKTGLVIKPFLRMSMDHTQSWGGKGCKENPLGRGYNDERKPTIMSLGLDGSAIVRSPL
FT                   ASPSPVPHDFQLRKVHINEVASTMTDP"
FT   gene            541160..542782
FT                   /locus_tag="YPD4_0446"
FT   CDS_pept        541160..542782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0446"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57355"
FT                   /protein_id="ACY57355.1"
FT                   /translation="MPPQIDRRYFQMAPPGQWLKKSAWPDSVPFKLIGFRPDNEEISGA
FT                   FPAVSARAFVWDNPSAPPSEVTLLRKTLWLLPDNDMGLMVFTGSVPLTHLFDEPIDTLL
FT                   VGLDDSHSLRELEYYQQVYKSRSVEGAASFEFLKDPELMPEGMPLNVIRDLADHPDSLR
FT                   YSASAMSEAESERFYQDVQDAIDRQEQQKSEEQETLGDLNVPAAGKEEAGTQWLESKED
FT                   TATNVTFLGTDFSGMTLDNKQFRYCMFTGCHFDKATFKDCTFEHCQFTQSDFENSRWNN
FT                   VHLSGCLFKQAEWQKAAFTHCKWEKSTFEYGVFKHAQFTDNALDNCLINHSDFSLGTFD
FT                   HCTLNGCFFSETHCDQTQFNQVIITSCIFEKCDGPKACFTESTIEKTSFISSSWVGGRL
FT                   SHCYLNSLTTGLNTNLSESHFEQCSLNKMGFLKVNLQSSTFINCSMLESCCDKADFSQA
FT                   TLIACDMTAVRLKDANLVHSHWQNTSLQQSMFYNADLRDATFQRCNLAGANLAMISQNM
FT                   DTRFEHCLTEKTHWIPRRYTVPA"
FT   gene            542808..543911
FT                   /locus_tag="YPD4_0447"
FT   CDS_pept        542808..543911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0447"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57356"
FT                   /protein_id="ACY57356.1"
FT                   /translation="MTPSDTPIMPPDSPRRIIGRHFTQRQLQQLTLSEVYFIQCTFTDI
FT                   SFAEIAVRNIHFESCHFTHLRLDGGRVENCSFRFCKFNDVSAQGVSILNTSCIEVQWQG
FT                   CYLTGCLIERWLLTSCQLDDAQLQDIQLNYWTVQDTPMTHLTMSDSKMQDSSWHGCTIQ
FT                   QSVWKNSELIRQVMGSCVLKECQYQAIQSDTVVWSQCQLEQVDFRHQPLENSNFHKSTL
FT                   TQCGFSDANLAAALFSEATLEGCDFNMAQLAAAQFVDATLRDCNFDTADLQNASLLRAN
FT                   LTRCHLTQVNLTKADLRSCMLSESSLQASKLSKTRIHGAQIPTLDTPLQMPDPLLSQID
FT                   NWYGHHQPGPKNNPKFPSIPSGASRYV"
FT   gene            543904..544521
FT                   /locus_tag="YPD4_0448"
FT   CDS_pept        543904..544521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0448"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57357"
FT                   /protein_id="ACY57357.1"
FT                   /translation="MSRLTTLLKPKNSLPGYLSYSPRTPLPAVSAPPQVITAKVIRPGN
FT                   ASVSLLGYETLPVTTASSCLFQPENGDLVSAVIDQQQIYITAILYRTSPDAPLVMNSGE
FT                   VPLHLVTTALEIHSPDRVEIHTRHFSLLTRTTLWVAKTMHQVADSLFVRAKQASREVEN
FT                   TDDVHARHISQLADQSLMINSRIGSLNASAVLKIDGGQVHMG"
FT   gene            544527..544892
FT                   /locus_tag="YPD4_0449"
FT   CDS_pept        544527..544892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0449"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57358"
FT                   /protein_id="ACY57358.1"
FT                   /translation="MTAANTRAGGISFIGSDPMIPISAPNTAPNANGIPNVSNYFCCGG
FT                   NEQNLNTIRPATIDGGSVMGAASGTHSAKMDPMQGSGKYFIQGSPATRLGDMSMTNNYN
FT                   APSTQIAPSQTKYFVNA"
FT   gene            544903..545376
FT                   /locus_tag="YPD4_0450"
FT   CDS_pept        544903..545376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0450"
FT                   /product="lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57359"
FT                   /protein_id="ACY57359.1"
FT                   /translation="MLPIFILTGCVLLSGCSWFSSSSEAALQKRRIDLQVVAAPLINPG
FT                   PNGQAQPLKVCIIELNKEGWSPPGLYQGTLCSGISVGGEVVSVTEYILAPTEVRQYSRD
FT                   VPFEQERWWAIAAEFQEMSNGKSLLTLKSDARADFNRVVLVDGKALSLKASTK"
FT   gene            545496..546851
FT                   /locus_tag="YPD4_0451"
FT   CDS_pept        545496..546851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0451"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57360"
FT                   /protein_id="ACY57360.1"
FT                   /translation="MLPKQRVAWVEGMLMEPQHFQQQERYLEHLTEMRARSLSALAWGF
FT                   HSLSINQGLLDQGKIALNQASGVFPDGTPFHMAGDEPLPLPFDPGENCQGSVVCLSVLM
FT                   DIPGNTYIDLKKSNQGSRFVALDAEVQDRNHGVAAEGTPLIATLQLGQLQSKLTLRASV
FT                   SDAESMLPVAYIKERTRDGRLILDDNFLPPMLDFRAIGWIDNAVTELLGLIVQRLESVY
FT                   RPDVTLSVGGLSELLELLLLQTLSEYNLKISHVLMQKQVHPEQLFQLLLGLLGRLSTIP
FT                   GGEKPWSRQDLLYTHHEPHNGYFSLFAALRRALSLVIEAPAVALPFIERGDNIYLCQND
FT                   SQLRLEKLIFTVSSKLPSETIRTYFPAQTKLGPVEKIVQLIDLQLPGARMIPMSSPPRY
FT                   IPYYPNSVYFEVDHDDPMYKEMMSGSAIALSIVGDFPELRFEVWGLRQGRLG"
FT   gene            546848..548458
FT                   /locus_tag="YPD4_0452"
FT   CDS_pept        546848..548458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0452"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57361"
FT                   /protein_id="ACY57361.1"
FT                   /translation="MNEFERQIRAAISAARNGAKHAEQSLTTPMWQAKSTVASLGGIVP
FT                   RSGSSSTSQAENYKEGLADQAASGNNMARTSAPPVTLYQQQPNANDSYPNGNNNNPNGD
FT                   NNNPNGSNNNIARVQRMPHGISRGLYERPGMLLGAWDNAYIAAAMPLLLLVENIRSWPT
FT                   RNAAEVRPPIVRELQYFQQHLQKKNYPQEDINHLSYLLCTYIDGIFNGLQTPDSYNQSL
FT                   LVEFHRDAWGGEDCFEHLRVYMNSPKQYREVLEFYDLIMCLGFDGKYQMIEHGAVLLMD
FT                   LRSRLHTQLYGQDATQSLAIAQAVKGSPRRQYIKALKIFTYGFALCLCAYGVTAWYLHQ
FT                   QSQQIRSNILTWVLPEPRKINIMETLPNPLSNILNEGWLEVRKDPRGWLLIFTSDGAFR
FT                   TGEATLSEEFINKKNIERLGLALAPWPGDIEVIGHTDNKPFRSTSGNNNLKLSAARASV
FT                   VADKLRESTQINETHQREISAIGRGESDPLADNATEEGRKRNRRVDILWKIGQRDADKA
FT                   MKQFLENPTPEVQGTNTQQ"
FT   gene            548523..551960
FT                   /locus_tag="YPD4_0453"
FT   CDS_pept        548523..551960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0453"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57362"
FT                   /protein_id="ACY57362.1"
FT                   /translation="MDRAADRHWPLFPSGGVWVRKIIIALILFWALWPFVAIFFSWIFR
FT                   YARAPLPKRKKKTVQLDRVSARFHDAMLTLQHADLSSQKTRWQRWRQRRKRQYIDAKPW
FT                   FLVMGPPGCGKTSIVYESSEKFLLSEQYGLAQTTDIGPTQDCNWWLTDRAVYIDTAGEW
FT                   ILLHGQSEEAGTARQKLFSMIRKYRRYPGVDGIVLCLDVSVLLNSSVTERKSLADTLRL
FT                   RILEVASTFQADIAVYLFLNNIDKLPGGETFLSLMNDELLAGGLGISMTHNEKGQNNFV
FT                   ADEERYRELLTRVSRYVLEILHDSPNMEMRHQLLLFTESLGALQKPLFGLFEQIFPATP
FT                   IGYTGCLRQFWFGSTQNLTSWEALYYPSSTSTFESRPAGQMYFPALSQAITERGVLHAT
FT                   GPMPLRNRLLNIGKYVFVVLVLCILLLMLSARYFWEYDYIGYATARFEETRRIVRDIPI
FT                   TNQVNDNLVAAYEQLGYINTHYLESSPPLLTPYFEHRLLNQAMLQTYHRHLNKVFWPAV
FT                   QNYVTNELKKDTQSPDGDNYDTLKVYLMLGQPDHRSQEALVQWFMSRWESFAPQGYGQN
FT                   DRKLFSYHLSELFSDTASAAPKVKLNDELIRESRIKAMKTPIHIRVINRIHDAPLPARI
FT                   EDLSLADAAGPSVTLMLRRKSPSTVTDLAIPAFYTRASYHDVVNPQLQEASEAMINEEA
FT                   WVLSDGKASVSQVSLLAAAQKLSDEARKYYLMEYANQWDAFFNDIRVRPINGLDDAALL
FT                   ARQLSDPSSPLANLVRFSTREITLTTDNNGKGAMSSGWFNIQRNKLTTARRNIIDEMSG
FT                   ERSRFRLTPEKAVEDRFELLRRLGYALQSASTSNSDPLGRTFEQIYNQLITLSTSLRAG
FT                   QILPQNNDFSRLQIDMARQPEPVRSIMMDLLAVGQTQSLQQSKANLSKGVSSIASDLCS
FT                   NAVSGRYPFNRLASEEIGIGDFNRMFGRSGAMQSFFDQNLAPYVDTNGNRWKVKPDSNG
FT                   VVTPKTLRSFENSAQIRDTFFDASGKMAMSMIIRPISLTPSILEAVLDVDGQIINYSHG
FT                   SNQPVKVDWPGPKGGVYIRLTFKTQDGNVETVSFNGPWAIFRMYDVSNPRPLGVNSREL
FT                   MMVMDNVSGVFKIELSSTMKDYPLWSKALAQFSCPKNL"
FT   gene            551982..552335
FT                   /locus_tag="YPD4_0454"
FT   CDS_pept        551982..552335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0454"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57363"
FT                   /protein_id="ACY57363.1"
FT                   /translation="MLDPKNIQNVLKSSTDLGQQSQSDLQKPFVKGMQNMEMSGADAAR
FT                   SIMQSVNQSCETMMSDMNKILGGLQDNVDAHQKMQSEERPKDFERAMSDLRSTLSNGFP
FT                   EEMKSMFDKLPKM"
FT   gene            complement(552591..555497)
FT                   /locus_tag="YPD4_0455"
FT   CDS_pept        complement(552591..555497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0455"
FT                   /product="ATP-dependent helicase HepA"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57364"
FT                   /protein_id="ACY57364.1"
FT                   /translation="MPFTLGQRWISDTESELGLGTVVAIDVRMITLLFPATGENRLYAR
FT                   NDSPITRVMFNPSDTITHHEGWQLKVEEVTQENGLITYIGTRLDTEETGVAMREVLLDS
FT                   KLTFSKPQDRLFAGQIDRMDRFALRFRARKYQSEQFRLPWSGLRGIRASLIPHQLHIAY
FT                   EVGQRHAPRVLLADEVGLGKTIEAGMIIHQQLLAGRAERVLIVVPESLQHQWLVEMLRR
FT                   FNLRFSLFDDSRYSEALLDSSNPFDTEQMVICSLDFVRRNKQRLEQLADASWDLLVVDE
FT                   AHHMAWSEEAPSREYQVIEQLAEHIPGVLLLTATPEQLGQQSHFARLRLLDPDRFHDYE
FT                   EFVNEQQKYRPIADAVTLLLGGERLTDDKLNLLGELIDEQDIEPLLKAANSQSEDSEAA
FT                   RQELVTMLMDRHGTSRVLFRNTRNGVKGFPHRVLHQIKLPLPTQYQTAIKVSGIMGAKK
FT                   TLDARAKDMLYPEQIYQEFEGENATWWNFDPRVEWLLNYLVANRGEKVLVICAQAATAL
FT                   QLEQVLREREAIRAAVFHEGLSLIERDRAAAYFASEEDGAQVLLCSEIGSEGRNFQFAC
FT                   QLVMFDLPFNPDLLEQRIGRLDRIGQNREIQIMVPYLEDTAQAILVRWYHEGLDAFEHT
FT                   CPTGRTIYDSSYQELISYLATPSEQEGLDEFIHTCRQQHEGLKLQLEQGRDRLLEMHSN
FT                   GGEHGQELAQSIAEQDNDINLVSFALNLFDIVGINQEDRSDNLIVLTPSDHMLVPDFPG
FT                   LPPDGCTVTFDREQALSREDAQFVSWEHPIIRNGLDLILSGDTGSCAVSLLKNKALPVG
FT                   TLLAELVYVVEAQAPKHLQLTRFLPPTPVRMLMDRNGTNLAAQVEFESFNRQLNAVNRH
FT                   TSSKLVNAVQQEVHTMLQQAEALVEAQAQALIETAKREADDKLSTELARLEALKAVNPN
FT                   IRDDEIEALEHNRKMVLENLNQAGWRLDAIRLVVVTHQ"
FT   gene            complement(555958..558327)
FT                   /locus_tag="YPD4_0456"
FT   CDS_pept        complement(555958..558327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0456"
FT                   /product="DNA polymerase II"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57365"
FT                   /protein_id="ACY57365.1"
FT                   /translation="MGQTRQGFLLTRHWRDTPAGTEVEFWLATDEGPQHVRLPPQPSVA
FT                   FIPAEQQQRAETVLRAERHWQLRPLALTDFHQRPVLGLYCTQHRQLIRLEKRLRESGVN
FT                   VYEGDIRPPERFLMERFITAPVWFSGQENDHGPLLNTQLKPADDYRPTLKLVSLDIETS
FT                   EHGELYCIGLEGCGQRQVYMLGPPNGETTGTPLDFNLEYVASRPLLLEKLNQWLAVHDP
FT                   DAIIGWNLVQFDLRVLQKHADRYQIPLRFGRGGNLLEWREHGFKQGHFFASAAGRLIID
FT                   GIEALKSATWNFPSFSLESVSQTLLGEGKASDSPYQRMDEINQRFAHDKPALARYNLKD
FT                   CELVTRIFAKTELLSFLLERSTVTGLAADRSGGSVAAFTHLYLPRMHRIGYVAPNLGEL
FT                   PEEHSPGGFVMDSQPGLYDSVLVLDYKSLYPSIIRTFLIDPVGLVAGMQQPDIQHSVPG
FT                   FRGAWFSREKHCLPAIVNQIWQGREAAKRQQNKPLSQALKIIMNAFYGVLGSSGCRFFD
FT                   PRLASSITLRGHEIMRQTRELIEAQGYQVIYGDTDSTFVWLKSAHNDEQATRIGNELVQ
FT                   LVNQWWQNHIQQNFNLPCALELEFEIHYRRFLMPTIRGAEQGSKKRYAGLISTPTGDQM
FT                   VYKGLETVRTDWTPLAQQFQRELYLRIFQQQPYQDYVRDYVARTLNGELDEQLVYRKRL
FT                   RRRLDDYQRNVPPHARAARLADEFNRKLGRPLQYQNGGWISYVMTTAGPEPLETRQSPI
FT                   DYDHYLTRQLQPVADAILPFTQDDFTTLITGQMGLF"
FT   gene            558523..559290
FT                   /locus_tag="YPD4_0457"
FT   CDS_pept        558523..559290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0457"
FT                   /product="putative DedA-family membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57366"
FT                   /protein_id="ACY57366.1"
FT                   /translation="MEAYLLHLLTQSLAFTLFIVMLVTFLESLALVGMLLPGTVMMTSV
FT                   GALIGSGEVDFYFAWVAATLGCLLGDWISYFIGRRFKAPLHNWSFLQKHKSLLNKTEHA
FT                   LHNHSMATVLLGRFIGPTRPIVPMVAGMLNLPTAKFALPSVIGGLTWPPIYLFPGILAG
FT                   VAIDIPPSSNSFMFKCLLFVVVVLIWLSLWLSWRWWRFGKRSPDRLSVWLPLARLRWVT
FT                   LLTIAAAIASFIWLHMQPLMPIYRHLLWKVLAG"
FT   gene            complement(559359..560069)
FT                   /locus_tag="YPD4_0458"
FT   CDS_pept        complement(559359..560069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0458"
FT                   /product="thiamine transport ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57367"
FT                   /protein_id="ACY57367.1"
FT                   /translation="MLKLEKITYLYDHLPMCFDLRIQPGERVAILGPSGAGKSTLLSLI
FT                   AGFLAPTGGHMLLNNQDHTASTPAQRPVSMLFQENNLFAHLTVEQNIGLGLHPGLKLSG
FT                   EQRLLLQHIAQQVGLESCLDRLPAQLSGGQRQRAALARCLVRSQPILLLDEPFSALDPA
FT                   LRNEMLQLVDQVCINRQLTLLMVSHNLDDAARIAQRTLLIVEGRIDYDGPTQALVDGSA
FT                   AKASVLGIKSAVIS"
FT   gene            complement(560056..561663)
FT                   /locus_tag="YPD4_0459"
FT   CDS_pept        complement(560056..561663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0459"
FT                   /product="thiamine transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57368"
FT                   /protein_id="ACY57368.1"
FT                   /translation="MAIRRQPLIAPWLWPGLLAAGLIVAVALLAFAAIWHHAPTADWQS
FT                   VWHDRYLWHVIRFTFWPAFLSALLSVIPAIFLARALYRRNFPGRQFMLRLCAMTLVLPV
FT                   LVALFGILTVYGRQGWLAHLFDWLGVDYRFSPYGLQGILLAHIFFNLPLATRLLLQSLE
FT                   GIAVEQRQLAAQLGMNGWQHFRWVEWPYLRRQILPTAALIFMLCFASFATVLSLGGGPQ
FT                   ATTIELAIYQALSYDYDLGRAALLALIQLGCCLGLVVLSQRLNSVLTVGNTHGQIWRNP
FT                   QDSGWARLGDTLLICSALLLMVPPLLTVVIDGSNKTILTVLQQPALWQAFFTSVTIAIG
FT                   AGLLCVILTMMLLWSSRELKLRQRAAYGQALEVSGMVILAMPGIVLATGFFLLLNDTLG
FT                   LPQSPYGLVILTNALMAVPYALKVLDNPMRDLAERYTPLCLSLDIRGWHRLRYIELRAL
FT                   KRPLAQALAFASVLSIGDFGVVALFGNEHFRTLPFYLYQQIGSYRSNDGAVTALLLLLL
FT                   CFLLFTLIERLPSRHAKA"
FT   gene            complement(561639..562685)
FT                   /locus_tag="YPD4_0460"
FT   CDS_pept        complement(561639..562685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0460"
FT                   /product="thiamin/thiamin pyrophosphate ABC transporter,
FT                   thiamin/thiamin pyrophospate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57369"
FT                   /protein_id="ACY57369.1"
FT                   /translation="MLTTASDTFATFMFKECKVFKHIISCLLLISATSALAAEKPTLTV
FT                   YTYDSFAADWGPGPAIKQAFEAECDCQLKFVALEDGVSLLNRLRMEGKNSQADVILGLD
FT                   NNLVQAAEQTGLFTPSQVDTRNLTLPEPWQNKTFVPYDYGYFAFVYNKEKLKNPPKSLH
FT                   ELISSKEPWKVIYQDPRTSTPGLGLMLWMQKVYGDQAPQAWQQLAQKTVTVTKGWSEAY
FT                   GLFLKGEADLVLSYTTSPAYHLIAEKNNNYAAADFSEGHYLQVEVAGQLAASKQPELAQ
FT                   RFMQFIVTPAFQNHIPTGNWMYPVIKMDLPAGFETLAVPQTALQFDAKDVADNRSKWIQ
FT                   AWQSAVSR"
FT   gene            complement(563571..565232)
FT                   /locus_tag="YPD4_0461"
FT   CDS_pept        complement(563571..565232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0461"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57370"
FT                   /protein_id="ACY57370.1"
FT                   /translation="MSTSRLQQQFIRLWQRYNGQSTETTLQALAEVLNCSRRHVRSLLG
FT                   KMQHAGWLDWQAEAGRGKRSQLIFLRSGLALQQQRAEELLEQDHIDQLVQLVGDKKAVR
FT                   QMLLSQLGRSFRQGKHILRVLYYRPLENLLPGTALRRSETHMVRQIFNGLTRINEENGE
FT                   LEPDLSHHWQAITPLHWRFYLRPAIHFHHGRELEMSDVISSLTRLIPQPLFSHIAEVRS
FT                   PTPYVIDVYLHSPDHWLPWLLGSVHAMILPQEWETQPDFHRQPIGTGPYSVIRNHHSQL
FT                   KIQAFDNYFGFRALIDEVNIWVLPELSEELVYSGVQLQADDTGKNELESRLEEGCYFLL
FT                   FDQRSPQACTPEIRRWLCELITPIALLSHAAPFYQRYWSPAYGMLPRWHHNRLTTQEPK
FT                   PEGLNELTLTFYSEHSEFDAISQTLTQLLAAQGVTLKIQVLDYTRWYQGDAQSDIWLGS
FT                   ANFYLPLEFSLFATLYEMPLLQHCLSEELHQDIESWRNNTLLMADWSQRLVSQHQFHPL
FT                   FHHWLELYGQHSMRGVRMNTLGWFDFKSAWFTPPEA"
FT   gene            565896..566852
FT                   /locus_tag="YPD4_0462"
FT   CDS_pept        565896..566852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0462"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57371"
FT                   /protein_id="ACY57371.1"
FT                   /translation="MRSARAFSRRINPVFLAFFVVAFLSGIAGALQAPTLSLFLSTELK
FT                   VRPLWVGLFYTVNAIAGITVSFLLAKRSDLGGDRRKLILICYLMAVGNCLLFAFNRDYL
FT                   TLITLGVLMASVANTAMPQIFALAREYADNSAREVVMFSSIMRAQLSLAWVIGPPLSFM
FT                   LALNYGFTLMFSIAAGIFVISALVVWFILPSVKQPEPVADAPVVVQGSLFADKNVLLLF
FT                   IASMLMWTCNTMYIIDMPLYITANLGLPERLAGLLMGTAAGLEIPIMLLAGYSVRRFGK
FT                   RKIMLFAVMAGVLFYTGLVLFKFKTALMILLSTTDEK"
FT   gene            complement(566896..567675)
FT                   /locus_tag="YPD4_0463"
FT   CDS_pept        complement(566896..567675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0463"
FT                   /product="insertion sequence IS100, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57372"
FT                   /protein_id="ACY57372.1"
FT                   /translation="MMELQHQRLMALAGQLQLESLISAAPALSQQAVDQEWSYMDFLEH
FT                   LLHEEKLARHQRKQAMYTRMAAFPAVKTFEEYDFTFATGAPQKQLQSLRSLSFIERNEN
FT                   IVLLGPSGVGKTHLAIAMGYEAVRAGIKVRFTTAADLLLQLSTAQRQGRYKTTLQRGVM
FT                   APRLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQTFAGDAALTS
FT                   AMLDRILHHSHVVQIKGESYRLRQKRKAGVIAEANPE"
FT   gene            complement(567675..568697)
FT                   /locus_tag="YPD4_0464"
FT   CDS_pept        complement(567675..568697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0464"
FT                   /product="transposase for insertion sequence IS100"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57373"
FT                   /protein_id="ACY57373.1"
FT                   /translation="MVTFETVMEIKILHKQGMSSRAIARELGISRNTVKRYLQAKSEPP
FT                   KYTPRPAVASLLDEYRDYIRQRIADAHPYKIPATVIAREIRDQGYRGGMTILRAFIRSL
FT                   SVPQEQEPAVRFETEPGRQMQVDWGTMRNGRSPLHVFVAVLGYSRMLYIEFTDNMRYDT
FT                   LETCHRNAFRFFGGVPREVLYDNMKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFSPRLC
FT                   RPFRAQTKGKVERMVQYTRNSFYIPLMTRLRPMGITVDVETANRHGLRWLHDVANQRKH
FT                   ETIQARPCDRWLEEQQSMLALPPEKKEYDVHLDENLVNFDKHPLHHPLSIYDSFCRGVA
FT                   "
FT   gene            complement(569277..569879)
FT                   /gene="leuD"
FT                   /locus_tag="YPD4_0465"
FT   CDS_pept        complement(569277..569879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuD"
FT                   /locus_tag="YPD4_0465"
FT                   /product="isopropylmalate isomerase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57374"
FT                   /protein_id="ACY57374.1"
FT                   /translation="MAKFIQHIGLVAPLDAANVDTDAIIPKQFLQKVTRTGFGQHLFND
FT                   WRFLDDAGKVPNPDFVLNLPRYQGATILLARENFGCGSSREHAPWALTDFGFKVVIAPS
FT                   FADIFYGNAFNNQLLPVTLSEADIDTLFQLVKENEGIEFVVDLEQQTVNAGGKSYAFEI
FT                   DPFRRHCMINGLDSIGLTLQHEHNISAYEKQQPEFLR"
FT   gene            complement(569894..571324)
FT                   /gene="leuC"
FT                   /locus_tag="YPD4_0466"
FT   CDS_pept        complement(569894..571324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuC"
FT                   /locus_tag="YPD4_0466"
FT                   /product="isopropylmalate isomerase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57375"
FT                   /protein_id="ACY57375.1"
FT                   /translation="MGTTSSQSKTLYQKLYDAHIVHEAPNETPLLYIDRHLVHEVTSPQ
FT                   AFDGLRAMGRPVRQPGKTFATMDHNVSTQTKDINASGEMARIQMQELIKNCAEFGVSLY
FT                   DLNHPFQGIVHVIGPEQGMTLPGMTIVCGDSHTATHGAFGSLAFGIGTSEVEHVLATQT
FT                   LKQGRAKTMRIEVNGTVGAGITAKDIVLAIIGKTGSAGGTGHVVEFCGSAIEALSMEGR
FT                   MTLCNMAIEMGAKAGLVAPDDTTFAYLKGRQFAPTGEQWEQGVAYWRTLKSDADAQFDT
FT                   IVTLDAADIAPQVTWGTNPGQVIAVNQIIPAPESFSDPVERASAEKALAYMDLRPGIKL
FT                   TEVAIDKVFIGSCTNSRIEDLRAAAAIAQGRKVAKGVQAIVVPGSGPVKAQAEAEGLDK
FT                   IFIAAGFEWRLPGCSMCLAMNNDRLEPGERCASTSNRNFEGRQGRGGRTHLVSPAMAAA
FT                   AAVSGHFADVRELSATTH"
FT   gene            complement(571326..572417)
FT                   /locus_tag="YPD4_0467"
FT   CDS_pept        complement(571326..572417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0467"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57376"
FT                   /protein_id="ACY57376.1"
FT                   /translation="MTKTYHIAVLPGDGIGPEVMAQASKVLDAVRQRFGLKISTSVYDV
FT                   GGAAIDRHGSPLPAATVAGCEQADAILFGSVGGPKWEHLPPAEQPERGALLPLRKHFKL
FT                   FSNLRPARLYQGLEDFCPLRSDIAARGFDILCVRELTGGIYFGQPKGREGQGMHERAFD
FT                   TEVYHRFEIERIARIAFESARKRRSKVTSIDKANVLQSSILWREVVNGIAADYPDVALS
FT                   HMYIDNATMQLIKDPSQFDVLLCSNLFGDILSDECAMITGSMGMLPSASLNEQGFGLYE
FT                   PAGGSAPDIAGKNIANPIAQILSLTLLLRFSLGKDDAADAIERAINQALEQGYRTADLA
FT                   GDGHAIGTHEMGDIIAKFVVEGV"
FT   gene            complement(572420..573982)
FT                   /gene="leuA"
FT                   /locus_tag="YPD4_0468"
FT   CDS_pept        complement(572420..573982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuA"
FT                   /locus_tag="YPD4_0468"
FT                   /product="2-isopropylmalate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57377"
FT                   /protein_id="ACY57377.1"
FT                   /translation="MSQQVIIFDTTLRDGEQALQASLSVKEKLQIALALERMGVDIMEV
FT                   GFPVSSPGDFESVRTIAQQVKNSRVCALARCVDKDIDVAAEALRIAEAFRIHVFLATST
FT                   LHIESKLKRSFDDVLAMAVHSVKRARNYTDDVEFSCEDAGRTPIDNLCRVVEAAITAGA
FT                   TTINIPDTVGYTTPYQFGGIITDLYERVPNIDKAIISVHCHDDLGMSVANSITAVQAGA
FT                   RQVEGTINGLGERAGNCSLEEVIMAIKVRHEMLGVHTNINHQEIYRTSQLVSKICNMPI
FT                   PGNKAIVGSNAFAHSSGIHQDGVLKNRENYEIMTPESIGLKEVQLNLTSRSGRAAVKHR
FT                   MEEMGYQDKDYNLDSLYDAFLKLADKKGQVFDYDLEALAFINKQQEEPEYYRLDYFSVQ
FT                   SGSSVMATASVKLVCGEEIKSEAATGNGPVDAVYQAINRITDYPIELVKYQLSAKGQGK
FT                   DALGQVDIVVDHKGRRFHGVGLATDIVESSAKALVHVLNNIWRAHQVEKEKQRLQQNNQ
FT                   EMV"
FT   gene            575908..576864
FT                   /gene="leuO"
FT                   /locus_tag="YPD4_0469"
FT   CDS_pept        575908..576864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuO"
FT                   /locus_tag="YPD4_0469"
FT                   /product="leucine transcriptional activator"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57378"
FT                   /protein_id="ACY57378.1"
FT                   /translation="MSEYNLVTDSQATKKESIDVHLRSVDLNLLTVFDAVMQMQNVTRA
FT                   AQSLGMSQPAVSNAVARLKVMFNDELFVRYGRGIQPTARARQLFGPVRQALQLVQNELP
FT                   GAGFEAKNSERLFNLSICSPLDVRLAAQIVQRVKQSAPNVQLVIKSYLNDNIEHQLRYQ
FT                   ETEFVIGYTEFDRPDFHRIPLFKDELVLAVSKDHPRINDSITENQLLSESHAVVSLDKK
FT                   GSFSEPYYDSTTSTQSIAYESTDMNSVLNIVSQTYFVAIAPRWLVKTYSEALNLKLISL
FT                   PWENTSRACYLTWHESTDRDKGHQWMKALLGQFSSPV"
FT   gene            577440..579206
FT                   /locus_tag="YPD4_0470"
FT   CDS_pept        577440..579206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0470"
FT                   /product="AMP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57379"
FT                   /protein_id="ACY57379.1"
FT                   /translation="MRQQVSDRSELVAFREWSPEGEKQLNWQQIDEHVTRISTALLSLG
FT                   AAIQERIGIFANNSMAWSLVDLAILQLRGVSVPLYATNTAAQAAYIVNDADVRILFVGE
FT                   QSQFDIAITLQPLCPQLAHIIVLDPAVDLRGCEYAQHLADFEQQQQPDTVQQHLLTTRI
FT                   EGCDLDDLFTLIYTSGTTGEPKGVMLDYRNMAAQLYLHDQRLTLTPQDVSLSFLPLSHV
FT                   FERAWSFYVMHTGAQNVYIRNTDWVRSAMQAVKPTVMCAVPRFYEKVFSAINDKVALAK
FT                   WHQRVLFHWAVGCGERKFKRLQQGRPLPWLSEQMYTLADRLVLRKLRGVLGGRVRFLPA
FT                   AGARLDDNIILFFQAIGVNIKYGYGMTETCATVSCWEEQNFRFGSIGKPLPGIDVRLGA
FT                   ENEIQVRGPIVMRGYFKKPQETLEAFTEDGWLKTGDAGALDAQGHLFITERLKDLMKTS
FT                   GGKYIAPQMIEGTLGQDRFIEQVAIIADTRKFVSALIVPSFESLEEYARSINLKYHDRL
FT                   ELLRHSHIVNMFEQRLKEIQKELALFEQVKKFTLLPQAFTMETGELTPTMKLRRKIILQ
FT                   RYQNEIDLMYSD"
FT   gene            579690..581393
FT                   /locus_tag="YPD4_0471"
FT   CDS_pept        579690..581393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0471"
FT                   /product="acetolactate synthase isozyme III large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57380"
FT                   /protein_id="ACY57380.1"
FT                   /translation="MVVRSLIDQGVKHVFGYPGGAVLDIYDALHTVGGIDHVLVRHEQG
FT                   AVHMADGYARATGEVGVVLVTSGPGATNAITGIATAYMDSVPMVVLSGQVPSSLIGFDA
FT                   FQECDMVGISRPVVKHSFLVKRTEDIPMVLKKAFYLASTGRPGPVVIDLPKDIVGPAVK
FT                   MPYAYPEQVSLRSYNPTVQGHRGQIKRALQTIMAAKRPIMYVGGGAINAACHEELLILA
FT                   EKLNLPVTSSLMGLGSFPGTHRQSVGMLGMHGTFEANMAMHNTDLIFAVGVRFDDRTTN
FT                   NLAKYCPDATVLHIDIDPTSISKTVTADIPIVGDAKQVLTQMLDLLSQVGCTQDFDSLR
FT                   DWWQSIEQWRTRNCLGYNKDSGKIKPQAVIEALHRLTKGDAYVTSDVGQHQMFAALYYP
FT                   FDKPRRWINSGGLGTMGFGLPAALGVKLALPNETVVCVTGDGSIQMNIQELSTALQYNL
FT                   PVLVLNLNNRYLGMVKQWQDMIYSGRHSQSYMDSLPDFVKLAEAYGHIGVAINTPDELE
FT                   SKLADALTQLSETNRLVFVDVTVDETEHVYPMQIRGGGMDEMWLSKTERT"
FT   gene            581396..581890
FT                   /gene="ilvH"
FT                   /locus_tag="YPD4_0472"
FT   CDS_pept        581396..581890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvH"
FT                   /locus_tag="YPD4_0472"
FT                   /product="acetolactate synthase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57381"
FT                   /protein_id="ACY57381.1"
FT                   /translation="MRRRILSVLLENESGALSRVVGLFSQRGYNIESLTVAPTDDPTLS
FT                   RMTIQTVGDAKVLEQIEKQLHKLVDVLRVSELVSGSHVEREIMLVKLQASGYGREEVKR
FT                   CAEIFRGQIVDVTATLYTVQLAGTSEKLDAFLNAVREVAEIVEVARSGIVGVSRGDKIM
FT                   R"
FT   gene            582038..582547
FT                   /locus_tag="YPD4_0473"
FT   CDS_pept        582038..582547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0473"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57382"
FT                   /protein_id="ACY57382.1"
FT                   /translation="MRSGNCKCSTRNQKGVPMRDEKSLAHTRWNCKYHIVFAPKYRRQV
FT                   FYREKRRAIGSILRKLCEWKNVNILEAECCVDHIHMLLEIPPKMSVSGFMGYLKGKSSL
FT                   MLYEQFGDLKFKYRNREFWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGS
FT                   PFTGRK"
FT   gene            583052..584062
FT                   /gene="fruR"
FT                   /locus_tag="YPD4_0474"
FT   CDS_pept        583052..584062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fruR"
FT                   /locus_tag="YPD4_0474"
FT                   /product="putative fructose repressor"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57383"
FT                   /protein_id="ACY57383.1"
FT                   /translation="MKLDEIARLAGVSRTTASYVINGKAKQYRVSDKTVDKVMAVVREH
FT                   NYHPNAVAAGLRAGRTRSIGLVIPDLENTSYTRIANYLERQARQRGYQLLIACSEDQPD
FT                   NEMRCVEHLLQRQVDAIIVSTALPPEHPFYQRWAKDPFPIIALDRALDREHFISVVGAD
FT                   QEDAQMLAQELRSFPAESVLYLGALPELSVSFLREMGFREAWKDDPRKVEYLYANSYER
FT                   EAAGVLFAEWLKTHPMPQALFTTSFQLLQGVMDVTLKQSGRLPCNLAIATFGDNELLDF
FT                   LECPVLAVAQRHRDVAERVLELVLASLDEPHKPKPGLTRIRRNLFRRGTLSLSRR"
FT   gene            complement(584193..584633)
FT                   /locus_tag="YPD4_0475"
FT   CDS_pept        complement(584193..584633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0475"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57384"
FT                   /protein_id="ACY57384.1"
FT                   /translation="MFSTGPRWRSAVADTFALVVYCFVIGMAIEVVISGMTFRQSLSSR
FT                   LLSIPVNILIAWPYGMYRDAFIRFAQRHAGQRFWARNLADLLAYVSFQSPVYAMILWSV
FT                   GADFEQMISAVASNAVVSMVMGVAYGYFLEYCRRLFRVAGYV"
FT   gene            585745..586203
FT                   /locus_tag="YPD4_0476"
FT   CDS_pept        585745..586203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0476"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57385"
FT                   /protein_id="ACY57385.1"
FT                   /translation="MFRGATMVNLDSKGRLAVPTRYRESLNEESQGQMVCTIDLHQPCL
FT                   LLYPLPEWEIIEQKLSRLSSMNPAERRVQRLLLGHASECQMDGAGRLLIAGTLRQHAGL
FT                   NKEVMLVGQFNKFELWDEQTWYQQVKDDIDAEQSTQEPLSERLQGLSL"
FT   gene            586206..587168
FT                   /gene="mraW"
FT                   /locus_tag="YPD4_0477"
FT   CDS_pept        586206..587168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraW"
FT                   /locus_tag="YPD4_0477"
FT                   /product="S-adenosyl-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57386"
FT                   /protein_id="ACY57386.1"
FT                   /translation="MVDNNKTVDNNYKHTSVLLDEAVKGLNIRDNGIYIDGTFGRGGHS
FT                   RLILSQLGPEGRLIAIDRDPEAIEAAKQITDPRFSIVHGPFSDLAHYVRDLDLVGRIDG
FT                   ILLDLGVSSPQLDDAERGFSFMRDGPLDMRMDPSRGLSAAEWLMKASADDIAWVLKTFG
FT                   EERFAKRLAKAIVERNLTQPMTRTKELADLIANASPFRDKHKHPATRSFQAIRIYINSE
FT                   LEEIERALDGAHEVLAPEGRLSVISFHSLEDRIVKNFIRHHSRGPQVPAGLPLTEAQLR
FT                   SMGGRTLKSVGKMMPGDAEIAENPRARSSVLRFAERIGE"
FT   gene            587165..587482
FT                   /gene="ftsL"
FT                   /locus_tag="YPD4_0478"
FT   CDS_pept        587165..587482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsL"
FT                   /locus_tag="YPD4_0478"
FT                   /product="putative cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57387"
FT                   /protein_id="ACY57387.1"
FT                   /translation="MIGNERHGLVGVIGADLIRNAKIPLILLVAVLISAVLVVTTAHRT
FT                   RLLTAEREQLVLERDALDIEWRNLILEENALGDHSRVESIAIEKLKMQHVDPSQENIVI
FT                   K"
FT   gene            587548..589311
FT                   /gene="ftsI"
FT                   /locus_tag="YPD4_0479"
FT   CDS_pept        587548..589311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsI"
FT                   /locus_tag="YPD4_0479"
FT                   /product="penicillin-binding protein 3"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57388"
FT                   /protein_id="ACY57388.1"
FT                   /translation="MKTARPGKLKRQEEQASFISWRFALLCGCILLALVGLIMRTAYLQ
FT                   VINPDKLVREGDMRSLRVQEVPTARGMISDRSGRPLAVSVPVNAVWADPKELIEQGGIS
FT                   LDTRWKALSDALEIPLDQLATRINANPKGRFVYLARQVNPAIGDYIRKLKLPGIHLRQE
FT                   SRRYYPAGQVMAHIIGVTNIDGQGIEGVEKSFDRWLTGQPGERTVRKDHYGRVIEDISS
FT                   VDSQAAHNLVLSVDERLQALVYRELNNAVAFNKAESGTAVLVDVNTGEVLAMANSPSYN
FT                   PNNLTGTPKDAMRNRAITDIFEPGSTVKPMVVMTALQHGVVKENSVLNTLPYFVNGHQI
FT                   KDVARYAELSVTGILQKSSNVGVSKLALAMPSSALVDTYSRFGFGKATNLGLVGESSGL
FT                   YPKKQRWSDIERATFSFGYGLMVTPLQLARVYATIGSMGVYRPLSITRVDPPVAGERIF
FT                   PEPLVRTVVHMMESVALPGGGGTKAAIKGYRIAIKTGTAKKVGPDGKYMDRYLAYTAGV
FT                   APASNPRFALVVVINDPQAGKYYGGAVSAPVFGAIMGGVLRTMNIEPDALPTGDKSELV
FT                   INTKEGSGGRS"
FT   gene            589298..590785
FT                   /gene="murE"
FT                   /locus_tag="YPD4_0480"
FT   CDS_pept        589298..590785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murE"
FT                   /locus_tag="YPD4_0480"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57389"
FT                   /protein_id="ACY57389.1"
FT                   /translation="MADRNLRDLFAPWGLDVPERALREMTLDSRIAAAGDLFVAVVGHQ
FT                   TDGRRYIPQAIAQGVAAIVAEADGVAPDVSVAEIHGVPVIYLRNLNQHLSTLAGQFYHQ
FT                   PGAALRLVGVTGTNGKTTTTQLLAQWSQALGETSAVMGTVGNGLLGQVIPTENTTGSAV
FT                   DIQHLLRNLVDQGATFAAMEVSSHGLIQDRVAALSFAAVVFTNLSRDHLDYHGNMTSYE
FT                   AAKWLLFSTHQSEHKIINADDDVGRRWLSQLPQAVAVSMAGNVPKGWNGPWLSANKVIY
FT                   HDNGASIAFDSSWGEGELESRLMGAFNVSNLLVALATLLVQGYPMAQLLAAAPHLQPVC
FT                   GRMEVFNAPGKPTVVVDYAHTPDALEKALAAARLHCTGKLWCVFGCGGDRDKGKRPLMG
FT                   GIAEQLADCVVVTDDNPRSEEPQAIVADILSGLLDAGRVQAIHGRAEAVTSAIMQAKED
FT                   DVVLIAGKGHEDYQLVGNRRLDYSDRVTVARLLGGQA"
FT   gene            590782..592158
FT                   /gene="murF"
FT                   /locus_tag="YPD4_0481"
FT   CDS_pept        590782..592158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murF"
FT                   /locus_tag="YPD4_0481"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diamino pimelate--D-alanyl-D-alanyl ligase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57390"
FT                   /protein_id="ACY57390.1"
FT                   /translation="MIKVSLRFLASLLNAEYIVAESVSDDIEITEVTIDTRKVTAGCLF
FT                   VALKGERFDGHDFAEDAIAAGAGALLVSKRLLVGGPQLVVKDTRLALGQFAAWVRQQVP
FT                   ARIVALTGSSGKTSVKEMAAAILRQCGNVLYTAGNFNNDIGVPLTLLRLTAEHDFAVIE
FT                   LGANHVGEIAYTTDLSRPESALVNNLAAAHLEGFGSLAGVAQAKGEIFAGLPANGTAII
FT                   NADSNDWPHWQETLHNKRVWRFSPHAAEHIDFYASDVRITPQLTSFTLHSPFGTVAIEL
FT                   PLPGQHNIANALAAAALAMSVGADLAAVRQGLAQLQAVPGRLFPVPLAEGQLLLDDSYN
FT                   ANVGSMIAAAQVLAEMPGYRVMVVGDMAELGETAADCHRQVGEAAKLAGVDKVLSVGTL
FT                   SQILSSASGNGEHFQDQNTLSTRVNALLNEYPVITVLIKGSRSAAMENVVRALQEKASC
FT                   "
FT   gene            592152..593234
FT                   /gene="mraY"
FT                   /locus_tag="YPD4_0482"
FT   CDS_pept        592152..593234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraY"
FT                   /locus_tag="YPD4_0482"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57391"
FT                   /protein_id="ACY57391.1"
FT                   /translation="MLVWLAEYLVKFYSGFNVFSYLTFRAIVSLLTALFISLWMGPHLI
FT                   AWLQKLQIGQVVRNDGPESHFSKRGTPTMGGLMILFSITISVLMWAYPSNPYVWCVLFI
FT                   LIGYGIVGFIDDYRKVVRKNTKGLIARWKYFWQSIIALAAAFTMYSIGKDTSATELVVP
FT                   FFKDIMPQLGLLYVLLAYFVIVGTSNAVNLTDGLDGLAIMPTVFVAAGFALVAWATGNV
FT                   NFAAYLHIPYLRHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIA
FT                   VLLRQEFLLVIMGGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIV
FT                   RFWIISLMLVLIGLATLKVR"
FT   gene            593237..594553
FT                   /gene="murD"
FT                   /locus_tag="YPD4_0483"
FT   CDS_pept        593237..594553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murD"
FT                   /locus_tag="YPD4_0483"
FT                   /product="UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57392"
FT                   /protein_id="ACY57392.1"
FT                   /translation="MVDYQGKKVVIIGLGLTGLSCVDFFIARGVTPRVMDTRINPPGLD
FT                   QLPESVEQHVGDLNQEWLLDADLIVVSPGMALAHPALSEAAEAGVEIIGDIELFCRENQ
FT                   APVVAITGSNGKSTVTTLVGEMAKAAGWSVGGGGNIGVPALTLLKQDNQLTVLELSSFQ
FT                   LETTHSLRASAATILNVTEDHTDRYPLGLQQYRAAKLRVYENAKVCVVNADDALTMPVR
FT                   GADSRCISFGVDVGDYHLNKQQGEIWLRVRGEKVLNTREMKLSGRHNYTNALAALALAD
FT                   AVGIPRASSLKALTTFSGLPHRFQLVLERHGVRWINDSKATNVGSTEAALDGLQVDGTL
FT                   HLLLGGDGKSADFSGLTHFLQGDRIKVYCFGRDGGQLAALRPDVSQLTETMAQAMALVA
FT                   KVVLPGDRVLLSPACASLDQFRSFEHRGNEFARLAEELG"
FT   gene            594553..595755
FT                   /gene="ftsW"
FT                   /locus_tag="YPD4_0484"
FT   CDS_pept        594553..595755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsW"
FT                   /locus_tag="YPD4_0484"
FT                   /product="cell division protein FtsW"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57393"
FT                   /protein_id="ACY57393.1"
FT                   /translation="MRMPGLGLFNTLKHYVMGSRESDTTSMVLYDRTLLWLTFGLAIIG
FT                   FVMVTSASMPIGQRLANDPFLFAKRDALYLALAFGLSLVTLRIPMDVWQRYSNIMLLIS
FT                   IVLLLVVLVVGSSVNGASRWIALGPLRIQPAELSKLSLFCYLASYLVRKVEEVRSNFWG
FT                   FCKPMGVMVILAVLLLAQPDLGTVVVLFITTLAMLFLAGAKMWQFMAIIGSGAFAVCLL
FT                   IIAEPYRMRRVTSFWNPWADPFGSGYQLTQSLMAFGRGEFWGQGLGNSVQKLEYLPEAH
FT                   TDFIFSILGEELGYFGVVLALLMVFFVAFRAMSIGRRALEIGQRFSGFLACSIGIWFSF
FT                   QALVNVGAAAGMLPTKGLTLPLISYGGSSLIIMSTAIVLLLRIDFETRLAKAQAFVRSA
FT                   R"
FT   gene            595752..596822
FT                   /gene="murG"
FT                   /locus_tag="YPD4_0485"
FT   CDS_pept        595752..596822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murG"
FT                   /locus_tag="YPD4_0485"
FT                   /product="N-acetylglucosaminyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57394"
FT                   /protein_id="ACY57394.1"
FT                   /translation="MSGKTKRLMVMAGGTGGHVFPGLAVAHHLMAQGWQVRWLGTADRM
FT                   EASLVPQHGIEIDFIKISGLRGKGLMAQLTAPIRIYRAVRQAQKIMRDYQPNVVLGMGG
FT                   YVSGPGGLAAWLCGVPVVLHEQNGIAGLTNRWLARIAKKVLQAFPGAFPNADVVGNPVR
FT                   TDVLALPLPAVRLSGREGPIRVLVIGGSQGARILNQTLPLVAASLGEQITLWHQVGKGA
FT                   LPEVSQAYQQAGQAGHLVVEFIDDMAAAYAWADVVVCRSGALTVSEVAAAGLPAIFVPF
FT                   QHKDRQQYWNALPLEKAGAAKIIEQPQFTATSVSSLLASWDRATLLSMAERARSVAIPD
FT                   ATERVAAEVVAASKSA"
FT   gene            596912..598435
FT                   /gene="murC"
FT                   /locus_tag="YPD4_0486"
FT   CDS_pept        596912..598435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="YPD4_0486"
FT                   /product="UDP-N-acetylmuramate--L-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57395"
FT                   /protein_id="ACY57395.1"
FT                   /translation="MNAGCEYMTDKKVKRNVNTQQLAKLRTIVPEMRRVRHIHFVGIGG
FT                   AGMGGIAEVLANEGYQISGSDLAPNSVTQHLTALGAQIYFHHRPENVLDASVVVVSTAI
FT                   SADNPEIVAAREARIPVIRRAEMLAELMRYRHGIAVAGTHGKTTTTAMLSSIYAEAGLD
FT                   PTFVNGGLVKAAGTHARLGSSRYLIAEADESDASFLHLQPMVAIVTNIEADHMDTYQGD
FT                   FENLKQTFINFLHNLPFYGRAVMCIDDPVVRELLPRVGRHITTYGFSDDADVQIASYRQ
FT                   EGPQGHFTLRRQDKPLIEVTLNAPGRHNALNAAAAVAVATEEGIEDEDILRALVGFQGT
FT                   GRRFDFLGNFPLAPVNGKEGSAMLVDDYGHHPTEVDATIKAARAGWPDKRIVMLFQPHR
FT                   YTRTRDLYDDFANVLSQVDVLLMLDVYAAGEPPIPGADSRALCRTIRNRGKLDPILVPD
FT                   SESAPEMLAQILNGEDLILVQGAGNIGKIARKLAEHKLQPQLKDEEHHG"
FT   gene            598428..599348
FT                   /gene="ddl"
FT                   /locus_tag="YPD4_0487"
FT   CDS_pept        598428..599348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddl"
FT                   /locus_tag="YPD4_0487"
FT                   /product="D-alanylalanine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57396"
FT                   /protein_id="ACY57396.1"
FT                   /translation="MAEKVAVLLGGTSAEREVSLLSGQAVLAGLKEAGIDAYGVDTKDF
FT                   PVTQLKEQGFDKVFIALHGRGGEDGTLQGVLEFLQLPYTGSGVMASALTMDKLRTKLVW
FT                   QALGLPISPYVALNRQQFETLSPEELVACVAKLGLPLIVKPSHEGSSVGMSKVDHASEL
FT                   QKALVEAFQHDSDVLIEKWLSGPEFTVAILGDEVLPSIRIQPPGVFYDYDAKYLSDKTQ
FT                   YFCPSGLSDESEQQLAALALQAYHALDCSGWGRVDVMQDRDGHFYLLEVNTSPGMTSHS
FT                   LVPMAARQYGLSFSQLVARILMLAD"
FT   gene            599350..600177
FT                   /gene="ftsQ"
FT                   /locus_tag="YPD4_0488"
FT   CDS_pept        599350..600177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsQ"
FT                   /locus_tag="YPD4_0488"
FT                   /product="cell division protein FtsQ"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57397"
FT                   /protein_id="ACY57397.1"
FT                   /translation="MSQAALNARERAAEKNAARRSNGSQLAGVIFLLMVLGTILWGGWV
FT                   VIGWMKDANRLPLSKLVVTGERHYTTNDDIRQAILALGAPGTFMTQDVNIIQQQIERLP
FT                   WIQQASVRKQWPDELKIHLVEYVPFARWNDLHMIDEQGRSFSVPSERMGKQVLPLLYGP
FT                   EGSERDVLEGYRAINKVLAANKYQLKMVAMSARHSWQLALDNDVRLELGRSDRMGRLQR
FT                   FIELYPMLQQQPDKRVSYIDLRYDTGASVGWAPVFIDNQGGEPPINGQQNSNP"
FT   gene            600270..601460
FT                   /locus_tag="YPD4_0489"
FT   CDS_pept        600270..601460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0489"
FT                   /product="cell division protein FtsA"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57398"
FT                   /protein_id="ACY57398.1"
FT                   /translation="MVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQ
FT                   AELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHR
FT                   ILHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQL
FT                   IFAGLAASYAVLTEDERELGVCVVDIGGGTMDMAVYTGGALRHTKVIPYAGNVVTSDIA
FT                   YAFGTPPTDAEAIKVRHGCALGSIVSKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTE
FT                   LLNLVNDEILQLQEQLRQQGVKHHLAAGIVLTGGAAQIDGLAECAQRVFHAQVRIGQPL
FT                   NITGLTDYAQEPYYSTAVGLLHYGKESHLSGESEVEKRASVGNWFKRINSWLRKEF"
FT   gene            601533..602684
FT                   /gene="ftsZ"
FT                   /locus_tag="YPD4_0490"
FT   CDS_pept        601533..602684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsZ"
FT                   /locus_tag="YPD4_0490"
FT                   /product="cell division protein FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57399"
FT                   /protein_id="ACY57399.1"
FT                   /translation="MFEPMELTNDAVIKVIGVGGGGGNAVEHMVRERIEGVEFFAVNTD
FT                   AQALRKTAVGQTIQIGSGITKGLGAGANPEVGRNSAEEDREALRAALDGADMVFIAAGM
FT                   GGGTGTGAAPVVAEVAKELGILTVAVVTKPFNFEGKKRMAFAEQGIAELSKHVDSLITI
FT                   PNDKLLKVLGRGISLLDAFGAANDVLKGAVQGIAELITRPGLMNVDFADVRTVMSEMGY
FT                   AMMGSGVACGEDRAEEAAEMAISSPLLEDIDLSGARGVLVNITAGFDLRLDEFETVGNT
FT                   IRAFASDNATVVIGTSLDPEMNDELRVTVVATGIGMDKRPEITLVTNKKTQPVMDHRYQ
FT                   QHGMSPLPQEVKPAAKVVNDTTAQTNKEPDYLDIPAFLRKQAD"
FT   gene            602769..603704
FT                   /gene="lpxC"
FT                   /locus_tag="YPD4_0491"
FT   CDS_pept        602769..603704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxC"
FT                   /locus_tag="YPD4_0491"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
FT                   deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57400"
FT                   /protein_id="ACY57400.1"
FT                   /translation="MRDKMMIKQRTLKRIVQATGVGLHTGKKVTLTMRPAPANTGVIYR
FT                   RTDLNPPVDFPADAKSVRDTMLCTCLVNEHDVRISTVEHLNAALAGLGIDNIIIEVNAP
FT                   EVPIMDGSASPFVYLLLDAGIEELNSAKKFLRLKETVRVEDGDKWAELSPFNGFRLDFT
FT                   IDFNHPAIDSSTQRYCLDFSADSFVRQISRARTFGFMRDIEYLQSRGLCLGGSFDCAIV
FT                   VDDYRVLNEDGLRFEDEFVRHKMLDAIGDLFMCGHNIIGAFTAYKSGHALNNKLLQAVL
FT                   AKQEAWEFVTFQDEAEMPLAFKAPSTVLAY"
FT   gene            complement(603871..604395)
FT                   /locus_tag="YPD4_0492"
FT   CDS_pept        complement(603871..604395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0492"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57401"
FT                   /protein_id="ACY57401.1"
FT                   /translation="MRENRPQLLDVLFDDAVAAENGPLHNVQQRATALLKLNRAVKGLL
FT                   PSQLQPWCRVANYRQSVLVLETANASWLMRLRYEQPALLSALRAQILPSLSSIDIRINP
FT                   SLMAKGHNVTQDAAKSPQDRVKSPPVRHLSLESAKELRGLASRSPEKLRVILERLAALA
FT                   GEGANATKRDK"
FT   gene            604424..604957
FT                   /locus_tag="YPD4_0493"
FT   CDS_pept        604424..604957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0493"
FT                   /product="SecA regulator SecM"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57402"
FT                   /protein_id="ACY57402.1"
FT                   /translation="MIGILNRWRQFGRRYFWPHLLLGMVAASLGVPLNLSGVPDHAALA
FT                   NTSSSQSRQNHGTTNFNSLALLHDIHRRLSFSVDYWQQHALRTVIRHLSFALAPQAAYA
FT                   RVQEVAETERVAPSKIQQLALLDTLNALLTHEFKPPAIIRYTEQVERPVLSPYKPGLWL
FT                   AQVQGIRAGPANLS"
FT   gene            605035..607749
FT                   /gene="secA"
FT                   /locus_tag="YPD4_0494"
FT   CDS_pept        605035..607749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="YPD4_0494"
FT                   /product="translocase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57403"
FT                   /protein_id="ACY57403.1"
FT                   /translation="MLIKLLTKVFGSRNDRTLRRMQKVVDVINRMEPDIEKLTDTELRA
FT                   KTDEFRERLAKGEVLENLIPEAFAVVREASKRVFGMRHFDVQLLGGMVLNERCIAEMRT
FT                   GEGKTLTATLPAYLNALSGRGVHVVTVNDYLAQRDAENNRPLFEFLGLSIGINLPNMTA
FT                   PAKRAAYAADITYGTNNEFGFDYLRDNMAFSPEERVQRQLHYALVDEVDSILIDEARTP
FT                   LIISGPAEDSSEMYIRVNKLIPKLIRQEKEDSDSFQGEGHFSVDEKSRQVHLTERGLIL
FT                   IEQMLVEAGIMDEGESLYSPANIMLMHHVTAALRAHVLFTRDVDYIVKDGEVIIVDEHT
FT                   GRTMQGRRWSDGLHQAVEAKEGVEIQNENQTLASITFQNYFRLYEKLAGMTGTADTEAF
FT                   EFSSIYKLDTIVVPTNRPMIRKDLADLVYMTEQEKIGAIIEDIRERTANGQPVLVGTIS
FT                   IEKSEVVSAELTKAGIEHKVLNAKFHAMEAEIVSQAGQPGAVTIATNMAGRGTDIVLGG
FT                   SWQSEIAALEDPTEEQIAAIKAAWQIRHDAVLASGGLHIIGTERHESRRIDNQLRGRAG
FT                   RQGDAGSSRFYLSMEDALMRIFASDRVSGMMRKLGMKPGEAIEHPWVTKAIANAQRKVE
FT                   SRNFDIRKQLLEYDDVANDQRRAIYSQRNELLDVSDVSETINSIREDVFKTTIDSYIPT
FT                   QSLEEMWDIEGLEQRLKNDFDLDMPIAKWLEDEPQLHEETLRERILQQAIETYQRKEEV
FT                   VGIEMMRNFEKGVMLQTLDSLWKEHLAAMDYLRQGIHLRGYAQKDPKQEYKRESFAMFA
FT                   AMLESLKYEVISVLSKVQVRMPEEVEALEVQRREEAERLARQQQLSHQTDNSALMSEEE
FT                   VKVANSLERKVGRNDPCPCGSGKKYKQCHGRLQ"
FT   gene            608044..608430
FT                   /locus_tag="YPD4_0495"
FT   CDS_pept        608044..608430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0495"
FT                   /product="mutator protein MutT"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57404"
FT                   /protein_id="ACY57404.1"
FT                   /translation="MKHLQIAVGIIRNSQQEIFITQRAADSHMAGFWEFPGGKIEQGET
FT                   PEIALKRELLEETGIVVQQATLLTMLEHTFSDRIVTLHFYRVEVWDGEPFGREGQPMRW
FT                   VLQSELRADEFPPANAAIIELLTK"
FT   gene            complement(608692..609471)
FT                   /locus_tag="YPD4_0496"
FT   CDS_pept        complement(608692..609471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0496"
FT                   /product="insertion sequence IS100, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57405"
FT                   /protein_id="ACY57405.1"
FT                   /translation="MMELQHQRLMALAGQLQLESLISAAPALSQQAVDQEWSYMDFLEH
FT                   LLHEEKLARHQRKQAMYTRMAAFPAVKTFEEYDFTFATGAPQKQLQSLRSLSFIERNEN
FT                   IVLLGPSGVGKTHLAIAMGYEAVRAGIKVRFTTAADLLLQLSTAQRQGRYKTTLQRGVM
FT                   APRLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQTFAGDAALTS
FT                   AMLDRILHHSHVVQIKGESYRLRQKRKAGVIAEANPE"
FT   gene            complement(609471..610493)
FT                   /locus_tag="YPD4_0497"
FT   CDS_pept        complement(609471..610493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0497"
FT                   /product="transposase for insertion sequence IS100"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57406"
FT                   /protein_id="ACY57406.1"
FT                   /translation="MVTFETVMEIKILHKQGMSSRAIARELGISRNTVKRYLQAKSEPP
FT                   KYTPRPAVASLLDEYRDYIRQRIADAHPYKIPATVIAREIRDQGYRGGMTILRAFIRSL
FT                   SVPQEQEPAVRFETEPGRQMQVDWGTMRNGRSPLHVFVAVLGYSRMLYIEFTDNMRYDT
FT                   LETCHRNAFRFFGGVPREVLYDNMKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFSPRLC
FT                   RPFRAQTKGKVERMVQYTRNSFYIPLMTRLRPMGITVDVETANRHGLRWLHDVANQRKH
FT                   ETIQARPCDRWLEEQQSMLALPPEKKEYDVHLDENLVNFDKHPLHHPLSIYDSFCRGVA
FT                   "
FT   gene            complement(610771..611166)
FT                   /locus_tag="YPD4_0498"
FT   CDS_pept        complement(610771..611166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0498"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57407"
FT                   /protein_id="ACY57407.1"
FT                   /translation="MNKLQDTGLLVARILMPIIFIVAGYGKMGDAYAGTQQYMQAMGVP
FT                   GFFLPLTILLEFGGGLAILFGFLTRTTSLFIAGFTLLTAFIFHTDFTDSTNQLMFMKNL
FT                   SIAGGFLVLAMAGPGGFSIDRLLGKKW"
FT   gene            complement(611751..612146)
FT                   /locus_tag="YPD4_0499"
FT   CDS_pept        complement(611751..612146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0499"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57408"
FT                   /protein_id="ACY57408.1"
FT                   /translation="MAEQPRTQGPAKGVLDTVHRIATIVVGIVETRVRLAVIELEEEKA
FT                   TLVQLLMMAGITLLLTAFGLMSLLVLVIWAIDPAYRLVALGTTTAVLLILALIGVIWTL
FT                   TKVRHSTLLGSTRKQLETDRELLEKDH"
FT   gene            complement(612149..612454)
FT                   /locus_tag="YPD4_0500"
FT   CDS_pept        complement(612149..612454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57409"
FT                   /protein_id="ACY57409.1"
FT                   /translation="MPQDKTSEHLRAELKSLADTLEEVLQSSTDKPKAELDKLRAKAES
FT                   ALKDTRVRLSETSDKIAAQTKEIADKADNYVHDNPWTGVGIGAAVGVVLGVLLSRR"
FT   gene            complement(612609..612989)
FT                   /locus_tag="YPD4_0501"
FT   CDS_pept        complement(612609..612989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0501"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57410"
FT                   /protein_id="ACY57410.1"
FT                   /translation="MLLRRSLLLALPLITFCGFATAASDNECDIKAKEIQQQIDYAKQH
FT                   GNTRRAAGLETALKEVKTHCTEESLQAERQKKIRQKQHNVTERQQELKEAQQKGDAGKI
FT                   AKQQKKLAEAQAELQQAQSQQH"
FT   gene            complement(613216..613605)
FT                   /locus_tag="YPD4_0502"
FT   CDS_pept        complement(613216..613605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0502"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57411"
FT                   /protein_id="ACY57411.1"
FT                   /translation="MINFRGRFGRPLWHYLVLPVVLLLLAVILLTPMIVQTESTLKIRP
FT                   NQQGLSLPDGFYLYQHLNGRGIHIKSIIPENDSLVVSLEFPEQQMQAIEVLQDVLPAGY
FT                   AIVASESKKRHRLLPVFRSNQQNLG"
FT   gene            complement(613602..614300)
FT                   /locus_tag="YPD4_0503"
FT   CDS_pept        complement(613602..614300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0503"
FT                   /product="putative DedA-family membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57412"
FT                   /protein_id="ACY57412.1"
FT                   /translation="MDIIKELLHALWAQDYETLADPSLVWAIYLLLFVILFLENGLLPA
FT                   AFLPGDSLLILVGVLIAKGAMSFPVTLVVLTTAASLGCWVSYIQGRWLGNTKVVQGWLS
FT                   HLPAHYHQRAHNLFHRHGLSALLVGRFLAFVRTLLPTIAGLSGLDNARFQFFNWMSGLL
FT                   WVLILTTMGFAFGKTPVFLRYEDEVMFVLMLLPLALLVIGLFGSLYVLWRKKNATPAKV
FT                   SHDNKKGKSE"
FT   gene            complement(614578..615159)
FT                   /locus_tag="YPD4_0504"
FT   CDS_pept        complement(614578..615159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0504"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57413"
FT                   /protein_id="ACY57413.1"
FT                   /translation="MATLFYLVALGAKRKYMRWLFALFITVSCWASLVSGNMLLPPHST
FT                   PSGAALSALSTVYSDNHCASYSLSSFHALSAKLRLQNQDVSPQLRLVGVSVKKTAIKNR
FT                   LSAAQFTGSANLSLLNNTWPAAYFAISRSHRADDIYKQPRQSLSLVNYSNWIFHAATQQ
FT                   NRVGGWKESNTQYSGMLTYHHYDAMVFMLA"
FT   gene            complement(615360..616154)
FT                   /gene="exuR"
FT                   /locus_tag="YPD4_0505"
FT   CDS_pept        complement(615360..616154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exuR"
FT                   /locus_tag="YPD4_0505"
FT                   /product="exu regulon transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57414"
FT                   /protein_id="ACY57414.1"
FT                   /translation="MEFTETRRLYQQLAAELKRRIEAGVYPVGDKLPAERYISEEMNVS
FT                   RTVVREAIIMLEVEGYVEVRKGSGIHVMSNQQKHLVTNQGIEFDTAGPFELLQARQLIE
FT                   SNIAEFAATQVTRQDIVQLIEIQKHARQEDRFRDSQWDLKFHVQVALATQNTAMATIVE
FT                   KMWSQRTHNPYWIKLHEHIDDVSIESWCEDHDKILEALIRKDPHASKLAMWQHLENTKQ
FT                   MLFRATTDDFEFNVDRYLFTENPVVHLDNLMNNSKVPISSKN"
FT   gene            complement(616417..617721)
FT                   /gene="exuT"
FT                   /locus_tag="YPD4_0506"
FT   CDS_pept        complement(616417..617721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exuT"
FT                   /locus_tag="YPD4_0506"
FT                   /product="ExuT transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57415"
FT                   /protein_id="ACY57415.1"
FT                   /translation="MMRKIKGLRWYMIALVTVGTILGYLTRNAIAVAAPTLQEQLHITT
FT                   QQYSYIIAAYSAAYTLMQPVAGYVLDVMGTKVGYAMFAVMWAIFCMSTALASSWGGLAI
FT                   ARGAVGMAEAAMIPAGLKASSEWFPAKERSIAVGYFNVGSSIGGMIAPPLVVWAIVMHS
FT                   WQMAFIITGVLSLIWAIAWLILYKHPKDQKRLSDEEREYILSGQEAQHSTANAKKMSAM
FT                   QIIRNRQFWGIAIPRFLAEPAWGTFNAWIPLFMFKAYGFNLKEIAMFAWMPMLFADVGC
FT                   ILGGYLPPLFQKYFKVNLIVSRKLVVTMGGVLMIGPGTIGLFTSPYAAIALLCIGGFAH
FT                   QALSGALITLSSDVFGRNEVATANGLTGMAAWTASTLFALVVGALADTMGFSPLFAALA
FT                   VFDLLAVVVIWTVLQDRTADEPTNDPVQRPPVGQN"
FT   gene            618466..619875
FT                   /gene="uxaC"
FT                   /locus_tag="YPD4_0507"
FT   CDS_pept        618466..619875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uxaC"
FT                   /locus_tag="YPD4_0507"
FT                   /product="uronate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57416"
FT                   /protein_id="ACY57416.1"
FT                   /translation="MSQFLTEDFLLDTEFARRLYHDYAKDQPIFDYHCHLPPEQIAENY
FT                   RFKNMYDIWLKGDHYKWRAMRTNGVAERLCTGDASDREKFDAWAATVPHTIGNPLYHWT
FT                   HLELRRPFGITGKLLSPATSEEIWQRGNELLAQDPFSARGIMQQMNVKMVGTTDDPIDD
FT                   LRHHKAIAADGSFNIKVLPSWRPDKAFNIEAAGFNDYMQRLEAAADTSISRFADLCVAL
FT                   NKRMDHFAAHGCKVSDHALDVVVYGEADETTLDAILARRLAGNQPSTEEIAQFKTAVLL
FT                   FLSGEYHRREWVQQYHIGALRNNNSRMFNLVGPDIGFDSINDQPLAQPLSRLLDAQGLR
FT                   NALPKTILYCLNPRDNEVIGTMVGNFQGEGEAGKMQFGSGWWFNDQKDGMQRQMTQLAQ
FT                   LGLLSRFVGMLTDSRSFLSYTRHEYFRRILCQMIGRWVADGEAPADIALLGAMVKNICF
FT                   DNAQQYFAIEL"
FT   gene            620074..621525
FT                   /gene="uxaB"
FT                   /locus_tag="YPD4_0508"
FT   CDS_pept        620074..621525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uxaB"
FT                   /locus_tag="YPD4_0508"
FT                   /product="tagaturonate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57417"
FT                   /protein_id="ACY57417.1"
FT                   /translation="MQTLNRRDFPGRSHPDKIIQFGEGNFLRAFVDWQIDLLNEHTDLN
FT                   AGIVVIRPIDTDFPPSLSTQDGLYTAVIRGLNEQGEAVRESRLIRSVNREINIYRQFDD
FT                   YLALARDANIRFMFSNTTEAGIAWNEADQFSDAPPSSFPAKLTRLLFERFEHFDGAADK
FT                   GWVLLPCELIDYNGEALRELVLRYASHWQLPAAFTHWLTENNTFCSTLVDRIVTGYPRD
FT                   EVAALQTELGYQDSFLDTAEYFYLFVIQGPQGLAQELRLDQLDLNVRIVDDIKPYKERK
FT                   VAILNGAHTALVPVAYLSGLDTVGQTMDDAQISRFVEKTITEEIVPVLDLPEDELLSFS
FT                   QAVLSRFRNPFIQHQLLSIALNGMTKFRTRILPQLLTYQQQKGQLPPRLTFALAALIAF
FT                   YRGEREGQTYPLQDDAHWLERYSTLWNGVKHGDIALAELVNRVLSDANHWGQDLTAVPQ
FT                   LANQVTEQLQTILSRGMRAAVAAYS"
FT   gene            621536..622936
FT                   /locus_tag="YPD4_0509"
FT   CDS_pept        621536..622936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0509"
FT                   /product="altronate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57418"
FT                   /protein_id="ACY57418.1"
FT                   /translation="MQNIIKIHPLDNVAVALQDLAADERIESGEFSVKLAQPVVRGHKF
FT                   ALTAIELGQMIVKYGLPIGHALTLIQPGEHIHSQNAKTNLSDLDEYEYQPEFSSLPPQM
FT                   ADRDVQIYRRPKGDVGIRNELWIIPTVGCVNGIARQIQQRFLKETQDAEGIDGVYLFSH
FT                   PFGCSQLGQDHENTRTMLQNMVRHPNAGAVLVIGLGCENNQVDVFQTTLGKVDEERVRF
FT                   MVCQQHDDEVEAGLEHLHALYQVMRHDRREPGQLSELKFGLECGGSDGLSGITANPLLG
FT                   RFSDYVITNGGTSVLTEVPEMFGAERILMSRCRDEATFEKTVSMVNDFKQYFIAHDQPI
FT                   YENPSPGNKAGGITTLEEKSLGCTQKAGQSQVVDVLKYGERLQRPGLNLLSAPGNDAVA
FT                   TSALAGAGCHMVLFSTGRGTPYGGFVPTVKLATNSELAAKKPHWIDFDAGKLIHGTSMD
FT                   TLLNEFVI"
FT   gene            623178..623708
FT                   /locus_tag="YPD4_0510"
FT   CDS_pept        623178..623708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57419"
FT                   /protein_id="ACY57419.1"
FT                   /translation="MTFYWFAQAVGVLAFFVGITMFFNRDERRFKQQLSVYSAIIGCHF
FT                   FLMGASAAGSSALLNSLRTLISTKTRSSRVMVVFIILTLALGIWRMQHAVEILPIFGTV
FT                   ISTWALFRTSGLTTRSVMWISTACWFIHNVWLGSIGGSLIEGSFLLLNGFNIIRFRRLQ
FT                   LQGIDPFEIEKKA"
FT   gene            complement(623826..624335)
FT                   /locus_tag="YPD4_0511"
FT   CDS_pept        complement(623826..624335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0511"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57420"
FT                   /protein_id="ACY57420.1"
FT                   /translation="MRSGNCKCSTRNQKGVPMRDEKSLAHTRWNCKYHIVFAPKYRRQV
FT                   FYREKRRAIGSILRKLCEWKNVNILEAEYCVDHIHMLLEIPPKMSVSGFMGYLKGKSSL
FT                   MLYEQFGDLKFKYRNREFWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGS
FT                   PFTGRK"
FT   gene            complement(624537..625691)
FT                   /gene="sstT"
FT                   /locus_tag="YPD4_0512"
FT   CDS_pept        complement(624537..625691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sstT"
FT                   /locus_tag="YPD4_0512"
FT                   /product="sodium/serine (threonine) transporter"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57421"
FT                   /protein_id="ACY57421.1"
FT                   /translation="MKQILIGLVAGIVLALVSTPAAIAVGLLGSLFVGALKAVAPVLVL
FT                   MLVIASIANHKKGQKTSIRPILFLYVLGTFSAALVAVVVSFIYPSTLILVAESADITPP
FT                   SGIVEVLHGLLNSIIANPIHALLNANYIGILAWAVGLGIALRHAADTTKALINDMSDAV
FT                   TLVVRVVIRFAPLGIFGLVASTIAATGFGALQLYAQLLVVLIGCMLLVALVVNPLIVYW
FT                   KIRRNPYPLVFACLRESGVTAFFTRSSAANIPVNMEMCKKMNLNEDTYSISIPLGATIN
FT                   MAGAAITITVLTLAAVHTLGITVDLPTALLLSVVAAHLCLWCIRCCRWLSVTDPTGLQH
FT                   VRHSKRCGNASGWCWLHYRRIAGFSRNCTELFNRCVVYCSGLSG"
FT   gene            complement(626277..627272)
FT                   /locus_tag="YPD4_0513"
FT   CDS_pept        complement(626277..627272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0513"
FT                   /product="putative MocA-family oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57422"
FT                   /protein_id="ACY57422.1"
FT                   /translation="MIRFAVIGTNWITARFVDAAHESGKMKLVAVYSRKLDQAQTFGDD
FT                   YHVTDCFDNLEALAASDLIDAVYIASPNALHYSQAKLFLSHKKHVICEKSLASNLAEVE
FT                   SLIACAHQHQVVLFEAFKTAYLPNFIQLQQALPRVGKLRKAFINFCQYSSRYQRYLNGE
FT                   NPNTFNPAFSNGSIMDIGYYCLASALALWGEPKSVWASASLLPSGVDAHGTVSLNYGDF
FT                   DVIIIHSKVSQSDIPSEIQGEDGSLVIESISECLSVAFTPRGSHSQDLTQPQHINTMLY
FT                   EAEAFARLVENNRVDHDGLHLSLLTSRIQTEIRRQTGVIFPADTQYPAAS"
FT   gene            complement(627475..627984)
FT                   /locus_tag="YPD4_0514"
FT   CDS_pept        complement(627475..627984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0514"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57423"
FT                   /protein_id="ACY57423.1"
FT                   /translation="MSVLTYLQGYPEHLQTQVRQLITEQRLGNVLRQRYPQPHDYNTDK
FT                   TLYHYTIELKNQYLRNAQPLSKVAYDNKIQVMKHALGLHTAISRVQGGKLKSKAEIRVA
FT                   TVFKNAPEAFLKMIVVHELAHLKEKDHNKAFYNLCCHMEPQYHQLEFDTRLYLTHLDLF
FT                   GSIYAY"
FT   gene            complement(628223..631036)
FT                   /locus_tag="YPD4_0515"
FT   CDS_pept        complement(628223..631036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0515"
FT                   /product="putative autotransporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57424"
FT                   /protein_id="ACY57424.1"
FT                   /translation="MGKSILNKKQSAVNAIINEGNSLVLTDSASAEHTAVNTGSIFTLK
FT                   EDSTADITSVTGGFFSLSGSSKANINTVLSGGWLEVNDDASITETTISSDIEKKSTVRL
FT                   YQDGSATKTTVGDNGILYVSGDSRAEETHVTKGGKLIVYSESQGPTLKNTQIAGTLTLK
FT                   SDVTLEGKTEFVSSATIKTTGHLIDNQGQLIFNSDKDIVIEAMIDGQGSLTKENPLTTL
FT                   TLSSAGDAWVASYVYSGETHINAGNLKLANTHFFGSPISGNPNTRLILEKSTLDTTVQG
FT                   SSVFIDKHSIWNMLGDSNIHHLDILDSGRHDLNNPGKTGNQLIINGDYFSDNGTLIFHS
FT                   QLAGDDSVTDHILIKGNTGGHTNVRVINVNGEGNKTDSGIQLIEVRGISDGEFSQVGRI
FT                   TAGAYEYRLGRGKDELSKNWYLSSDITDYSSDGVPEAELPGILVLKSDNAAVFSAKLAD
FT                   YALQAVGGVVDSFTQPETSPPSNTPELTVPDPKRANAAAFSAKLADYALQTVGGVVDSF
FT                   TQPETSPPSNTPELTVPDPKRANAEAFSAKLADYALQAVGGVVDTFTSPEQTEQTTATP
FT                   DSTPKSTDSAVKPASTPKPTDLAVKPANTVISNAKTAAPKRQTLVHTPENGSYIANIAM
FT                   ARNLFTTRLEDRTSHYLYKDIVTGQWQPTSMWMHTQGGRSQFGHTVEQLNIKGNYYSVQ
FT                   LGGDIAQWATNEQGSGRIGMLAGLGKATNHSHSKVTSYHSRGAVDGYNLGIYATWFADQ
FT                   QHNTGVYIDTLAQYSWFNNAVNGQDKAEEKYKSSGFTTSIESGYTFNLANSDQLSYFIQ
FT                   PNAQITWAGINAQTHKTADGAVVSYRNNGHFITRIGAKAYLQTHDTLNTKFTPFVAVNW
FT                   IHQNQNTGTTISGQGIDNKIQNSTEFNVGVESQIDQQLHIWANINHQIGRYNYTDTNAL
FT                   VGVKYHF"
FT   gene            631676..632863
FT                   /locus_tag="YPD4_0516"
FT   CDS_pept        631676..632863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0516"
FT                   /product="putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57425"
FT                   /protein_id="ACY57425.1"
FT                   /translation="MSQLDLGTQSLELERFPPQENSNTLQAWEAADEYLLQNIDLSQID
FT                   GRPVLVFNDQFGTLACALHAYRPFSSSDSYMSQLATAHNLRLNHLDESAVTLLSSVDDL
FT                   PEAPKLVVIKIPKALALLEHQLRALRRVVAPDTVIIAGAKSRDVHNSTLQLFEKILGPT
FT                   KTTLAWKKARLIHCEVADIPLADAPETIDWPLPNTDYIIHNHANVFSRNNLDIGARFFM
FT                   EILPYDVTGKIADLGCGNGVVGLIALEQNPLAEMLFVDESYMAVASSELNITVNRPQDL
FT                   SRCEFMVSHGLAGVERESLQLVLCNPPFHQQHAVSDHVAWQMFCDAKRCLKAGGELMIV
FT                   GNRHLDYFHKLKRLFGNCETLDSNQKFMVLKSVKQASSRSEGGGSGSLDMSYSDF"
FT   gene            complement(632979..635000)
FT                   /gene="fadH"
FT                   /locus_tag="YPD4_0517"
FT   CDS_pept        complement(632979..635000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadH"
FT                   /locus_tag="YPD4_0517"
FT                   /product="2,4-dienoyl-CoA reductase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57426"
FT                   /protein_id="ACY57426.1"
FT                   /translation="MLAYPHLFTPLDLGFTTLKNRILMGSMHTGLEELPDGPQRLAAFY
FT                   AERAAGGVGLIVTGGIAPNMKGGVYQGASVLNDAAQIPHHQVVTEAVHQAGGKIALQIL
FT                   HAGRYSYQKHPVAPSALQAPINPFVPQALSHEEILQTIADFAHCAQLAKQAGYDGVEIM
FT                   GSEGYLINQFLTARTNQRDDEWGGDFTHRMRFAVEIVRAVRQATGHDFILIYRLSMLDL
FT                   VEEGSNWVEIEQLAQAVEQAGATVINTGIGWHEARIPTIATMVPRAGFSWVTRKLMGKV
FT                   NIPLITTNRINDPAVAEQVLADGCADMVSMARPFLADAAFVQKAAQGRADEINTCIGCN
FT                   QACLDQIFDGKLTSCLVNPRACRETEMPELPTDAPKRLAVVGAGPAGLAFAVTAARRGH
FT                   QVTLFDAAAEIGGQFNIAKQIPGKEEFYETLRYFRRQLVLNGVTLQLNTLVQVKQLAEF
FT                   DEVILACGIQPRLPCINGIDHPKVLTYLDVLRDKKPVGQRVAIIGAGGIGFDTAEYLSQ
FT                   SGDSPRFDSTAFSTEWGIDQDLAHRGGLSPAGAKVPPSPRQIFLLQRKASKVGEGLGKT
FT                   TGWIHRTSLAMRGVKMLNSVSYEAIDDKGLHIIRAEQACCLPVDTIIICAGQEPRRELH
FT                   QPLLDMGKTVYLIGGADKAVELDARRAIDQGTRLALAI"
FT   gene            complement(635213..635782)
FT                   /locus_tag="YPD4_0518"
FT   CDS_pept        complement(635213..635782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0518"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57427"
FT                   /protein_id="ACY57427.1"
FT                   /translation="MLNIDQKYLTNLDESALKKQRIFMRIVAVLLLLGGIFCLINPLAS
FT                   GAALSMVIGILLLLSGIAMIVGMIANRSDNFWPMVAGILLGVAYIVMGYVFITNPAIGM
FT                   ISLAVVLAVLFAFGGVLRLINGFKDLKRPGAWLQILLGVLDLVITYLLVSAGPLMSITM
FT                   VTTLVGIEMLFSSFSCFMVASLFKRS"
FT   gene            complement(636173..637672)
FT                   /locus_tag="YPD4_0519"
FT   CDS_pept        complement(636173..637672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0519"
FT                   /product="kinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57428"
FT                   /protein_id="ACY57428.1"
FT                   /translation="MANIVTCTTKDGETIQYVDEIIGSGSMKDVYFSPDKSYVVAFYKK
FT                   PQNDQAKERIDMITGRYRQNIFEQSGGEYWKDLFCWPTHVVEHNGKIGIVVPSYQNHFF
FT                   FKYGSKNNDFLGIKGREKEGKWFASANNQNKFLDPRERGNILNYLKVCLLLTRAVRRMH
FT                   AAGLCHSDLSYKNVLIDPEQGHACIIDVDGLVVPGKFPPDVVGTPDFIAPEVVKTSHLL
FT                   KEDPQRILPNITTDRHALSVLIYMYLFYRHPLRGGKIHDMDDEVRDESLAMGERALFIE
FT                   HPTDRSNAVKLNQVKPSSLLWADPQKVPYTIMGPYLTQLFEKAFIDGLHDPSKRPTADE
FT                   WETALVKTVDLIQPCQNTACEQKWYVFSGKTKPVCPYCGTAFKGKLPILNLYSSRKAGS
FT                   YRPDDHRLMVWNGQSLYAWHVNRLIAPNERTSEAQKKRVGYFVFHNDQWWLVNEGITGL
FT                   MSLPDKKTIGIGEKLALTDGAQLVLSTEEGGRLVVVQLVAN"
FT   gene            complement(637704..639437)
FT                   /locus_tag="YPD4_0520"
FT   CDS_pept        complement(637704..639437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57429"
FT                   /protein_id="ACY57429.1"
FT                   /translation="MDINDNLHQDDLRQDDVYQKVLRLLLDEAGIVLPETELVALKQDT
FT                   AIRSLLNDLLASVSAKAEHLALANNETAIDDRQPLVSLSEEKSHEVIGSEENIVKEPDQ
FT                   HNERLLLAETLSAKTLEPNPPADVLPPIEIHHKVPVEEESWQAMLFSPIEQHANTASSA
FT                   AGTKLLRPGQIPVGMPNPANCPPQYTQPKAKINIANARVGTPFHSDVDISLDNGAKAEI
FT                   LDLSFAKDIGLIFDQATSSLSGTPTESGDIEATVTWSCHSAPYFSTKVLFIVNPDPRSL
FT                   WKILEPPADDHYFKENVDHKLISAPGVNIAAASRRGRSHEHVGSFRDDDFFISSNHDTG
FT                   WNIMLVADGAGSAKNSRKGSQIVTETVGHYLSAQLSGDKGRELKERIINWTPEDQRVVG
FT                   ETFIRQFHHASVIAINNIKNESLIAEETVKSYSTTLLATVSFRTGTELFAAAFWMGDGA
FT                   IAAYGPVGRVRILGTPDSGEYAGQTRFLDVDAVGDPEFSKRVSIGKWTGISHLVLMTDG
FT                   VSDPRFETDNGLQNPQKWDALIAEISPCLNDNPQAAEQLAEWLNFFSPGNHDDRTMVVS
FT                   W"
FT   gene            complement(639493..640431)
FT                   /locus_tag="YPD4_0521"
FT   CDS_pept        complement(639493..640431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0521"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57430"
FT                   /protein_id="ACY57430.1"
FT                   /translation="MIGENLKKMNDGLQMIINDLKKDPHALETAWISVIAFAGVAKTIV
FT                   PLVEVVSFYPPRLPIGGGTSLGAALQELTRQIDTQVRKTTEERKGDWKPVVYLLTDGRP
FT                   TDDTTAEITRWKTHYARKVNLIAIGLGPSADLNILRQLTENVLLFNDTQEGDFTQFIKW
FT                   ITASVSAHSRSVGEESPPLLNQTDYIVKLAKDDVARAYDENCVTLIGRCSKSRRPYIIK
FT                   YERPAVNLSSLNFKLNINGFNLAGCLPIDEDYFAWSDESVSSQQVNTSDCMAHLVAHIA
FT                   ATAVHLPCVTAVNCSVSMARMMLSARGVIEG"
FT   gene            complement(640578..641195)
FT                   /locus_tag="YPD4_0522"
FT   CDS_pept        complement(640578..641195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0522"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57431"
FT                   /protein_id="ACY57431.1"
FT                   /translation="MLIDTSGSMRGESIHAVNVGIQAMMSALRQDPYALESVHLSIITY
FT                   DNQAREYIPLTALENFQFTDITVPSAGGTFTGAALECLIHCVDRDIQRSDGDQKGDWRP
FT                   LVFLMTDSTPSDVYAYGEAIKEVKKRAFGSIIACAVGAKAKHEHLKQLTSQVVALETLD
FT                   STAFSGFFKWVSASVAAGSSSAGINTGQDNLPPPPPEIQLVL"
FT   gene            complement(641218..641859)
FT                   /gene="terX"
FT                   /locus_tag="YPD4_0523"
FT   CDS_pept        complement(641218..641859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="terX"
FT                   /locus_tag="YPD4_0523"
FT                   /product="putative tellurium resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57432"
FT                   /protein_id="ACY57432.1"
FT                   /translation="MSVSLHKGQGVSLRKNEYDLSSVTIGLGWDINEEKKGILGSLFGK
FT                   KEEEYDLDVIAFLCNAQGKVTDLGNVENGKPSLVNGDIIFFNSLRHKSGQIWLTGDNRT
FT                   GAGDGDDEQIIVKLNTLDPKYEKIVFIVQIYNGSKLQQHFGKVQNAFIRAVDAKNIEMA
FT                   RFNLSGGPAFNQQCSMLFAELVRESTGWKLNAIGEPSDSDTFVTHLKNYL"
FT   gene            complement(641892..642530)
FT                   /gene="terY"
FT                   /locus_tag="YPD4_0524"
FT   CDS_pept        complement(641892..642530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="terY"
FT                   /locus_tag="YPD4_0524"
FT                   /product="putative tellurium resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57433"
FT                   /protein_id="ACY57433.1"
FT                   /translation="MRRLPVYLLLDTSGSMTGEPIEAVKNGVQMLLSTLRQDPYALETA
FT                   YVSVITFDSSARQAVPLTDLLNFKLPELVANGTTALGDALSLTAKCIGNEVQKTTADTK
FT                   GDWRPLVFIMTDGSPTDDWRKGLSDFKAARTGVVVACAAGHAVETKVLQEITEIVLQLD
FT                   TADSSSIKAFFKWVSASISVGSQKVESGKKEVIGLDDLPPPPPEVNVVL"
FT   gene            643245..644933
FT                   /locus_tag="YPD4_0525"
FT   CDS_pept        643245..644933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0525"
FT                   /product="putative hemolysin activator protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57434"
FT                   /protein_id="ACY57434.1"
FT                   /translation="MSRFYYSILVAGVLLKIVAIPDASYGAELAPVQQSIHQQERQRAL
FT                   EERLAPPTPDVRLSAPSAFFSRIIFPLETPCFVINRIKISGAEPLPRWLPLQRIADQAQ
FT                   GQCLGAKGINLLMSQMQNRLVDHGYVTTRVLAPQQDLNSGTLALNVVPGKIRGVELTPD
FT                   SNRYVTLFSAFPARAGTLLDLRDIEQGLENLQRVPTVQANMVLIPGSAPGETDIILNWQ
FT                   QRKMWRLAASLDDSGTRSTGRYQGGATLFLDNPLSLSDLFYVSAGGALQRRGDKGTNNL
FT                   TGHYSLPFGYWTAGMTASRYDYYQAVAGLNGDINYRGESENVAFQLSRLLHRNASQKTT
FT                   FTYDVLTRSSKNYINDTEVEVQRRRTSAWRIGLQHRHFISQAILDAGISYQRGTRWFGA
FT                   IPAQEEYFGEATALSKILRLNAQLDIPFVVMAQNLHYNLQYQRQSTNTPLTPQDQFSIG
FT                   GRWSVRGFNGERTLIADRGWWVRNDIGWYLPLPGHELYVGVDYGEVGGRSGAYLLGRHL
FT                   AGSAVGVRGNVLNTRYDLFAGKPLSKPNGFKTDSLAVGFNLNWLY"
FT   gene            644978..654775
FT                   /locus_tag="YPD4_0526"
FT   CDS_pept        644978..654775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0526"
FT                   /product="putative hemolysin"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57435"
FT                   /protein_id="ACY57435.1"
FT                   /translation="MNKNLYRIVFNQARGMLMVVADIAASGRAASSPSSGVGHTQRRRV
FT                   SALSPLSFRLLIALGCISLSAQAAIVADGSAPGNQQPTIISSANGTPQVNIQTPSSGGV
FT                   SRNAYRQFDVDNRGVILNNGRGVNQTQIAGLVDGNPWLARGEASVILNEVNSRDPSQLN
FT                   GYIEVAGRKAQVVIANPAGITCEGCGFINANRATLTTGQAQLNNGQLTGYDVERGEIVI
FT                   QGKGLDSRGQDHTDLIARSVKVNAGIWANELNITTGRNQVDAAHQNINTNAADGRHRPA
FT                   VAVDVANLGGMYAGKIRLIGTETGVGVHNAGEIGASAGDIVITADGMLVNRGQISSAQQ
FT                   LAVNTPSGIENSGVLYGKGNTQLTTAGKLSNSGTVAAAGDTLIRAAEVNSSRNSVLGAG
FT                   IKSDNSAITRGTLDIKARGQLTAQGKNISGTAQTFNANRIDLSGSQTQSGDLTFTTEGG
FT                   DIDLTGANLFANRRLSVSTPSLLRTDKANLFAEQIALDAQALANVGGVITQTGLTDFNL
FT                   NLPGDIDNRDGTLLTRGNFLLQAEHLTSNSQSLLGAGIQSDGKLAPRGDLNVTTRHALI
FT                   AQGKTLTAGTLALSGSRLDLTDSLTQAKYMRLTATEGDIALTGATVMAANTLFADTRQI
FT                   LRSDKAYLTADQINLTAYSLSNVEGRVVQKGSGDFRLDLPGYLDNRGGVLLTKGNLALQ
FT                   AERLTSNSQSLLGAGIQADGSKASKGDLQANTTQALIAQGQNVAAGTMTLSGSRVDLTG
FT                   SQTHASNITITARDGDVTTREATLITPGTLSMTAVANPEQTLNNRGGKLHADNIQLNLA
FT                   KLENSNGEIAAATDLWLRLQSDFIHQAGARLTAGRDLLFNSRGALINQYKLEAGRDMQL
FT                   TALSIRNTSADRNTNADNSSLLAGRGLSLSTDSLFNRGAIYTTGVGQFTVNGNTENIGE
FT                   IYTEQQLTFTATGNLANRGVMQTRGEMQLSAQGDVNNSGMLYSAGDQMRLSIAGNLTNE
FT                   GKLHVANGEMRLLTEGNLDNRGSLYGAGNSDITTQGNAVNTGSVYTQGALQWLTKGSVR
FT                   NSASIAALGDLQLRANDLLSDNQSLMAAGLKADGSRSDSGNLAVSTEQALIAQGQNIAA
FT                   GSLALAGSQIDLTGSQTQANAISLTAKSGDITLTSAVIKAATQLLVTQLAATRSSFIPP
FT                   SSIPPSSTQSSSTQASASPSAWLRTDKASLIADQLTFDVQALSNLGGVIAQTGATDFNL
FT                   NLPGYLDNRGGTILSKGNVAIQAQGLDSDSGSLLGAGVQSDGKLTNAGDLAVTVRQDLI
FT                   AHGQSLAAGAMTLTGSGVDLTGSQTQARGITITANKGDVSTQRANILSLGSLAINAGAN
FT                   AGQTLNNQGGSLQANNIALNLGQLDNRTGKIAASQDLVLGLQSDFNILADSTLQAGRDF
FT                   SFTTHGALTNDGQLLAGRKLSTRSNSLLNNGNIRAVQADLRASGALTNRGEILTRGGLS
FT                   TDANTLFNSGTLIGATATLNARERITNSGPNALIGATDKNGTLALLAPVIENSDTVTRT
FT                   DTAPTTTLLGMGKVILAGGQDNSGNYSSAAQVLNLSGLIESGNDLLVYAKTLTNRRQIL
FT                   TATTDFIVGDTETGAAYWTAENPDIPGGRYTQPPAGGPMNSDYIGTNYTSTVAYNRIDQ
FT                   ISPEAQLLAGGNLTLQVGTLENNWSKVSAQGVIDLTGVTLQQDDWGSQQRLVEQTTSSG
FT                   EYRYRTYKGKLWGIAWGPEMKLRLNNQYASSITAKTLTGSGTVINNTVINNGAAPGAIV
FT                   APRDRDSTGKNIAVEFNGIALTLPRSGLYQLKTDKGDYAPGPEAALSLANISPPSSLDA
FT                   TGPRGVPPPSDDLNRTGLVTPDRAVSGGYLVETHPAFASLNNWKGSDLYLQQLSSDPSV
FT                   IHKRLGDNAYEQRLLRDQVLALTGRTVASDYRSEQAQFEQLFAAGVQYSKAFNLAPGTR
FT                   LSAEQMATLTGNIVLMENRDVAGQTVLVPVVYLAGVKPGDLRANGALIAAENISLTEVQ
FT                   GFANAGAISASNNLQISMAKDITLNNRCGLLQAGNHLQLSTLNSDIDLTSARLNATNLQ
FT                   LDSGRDVILRTASDQYSSGNGAVQRTQTILGPLASLNISNNAVITAQRDFIQQGAGINI
FT                   GKDLQVNTGGDWLLSTVQRSDQISAQYGGGSATSGSLRHLGSEVKVGGALSANVDNLTA
FT                   VGARVNAGTIDVRAQNITLSAATDSLSVTGGSSSKRHTSSVNLYDETLLGSQLNATGDI
FT                   NLQTVNDITLSASAVQTDGALKLAAGGDVTLTSQTEQHDEQRNHTGTKKGLLSSTTTRS
FT                   EEGRSQTLAVGSMLSAGSIDVSSQNIAVAGSSVVADKDIRLRAQENLTVSTAQQSESGS
FT                   QLFEQKKSGLMSTGGIGVFIGTSRQKTTDQTQTVSHVGSTVGSLTGNVRLEAGNQLTLH
FT                   GSDVVAGKDLALTGADVAISAAENSRSQQYTAESKQRGLTVALSGPVGSAVNTAVTTAK
FT                   AAREENTGRLAGLQGVKAALSGVQAVQAGQLVQAQGGGITEMVGVSVSLGSQKSSSQQQ
FT                   QEQTQVSGSALTAGNNLSIKASGSDILIAGSQLKAGGDTRLDAARDVQLLGAANRQKTD
FT                   GSNSSRGGSVGVSVGGSGLSVFANANKGQGNERGDGTFWTETTVDSGGMFSLRSGRDTA
FT                   LTGAQVSAETVKADVGRNLTLQSQQDRDNYDAKQSRASGGISVPVAGGGAAVNLSMSRD
FT                   RLSSQYDSVQAQTGIFAGSGGVDIRVGEHTQLDGAVIASTAAADKNTLDTGTLGFSDIK
FT                   NKAVFTVEHQGGSLSTGGPVGSDLLSNLGGMVLAGLGNGGYAEGTTQAAVSEGTITVRD
FT                   TENQQQNVDDLSRDTGNANGSIGPIFDKEKEQNRLKEVQLIGEIGGQALDIASTQGKII
FT                   ATHAANDKMKAVKPEDIAAAEKQWEKAHPGKAATAEDINQQIYQTAYNQAFNESGFGTG
FT                   GPVQRGMQAATAAVQGLAGGNMGAALTGASAPYLAGVIKQSTGDNPAANTMAHAVLGAV
FT                   TAYASGNNALAGAAGAATAELMAPTIISALGWDKNTLTEGQKQAVSALSTLAAGLAGGL
FT                   TGDSTADALAGGQAGKNAVENNLLGGNEFTHTQFVQKHGADVLSCADNPSNAACQRGIA
FT                   ENKAYIAALATGSVALLPGSSQAMWALGAGTNAGMQYADNGKINPVNSVAAGWINVITM
FT                   GQGWKGTIAWNAAGGALINAINGGDPLTGAITNGTGAGFGYGVGNYVVKPAANTLGKWI
FT                   TGGWNPKFDPNLLKYAEVKGQLGISKGNVAEQDP"
FT   gene            656134..656889
FT                   /locus_tag="YPD4_0527"
FT   CDS_pept        656134..656889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0527"
FT                   /product="putative hemagglutinin/hemolysin"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57436"
FT                   /protein_id="ACY57436.1"
FT                   /translation="MRRTYKGKLWGIAWGPEMKLRPNNQYASSITAKTLTGSGTVINNT
FT                   VINNGTAPGAIVAPRDRDSTGKNIAVEFNGIALTLPRSGLYQLKTDKGDYAPGPEAALS
FT                   LANISPPSSLDATGPRGVPPPSDDLNRTGLVTPDRAVSGGYLVETHPAFASLNNWKGSD
FT                   LYLQQLSSDPSVIHKRLGDNAYEQRLLRDQVLALTGRTVASDYRSEQAQFEQLFAAGVQ
FT                   YRKAFNLAPGTRLSAEQMATLTGNIVLME"
FT   gene            complement(657385..659670)
FT                   /gene="yapF"
FT                   /locus_tag="YPD4_0528"
FT   CDS_pept        complement(657385..659670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yapF"
FT                   /locus_tag="YPD4_0528"
FT                   /product="putative autotransporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57437"
FT                   /protein_id="ACY57437.1"
FT                   /translation="MNNHKIWRLSAVAVALLISGNSYADQTLHFAQQPHNTGDHTVIAA
FT                   PEVNNFSLADLTANAEGQAVDATNAGALSLRVEPTQGDAQANGVLVTSGTFTNQAQGSI
FT                   TVSASSQDQHAVASGLQATDAYWSTLRNQGSIRATSNSLHGSAEVYGIQAGLAFSDAAG
FT                   DHYGDHMMLSNEGVMQVSATAEQDAFASGIYTNAGNGVVNNGRLDVSAHASAGDARATG
FT                   LHTLSANPGVDPDPWNPANPTHLMSNNGSLSVTASGNNATASAISTEGEGVYIYNNGTL
FT                   IVDAFSESAQGGASAYGIHVLNGSATINSSGRILATATGGSQQQAYEVMADGSVVNIER
FT                   YTLALGNETPWAVSNGGSIVLGNGTQGADLVLMAGQASEGFAYGKEYSLDNLAYDTTSG
FT                   QQSTVGGSIAGLYGITPDIKVIHSGSSSSSLGSAALVYAPDVSHAGVSALAQRSSMEQA
FT                   SNIISSQLHSQLVSNAGCNQKLESADSCVFITPYAGEYRRDPVTSGYSGQRYGVLLGQN
FT                   QHFGDFQLGWHGGYESASTDFNGTSVGRKEEINTLMLGVQGGMKLSESLFIAATSTWFS
FT                   SDTDYSDSNTYYGVGSQSGSYDSSGLYTDVSVGNSWQLNRNYAMTPMVGLTHIWQQRDG
FT                   YTVSSNNKNYDLIDTRYSSYSDHAVALHAGVRLDGRYPLTNETLLKPFFNVGFQQMLYG
FT                   DEITIDQSIPNSPVVGVSTKDKTTQGTFDLGMALVSDNGVSASLQLSGMVNSDRQDFTG
FT                   WANLGWAF"
FT   gene            complement(659730..660725)
FT                   /locus_tag="YPD4_0529"
FT   CDS_pept        complement(659730..660725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0529"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57438"
FT                   /protein_id="ACY57438.1"
FT                   /translation="MKRLLLSALLITPGTLLAADAQELPLLSGGDAPTIKNSNLDLFGV
FT                   SRDFGDIIFIDDDRTVNDSAPKRTRVFTGYEYENIKFSNHPAQLYSTLVFADGSTKITD
FT                   SFSMGYVLRETTIYDGPRNNAFAGSDKSRRDSFMEIQLLPKYINWVNENLSYGAELGYE
FT                   RFTDAKDAPEKQMYHIRPEINLGFGRNFLHLNAELGWIDRTDRGAYIETEPLYLYRVTD
FT                   NFNIGAKAYYHAEDNDYRWRETAIRPLIQYRFANSTYLELRWEIGGIRTHDGSGYNYNN
FT                   YGLYTEIPFNPTISFMADLQYKDQKQHRGNEWSWGDKEDIFAKVGFILNF"
FT   gene            complement(660827..662131)
FT                   /locus_tag="YPD4_0530"
FT   CDS_pept        complement(660827..662131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0530"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57439"
FT                   /protein_id="ACY57439.1"
FT                   /translation="MIDQLKVSEHLYPKGFESEFQNNLDFYRDGVGVDEKAKVPYDTIR
FT                   IEGTEIVKGYYTNTTEVGLYLNILTESVKAGNLQALQRIKETLTTLEQAPKWNGLFYWP
FT                   YDIRDGKLVTNPDEIVPAVDNGNLSFALAGVAGAFLDSSDADKQEIVQRIEAILDGQKP
FT                   GWAALYDENKGLLSSGWSTKNNASLGYFVDRKGNESRAAVAWAVLATKDMGAKALPVSA
FT                   FSKMELYTQRYEINGKQYNPLLTWDGAYFQMMMPQIWLNERELMPNYGIVEDHTFIQKV
FT                   YASKHGIPMVSSSATTDNAYHAFGVPQLSESKVRFKNKIDDGYTGTPHAIALSYIVDPA
FT                   GAISALKKLKQAYPNIESPYGWYDAVDSSGKISKNILSLDVGMFVGAFLAKEINADVEK
FT                   YLQSKGDMELLKEMYQSYVPNNYKPLDGLSSSSLH"
FT   gene            662545..663648
FT                   /locus_tag="YPD4_0531"
FT   CDS_pept        662545..663648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0531"
FT                   /product="transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57440"
FT                   /protein_id="ACY57440.1"
FT                   /translation="MLHNVNKIYPNGMQVLHDINLDIKDGEFMVIVGPSGCAKSTMLRM
FT                   IAGLEEISSGELTIADRKCNDVQPKDRGIAMVFQNYALYPHMTVYENMAFGLKVAKKTK
FT                   AEIAQRVNEAAELLEITDLLQRKPKEMSGGQCQRVALGRAMVRKPAVFLFDEPLSNLDA
FT                   KLRVSMRLRISKLHQQLRESGRPATMIYVTHDQVEAMTMGERVCILRKGKIMQVDRPMN
FT                   VYRHPLNKFVAEFVGSPAMNMFSGRIEEYQEQLVIRCGEYRFPLPADKVAKSRSYLGRE
FT                   IDFGIRPEDISISRADVANALTATVIRVDAMGSDEFIYFNLMGQQAICKRPNPEDEIQI
FT                   NETCHFSFNLDKCHLFDKESEKNILYI"
FT   gene            663797..667084
FT                   /locus_tag="YPD4_0532"
FT   CDS_pept        663797..667084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0532"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57441"
FT                   /protein_id="ACY57441.1"
FT                   /translation="MQGNMLKNMLAGDIMLNLFDTPRLDMAIANIFLRQLDDSGIVRVT
FT                   PLLFHNDQLVTYKNAQDEIIWQTTAPDFTAFVTLSFSHEQEETYYYSVRVENHSAQALR
FT                   YDLIYGQDLSLSDAGATKTNESYCSQYLDHKVFSLDKYGYTVSSRQNLPQSTGNPLLQL
FT                   GSFSPAVGFSTDGYQFFAKQYKFSHLPTIVTEPSLENRNYQYEMAYVALQLQPVTLSAG
FT                   DSADSVFYGFYLSHQPEANIAQAFDVARIRANYRQPQREPATEQASPTQQGYDQRPLSG
FT                   DKLTAEEIEQLFDGEKQFVEQLDGELLSFFYQEANYVTLAEKERHLERPTGHIISSGNN
FT                   IDFTNPIMNSTHYIYGVFNSHLTLGNTSFNKLLGVNRNMLNQFKSSGQRILVQIGGEYR
FT                   ILAMPSAYEVGANFSRWIYKLAEGMIQVRAFASQSEPVIQLDIAVSGHSQPLNVIVSHQ
FT                   LIMGNLEEEATVQVERHGDLLQISRTGDDHGPRFSIATRGGFTGVERYVDSDSQGVQYL
FT                   LLQGQIAQQASIAFGGVLNGVDSRGKWLDFEHERQAYHAQYRALLNDFSVSFSAAPQQA
FT                   QKLNHAMHWFTHNALTHYSSPHGLEQPAGAAWGTRDVSQGPIEFFMAMGRYQQVEAILC
FT                   QTYRHQYLETGTWPQWFMFDEYAQVQQQESHGDIVVWPLKALADYLLATDRVALLDTRL
FT                   SYTSIKQNFAFTGEQETLLQHVQRQIDHIVAHLVPGTYLSSYGDGDWDDTLQPANQSLR
FT                   ENMVSGWTIPLTLQTLKTLTKALQAYPQFADFIARIVTLTSNMEADYHKYLIKDGVISG
FT                   FIHFNQGEAEYLLHPTDTTTQIKYRLLPAKRSIISESFDKEMAEQHMKIIMDNLMYPDG
FT                   VRLMDRMAEYKAGKQTYFKRAELSANLGREIGLQYCHAHIRFIEALCKMGMAQELYDNL
FT                   FKTIPVGIQESVPNAELRQANSYFSSSDAKFDDRYQAYNNFDQLKTGAVAAKAGWRIYS
FT                   SGPGIYINQIVSNVLGVRYQAGDLLLDPVISRQFGDVTLNYQLYNLPVTLRIYPQQGEF
FT                   TPKRVLLDGQSLAFTLQDNPYRSGAALIHRQEIEGRLTAHSQLEIYL"
FT   gene            667193..668179
FT                   /locus_tag="YPD4_0533"
FT   CDS_pept        667193..668179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0533"
FT                   /product="LacI-family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57442"
FT                   /protein_id="ACY57442.1"
FT                   /translation="MSVTIKDVAKRAKVSISTVSYAINGSPKITEETRLRVLKIAQEMN
FT                   YTANNNAKMLKAKKSGAIGLFFNSWFGPVYSELVRGIEERVHREHYDLVACSLYGGEQS
FT                   TAHKYLRDRSVDGAIILTSSFDDRFLQSVASDVLPIVVLDRELKSPHIYNVLIDNFGGA
FT                   FKAVNALLAKGCRDIYFFSGPEQSYDNQKRLDGFIAALGYHNIQLNRDFIIHSNFTEAD
FT                   AYLKMQALIAAGRVPSAIFSANDEMAIGILRAAKEHNIRVPDDLKVVGFDNIYASSVLT
FT                   PSLTTINHHKYEMGVISANTLLRAIKEETNIDAVTLLPTELIERETL"
FT   gene            668328..669500
FT                   /locus_tag="YPD4_0534"
FT   CDS_pept        668328..669500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0534"
FT                   /product="sugar ABC transporter, periplasmic sugar-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57443"
FT                   /protein_id="ACY57443.1"
FT                   /translation="MVPSGSYVSFMRNTVTPEFNKLYPEVNLVVSNDEQLDTRMAAGDN
FT                   PNVYIGVFGYQPAKLAKLGKLAYLDKFPGFAELNERIDPHFLRENFGRTYYIPWNATTQ
FT                   MMIYNKELFAEAGLDPERPPATWDEFLLAAEKISALPPRSDGSKVYGTVFWNDVLSFGS
FT                   WYWNLLAPMYYNVNQGQYQLLNRYGTDIVFDRPDANMAQFMRTMQQAQRFAPLTMEKSF
FT                   FSRNIGMWLQFGFGWKATLSSAAERPMVVGQDVAIAPIPVQTKGDIHYSVLDGRAIMIF
FT                   KDEARKEQLSWALLNLLMRDDINLQANIALGQLPTLKALQDAPYFQSAEAQPFVQQLQH
FT                   AILSEPFANAMEVANIILANYSKVVLKGEISPEQAVATSAQAARQLLNEH"
FT   gene            669554..670435
FT                   /locus_tag="YPD4_0535"
FT   CDS_pept        669554..670435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0535"
FT                   /product="putative permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57444"
FT                   /protein_id="ACY57444.1"
FT                   /translation="MKNKNVMMGYLFIAPWIIYFLVFILYPFFLSFQNSFLDINVLSPE
FT                   STQFVGLNNWISVSSDELFWRSLFNVIFNQVIFVLLSFVLAMGMALLLHEITHFGGLFR
FT                   TIMFIPVITSITVAMIIFNFLSSPAGPVQSLLLEWGVLDAPVFWKFERWLPMPLIAVFS
FT                   TWKWFGIQMIIFLGGIAGISKSLYEAADIDGASWRRKTWSITLPLLKPQIIFVMTMNII
FT                   NGMQMFIEVLMNFDLHGGPYNAALTPVLYLYKTGFSDMKMGTASTIGLLLAAVIYIFTM
FT                   LQLKFTQEKEHS"
FT   gene            670435..671253
FT                   /locus_tag="YPD4_0536"
FT   CDS_pept        670435..671253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0536"
FT                   /product="putative permease"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57445"
FT                   /protein_id="ACY57445.1"
FT                   /translation="MRISKKNLLIYSLLIIISLIVLYPFFFMIMNSFKTGSEIINAPNA
FT                   LPKNFSFNGYIQAFYSLNLGRIFLNTLFISVTVTLVNTLLSAMVAYAIVKMNLPGREFW
FT                   IKLILTSMMVPAVLFTIPTYMMLYSWGWVNTFQALIVPGTISAYNIFLLVQFLKQVDNA
FT                   YLEAARIDGAGEFTIFFKVVLPMIRPALATVAILTFMGSWNDFMGPLLYVRDDSLMTLQ
FT                   LALFKFVNDIPTDNLEQLWAMTTMIAVPVVLVFFFLQRNFIKAFTGIGVK"
FT   gene            671250..671765
FT                   /locus_tag="YPD4_0537"
FT   CDS_pept        671250..671765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0537"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57446"
FT                   /protein_id="ACY57446.1"
FT                   /translation="MMSGKKGFFALVLIILLAYLSAWLMVYQQSKRYFDFAEQRYAAGD
FT                   YILALKGMNKIELYRHDVYSGGYQQVIDDWRHGMLVYRPDFYYQALARSSDLLARASDQ
FT                   QLAEFIATYTEIDTRFVAEAATCLLARYRQRGERASQRTMEEYLAEAFPAHALRTSSQL
FT                   DAGCNTDS"
FT   gene            671816..673999
FT                   /locus_tag="YPD4_0538"
FT   CDS_pept        671816..673999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0538"
FT                   /product="putative glycosyl hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57447"
FT                   /protein_id="ACY57447.1"
FT                   /translation="MSTVYRDATLPIEARIDDLLSQMTLAEKVGQLCQQPMLDYQQHRD
FT                   DYLAGVRAGRWGSRILADTAWAGNAPGENVDPCQLNEIQRAAVEHSRLGIPLLFARDVI
FT                   YGQATVLPIPLAQAASWNPELVQQAYRVIAREAASLGIHWTFAPMLDIARDPRWGRTIE
FT                   TSGEDPWLTAQFAAAVVKGFQGDDLSAADSLMACAKHFVGYAAVEGGRDYDTTELSDNT
FT                   LHNVHLPPFQAAIEAGVGSVMTGFCDFGGTPVTAHGELIRGWLKQQQNFDGLVISDWGS
FT                   IADLTHFGIAQDALRAAELALQAGVDMAMTHEAYEDKLDQLVLQGRIKEALLDDAVRRV
FT                   LRAKFRCGLFERPYVDEEWHKRELRRPEHLALAQRLAEQSIVLLKNRQALLPISRTSVP
FT                   LTLAVIGPHAHSQRQHLGSWCLDGDADQVMSIYQSLCAIAGEVKVITEQSCFSDEMIEC
FT                   AHRADIVILCTGESHRRTGEARNIAELQLPPGQEELIAAVGRTGKPLVVIQCTGRPLPS
FT                   PATEQYADALLYGWQCGSEAGKAIARIIFGEQVPCGKLPMTVPRSTGQIPIYYGRKPLG
FT                   KMRDYREYQPYKDLADTPLYPFGFGLSYTRFTYSDLQLSHESLELGASLRVTMTVTNDG
FT                   AVAGDEVVQCYIRQYVASTTRPQRELKGFQRISLQPGELGEVSFTLGVRELAFYGQHRR
FT                   YAQEPSRISVFVGGDSTTPHQADFTLFENLYTV"
FT   gene            complement(674063..675424)
FT                   /locus_tag="YPD4_0539"
FT   CDS_pept        complement(674063..675424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0539"
FT                   /product="outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57448"
FT                   /protein_id="ACY57448.1"
FT                   /translation="MGGGNFSVPPNPIVAELAQPPTIKSDHAYSLPELIDIAQRQNPDT
FT                   RIAWQQARQAALAVGMGEAIFLPIISASVIGGYQRTTTPLPYAIGNEKDLKTTGSAVIP
FT                   ALALQWLIFDFGQRSALLDAAKQTSYAANVTFNGMHQKLIYDVTRTYFQYGAAQAQSQI
FT                   AKQTLQNSLKIQDAAEERQKKGIATTVEVALARQQVAQSQLRRVVAKGTERDAYQALLG
FT                   AMGVSPSLDIKAAYTEDRALPDGISAPTEKMIQLALSQRPDVLASYAAVEAAKAGIKAT
FT                   EADFLPKVYLAGAVAGGDGHFDIQGLPGISPQTSSSSILVGVSVPLYDGGIRAARVKEA
FT                   ESRAAVAAEGFKKTQELAVREIVVAADTLRSALESNQAALNLVKTSFISYDAALESYRS
FT                   GVGTITVANEAANGLLNAQQMSTDAHAASLVAAANLAFVMGKMTNTSPPLELLH"
FT   gene            complement(675594..677495)
FT                   /locus_tag="YPD4_0540"
FT   CDS_pept        complement(675594..677495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57449"
FT                   /protein_id="ACY57449.1"
FT                   /translation="MTTVADGTLGGIIRQAKADLAFFPGRVAMAWRVAVLCALMAMIAM
FT                   IYGIPESAISCYLIIFVMKPDGVESMVMAVAITILVSLVVGLVFLLIHFTLEAAPLRMA
FT                   ALIVSSFLFLYLGSASKLGPVGSIIALVIAYVMTLLSNIPMGEVATRGLLYAWLMAVSP
FT                   MLLIIGFNLFFGRAPQTLLRASLAERLSTVAETLRYPNAANMARVGEQLQEGQHEHQQR
FT                   ALFVRIFHLRPSAEAAWLESAVKSSYRLLLVTSALPPTSPEAVRLELAAYCSDAAQAIA
FT                   SGDLAAPPHFAIEDTSDEINEIRNALIALANADNGQDLDAPKSSFFAADALTNPVHQQF
FT                   ALKTTAAALICYLIYTALDWQDIHTAMITCYVAALGTTGETVHKLVLRIIGCLIGALMG
FT                   VLSIIFIIPHMSDIGQLMALVFGCILVAAWVSCGSERIAYAGVQVGLAFLLTVLQGFGP
FT                   STDMGVALDRVLGILLGNLVVYLIFSRLWPVAITDAVHVHISRALKGLTNLAALSPDAR
FT                   PAALREATTVEAEITKAQEELALIPFEPVQFRPSRKECARLQAILAEMGKLCPVLFLPT
FT                   EKSASDVEQLRQLSAGSDAMTLSDEQGQNSGSLRQELSPINLTIQQRIKRLEELLGI"
FT   gene            complement(677479..678528)
FT                   /locus_tag="YPD4_0541"
FT   CDS_pept        complement(677479..678528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0541"
FT                   /product="putative HlyD family secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57450"
FT                   /protein_id="ACY57450.1"
FT                   /translation="MNKQQGSGRKRQLALIVAGVIIIAAAISGWLSVRQTTLNPLSEDA
FT                   ELGASVVHIASSVPGRIISINVEENSKVRRGDLLFSIEPDLYRLQVEQAQAELKMAEAT
FT                   HDTQQRTVVAERSNAAITNEQIVRAQANLKLATQTLARLQPLRPKGYVTAQQVDDAATA
FT                   KHDAEVSLKQALKQSVAAEALVSSTASSEALVVARRAALAIAERELANTQIHAPNDGRV
FT                   VGLTVSAGEFVAPDQAIFTLINTEHWHASAFFRETELKHIKVGDCATVYVMADRQRAIQ
FT                   GRVEGIGWGVSSEDMLNIPRGLPYVPKSLNWVRVVQRFPVRISLEKPPEDLMRIGATAV
FT                   VIVRNDDGC"
FT   gene            679836..681068
FT                   /locus_tag="YPD4_0542"
FT   CDS_pept        679836..681068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0542"
FT                   /product="putative aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57451"
FT                   /protein_id="ACY57451.1"
FT                   /translation="MNTIRRKMRPEFQGLQGGLFSSVKKADVGTAVLDLMANGVDMLCW
FT                   ADPFFPDPVLPEHISQAVIKSMENGSASHYTMPIGNPELKEKIALKLQRYNNLTVEAQR
FT                   NILITPGSDSGLLFAMMPFINNDDEVLIHSPSYPSNFLNVELLGGKPISVELKAENNFQ
FT                   IDIKDFENKITEKTKMVILTNPNNPTGTVLRRESLQAIADFIIAHDLILVVDQAFEDAI
FT                   FDEIEFISIASLPGMWERTVSVFSFSKGMGLSGFRVGYLVADAQIVDVLFGCTVNVVGA
FT                   TNTSSQAGMIAALDEPSFMGEYTQIFERRRKVVFEMMNAIPGVCMVMPESGFLSWIDIS
FT                   KLGTSTFICDYLLQHAHVMVNSGVPYGQGGEGYIRLVHGCYKDDEKLYAVLTRIQQALM
FT                   QLAKEKGICHG"
FT   gene            681061..682512
FT                   /locus_tag="YPD4_0543"
FT   CDS_pept        681061..682512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0543"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57452"
FT                   /protein_id="ACY57452.1"
FT                   /translation="MDNEGLIFRGGKNMALLPMLLFIVSCSLFFSVFHVFDMTALAMLA
FT                   FLAIMIGAIFSRNVSHYWKAVISEGIGSEMAVTIATILLIIGMYAKMIAQSGVADSFAL
FT                   LANHLGLHGGAFTLFTFISVCIVATATGTSVGTLFTAFPVFYPSGILLGADPVVLASAI
FT                   LCGAIFGDNIAPISDTTVASSSTQTYKHKPGSAEIAGVVAARFRFAIVSAIIAGALFYF
FT                   LGSNNIPLAESSLVRDSQASYRSLWMLVPMAVLLIVAMKTRNIFKAIPSGILTGIIIGL
FT                   LSGIFNLTDIFALDNGNVTGFLYNGFHEMVSTILFVLSLFGIIGILRASKTMDRISAAI
FT                   CSSRLAQSAQGAEWCIAIGSIIATALVGGVTSASILAFGPVANEIGLRKSLHPYRRAVL
FT                   VDCFAMTLAAIIPFLSAFIFIVSAIISSLQKEYPFIQPVNPIDLSLAAFYPLTLFVVMS
FT                   FSIIVGWGRSFESKDGSLVKSLPLN"
FT   gene            682525..682962
FT                   /locus_tag="YPD4_0544"
FT   CDS_pept        682525..682962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0544"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57453"
FT                   /protein_id="ACY57453.1"
FT                   /translation="MMECITVSDVINVSVEEVWKKISAFDEFSDYHPGAVRSFYLHQAA
FT                   DQQGSIRRVEMSDGYVEELLVNIDPKNYHLEYSILKSSFPLDGYSAEIKLIPVTQDNRT
FT                   FIQWNVSFTTTHPSPEALVAEIKNNVLIAGINGLNDYFSKS"
FT   gene            683096..683722
FT                   /locus_tag="YPD4_0545"
FT   CDS_pept        683096..683722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0545"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57454"
FT                   /protein_id="ACY57454.1"
FT                   /translation="MTQDEIIKSWIPMVEFIARTYGENCEVILHDLRDLDKSIVAIKNN
FT                   HITGRQIGGTITDFALKLIHEKSWEERDFIINYKGRIPGKSENIRASTFFIKDEEGEII
FT                   AMLCMNVDLTSLSLAHKIIGNLMFIEEDNKNDEEVLRNTSITDMLHELITDVLKNYPRA
FT                   PSLLIMDEKKEIVKKLNEKGVFYLKGQLLRWRCVLKRQSRQFIVI"
FT   gene            683738..684118
FT                   /locus_tag="YPD4_0546"
FT   CDS_pept        683738..684118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0546"
FT                   /product="putative translational inhibitor protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57455"
FT                   /protein_id="ACY57455.1"
FT                   /translation="MKSVIETKNAPSAIGPYSQAICFNGILYASGQIPINPDTGDLVEN
FT                   DIEKQTRQVLKNIDAVLLQAGTTKDKIVKTTIFITNINNSSQVNDIYADYFKGTIFPAR
FT                   STVEVSALPKGALVEIEVIAGV"
FT   gene            684403..684807
FT                   /locus_tag="YPD4_0547"
FT   CDS_pept        684403..684807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0547"
FT                   /product="putative translational inhibitor protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57456"
FT                   /protein_id="ACY57456.1"
FT                   /translation="MNRRVINPETMYPSVPFGFSHAVEQLSGRTLHIAGQVAWNANGEL
FT                   VGGQDLLAQTQQVLANLKEVLRYAGATPADVVRLRTYVVNHSPANLAAICAQIGAFYEG
FT                   ADPAANSFIGVQALALPELLIEIEATACLG"
FT   gene            complement(685022..685324)
FT                   /locus_tag="YPD4_0548"
FT   CDS_pept        complement(685022..685324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0548"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57457"
FT                   /protein_id="ACY57457.1"
FT                   /translation="MSYILQVDFPYTGPWGNEMTKAMEGLARSIAEEPGLIWKIWTVNE
FT                   TTNEAGGIYLFSDISAAKAYLAMHTARLKSFGIPHVNGKIFLVNEALSQLDRAPI"
FT   gene            complement(685584..686300)
FT                   /locus_tag="YPD4_0549"
FT   CDS_pept        complement(685584..686300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0549"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57458"
FT                   /protein_id="ACY57458.1"
FT                   /translation="MMKCDPVKGTCQLPDFKSTETAVPAIRNGVAVHYIGDPMCSWCWG
FT                   ISPTVSKVMAFCEAEGIEFSMTMGGLRAGGGDPWNTAFKDFLHNEWRHIAQVTGQPFGF
FT                   TLLDAAHFDYDTEPACRAVMTVQLLQTRKNLAPSIALKFFSAIQRKFYVEGKDPKVTDF
FT                   YADICASIGLDFAEFRNLFEYSEARQAVQEAFLRCRQWSVSSFPTLLLESNNKMAPLAT
FT                   GFVTTEQVLSRLRQRI"
FT   gene            686480..687394
FT                   /locus_tag="YPD4_0550"
FT   CDS_pept        686480..687394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0550"
FT                   /product="LysR-family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57459"
FT                   /protein_id="ACY57459.1"
FT                   /translation="MTTFAKVVETGSFTRAADVLALPKARVSQRVSDLERHLGVRLLNR
FT                   TTRSLNLTEDGQAYFAKCQVILQEIDELEGALKGGSVEPRGKLRVEALVSVARWVIAPS
FT                   LHEFQARYPNISVRLGGSDRISHLLDNGIDCAIRGGHLEDSSQIARHVCDVHLGLYAAP
FT                   AYLEAAGAVTHPQELSVHRRISWFTGQRNPFIWSLQSASDAFELPAEEGLLFDDPDVAL
FT                   ASCMAGSGICPGAPFAVESWVRAGALVPVLPHWRFKARPIHIIYPSNRHLSARVRCFVD
FT                   WSLEMMQANTSMRITPWELAERI"
FT   gene            689430..690812
FT                   /locus_tag="YPD4_0551"
FT   CDS_pept        689430..690812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0551"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57460"
FT                   /protein_id="ACY57460.1"
FT                   /translation="MSFNLPGMYLYYLSRDNLAPEEYERIISPHAAWARICREYEFDDS
FT                   HNTSRYLINMREREQRSSPDQPRPGGIREKEKLEKLVFSGDVVMLSDMYGPARLFYING
FT                   EGQLMSTDPHAFRFEGAAKIIKAFDDSVKCRNYQRTGGKPRSTQTRRLKSTTNTIPDRS
FT                   MVTRASDESGRVLSAKWQSVTDSAKTLWEATPFTHDKATTEAARGRIADGAVGTLEGLG
FT                   TLMGPSAQEYMAGAFNPEQAAINKVRQQNQQAAGKAIYDNTKGAVTDAYQRNGLAGAAA
FT                   MVVTASVAELAGTKGLGTVEKVGTLGDVAKLGKAVELEKLEGYLGTYKGQKVLLQNVDV
FT                   VKMDYVRRSTADRNLLRKEFDNGVRKKFLKDIANNPEVVKRLDAFDRSVLAKGVVPDGY
FT                   QVHHKLPLDDSGNNNFDNLVLISTRPEHAAFTTTQKHITKNLTPTGTNIVLWPKPQGII
FT                   YP"
FT   gene            690821..691291
FT                   /locus_tag="YPD4_0552"
FT   CDS_pept        690821..691291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0552"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57461"
FT                   /protein_id="ACY57461.1"
FT                   /translation="MTDIEKAVTTFQAYRAAIGYPKIPPYEGEVIEYDFGRKIESNQPD
FT                   FWTQYHEFLRLSDGLAADGVYFYGIACEGKLIGNRLIDNNDALRDGEMYDESMDGLIAI
FT                   GSSNSDIFVYDTNTHKWESRDRIAIDDINESYDTLAELIDSQLQRINIGDAF"
FT   gene            691318..691773
FT                   /locus_tag="YPD4_0553"
FT   CDS_pept        691318..691773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0553"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57462"
FT                   /protein_id="ACY57462.1"
FT                   /translation="MANLEKAVNEFTRISKSMGYNINPPYTGKLETYDFGRDISPEQPD
FT                   FWKQYGSFLRISNGSFADGCVFYGMSGGEDDAGLIEFNNALNIPDFKDETMTGLIVIGG
FT                   NNTDTFYYDPRTGKWEACDRIGTDRVWESCDSLAELIETQIKMLENG"
FT   gene            692058..692396
FT                   /locus_tag="YPD4_0554"
FT   CDS_pept        692058..692396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0554"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57463"
FT                   /protein_id="ACY57463.1"
FT                   /translation="MGRTTIHDIATFGNYQIGENEEGQPVFQASWKFKDSKDIKPEHLA
FT                   AVAELSTGKDGLKIKLHDPKAAIKQLAGMCGWEAPKKAELTGANGGPIQTSNLTPDEAA
FT                   EAYRKMMG"
FT   gene            complement(692642..692718)
FT                   /locus_tag="YPD4_t6"
FT   tRNA            complement(692642..692718)
FT                   /locus_tag="YPD4_t6"
FT                   /product="tRNA-Met"
FT   gene            complement(692914..694752)
FT                   /locus_tag="YPD4_0555"
FT   CDS_pept        complement(692914..694752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0555"
FT                   /product="RNA polymerase sigma factor RpoD"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57464"
FT                   /protein_id="ACY57464.1"
FT                   /translation="MEQNPQSQLKLLVTRGKEQGYLTYAEVNDHLPEDIVDSDQIEDII
FT                   QMINDMGIQVLEEAPDADDLMLAENTTDTDDDAAEAAAQVLSSVESEIGRTTDPVRMYM
FT                   REMGTVELLTREGEIDIAKRIEDGINQVQCSVAEYPEAITYLLEQYDRVEAGESRLSDL
FT                   ITGFVDPNAEEDIAPTATHVGSELSTEEMDDEDEDEDEDDDAEDDNSIDPELARQKFSD
FT                   LREQYENARMEIKKNGRNHANAAAEILKLSEVFKQFRLVPKQFDYLVNNMRAMMDRVRT
FT                   QERIIMKLCVEQCKMPKKNFVTLFSSNETSDTWFNAAVAMGKPWSEKLKDVSEDVQRSL
FT                   QKLRQIEEETGLTIEQVKDINRRMSIGEAKARRAKKEMVEANLRLVISIAKKYTNRGLQ
FT                   FLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIET
FT                   INKLNRISRQMLQEMGREPTPEELAERMLMPEDKIRKVLKIAKEPISMETPIGDDEDSH
FT                   LGDFIEDTTLELPLDSATSESLRSATHDVLAGLTAREAKVLRMRFGIDMNTDHTLEEVG
FT                   KQFDVTRERIRQIEAKALRKLRHPSRSEVLRSFLDD"
FT   gene            complement(694910..696100)
FT                   /locus_tag="YPD4_0556"
FT   CDS_pept        complement(694910..696100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0556"
FT                   /product="DNA primase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57465"
FT                   /protein_id="ACY57465.1"
FT                   /translation="MLVTNDTGRTYDRFRERVMFPIRDKRGRVIAFGGRILGDGVPKYL
FT                   NSPETEIFHKGRQLYGLYEAQVNHPNPTRLLVVEGYMDVVALAQFGIDYAVASLGTATT
FT                   AEHIQLLFRATDNVICCYDGDRAGRDAAWRALETALPYLNDGRQLRFMFLPDGEDPDTL
FT                   VRKEGKDAFEQRMEAAQPLSTFLFETLMPQVDLSSPDGRAKLSTLALPLISQVPGEALR
FT                   LYLRQQLGNKLGLLDDSQLDKLMPKQIDNANTYQPPQLKRTTMRILIGLLVQNPQLATL
FT                   IPSLQGLEQAKLAGLPLFIELVETCLAQPGLTTGQLLELYRDNKFSQQLETLATWNHMI
FT                   VEDMVEPTFVDTLASLYDSILEQRQETLIARDRTHGLNAEERKELWSLNLALARKK"
FT   gene            complement(696135..696437)
FT                   /locus_tag="YPD4_0557"
FT   CDS_pept        complement(696135..696437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0557"
FT                   /product="DNA primase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57466"
FT                   /protein_id="ACY57466.1"
FT                   /translation="MNYDRLEFVESIEELATMHGLEVPYEAGSGTTQIERHQRQSLYQL
FT                   MESLSAFYQQSLKGQNAKQAREYLKHRGLSRRNHPTFCYRFCAPWLGQCLKTFWS"
FT   gene            697416..698429
FT                   /gene="gcp"
FT                   /locus_tag="YPD4_0558"
FT   CDS_pept        697416..698429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcp"
FT                   /locus_tag="YPD4_0558"
FT                   /product="putative glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57467"
FT                   /protein_id="ACY57467.1"
FT                   /translation="MRVLGIETSCDETGIAVYDDKAGLLANQLYSQVKLHADYGGVVPE
FT                   LASRDHVRKTVPLIQAALKEANLSAKDIDAVAYTAGPGLVGALLVGATIGRALAFAWGV
FT                   PAVPVHHMEGHLLAPMLEENAPEFPFVALLVSGGHTQLISVTGIGEYLLLGESVDDAAG
FT                   EAFDKTAKLLGLDYPGGPMLSRMAQQGTVGRFTFPRPMTDRPGLDFSFSGLKTFAANTI
FT                   RANGDDDQTRADIARAFEDAVVDTLAIKSKRALDQTGFKRLVIAGGVSANQTLRLKLAD
FT                   MMQKRGGEVFYARPEFCTDNGAMIAYAGMVRLRSNLNSELSVSVRPRWPLSELPKV"
FT   gene            complement(698675..699415)
FT                   /locus_tag="YPD4_0559"
FT   CDS_pept        complement(698675..699415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0559"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57468"
FT                   /protein_id="ACY57468.1"
FT                   /translation="MCLPDTTSSRICVLSTDVAIKTTIIQRGGVMSAIALGMIIFAYLC
FT                   GSISSAILVCRVARLPDPRTHGSGNPGATNVLRIGGRTAAVAVLLFDILKGMLPVWIAY
FT                   LLHIPPLYLGLTAIAACLGHIYPVFFHFKGGKGVATAFGAIAPIGWDLTGLMTGTWLLT
FT                   VLLSGYSSLGAIVSALIAPFYVWWFKPQFTFPVAMLSCLILMRHHDNIQRLWRGKEGKI
FT                   WDKLRKKKQKTPAEEAAELEEKED"
FT   gene            699433..699792
FT                   /gene="folB"
FT                   /locus_tag="YPD4_0560"
FT   CDS_pept        699433..699792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folB"
FT                   /locus_tag="YPD4_0560"
FT                   /product="putative dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57469"
FT                   /protein_id="ACY57469.1"
FT                   /translation="MDIVFIEELSVITTIGVYDWEQTIQQKLVFDIEMGWDNRKAAGSD
FT                   DVNDCLSYADISEAVIQHVGSQRFALVERVAEEVAELLLRRFNSPWVRIKVSKPGAVAQ
FT                   AKNVGVIIERGQRLS"
FT   gene            700066..700884
FT                   /gene="uppP"
FT                   /locus_tag="YPD4_0561"
FT   CDS_pept        700066..700884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uppP"
FT                   /locus_tag="YPD4_0561"
FT                   /product="undecaprenyl pyrophosphate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57470"
FT                   /protein_id="ACY57470.1"
FT                   /translation="MTDMYSLFVAFILGVVEGLTEFLPVSSTGHMIIVGELLGFTGDKA
FT                   KTFEVIIQLGSILAVVVVFWRRLFGLIGIHFGAVPHEGKTNGHLTLGHILLAMIPAVIL
FT                   GLAFHDVIKALFDPKSVMYALVAGGVLLLAAEWLKPKNPKAVGLDDITYRQAFAIGCFQ
FT                   CLALWPGFSRSGATISGGMLVGVNRYAASEFSFILAVPMMIGASGLDLYKSLHFLTLGD
FT                   LPMFAVGFITAFIVALIAIKTFLSLIKRISFVPFAIYRFIVAAVVYWVFM"
FT   gene            complement(701120..701428)
FT                   /locus_tag="YPD4_0562"
FT   CDS_pept        complement(701120..701428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0562"
FT                   /product="tRNA nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57471"
FT                   /protein_id="ACY57471.1"
FT                   /translation="MNKLRPETLLKLFNAIDVWRKPERLEQMIMTSEADARGRTGFENN
FT                   PYPQGDYLRAAFQIANGVSIQEVVASGLQGLAIRDELQRRRQQALAEWKQTQETASI"
FT   gene            complement(701421..702359)
FT                   /locus_tag="YPD4_0563"
FT   CDS_pept        complement(701421..702359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0563"
FT                   /product="tRNA nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57472"
FT                   /protein_id="ACY57472.1"
FT                   /translation="MNIYLVGGAVRDSLLNLPVTEQDWVVVGATPEQLLKLGYQQVGKD
FT                   FPVFLHPVSHEEYALARTERKSGQGYTGFTCYAAPDVTLEDDLLRRDLTVNAIARSADG
FT                   EFIDPYHGKQDLENRVLRHVSDAFGEDPLRVLRVARFAARFAYLGFTIAPETMSLMSNM
FT                   AQSGELSALTPERVWKETEKALKTQSPHVYFQVLRDCGALAVLFPEIERLFGVPAPEKW
FT                   HPEIDTGIHTLMTLAIAAQLSPEVDIRFAALCHDLGKGLTPKEHWPHHHGHGPAGVKLV
FT                   EQLCQRLRIPNPVRDLAKLVAEYHDLSSYSE"
FT   gene            complement(702519..703142)
FT                   /locus_tag="YPD4_0564"
FT   CDS_pept        complement(702519..703142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0564"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57473"
FT                   /protein_id="ACY57473.1"
FT                   /translation="MQKLRLICLTILSVSLSWGAQAEEKRYISDELDTYVHSGPGNQYR
FT                   IVGTLKGGDEVTLISVDNGTNYGQIRDSKGKTTWIPLNQLSETPSLRVRVPDLEQQVKT
FT                   LTDKLANIDNSWNQRTAEMQQKVAASDSVISELQKENESLKNQLIVAQKKVNAVNLQLD
FT                   DKQRTIILQWFMYGGGVAGIGLLLGLVLPHLIPSRKKNNRWMNC"
FT   gene            703446..704753
FT                   /locus_tag="YPD4_0565"
FT   CDS_pept        703446..704753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0565"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57474"
FT                   /protein_id="ACY57474.1"
FT                   /translation="MTVEIELKFIATPAAIAALPEWIESQKNQHFPPQTLANIYFDTAD
FT                   KRLRQNDIGLRIRGYDGRYEMTVKTGGKVVGGLHQRPEYNVDIDSDQLDLARFPQDIWP
FT                   EGWAVDLLQAELQPLFRTDFTREKWVITYGESEIELALDQGSISADTLSEPLSEIELEL
FT                   KQGTQGDLLALAAELAKMGGLRQSNLSKAARGYHLAQGNPPRELRPFLVFQPVAKSTVE
FT                   QGMAGGLESILEHWQYHEELWLRGEPAAKTMIIDALAMVRQSLAIFGGLVPRKASTELR
FT                   ALLIALEPQLEPKSVDAALLCYSVDYLKCKLALTSWLITAGWRPFMDAKAQAKFDGSFK
FT                   RFCDIMLSRSAADLKEAFGHNLDDDGYLAQLPRLNRQLIAFQLLSGFYPQSEWHPYIDA
FT                   WFGLQQAIMARQGHWRDTARKEALSQAAFWLNGAVR"
FT   gene            704924..707779
FT                   /gene="glnE"
FT                   /locus_tag="YPD4_0566"
FT   CDS_pept        704924..707779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnE"
FT                   /locus_tag="YPD4_0566"
FT                   /product="glutamate-ammonia-ligase adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57475"
FT                   /protein_id="ACY57475.1"
FT                   /translation="MLPLPSELQIQAQSIKQRFSELPAPPDLRDEDIAVLALSDFVSDM
FT                   LLIHPQWLEELHQQPPQPQEWQYYSQWLSQALAGVQDEAALLTALRLFRRRVMVRIAWS
FT                   QVLQTSGTAETLQQLSTLAESMIIAARDWLYQVCCRELGTPCNRQGVPQPLLILGMGKL
FT                   GGGELNFSSDIDLIFAYPENGQTQGGRRELDNAQFFTRLGQRLIKALDQHTIDGFVYRV
FT                   DMRLRPFGDSGPLVLSFAALEDYYQEQGRDWERYAMVKARLMGGADDPYSQELRQMLRP
FT                   FVFRRYIDFSVIQSLRNMKGMIAREVRRRGLKDNIKLGAGGIREIEFITQVFQLIRGGR
FT                   EPRLQERALLPTLQAVAELGLLPEQQVADLSGSYLFLRRLENLLQAIADEQTQTLPNDP
FT                   LNQARLAWGMGYADWAAMSTALENHMQAVRVVFDDLIGDETPDIGEDPSHGLYKSLWQD
FT                   VLEESDLAPLTPHLEEAARRQLLATISGFRHDVDKRTIGPRGREVLDQLMPRLFAEVCP
FT                   RPDANVALSRLILLLLSIVTRTTYLELLVEYHAALKHVIRLCSASPMVASQLARYPLLL
FT                   DELLDPQSLYQPLAPSAYRDELRQYLLRVPEDDEEQQLEALRQFKQAQQLRIAAGDITE
FT                   ALPVMKVSDHLTYLAEAIIDAVIQQAWNQMVARYGQPSHLQQSEGRGFAVIGYGKLGGW
FT                   ELGYSSDLDLVFLLDCPLDVMTDGDRSIDGRQFYLRLAQRIMHLFSTRTSSGILYEVDA
FT                   RLRPSGEAGMLVSTIEAFADYQRNEAWTWEHQALVRARIVYGSPKLHQQFDAIRQQILC
FT                   RHREDPQLQQEVREMREKMRNHLGSKQRDIFDIKADAGGITDIEFIAQYLVLRYAASEP
FT                   RLTRWSDNVRIFESMAHYDIMSPEEAAALTRAYVTMRDEIHHLALQEQSSKVAADSFIA
FT                   EREQVAASWHKWLAANDANVS"
FT   gene            707914..709344
FT                   /gene="rfaE"
FT                   /locus_tag="YPD4_0567"
FT   CDS_pept        707914..709344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfaE"
FT                   /locus_tag="YPD4_0567"
FT                   /product="ADP-heptose synthase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57476"
FT                   /protein_id="ACY57476.1"
FT                   /translation="MKVTLPDFRRAGVLVVGDVMLDRYWYGPTCRISPEAPVPVVKVDT
FT                   IEERPGGAANVAMNIASLGAVARLVGLTGIDDAARALICKLSEVRVRCDFVSVPTHPTI
FT                   TKLRVLSRNQQLIRLDFEEGFDGVDPTPIFERIQLALPQIGALVLSDYAKGALNSVQPM
FT                   IQLARKANVPVLIDPKGSDFERYRGATLLTPNLSEFEAVVGRCKNEEELVNRGMQLVAD
FT                   FELSALLVTRSEQGMTLLQLGKPPLHLPTQAKEVFDVTGAGDTVIGVLAAALAAGNSLE
FT                   ESCFLANAAAGVVVGKLGTSTVSPIELENAIRGRAETGFGVMDEQQLKIAVAQARQRGE
FT                   KVVMTNGIFDILHAGHVSYLANARKLGDRLIVAVNSDASTKRLKGEKRPVNPLEQRMVV
FT                   LGALEAVDWVVPFEEDTPQRLIADILPDLLVKGGDYKPHEIAGSEEVWAAGGEVKVLNF
FT                   EDGVSTTNIIQSIKNGRG"
FT   gene            709496..710632
FT                   /locus_tag="YPD4_0568"
FT   CDS_pept        709496..710632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0568"
FT                   /product="permease"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57477"
FT                   /protein_id="ACY57477.1"
FT                   /translation="MIVYGPGPVLIVLVFPIAIAFAALGRHFPSAGGAAHFVAIAFGPK
FT                   LGKVTGWLFLSVIPVGLPAALQIAAGFWQAMFGWSDTGLLMVQLVTLLVIWLLGTRSAG
FT                   SSANLQTVIALLVIALVAAIWWQGDIRLSQIPWPALQDVSPPNIFNALAVMFWCFVGLE
FT                   AFAHLATEFRHPERDFPRALIVGLLVAGAVYWGCTVAVLHFQAYGESQAAAASLPGIVV
FT                   QLFGEHALWIACIIGYLACFASVNIYTQSFARMVWSQSQVRPQSKLARLSAGQTPVNAL
FT                   TAVVGSCLVFALLIYWLALPLDLLIVYANGIFVLIYLLCMLAGIRLLSGRARVMSVIGS
FT                   LLCCVLLVMIGWKSVYALLMFALLWMLMSKPKTQLTQP"
FT   gene            711807..712460
FT                   /gene="ribB"
FT                   /locus_tag="YPD4_0569"
FT   CDS_pept        711807..712460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribB"
FT                   /locus_tag="YPD4_0569"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57478"
FT                   /protein_id="ACY57478.1"
FT                   /translation="MNQTLLSDFGTPVERVERAIDALRNGRGVMVLDDESRENEGDMVF
FT                   AAEAMTLEQMALTIRHGSGIVCLCITDERRQQLDLPMMVTHNSSQFQTAFTVTIEAAEG
FT                   VTTGVSAADRLTTIRKAIADNAKPADLNRPGHVFPLRGQPGGVLSRRGHTEASIDLATL
FT                   AGYKPAGVLCELTNDDGSMAHAPEVIAFAKLHDMPVVTIDDLAAYLQSRAKKAS"
FT   gene            712919..713701
FT                   /locus_tag="YPD4_0570"
FT   CDS_pept        712919..713701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57479"
FT                   /protein_id="ACY57479.1"
FT                   /translation="MNTFRMPALFLGHGSPMNVLEENSYTQAWRTLGETLPRPKMILAI
FT                   SAHWYTRGTAVTAMEHPRTIHDFGGFPQALFDIQYPAPGSPELAAHIQQLLAPTPVRAD
FT                   TGEWGLDHGSWGVLIKMYPEADIPVVQLSIDGTQPAAYHYELGQKLAALREQGVMIVAS
FT                   GNVVHNLRLGKWQGESSPYPWAESFNQFVRDNLSYQGDDHPLVNFMQHEGAALSNPSPE
FT                   HYLPLLYVLGSWDGKEPVSIPTDGVEMGSLSMLSVQIG"
FT   gene            complement(714108..714764)
FT                   /locus_tag="YPD4_0571"
FT   CDS_pept        complement(714108..714764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0571"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57480"
FT                   /protein_id="ACY57480.1"
FT                   /translation="MVLACCIWPAAQDSEEDRGTVQYLQDCALEAGLPTEFMFMEEIGL
FT                   GEKGQFTDLDNQVISNLFKLYPWEFMFREIFSTKLEDAGVRWLEPAWKSIISNKALLPL
FT                   LWEMFPNHPNLLPAYFAEDDHPPLDHYVIKPLFSREGANIQIVENGKEVAKVDGPYGEE
FT                   GMIIQQFHPLPKFGDSYTLIGSWLVNDQPCGIGLREDRELITQDLSRFYPHIILG"
FT   gene            complement(714721..715269)
FT                   /locus_tag="YPD4_0572"
FT   CDS_pept        complement(714721..715269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0572"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57481"
FT                   /protein_id="ACY57481.1"
FT                   /translation="MKRLAISERPDWREKATEFGFRFHTMHGEPYWCEDAYYEFTLAQI
FT                   EELEETTAELHQMCLQVVEKVINSDQLLTKCRIPKHCWEFVRHSWRSNQPSLYSRLDLA
FT                   YDGKNPAKLLENNADTPTSLYEAAFFQWLWLEDQISAGNLSTDSDQYNSLQEKLIERFV
FT                   ELRDNHGFSLLHLACCSGQ"
FT   gene            complement(715279..715965)
FT                   /locus_tag="YPD4_0573"
FT   CDS_pept        complement(715279..715965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0573"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57482"
FT                   /protein_id="ACY57482.1"
FT                   /translation="MMKRTKNINQETFRKSWRSYRLAPVALAVSAVFMLAGCEKTDETV
FT                   SLYQNADDCSQANPSQSAECTTAYNTALQEAVKTAPKYATREDCVAEFGESQCTQAPAQ
FT                   AGMVPTSSSETTAAAPQQSGSMWMPLMAGYMMGRMMGGGASQPLFTSKAPNSPANGKFV
FT                   DASGKNFGAATTGRTMTVPKTALAPKPAVTKTITRGGFGESVAKQSSMQRSAATSSKTT
FT                   TRSMGG"
FT   gene            complement(716266..717663)
FT                   /locus_tag="YPD4_0574"
FT   CDS_pept        complement(716266..717663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0574"
FT                   /product="ABC-transporter outer membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57483"
FT                   /protein_id="ACY57483.1"
FT                   /translation="MKKLLPLLIGLSLAGFSTMSQAENLLQVYKQARDSNPDLRKAAAD
FT                   RDAAYEKINEVRSPLLPQLGLSAGYTHANGFRDASNSPDSNATSGSLKLTQTIFDMSKW
FT                   RALTLQEKAAGIQDVTFQTSEQQLILNTATAYFNVLRAIDSLSYTEAQKQSVYRQLDQT
FT                   TQRFNVGLVAITDVQNARASYDTVLAAEVAARNNLDNALESLRQITGVYYPELASLNVE
FT                   RLKTQRPDAVNNLLKEAEKRNLSLLSARLSQDLAREQIKSAETGYMPTVDLTASSSITN
FT                   TRYSGGTPSSQQVNNDSGQNQIGVQFSLPLYSGGATNSAVKQAQYNFVGASELLESAHR
FT                   NMVQTLRSSFNNISASISSINAYQQVVISNQSSLDAMEAGYQVGTRTILDVLTATTNLY
FT                   QSKQQLADARYNYLINQLNIKSALGTLNMNDLMALNAVLDKPVPTSAAALAPENTTRQT
FT                   VTTPRAQ"
FT   gene            718059..718691
FT                   /locus_tag="YPD4_0575"
FT   CDS_pept        718059..718691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0575"
FT                   /product="putative MutT-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57484"
FT                   /protein_id="ACY57484.1"
FT                   /translation="MTSKQSSPVTFDKNDVEIIARESLYRGFFSLNSYRFRHRLFNGEM
FT                   SGEVKREIFERGHAAVLLPYDPQRDEVVLVEQLRIAAIDSAVSPWLLEMVAGMIEEGES
FT                   VEEVARREAEEEAGIQVGRCKPVLSYLASPGGTSERLSIMVGEVDATTASGIHGLAEEN
FT                   EDIRVHVVSREQAYRWVEEGVIDNAASVIALQWLALHHQALRAEWQR"
FT   gene            718725..719150
FT                   /locus_tag="YPD4_0576"
FT   CDS_pept        718725..719150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0576"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57485"
FT                   /protein_id="ACY57485.1"
FT                   /translation="MSKRYTPDFPEMMRLCEINYAQLRRLIPRINEVGESVAYQIKEVS
FT                   YRLTIIESTRYTSVVEIVQTAPAASHWSLPSMVVRLYHDAMVAEVCASQQISRFKASYD
FT                   YPNKKLHQRDEKHQINQFLADWLRYCLAHGAVAVPVC"
FT   gene            719232..720059
FT                   /gene="icc"
FT                   /locus_tag="YPD4_0577"
FT   CDS_pept        719232..720059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icc"
FT                   /locus_tag="YPD4_0577"
FT                   /product="Icc-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57486"
FT                   /protein_id="ACY57486.1"
FT                   /translation="MESLFKLPMASGARVRILQITDTHLFAGEHETLLGVNTFHSYRAV
FT                   LDAIIAEQHPFDLVVATGDLAQDHSVAAYQNFAKGISRLPVPCVWLPGNHDFQPAMFDA
FT                   LAEAGIAPSKQVLAGEHWQILLLDSQVFGVPYGELSDYQLEWMERCLIAYPERYTLILL
FT                   HHHPMPSGCTWLDQHSLRNAHMLAAILTRYPRVTTLLCGHIHQDLDLDWYGKRLLASPS
FT                   TCVQFKPHCTNFTLDAVAPGWRYLDLLPDGGLETEVHRLDSDEFCPDMDSDGY"
FT   gene            720059..720640
FT                   /locus_tag="YPD4_0578"
FT   CDS_pept        720059..720640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0578"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57487"
FT                   /protein_id="ACY57487.1"
FT                   /translation="MSTLLYIHGFNSSPSSAKATAFKEWLQQHYPHIEMLTPQLPPYPA
FT                   PAAEMLENIVMDKAGQSIGIVGSSLGGYFATWLSQRFGIPAVVVNPAVRPYELLSDYLG
FT                   KNENPYTGQQYVLESRHIYDLKAMQIEKLESPDLLWLLQQTGDEILDYRQAVAYYTPCR
FT                   QTVESGGNHAFIGFDHYFSPIVTFLGLANT"
FT   gene            720742..722637
FT                   /gene="parE"
FT                   /locus_tag="YPD4_0579"
FT   CDS_pept        720742..722637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parE"
FT                   /locus_tag="YPD4_0579"
FT                   /product="DNA topoisomerase IV subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57488"
FT                   /protein_id="ACY57488.1"
FT                   /translation="MTESSYNADAIEVLSGLEPVRRRPGMYTDTSRPNHLGQEVIDNSV
FT                   DEALAGHARRIDVILHADQSLEVIDDGRGMPVDIHPEEGVPAVELILCRLHAGGKFSNK
FT                   NYQFSGGLHGVGISVVNALSKRVEVTVRRDSQIYSIAFENGDKVQDLQVIGTCGKRNTG
FT                   TSVHFWPDVSFFDSPRFSVSRLSHLLKAKAVLCPGVEIVFKDQVNNTEQRWCYADGLTD
FT                   YLMEAVNGFITLPEAPFVGSFAGDTEAIDWALLWLPEGGELLTESYVNLIPTMQGGTHV
FT                   NGLRQGLLDAMRDFCEYRNILPRGVKLSADDIWERCAYVLSVKMQDPQFAGQTKERLSS
FT                   RQCAAFVSGVVKDAFSLWLNQNVQAAEQLAELAISSAQRRMRAAKKVVRKKLTSGPALP
FT                   GKLADCTSQDLSLTELFLVEGDSAGGSAKQARDREYQAIMPLKGKILNTWEVSSDEVLA
FT                   SQEVHDISVAIGIDPDSEDLSQLRYGKVCILADADSDGLHIATLLCALFVRHFRALVRN
FT                   GHVYVAMPPLYRIDLGKEVFYALDEEEKAGVLEQLKRKRGKPNVQRFKGLGEMNPLQLR
FT                   ETTLDPNTRRLVQLTISDDDIDHTLAVMDMLLAKKRSEDRRNWLQEKGDTAEIEV"
FT   gene            722641..723552
FT                   /locus_tag="YPD4_0580"
FT   CDS_pept        722641..723552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0580"
FT                   /product="LysR-family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57489"
FT                   /protein_id="ACY57489.1"
FT                   /translation="MKVTLEELQAFTSVVDCGSITAAAEQRSQTTSGISRALSRLEQKL
FT                   ATTLLRRTTRRLELTEEGALFLSHARQIIGAVDDAEEQIALRRLKPAGRLRVNAAAPFM
FT                   QHVIVPMITGFRALYPQITLELNTDDLNIDLLEQRTDIAIRIGALRDSTIHARLLGASR
FT                   VRLLASPNYLQRHGTPHIIEALADHSLLGFTQPEFLNQWSLPHLPGGRSSIIPNLAASS
FT                   GETLRLLALQGEGIAELSDFMTREDQLAGRLVEVLADQILETWQPINAVYYRNTQLAAR
FT                   ITCFLDYVSEQIKLQGSHWLRI"
FT   gene            complement(723610..724194)
FT                   /gene="mdaB"
FT                   /locus_tag="YPD4_0581"
FT   CDS_pept        complement(723610..724194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdaB"
FT                   /locus_tag="YPD4_0581"
FT                   /product="putative modulator of drug activity"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57490"
FT                   /protein_id="ACY57490.1"
FT                   /translation="MSNVLIINAMKEFAHSKGALNLTLTNVAADFLRESGHQVKITTVD
FT                   QGYDIESEIENYLWADTIIYQMPAWWMGEPWILKKYIDEVFTDGHGRLYQSDGRTRSDA
FT                   TKGYGSGGLIQGKTYMLSVTWNAPREAFTDPEQFFHGVGVDGVYLPFHKANQFLGMKPL
FT                   PTFMCNDVIKQPDIEGDIARYRQHLAENVNS"
FT   gene            724498..726771
FT                   /gene="parC"
FT                   /locus_tag="YPD4_0582"
FT   CDS_pept        724498..726771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parC"
FT                   /locus_tag="YPD4_0582"
FT                   /product="DNA topoisomerase IV subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57491"
FT                   /protein_id="ACY57491.1"
FT                   /translation="MSDLTHDGAERLPLHTFTENAYLNYSMYVIMDRALPFIGDGLKPV
FT                   QRRIVYAMSELGLNNSAKFKKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLV
FT                   DGQGNWGAPDDPKSFAAMRYTESRLSKYAEVLLGELAQGTVDWVPNFDGTMQEPKMLPA
FT                   RLPNILLNGTTGIAVGMATDIPPHNVREIAQAVLALIDKPTTSLDELLEFVQGPDFPTE
FT                   AEIITPRDDIRKIYQNGRGSVRMRAVWKKEDGSAVITALPHQVSGAKVLEQIANQMRAK
FT                   KLPMVEDLRDESDHENPTRLVIVPRTNRVDLDQVMSHLFATTDLERSYRINMNMIGLDN
FT                   RPSVKGLLEILTEWLVFRRQTVRNRLNFRLEKVLKRLHILEGLLIAFLNIDEVIHIIRT
FT                   EDDPKPLLMQRFSISETQAEAILELKLRHLAKLEEVKIRGEQDELAKERDQLQALLASE
FT                   RKLNTLIKKEIQADAAAYGDDRRSPLTERGEAKAMSEHDIVPSEPVTIVLSEMGWVRSA
FT                   KGHDIDPSGLSYKAGDSFRAAARGMSNQPVVFIDSTGRSYALDPLTLPSARGQGEPLTG
FT                   KLTPPPGATIEHVLMAPDSQKLLMASDAGYGFVCTFNDLVAKNRAGKTMITLPENAKVL
FT                   PPLEIYGPDDMLLSITAVGRMLMFPVADLPELSKGKGNKIVSIPAAQAAAGEDRLAWLF
FT                   VLPPQTSITLHFGKRKLTLRPEDLQKFRAERGRKGSPLPRGLQRIDRIDVDAPPRAIAT
FT                   ESEE"
FT   gene            727198..727791
FT                   /locus_tag="YPD4_0583"
FT   CDS_pept        727198..727791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0583"
FT                   /product="acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57492"
FT                   /protein_id="ACY57492.1"
FT                   /translation="MLFGITIEQRIPAEAAKYGNCIYIANHQNNYDMVTMSNVVQPGTV
FT                   TVGKKSLLWVPLFGPLYWLTGNLLIDRDNRAKAHSTIAQVVEQVQKRNISIWMFPEGTR
FT                   SRGRGLLPFKTGAFHAAIAAGVPIVPICVSSTNGIKLNRWSNGKVIIEMLPPIDTSGYT
FT                   KERVRELSEHCRNLMLAKIEQLDAEVAQQSVAKK"
FT   gene            727970..729394
FT                   /gene="sufI"
FT                   /locus_tag="YPD4_0584"
FT   CDS_pept        727970..729394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sufI"
FT                   /locus_tag="YPD4_0584"
FT                   /product="putative cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57493"
FT                   /protein_id="ACY57493.1"
FT                   /translation="MSLSRRQFIQAAGLALGAGSLPLRAQASSTQQPQLPVPPLLESRR
FT                   GQPLFLTLQRAHWAFSGNKKAAVWGINGMYLGPTVRVFNGDDVKLIYSNRLTEPVSMTI
FT                   SGLQVPGTLMGGEARMIRPGEDWSPVLPVRQPAANCWYHANTPNRMAPHVYNGLAGMWL
FT                   VEDAVSKAMPLPSHYGVDDFPLIIQDKRLDNFGVPEYNPPAKGGFVGDTLLVNGAQSPF
FT                   VEVSRGWVRLRLLNASNARRYTLQLSDGRPLYVVASDQGFLPAPVAVQQLSLAPGERRE
FT                   VVIDMSQGNEVSITAGESAGIMDRLRGLFEPSSILISTLVLTLKPTGLLPLVTDNLPMR
FT                   LLADQIIEGSVIRSREFQLGDNLPGINGAIWDMNRVDVQAQQGTWERWIIHADMPQAFH
FT                   IQGVSFLVKSVNGAAAMAEDRGWKDTVWVDGTVELWVYFNQVSSPQFPFLFYSQTLEMA
FT                   DRGSAGQLVTVAAPTL"
FT   gene            729702..731249
FT                   /locus_tag="YPD4_0585"
FT   CDS_pept        729702..731249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0585"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57494"
FT                   /protein_id="ACY57494.1"
FT                   /translation="MSISLIQPERDLFSYQPYWAECYGTAPFLPMSREEMDILGWDSCD
FT                   IIVITGDAYVDHPSFGMAIVGRMLEAQGFRVGIIAQPDWTNKHDFMRLGEPNLFFGVTA
FT                   GNMDSMINRYTADRKLRHDDAYTPDNQSGKRPDRATLVYSQRCKEAYSHVPVLLGGIEA
FT                   SLRRIAHYDYWSDTVRRSVIVDAKADMLVYGNGERPLVEVAHRLAAGEKITDIQDVRNT
FT                   VVMRKTPLPGWSGVDSTRLDKPGRIEAIPNPYGEDLPCATDDISIPEAKPITVRAAKPK
FT                   PWEKTYVLLPSYEKVKADKVLYAHTSRILHHETNPGCARALMQKHGDRYIWINPPAIPL
FT                   STEEMDSVFALPYQRVPHPSYGKSPIPAYDMIRFSINIMRGCYGGCSFCSITEHEGRII
FT                   QSRSEDSIIREIEEIRDKVPGFTGIISDLGGPTANMYMLRCQSPRAEQTCRRASCVYPE
FT                   ICPHMDTNHQPTISLYRRARDLKGIKKILIASGVRYDLAVEDPRYIKELASHMWAVI"
FT   gene            731246..732046
FT                   /locus_tag="YPD4_0586"
FT   CDS_pept        731246..732046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0586"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57495"
FT                   /protein_id="ACY57495.1"
FT                   /translation="MKIAPEHTEEGPLSKMMKPGMGSYQRFKELFDTYSKQAGKEQYLI
FT                   PYFISAHPGTEDKDMVNLALWLKKNRFRLDQVQNFYPSPLANSTTMYYTGKNPLAKVDY
FT                   KSEEVVVPKGDRQRRLHKALLRYHDPANWPMLRSALEDMGLQHLIGARRECLVPAPTLE
FT                   EQREARRALRHHTPALTKHTSITRQRQPSNRAPAASAGKKAPTVANGTSSAHSTSANQS
FT                   TSANQSTSAAHSTLATKKSAGKTGVNKAAVNKPSAGSRGKNRQH"
FT   gene            complement(732068..732901)
FT                   /locus_tag="YPD4_0587"
FT   CDS_pept        complement(732068..732901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0587"
FT                   /product="putative aldo/keto reductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57496"
FT                   /protein_id="ACY57496.1"
FT                   /translation="MTMQPLIKLYDGRLMPQLGLGVWQASIQETELAVSKALEVGYRSI
FT                   DTAAIYKNEEGVGKALKAAAVARDELFITTKLWNDDQHNPQQALETSLQKLQLDYVDLY
FT                   LIHWPDPKQDHYVSAWRELVTLKEQGLIRSIGVCNFHIPHLQRLIDETGIAPTVNQIEL
FT                   HPLLQQRQLHAWNATHHIATESWSPLAQGGKGVFDQEIIRKLAQQYNKTPAQIVIRWHL
FT                   DSGLIVIPKSVTPARIRENFEVFDFKLQKEELLAITKLDCGKRLGPDPEVFGSDR"
FT   gene            complement(733320..734477)
FT                   /locus_tag="YPD4_0588"
FT   CDS_pept        complement(733320..734477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0588"
FT                   /product="putative iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57497"
FT                   /protein_id="ACY57497.1"
FT                   /translation="MQNFTLHTPTKVLFGTGQIAQLTQEIPADARILITYGGGSIKQNG
FT                   VLDQVHQALKGFDFLEFGGIEPNPTYETLMKAVELCRTEGINFLLAVGGGSVLDGTKFI
FT                   AAAVNYPQDPWHILETTGRDITEALPMGSVLTLPATGSEANNGAVISRRSTGDKQHFFS
FT                   PHVQPLFAVLDPVVTYTLPPRQVANGVVDAFVHTIEQYLTYPVDAKVQDRFAEGLLLTL
FT                   IEEGPKALKDPENYNVRANIMWSATMALNGLIGAGVPQDWATHMLGHELTARHGLDHAQ
FT                   TLAVVLPALLVAKKQQKRAKLLQYAERVWGLREGSEDQRIDAAIEATRHFFESLGVATR
FT                   LSAYKLDGSSIPDLIKKLEEHGMTKLGEHSDITLADSKRIYEAAV"
FT   gene            734875..735768
FT                   /locus_tag="YPD4_0589"
FT   CDS_pept        734875..735768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0589"
FT                   /product="AraC-family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57498"
FT                   /protein_id="ACY57498.1"
FT                   /translation="MVDVIDIQAQMADKIARLAQGDGLTPSTVSGVKILYSTVHQPRTP
FT                   VMYTPSVVIIFQGHKVGYLGSKVFQYDPKNYLILSVPLPFECETFASPEIPLAGISIQV
FT                   DSQMLQDLMMTMGDDELEKPPGNTSGVNSAPLTEEMLCATERLLDVMSIARDARVLGPQ
FT                   IVREILYYVLCGSCGGALQALVNRHGHFNQITKTLRRIENHFADNLSVEQLAAEVNMSV
FT                   SAFHHNFKAVTNTSPLQYLKSYRLHRARMMMLHDGLKASTAAIKVGYESASQFSREFKR
FT                   YFGHTPSEGVAKQRIN"
FT   gene            complement(735860..736522)
FT                   /locus_tag="YPD4_0590"
FT   CDS_pept        complement(735860..736522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0590"
FT                   /product="putative DedA-family membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57499"
FT                   /protein_id="ACY57499.1"
FT                   /translation="MDVLREILHALWQQDFSKLADPNVIWVIYGILFTTLFLENGLLPA
FT                   SFLPGDSLLLLAGALIAKGVMGFLPTLIILTTAASLGCWLSYLQGRWLGDTSVVKRWLL
FT                   QLPLQYRQRAHTLFVRHGLAALLVGRFLAFVRTLLPTLAGISGLNSIRFQLFNWLSGLL
FT                   WVGSVVGLGFALSHIPLVKQYENQVMTALMILPIVLLLAGLVGTLILVWCKRKSTTE"
FT   gene            complement(736715..737926)
FT                   /gene="metC"
FT                   /locus_tag="YPD4_0591"
FT   CDS_pept        complement(736715..737926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metC"
FT                   /locus_tag="YPD4_0591"
FT                   /product="cystathionine beta-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57500"
FT                   /protein_id="ACY57500.1"
FT                   /translation="MAVNKAIPEKLETALVSAGRSKKFTQGSVNTVIQRASSLVFESVK
FT                   AKKHATINRGNGELFYGRRGTLTHFSLQEAMTELEGGAGCVLYPCGAAAISNAILSFVA
FT                   TGDHVLMTGSAYEPAQSFCDKILSRMNITTTYFDPMIGAGIASLITPKTKVIFLESPGS
FT                   ITMEVQDIPAMVAAIRAVAPDVVIMMDNTWAAGVLFKALDFDIDISIQSGTKYIIGHSD
FT                   AMLGIAVANARCWEQLREDSYLMGQMVDADTAYLASRGLRTLSVRLKQHEKNSIEIANW
FT                   LAERPEVAVVYHPALPGCKGHEFYKRDFNGCNGLFSFELKEELTQQQLENYLDHFTHFS
FT                   MAFSWGGFESLILGYQPKDIRAIRKYDAEGIKGTLFRLHIGLENVQDLQDDLAAGFERI
FT                   QAVK"
FT   gene            738405..739442
FT                   /locus_tag="YPD4_0592"
FT   CDS_pept        738405..739442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0592"
FT                   /product="MotA/TolQ/ExbB proton channel family protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57501"
FT                   /protein_id="ACY57501.1"
FT                   /translation="MKIAGKESKEISRVQGRVMKGVMVLLLATGLAGHAQAAPGNGSAV
FT                   AATVTAPTAATSTPLPAPEITSVAAIPESTPESVLTSASALTSESIPAPMVQPVTAPVP
FT                   QKLAMDLSVWGMYQNADVVVKGVMIGLVLASIVTWTILFSKGTELFRARRRLRQEHEVI
FT                   GAVTDLDTASERAEDFGQGSVSSLLLHEALNERLLSIESNDNNGIKERTAFRLERRVAA
FT                   IGRQMGKGNGFLATIGAISPFVGLFGTVWGIMNSFIGIAHSQTTNLAVIAPGIAEALLA
FT                   TALGLVAAIPAVVIYNIFARQIGNYRAQVGDVAAQVLLLLSRDLDLASSAEVKSPRHPH
FT                   QLRAG"
FT   gene            739446..739877
FT                   /locus_tag="YPD4_0593"
FT   CDS_pept        739446..739877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0593"
FT                   /product="ExbD/TolR-family transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57502"
FT                   /protein_id="ACY57502.1"
FT                   /translation="MAMRMNDSLDESGELHEINVTPFIDVMLVLLIIFMVAAPLATVDI
FT                   KVDLPASSAVPQPRPEKPVFLTVKADNQLYVGDQPVDRETLATALDKVTQSNKETTIFF
FT                   QADKVVDYETLMSVMDALRKSGYLKVGLVGMEAGSSGAK"
FT   gene            complement(739974..741452)
FT                   /locus_tag="YPD4_0594"
FT   CDS_pept        complement(739974..741452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0594"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57503"
FT                   /protein_id="ACY57503.1"
FT                   /translation="MSFMALIPVFIGLIFLSFEFSHFIQKRAKLSDALEQASLALSTEN
FT                   NYRNDRASNNRNNYLVTSYAQSYLPSERFSQPRVVNTYNESLGYTEYNASLQMNYQLAL
FT                   LNSYLKQTPSPTWDVNENGAARKYLSSIAEPIDVVFVTDFSGSMDLPFGDIERNNRITK
FT                   LDELKAIFVKLNNRIFSNDGINTIGFVPFSWGTKRISANGQVSSTYCHFPYSPKKIDGN
FT                   GHYLQRYTASNLKNIPGLDNLSGIDNLAYGQLDEDKHHAILSEIEKKHRDNEIPTKTRD
FT                   QAKNFLDKAYKVNQISTITKIVEEHIDYKETINSIDRNGETIDIPMDDILDPFFCLKET
FT                   NAKSLNFDPNSKGDINEILNMKAEGGTLASSGILVGNKMLTESQNNNKLMIILSDGDDN
FT                   TQKMSSPHDQKAGIINITQKLITEGMCQKIKDNGIKMVFIGIGYVPDNNIIDWEKDCVG
FT                   TGNFYLAKNAHELEISIERALVVDDEVGRNIPKS"
FT   gene            complement(741555..742127)
FT                   /locus_tag="YPD4_0595"
FT   CDS_pept        complement(741555..742127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0595"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57504"
FT                   /protein_id="ACY57504.1"
FT                   /translation="MFRKNNTLINNQGGAIIVEFAFVTFIIVLFIKLLIAIAEYQSISG
FT                   KLDRLSYSAAGIIRERGRLYPHDPELNQQQVDQLRDLVQRALLNSGVPADNLRMRVETL
FT                   HFNPIEPPGSRQQQIDEHKSLSFSTGDCSPVQPLRGLVALSPLSQSERWVPLYQVTICL
FT                   PPPQRYRDLISVSPLPTLKSSAITIGR"
FT   gene            complement(742111..742581)
FT                   /locus_tag="YPD4_0596"
FT   CDS_pept        complement(742111..742581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0596"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57505"
FT                   /protein_id="ACY57505.1"
FT                   /translation="MRDTILRLLPANRGSIAVEFTLIFILFIFMLLLVAETSRLFYTSA
FT                   NLDFALSEAAKTAKNRDAENVLSYQQLFEHNFNRQVTVLGSLINTAPSAELTVNFSHSV
FT                   ADLINGNSEENNHTLPLAHYQVRLHYQPIFLPFPQAWVNTLLSREVIFVQEK"
FT   gene            complement(742581..743351)
FT                   /locus_tag="YPD4_0597"
FT   CDS_pept        complement(742581..743351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0597"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57506"
FT                   /protein_id="ACY57506.1"
FT                   /translation="MLKIFNTIIIIPVMIFLLSGCLSQQGLSSQGLSTKEFSYRESILI
FT                   KANNQIGLIKLYRESLKNKEDESIRVKLANAYYLSGDSHSSLYYLQPISHKPNVSIYLL
FT                   QIKNLINEGDNSGATTVLHRLLSIAPHNPEAHNLKGIILANRGDTAGARTAIVQSQALF
FT                   IQEDIARNNIAVISMLDNRYEDAVKILLPDYLSGKRNNLILHNLVFALIKMGDTRYAKN
FT                   IIEAERLSDNADELVLALSQVDSFPQEQSFIREK"
FT   gene            complement(743335..743916)
FT                   /locus_tag="YPD4_0598"
FT   CDS_pept        complement(743335..743916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0598"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57507"
FT                   /protein_id="ACY57507.1"
FT                   /translation="MAIFNVVNINQKTLLTIGLLSIISTLYLPRMIIKNALTKRTNNLL
FT                   KSLPFFIDITAACVQSGMTIENSLNYTTQKFQTINTDLCLIMSKVTKRAEINGLENAIK
FT                   ELQYYSPAIEMKMFCSTLQYSISFGSTVYEQLTHLSQDMREMQLLMTEESISKLSTKLT
FT                   LPLFLFILIPFVLLVISPSILELLNYVKNI"
FT   gene            complement(744166..745041)
FT                   /locus_tag="YPD4_0599"
FT   CDS_pept        complement(744166..745041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0599"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57508"
FT                   /protein_id="ACY57508.1"
FT                   /translation="MIYYVVALSGILLLVLNNLKWMKIKRSISNTKKSKAKSTSSITIL
FT                   IKKIFFEWIDYVSTHSKSTPHILLPICSLVIVYYINSTWINVNYSFVFIINIIFIIVLQ
FT                   LKYARSKHYLLFKQDFPEVLLMINMAASSGASINQVLERCGKEIRGPLGQELGLICRRL
FT                   NLGETPETVFYDAYERFHYPEFYFLVTIILLNIQQGGQLKELITRLSQIITKKKTTEQK
FT                   KAVMTAQIRMSVNIISIMPMLFSFLLYLLDPTTIEFVWQHPTGRFIIYYIIISEVIGIL
FT                   IIRKMLGKSL"
FT   gene            complement(745038..746324)
FT                   /locus_tag="YPD4_0600"
FT   CDS_pept        complement(745038..746324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0600"
FT                   /product="putative type II secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57509"
FT                   /protein_id="ACY57509.1"
FT                   /translation="MIVPLKIQELMRERMLANIDINKVELLVGDRNKLIGLLSQTFDDL
FT                   FNNNEYNLTTQAQKYIIEMIADEITGFGPLRELMEDDSISDIMVNGPERIFIERYGLLK
FT                   LTDRRFVNNTQLTDIAKRLMQKVNRRIDEGRPLADARLIDGSRINVAISPIALDGTALS
FT                   IRKFSKNKRRLEDLVDMGAMSSDMANFLIIAASCRVNIIISGGTGSGKTTLLNALSKYI
FT                   SEDERVITLEDAAELNLEQPHVVRMETRLAGLENTGQITMRDLVINSLRMRPDRIIIGE
FT                   CRGEETFEMLQAMNTGHNGSMSTLHANTPRDAVARLESMIMMGPVNMPLITIRRNIASA
FT                   INLIVQVSRMNDGSRKIRNISEIMGMEGEHVVLQDIFTFQPASTRDDQGRIQGEFINHG
FT                   LFNRSSVRINADIHNLANELNSVFSTVSK"
FT   gene            complement(746336..747463)
FT                   /locus_tag="YPD4_0601"
FT   CDS_pept        complement(746336..747463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0601"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57510"
FT                   /protein_id="ACY57510.1"
FT                   /translation="MQLILNKDLINKKDNREKSAVVIISTRKGLKDKISEYVRLADIKN
FT                   IKEIDDDIFSAASILIPDNVKGIIIDINENHDINTILDLMKVHTPRDCWCILVGDIDSI
FT                   SIAQQFIERGILYLHIQSQLADLTQNLLKGIQIESDRKAFFISILGCRGGIGTTLLSYQ
FT                   LAHVITQIKKSPTLLLQGNQGSQDLDLITEKKMGEDITGYQKNFDLMRGNERKLSEVNE
FT                   HNNKKHNFIIFDQPIHNARKEKTLDYISNSNCIILLIDHSMMSVRVAKEFIDTLERFKR
FT                   DNRQAIRLFICLNENRPITKDMLTTSDIQSLLGHSIDTAIPYINNAKNSLNSPDYFGRK
FT                   KTKVVELAKQSLGININLSSHTNMWIREKLNKLFK"
FT   gene            complement(747761..748210)
FT                   /locus_tag="YPD4_0602"
FT   CDS_pept        complement(747761..748210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0602"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57511"
FT                   /protein_id="ACY57511.1"
FT                   /translation="MNEKKRIRVMLGEEVSSIDKVFNLRGGDSYPSLRIRKANTTVELG
FT                   DGESFILGGLISSTERESLKKIPFIGDIPLLGALFRNAQTQRNQSELVVVATVNLVKPV
FT                   SARQIELPDFMHTSTVERFFNLTNIKDAKRRKQAKEFLQKGGFIK"
FT   gene            complement(748225..749079)
FT                   /locus_tag="YPD4_0603"
FT   CDS_pept        complement(748225..749079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0603"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57512"
FT                   /protein_id="ACY57512.1"
FT                   /translation="MNLYQLKDKKQNIIIFLSIVILYFLFENSANAKQIYLPIGGSHII
FT                   KVQEEIDTVFVSAAKTADYEIVDNNSVIIYAKKEGLAEFTLFNKNHQPISKTRVLVNNT
FT                   INDAYRRIRTEFPDSKIEINKIGESYILTGSAETEEAKDTIASIVGEATASKKEKERET
FT                   SYQSNPEYQGVINKIKLPQANQVNVKLTIVEITKDFTENIGLDWNSIKSAAGAFQFLNF
FT                   NAQSISTLVHAINDEAIAKVLAEPNLSVLSGEYASFLVGGEIPIVSTNQNGISVELKSL
FT                   ALS"
FT   gene            complement(749076..749942)
FT                   /locus_tag="YPD4_0604"
FT   CDS_pept        complement(749076..749942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0604"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57513"
FT                   /protein_id="ACY57513.1"
FT                   /translation="MNRKFLILFSLLIVAIGISGILLNPDKEIPELLTQTEKRKERNIV
FT                   LAQTRHDLTAGTLISKEDYSLQNITVDESSDLVKNDLSHGHRIDGDSIADDRTHDHKLD
FT                   GHLLKNNILAGSYIIDEMLISPDSREFSRLNLKHGEIIYKFYITEKNEYLLNTLNPGDF
FT                   LSFQLLTLETNKTKGMENGIAIDSKSMSSKQRQKYSLNNVIPDMPILSIKTYSPEELSV
FT                   KNNKNNKTEEYSLGYIEVIMKIQDLEFIHTVEKAGEVFLTPKSGDHKRIDLDDIIPTLQ
FT                   TIRELRG"
FT   gene            complement(749994..750416)
FT                   /locus_tag="YPD4_0605"
FT   CDS_pept        complement(749994..750416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0605"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57514"
FT                   /protein_id="ACY57514.1"
FT                   /translation="MDVIRLSLIVLIVSQLLFVCYSDIRHRIISNKFIISISFNAIIFS
FT                   LVMHHTVSIIIPIVALFIGYIIFHFNVMGGGDVKLITVLLLALTAEQSLNFIIYTAVMG
FT                   GVVMVVGLLINRVDIQKRGVPYAVAITAGFLSSVLI"
FT   gene            750565..751074
FT                   /locus_tag="YPD4_0606"
FT   CDS_pept        750565..751074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0606"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57515"
FT                   /protein_id="ACY57515.1"
FT                   /translation="MRSGNCKCSTRNQKGVPMRDEKSLAHTRWNCKYHIVFAPKYRRQV
FT                   FYREKRRAIGSILRKLCEWKNVNILEAECCVDHIHMLLEIPPKMSVSGFMGYLKGKSSL
FT                   MLYEQFGDLKFKYRNREFWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGS
FT                   PFTGRK"
FT   gene            751276..751785
FT                   /locus_tag="YPD4_0607"
FT   CDS_pept        751276..751785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0607"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57516"
FT                   /protein_id="ACY57516.1"
FT                   /translation="MRSGNCKCSTRNQKGVPMRDEKSLAHTRWNCKYHIVFAPKYRRQV
FT                   FYREKRRAIGSILRKLCEWKNVNILEAECCVDHIHMLLEIPPKMSVSGFMGYLKGKSSL
FT                   MLYEQFGDLKFKYRNREFWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGS
FT                   PFTGRK"
FT   gene            752138..754618
FT                   /locus_tag="YPD4_0608"
FT   CDS_pept        752138..754618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0608"
FT                   /product="outer membrane usher protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57517"
FT                   /protein_id="ACY57517.1"
FT                   /translation="MRIIKKIPIAMTTSLIMLSGAVSAIDFNTDAMDANDKQNIDLSHF
FT                   TNVGYIMPGEYRLEINVNNHRIPEQVIAFYARDDEPNSSEVCLPEAVVEQFGLKPDVLQ
FT                   KITFWHEGQCADLRELAGLTTEVDLATSTLAINVPQDWMEYSDSNWVPSSQWDEGIPGF
FT                   LLDYNVNSLFSKPKESGSTRNISLNGTSGLNAGPWRLRGDYQGNYSHNSGEQNSSTSTF
FT                   DWSRIYMYRAIKSLAATLSVGENYFASSLFDTFRYAGASLSSDERMLPPNLRGYAPEVS
FT                   GIARTNAKVTVSQQGRILYQTTVASGPFRIQELSDSVSGRLDVSVEEQDGTVQTFQVET
FT                   AAVPYLTRPGAIRYKTSVGQPSTLNHGTEGPVFASGEFSWGVSNRWSLFGGAIGSGDYN
FT                   AVSVGVGRDLYAFGAISTDITQTRASGLPNQETQSGKSLRVRYAKRFDELNSDISLAGN
FT                   RFFEREFMSMNQYLGTRYFDNDLGRNKEMYTVTASKNFPDIQTNINFSYSYQNYWDQPT
FT                   SNSYSATVSHAFDAFSLKDMTVNLSASRSKNNGVNDDVLYLSFSVPLGNQQTLSYSGQH
FT                   NGQGNNQTVNYSNSSAIDSSYRLSAGVNNSNDNGARGQFSGFYIHRSSIAETSLNVAYA
FT                   QDDFTSTGVSMRGGATVTAKGAALHGPGMSGGTRLMVNTDDIAGVPLEERNIRSNRFGI
FT                   AVLNNINSYYRTDTRIDINQLADDVEVKQSAVEFALTEGAIGYRRFAMMKGEKVLATIS
FT                   LTDSSHPPFGSLVISAKGQELGIVSDDGFTYLSGVEPGETLDVVWSGAKQCQVAIPAVI
FT                   QPQAQILLPCISVN"
FT   gene            754636..755355
FT                   /locus_tag="YPD4_0609"
FT   CDS_pept        754636..755355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0609"
FT                   /product="fimbrial chaperone protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57518"
FT                   /protein_id="ACY57518.1"
FT                   /translation="MKKLSLIALTSTVVFTSYTANAAIALDRTRIIYNGQDKSISLNIS
FT                   NENKTLPYLAQAWIENEQQQKVTTPLVATPPVQRVEAGKKSAVRISATPEALKLPQDRE
FT                   SLFYFNLREIPPRSEKSNVMQIALQTKIKLFYRPEGITPATGQIWQEQLVLHKTAQGFR
FT                   LENPTPYYITVVGLAEKGKSSADSNFQPLMVAPKSSAELKSASFTAPVLTYINDYGGRP
FT                   ELSFSCSGSTCRAAKAI"
FT   gene            755380..756486
FT                   /locus_tag="YPD4_0610"
FT   CDS_pept        755380..756486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0610"
FT                   /product="Fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57519"
FT                   /protein_id="ACY57519.1"
FT                   /translation="MKKNIFLTLRSERYKAGLLLLLLLLLCTTSKPSFAALQVNSCSLA
FT                   VSGAGGETPFVIKALPVTLTNGFVLGSMNFSVVTTFTKTGTTADYLYLGGWSMLAGGAV
FT                   MPVSTGVPGVKMSVNVSDALFGGYEWGNTEKATQSLFVPGTKITIANRVTVQLIVTDAS
FT                   VYQGGVINWFNVARSFALVSGNAQVWSTKSVATGGSRCGDMVTFNIGSTNIVLPPPTVA
FT                   TCDLGATDIVVALDPIDTSSLQTQGDRAGGQAFSIPLGSCAKDAKPYITFTDSSNKANR
FT                   TNILSLSPSSTATGVGLVLEKSDGNLVTFGAENASVSASNVGQFLIGTSTAAGGSMPLN
FT                   LTARYIRAEGVLKSGNVKADAIFTVAYP"
FT   gene            complement(756698..757777)
FT                   /gene="fepB"
FT                   /locus_tag="YPD4_0611"
FT   CDS_pept        complement(756698..757777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fepB"
FT                   /locus_tag="YPD4_0611"
FT                   /product="ferric enterobactin (enterochelin) binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57520"
FT                   /protein_id="ACY57520.1"
FT                   /translation="MFLYMTYIERKIRHSLFISLGCLGLILSLSGCEPAEETNFHPFPI
FT                   DENHSTSSPWSRTVDTVKGPVTLTHKPARIVSTSITITGTLLAINAPIIASSATEPNTT
FT                   LADNKGFFTQWSDIARARHLIPMYQTEPNIKAVAKMRPDLIIISATGDDSTLELYDQLS
FT                   AIAPTLVINYDDKSWQELTLQLGQATGHEGDAEQVIDKFARRLNEVKQKITLPPQPVSA
FT                   FVYQEVSGSAKLWTENSAQGRLLLELGFTLANVPDTLKDNTHTEHRKDIIQLGGDELAQ
FT                   GLNGKTILLFSGVHSAIDALKSNKFLTNLPAIQHDNVYAAGYDTFRLDYYSANNLLTRI
FT                   ESMFKGKKDSEPTYHESRT"
FT   gene            758633..759628
FT                   /locus_tag="YPD4_0612"
FT   CDS_pept        758633..759628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0612"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57521"
FT                   /protein_id="ACY57521.1"
FT                   /translation="MNILSLRGGFFLWMMLISTSSLAINCQRASTPVEYTVCSNEDLHW
FT                   LDQTFNSIYQVLLVKYNTEMVYQQRQTWEKSLNSCTSDSCIQRAYLQGIALMSDVDKNF
FT                   NWDGQWWNITKGNDRGGVIEIHRVTEWGFSLDSRAWSGENMGNFHAEARKTEGVAVVDV
FT                   IENTANCRLLLIPGKDGSLQVHSNGSWGCRISMPKDVFIDGQYVRAEKDPRKAPTLLSI
FT                   GIFSEASVDDAFRNLVGEHYAQFVQSANVYIYTNDLDNQGAKVLSTWVRGAANKRASII
FT                   MYTHTGQYWAAYVAPDKKGQLQIHYFTNVAADKNKRPKTIVEWQQSFIDN"
FT   gene            complement(760519..761307)
FT                   /locus_tag="YPD4_0613"
FT   CDS_pept        complement(760519..761307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0613"
FT                   /product="flagellar biosynthesis/export membrane protein
FT                   flhA, fhiA"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57522"
FT                   /protein_id="ACY57522.1"
FT                   /translation="MAIPTTQQYGEVDGILATDPTYGLAIVWIDPQEKPQALNLGYQVV
FT                   DCASVVATHVNKVVREHLSELFNYDDITLLHQRLAALSPRLAEDLVTTLNFSQLLKVYR
FT                   QLLTENVSLKDIVTISTTLLDSVTVTKDALLLTSDVRYALRNGIVNSINGDDKDLAVYT
FT                   INNELENMLLSSLNQAQQAGKVVLDNFPVDPNILTQLQQNLPIIKEQMKAENHQPILLV
FT                   TPQLRPLISRYARLFCSGLNVLSYNEIPDDMNLNVIGVLE"
FT   gene            complement(761315..762613)
FT                   /locus_tag="YPD4_0614"
FT   CDS_pept        complement(761315..762613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0614"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57523"
FT                   /protein_id="ACY57523.1"
FT                   /translation="MKHKLYDISRLLKETHIAVPVLLLCVLAMVILPLSPLVLDILFTF
FT                   NIVMAVLVLLVSVNSKRPLDFSILPPILLIATLMRLTLNVASTRVVLLNGHEGADAAGK
FT                   VIEAFGQVVIGGNFVVGFVVFIILMIINFVVVTKGAERVSEVSARFTLDALPGKQMAID
FT                   ADLNAGLINQEQASIRRKEVASEADFYGAMDGASKFVRGDAVAGMMILVINVIDGICIG
FT                   IFKYDLSASQSFQQYVLLTIGDGLVAQIPSLLLATAAAIIVTRVSDGGDMTDEVKDQLL
FT                   AKPTILYAAAFVMFILAIVPGMPHLAFLSFTGLLLFAARQQSKKIQQADLNPDFTALNP
FT                   VISDENALSISWDSIPAVEPIGLNLGYKLVTLVDESKGKPLNQRLRGVRQIISESSGVL
FT                   LPEVRVRENFRLKPSQYTININGVRIAGGGSPC"
FT   gene            complement(762603..763736)
FT                   /gene="flhB"
FT                   /locus_tag="YPD4_0615"
FT   CDS_pept        complement(762603..763736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhB"
FT                   /locus_tag="YPD4_0615"
FT                   /product="flagellar biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57524"
FT                   /protein_id="ACY57524.1"
FT                   /translation="MSNSSGEKSEKPTAGKLSKARKKGDIPRSKDVTMAAGLVTSFILL
FT                   SLFLPYYKALVSQSFVSVAQLASQLDDQGALEQFLLANLFIFAKFLATLIPIPLFSMLA
FT                   TLIPGGWNFTPVKLIPDLKKLSPLAGIKRIFSASNGTEVLKMLAKCSIVLYTLYLVVHS
FT                   SLDDLLHLQTLPLEEAITQGFAQYHHILLYFIAIVVVFAAIDIPLSHHLFTKKMKMTKQ
FT                   EVKQEHKNNDGNPEIKSRVRQLQRQYAIGQINKTVPSADVIITNPTHFSVALKYAPEKA
FT                   SAPYIVAKGKDDIALYIRSIAQKHKIEIVEFPPLARAIYHTTKVNQQIPAQLYRAIAQV
FT                   LTYVMQIKSWRSGQASKPVLNTHLGLPKEMQRFHDET"
FT   gene            complement(763736..764515)
FT                   /gene="fliR"
FT                   /locus_tag="YPD4_0616"
FT   CDS_pept        complement(763736..764515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliR"
FT                   /locus_tag="YPD4_0616"
FT                   /product="flagellar biosynthetic protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57525"
FT                   /protein_id="ACY57525.1"
FT                   /translation="MPMGIDIHAMTAPLFALWLPFVRILSFLHFCPVIRHKAFTRKAKI
FT                   GTALLLAILITPMISQPVVSGELLSIENLLLAGEQILWGWLFGSMLHLVLAALEAAGQI
FT                   LSMNMGLGMAMMNDPTSGASTAVISQIIFTFSVLIFFTLNGHLLFVTILLKSFSSWPIG
FT                   EAINDFSLRSLALSLGWILSSATLLALPTTFIMLIVQGSFGLLNRISPTLNLFSLGFPI
FT                   GMLFGLLCLLLLAINIPDHYLHLTNEILTQFERMKVH"
FT   gene            complement(764790..765560)
FT                   /gene="fliP"
FT                   /locus_tag="YPD4_0617"
FT   CDS_pept        complement(764790..765560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliP"
FT                   /locus_tag="YPD4_0617"
FT                   /product="putative flagellar assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57526"
FT                   /protein_id="ACY57526.1"
FT                   /translation="MSRSLRAITPVTIISRGLLVGGLLYSPLLLAQEGGITLFNTVQTA
FT                   TGQDYNVKIEILILMTLLGLLPIMMLMMTCFTRFIIVLAILRQALGLQQSPPNKVLTGI
FT                   ALALTLLVMRPVWTKIHQDAVIPFQQDEITLSQALGRAEAPLKNYMLAQTSTKSLDQMM
FT                   AIAQVSGEPQQQDLSVVTPAYVLSELKTAFQMGFMIYIPFLVIDLIVASILMAMGMMML
FT                   SPLIVSLPFKLMLFVLCDGWTLMVGTLTASVQGL"
FT   gene            complement(765557..765970)
FT                   /gene="fliN"
FT                   /locus_tag="YPD4_0618"
FT   CDS_pept        complement(765557..765970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliN"
FT                   /locus_tag="YPD4_0618"
FT                   /product="flagellar switch protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57527"
FT                   /protein_id="ACY57527.1"
FT                   /translation="MTDQQIELNNDLDFTLALDESAISPTEHFDSVINSPEIINTPEKT
FT                   ATKTDEQKRKMSLFSRIPVTLTLEVASVEIPLSELLTVNNDSVIELDKLAGEPLDIRVN
FT                   GIMFGQAEVVVINEKYGLRIININSQNLGELAL"
FT   gene            complement(765963..766862)
FT                   /locus_tag="YPD4_0619"
FT   CDS_pept        complement(765963..766862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0619"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57528"
FT                   /protein_id="ACY57528.1"
FT                   /translation="MQSNKVKAKVYNHDPRPDIVSLEINKLGRPHHKIPKIVNSYFSII
FT                   ESEISLYFLKKYRINITLDDIKFQTNCSHKNAKMLTSQMGNIAFDIDRLLLLNILNDYY
FT                   GLSQEKYGLSQEKKTTTTGKLSPLTKTEERLKNKLGLEITDLFLNQPFFGEHLIINNST
FT                   AALIACWSYRIDFFLKDYNKSGFSIFIDAPHIDRLIDTIKTKNEKAVEKNVSLSERQLE
FT                   HLVKKLPVTLTSQLSNINLTLAELMALKEGDIISASLPEYFPVFIGKEALFSAAITENR
FT                   GKLFFSEFNDQPNEMNHD"
FT   gene            767385..768413
FT                   /locus_tag="YPD4_0620"
FT   CDS_pept        767385..768413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0620"
FT                   /product="sigma-54 transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57529"
FT                   /protein_id="ACY57529.1"
FT                   /translation="MMNINVDVFPKNDHGFVANAPSSVSVFSLARRVAEFNVPVLVTGE
FT                   TGTGKECVAKYIHQKAMGDASPYIAVNCAAIPESMLEAILFGYEKGAFTGAIASVAGKF
FT                   EQANGGTLLLDEIGDMPLALQVKLLRVLQEQEVERLGGHKPIPLDIRIIASTNKDLSVE
FT                   IAEGRFRQDLYYRLSVVPIHILPLRERPEDILPLVKAFINKYQSFLNVKIDITAEAQCE
FT                   LYKYTWPGNVRELENVIQRGIIMSNNGVIELPSLGLPMAQGISSPVGETSLPFSTIQPP
FT                   DGENNIKLRGRLAQYQYIVDLLQRHQGNKSKTAAFLGITPRALRYRLANMREDGIDIEC
FT                   HS"
FT   gene            768430..768810
FT                   /gene="fliE"
FT                   /locus_tag="YPD4_0621"
FT   CDS_pept        768430..768810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliE"
FT                   /locus_tag="YPD4_0621"
FT                   /product="putative flagellar hook-basal body complex
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57530"
FT                   /protein_id="ACY57530.1"
FT                   /translation="MDNIDSINMPRSQSPVMLEMRQMAAMAGSGLEFGTIQPAATNSPF
FT                   FPVEKGANNLSFSQVLNGAIKSVDQLQHVASEKQTAMDMGISDDLTGTMLASQKASVAF
FT                   SAMVQVRNKLTSALDDVMNTAL"
FT   gene            768820..770460
FT                   /gene="fliF"
FT                   /locus_tag="YPD4_0622"
FT   CDS_pept        768820..770460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliF"
FT                   /locus_tag="YPD4_0622"
FT                   /product="flagellar M-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57531"
FT                   /protein_id="ACY57531.1"
FT                   /translation="MLDKIKQKLSPGQLGENTKTILMSAVALLVTAAIIFSLWRSSQGY
FT                   TALFGSQENIPITQVVEVLEGEAIAYRINPDNGQVLVAENQLGKARILLAAKGITATLP
FT                   IGYELMDKESMLGSSQFIQNVRYKRSLEGELAQSMMALSAVEYARVHLGMSEASSFAIS
FT                   NHADNSASVVLRLRYGQTLSTEQVGAIVQLVAGSIPGMKPANVRVVDQHGELLSQAYQA
FT                   NSEGVPSVKSGTELAHYLQSTTEKNIANLLNSVIGANNYRISVSTQLDMSRIEETAEHY
FT                   GPDPRINDENIQQENSNDDMAMGIPGSLSNQPIPQSQAGQTPAAVSRSQAQRKYIYDRN
FT                   IRHVRYPGYKLEKMTVAVVLNKSLPVLEQWTPEQQEELKRLIEDAAGIDVKRGDSLTIN
FT                   MMAFAVPTLIDEPVMPWWQEPSTFRWAELLGIGLLSLLVLWFGVRPLMKRYSRKGSENL
FT                   PLAISSASADEALDHVDTGVDGAESSPRTENAFSASSLWKSDDLPEQGSGLETKIAHLQ
FT                   QLAQSETERTAEVIKQWINSNERIKSQPE"
FT   gene            770432..771475
FT                   /locus_tag="YPD4_0623"
FT   CDS_pept        770432..771475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0623"
FT                   /product="flagellar motor protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57532"
FT                   /protein_id="ACY57532.1"
FT                   /translation="MNESNLNLNDDSSVKSDTKGRSRLEQASILLLSIGEEAAAMVMQQ
FT                   LSREEVVCVSQMMSRLHNIKLDQARQALDDFFQDYREQSGINGASRSYLQAILNKALGS
FT                   DIAKSVINGIYGDEIRHRMTRLQWVDTPQLVALIDQEHLQLQAVFLAFLPPDVAAAVLA
FT                   YLDKDRQDDILYRIAKLDDVNRDVVDELDRLIERGVAVLSEHGSKVIGIKQAANIVNRI
FT                   PGNQQQLLDQLGERDEEVLNELKDEMYEFFILSRQSEATLQRLMDLIPMSDWAIALKGT
FT                   EPALRQAIYDVLPKRQIQQLQNATQRTGAVPVSRVEHIRKVIMAQVRELAEAGEIQVQL
FT                   FAEQTME"
FT   gene            771480..772196
FT                   /locus_tag="YPD4_0624"
FT   CDS_pept        771480..772196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0624"
FT                   /product="flagellar assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57533"
FT                   /protein_id="ACY57533.1"
FT                   /translation="MLIKNTPRAGAVKLRVHQFPPLRKVRQVAPSAADQTLDPAEYQKQ
FT                   LMAGFQEGISQGFDKGLAEGKEEGYQEGVRLGHDDGLKKGRIEGRQSELASFNDVIKPF
FT                   SGYITQLHTYLETYEQRRRDELLQLVEKVTRQVIRCELALQPAQLLTLVEEALAALPMV
FT                   PQQLKVYLNPAEFGRINDVAPEKVQAWGLAADPDMVGGECRIVTETTEIDVGCQHRLDQ
FT                   CIGALHSSFLTEPHHE"
FT   gene            772189..773529
FT                   /gene="fliI"
FT                   /locus_tag="YPD4_0625"
FT   CDS_pept        772189..773529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliI"
FT                   /locus_tag="YPD4_0625"
FT                   /product="flagellum-specific ATP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57534"
FT                   /protein_id="ACY57534.1"
FT                   /translation="MSESPALDHALKSIENIHLARVAGRLVRVTGLLLESVGCRLAIGQ
FT                   RCRIESVDETFIEAQVVGFDRDITYLMPFKHPGGVLGGARVFPSEQDGELLIGDSWLGR
FT                   VINGLGEPLDGKGQLGGSTPLQQQLPQIHPLQRRAVDTPLDVGVNAINGLLTIGKGQRV
FT                   GLMAGSGVGKSVLLGMITRYTQADVVVVGLIGERGREVKEFIEHSLQAAGMAKSVVVAA
FT                   PADESPLMRIKATELCHAIATYYRDKGHDVLLLVDSLTRYAMAQREIALSLGEPPATKG
FT                   YPPSAFSIIPRLAESAGNSSGNGTMTAIYTVLAEGDDQQDPIVDCARAVLDGHIVLSRK
FT                   LAEAGHYPAIDISQSISRCMSQVIGSQQAKAASLLKQCYADYMAIKPLIPLGGYVAGAD
FT                   PMADQAVHYYPAITQFLRQEVGHPALFSASVEQLTGMFPSFAPTDEA"
FT   gene            773533..773970
FT                   /locus_tag="YPD4_0626"
FT   CDS_pept        773533..773970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0626"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57535"
FT                   /protein_id="ACY57535.1"
FT                   /translation="MSDMIDTLQQLQQLRQRSLNQVTSQLTQQKQLCQRYQRNINALNA
FT                   LTLSEEAFPGVSALQMANHAGYQRHIQRLIDWQKQEQALADIEVGNLQTQMQQQARREK
FT                   IVAVVLEQQQEEYQREQGRLAQKNTDALATQCWQRQQAGDI"
FT   gene            complement(774298..774723)
FT                   /locus_tag="YPD4_0627"
FT   CDS_pept        complement(774298..774723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0627"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57536"
FT                   /protein_id="ACY57536.1"
FT                   /translation="MEPTQRVKQLLIDIQEDRKRYIALEKLLIKQRELMIGHKTEALEA
FT                   LNPQLTELYSVLDNTATERRLLMQQLQLPANKEGIHQLLSRLPAHYREHAGALWADLRL
FT                   RAHACHQQNHHNGMLLTQQIALLSSLAEQPTEFLYAG"
FT   gene            complement(775225..776073)
FT                   /locus_tag="YPD4_0628"
FT   CDS_pept        complement(775225..776073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0628"
FT                   /product="flagella basal body P-ring formation protein
FT                   FlgA"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57537"
FT                   /protein_id="ACY57537.1"
FT                   /translation="MQLTCQVYNIIINSIFYFYCSPKWKVNFRLSVTFSIRVRHCLQSL
FT                   LICGALLCANTISAAENNTRKQVYTQALHAATADIAQTAKNKNWQGYSVKMNIFIPAEI
FT                   SRYKPCQKALQVALPTAETQHLSRLRYEISCPDGQGWEVVATVKPDIYLPIWVAKQTLE
FT                   RGRKVQADDIELKKKNITGVQGGYITDPDEILGLTIKRRIRQLQAVIPSQLEQPVLVTR
FT                   NQHVLMLAAQDGIEAQMLGIAQKNGRKGELIKVKNLSSGRVVTATVDGSGRVRMLGLST
FT                   P"
FT   gene            776131..776577
FT                   /gene="flgB"
FT                   /locus_tag="YPD4_0629"
FT   CDS_pept        776131..776577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgB"
FT                   /locus_tag="YPD4_0629"
FT                   /product="flagellar basal body rod protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57538"
FT                   /protein_id="ACY57538.1"
FT                   /translation="MGIHFQKALGVHPMAMQLRLTRAELLSANLANVNTPNFQAKDIDF
FT                   AAEMQRAKRGNGVMAAPDRSSAQMLSTQMSSAQMSSPQMMSSPQIMSSPQIKYRLPYQP
FT                   SLDGNTVALNVEQAEFSKNALDYQTSLSFLNMKLTGLKQAIEGK"
FT   gene            776580..777005
FT                   /gene="flgC"
FT                   /locus_tag="YPD4_0630"
FT   CDS_pept        776580..777005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgC"
FT                   /locus_tag="YPD4_0630"
FT                   /product="flagellar basal body rod protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57539"
FT                   /protein_id="ACY57539.1"
FT                   /translation="MSFNQIYRVAGSAMTAQTIRLNTIASNLANAESPAASAATVYKAR
FT                   SPVFSAVYSARTAADPRGVQSAQVQVLDVVEVGGSVQRYEPNHPMANPQGYVFYPAVNV
FT                   VSEMADMMSASRSFETNVEVLNSVKSMQQSVLKLGER"
FT   gene            777008..777664
FT                   /gene="flgD"
FT                   /locus_tag="YPD4_0631"
FT   CDS_pept        777008..777664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgD"
FT                   /locus_tag="YPD4_0631"
FT                   /product="flagellar basal body rod modification protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57540"
FT                   /protein_id="ACY57540.1"
FT                   /translation="MQINESRNSANVGNQSPAPEGGLPGGEQLNNQFMTLLVAQIKNQD
FT                   PLNPADGTEFVSQMAQLSQVQATENMAKLLKSNTVQMAKMQTMATANLVGQQVMVEGHE
FT                   ITLGKDPVAGRLTLKQPAPTLLLHITDILGQEKVIDLGKQPAGPVNFTLDPAAAKLQPG
FT                   QYQLSAVSGSGEELIPLEVAGKVNNVRISPQGGAPQLNITGLGEVSYSQITQFGA"
FT   gene            777719..778960
FT                   /gene="flgE"
FT                   /locus_tag="YPD4_0632"
FT   CDS_pept        777719..778960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgE"
FT                   /locus_tag="YPD4_0632"
FT                   /product="flagellar hook protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57541"
FT                   /protein_id="ACY57541.1"
FT                   /translation="MSFSIANTALNAHTEQLNTISNNIANSATKGFKASRTEFSSMYAQ
FT                   SQPLGVAVSGVSQNISKDGQKEKTGMGLDLAISGGGFFVVRESSGDKAYTRAGMFRSDV
FT                   DGYLVNGQGMKLQGYPADAAGNIQAGIISDLKINNAGVPAKASEQLDFMANLNASVTAP
FT                   SVSVFNPTNEKSYNFTTTSTVYDSLGREHAVAHYFVKSTTPPAGSVASEWAVHHTVDGG
FT                   TATPPLTLQFTDTGALIPGIPAAGSGMKGSAINLHGTFNPAGAADYDIDIDYTGTTQLS
FT                   QGFTTTRNKSDGYTSGVKNAERIESDGSVYATFSNGERVLQGKVVLANFASPSGLVTQN
FT                   GTSWSESNKSGAALLGTPGTGLLGSLESGALENSNVDITAELVGLMTAQRNYQASTKII
FT                   STNDSMMNALFQVL"
FT   gene            complement(779184..779693)
FT                   /locus_tag="YPD4_0633"
FT   CDS_pept        complement(779184..779693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0633"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57542"
FT                   /protein_id="ACY57542.1"
FT                   /translation="MRSGNCKCSTRNQKGVPMRDEKSLAHTRWNCKYHIVFAPKYRRQV
FT                   FYREKRRAIGSILRKLCEWKNVNILEAEYCVDHIHMLLEIPPKMSVSGFMGYLKGKSSL
FT                   MLYEQFGDLKFKYRNREFWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGS
FT                   PFTGRK"
FT   gene            779809..780402
FT                   /locus_tag="YPD4_0634"
FT   CDS_pept        779809..780402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0634"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57543"
FT                   /protein_id="ACY57543.1"
FT                   /translation="MGGGYSSRVAVLSQNAGVDMTPASLQETGRDLDIALKNQGLIAVL
FT                   SGGREAYTRNGQMDVSAEGALTINGLPVLGDGGPIVLPPYSALSIADDGTIAIIPQAGG
FT                   IKTPEEIERIKLVDIPANQLRKNNRGLLVSNRGPAARDETVQVVNKHLESSNVSAISEM
FT                   IASISLSRQFEAQIKMMKVAEDLAQAGNRMIRGS"
FT   gene            780470..781255
FT                   /gene="flgG"
FT                   /locus_tag="YPD4_0635"
FT   CDS_pept        780470..781255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgG"
FT                   /locus_tag="YPD4_0635"
FT                   /product="putative flagellar basal-body rod protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57544"
FT                   /protein_id="ACY57544.1"
FT                   /translation="MNSALWVSKTGLAAQDAKMGAISNNLANVNTDGFKRDRVVFADLF
FT                   YQNQRTPGAPLDQNNTTPSGIQFGSGVQIVGTQKQFTVGNIKVTKGDMDVAITGQGFFQ
FT                   IETADGGIAYTRAGNLTTNADGVLVNAQGMPLIPQIELPTGSKQLHIGKDGTVTATVGG
FT                   ETEPVEVGQITLVNFINPAGLEAIGGNLYRETAASGEAVEGVPGEEAFGQLEQGALEGS
FT                   NVQVVEEMVDMITVQRAYEMNAKMVSAADDMLKFVSQKL"
FT   gene            781290..781955
FT                   /gene="flgH"
FT                   /locus_tag="YPD4_0636"
FT   CDS_pept        781290..781955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgH"
FT                   /locus_tag="YPD4_0636"
FT                   /product="flagellar L-ring protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57545"
FT                   /protein_id="ACY57545.1"
FT                   /translation="MKRFLILTPMVLALCGCESPALLVQKDDAEFAPPANLIQPATVTE
FT                   GGGLFQPANSWSLLQDRRAYRIGDILTVILDESTQSSKQAKTNFGKKNDMSLGVPEVLG
FT                   KKLNKFGGSISGKRDFDGSATSAQQNMLRGSITVAVHQVLPNGVLVIRGEKWLTLNQGD
FT                   EYMRVTGLVRADDVARDNSVSSQRIANARISYAGRGALSDANSAGWLTRFFNHPLFPI"
FT   gene            782125..783144
FT                   /gene="flgI"
FT                   /locus_tag="YPD4_0637"
FT   CDS_pept        782125..783144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgI"
FT                   /locus_tag="YPD4_0637"
FT                   /product="flagellar P-ring protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57546"
FT                   /protein_id="ACY57546.1"
FT                   /translation="MDIQGVRGNQLVGYSLVVGLDGSGDKNQVKFTGQSMANMLRQFGV
FT                   QLPEKMDPKVKNVAAVAISATLPPGYGRGQSIDITVSSIGDAKSLRGGTLLLTQLRGAD
FT                   GEVYALAQGNVVVGGIKAEGDSGSSVTVNTPTVGRIPNGASIERQIPSDFQTNNQVVLN
FT                   LKRPSFKSANNVALALNRAFGANTATAQSATNVMVNAPQDAGARVAFMSLLEDVQINAG
FT                   EQSPRVVFNARTGTVVIGEGVMVRAAAVSHGNLTVNIREQKNVSQPNPLGGGKTVTTPE
FT                   SDIEVTKGKNQMVMVPAGTRLRSIVNTINSLGASPDDIMAILQALYEAGALDAELVVI"
FT   gene            783560..784921
FT                   /gene="flgK"
FT                   /locus_tag="YPD4_0638"
FT   CDS_pept        783560..784921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgK"
FT                   /locus_tag="YPD4_0638"
FT                   /product="flagellar hook-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57547"
FT                   /protein_id="ACY57547.1"
FT                   /translation="MNFIRTAFSGMQATQAHLNATSMNIANMHTPGYSRQRAEQSAIGA
FT                   DGQGGVNAGNGVNVDGIRRLSQQYVVMQEWRANSQQQYYDAGEQYLNAVELMVSNESTS
FT                   LATGLNNFFSSLSAATQLPDSPPMRQQIIESANAMALRFNNVNNFIVQQKKSIGQQRDI
FT                   TVKEINSLTRSIADYNQQILKNRSDGNNINDLLDKQELQIKKLSGLIETQVNQAEDGTY
FT                   RISVKQGQPLVNGAVAAELAVDTSSVDTKITLHFSGATQGMNMSCGGQLGGINDYELTT
FT                   LKKLQDSTQEMAKTVADKFNDQLGKGTDFTGAPGQDLFVFNPSDPNGMLQLSAITAEQL
FT                   ALAAHGKPAGDNSNLFELLDIRKTPVTGMKNVPLDDAATALVGYIAITSNRNHSELENA
FT                   ENTLNQATRYHESFSGVNNDEEAMNLMEYQRAYQSNMKVIATGDKLFSDLLALV"
FT   gene            784950..785873
FT                   /gene="flgL"
FT                   /locus_tag="YPD4_0639"
FT   CDS_pept        784950..785873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgL"
FT                   /locus_tag="YPD4_0639"
FT                   /product="flagellar hook-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57548"
FT                   /protein_id="ACY57548.1"
FT                   /translation="MRVSTPTMSSTMNRFITQHNEKLEKINKQMMTQQRITLPSEDPIA
FT                   STRLLQINREQANIKQYSSNISGLSNSLTNQTGHVSAINKQLVSIKSSLVSINGNIKSN
FT                   KDIAGVADELNYMLESVVAGLNAKNSEGRYLFAGTASNKQPITFDSAKNKYTYVGNSDN
FT                   RQTGVGEGVKITENVHLQSGFTDTSGDLATLNKLKKLCDNIKKPILPAAVASHTAAIDE
FT                   MMGLIDNASDHMGVTLTELGIRQKHSQLLQKNHEEMELSNATIQENLVGLDLAESYMEL
FT                   MNLMAVTNANYTTFKQINSLSLFNLI"
FT   gene            785885..786898
FT                   /locus_tag="YPD4_0640"
FT   CDS_pept        785885..786898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57549"
FT                   /protein_id="ACY57549.1"
FT                   /translation="MQVGLNRPQWEVANKTSLPDFDRLQGANSLSLIKKEVDFPESPFI
FT                   SSQPLRYNVQLNRQLTALQRAEGYLHTTERQVAQLQRALQQERAETEIKPLALKTLHWL
FT                   QQRTAMSGNAVDRQLNFVPEQRTEVNFALHGAEQLLQPAESETLLFSLTGNGYNVVAVN
FT                   LPAYASPAQNLLRLNNGLGRLGIHGRLDPQGNAQFHVDEKRWAEIEAHLQVRGGGGRFA
FT                   KESFQPLKLQPEVVLEDRVRDIAAKPQEAKKHLAGIQQAMGQITGQMRKLSEHKRNTGV
FT                   QINSMSSFSAPNSALMAAEALAEKLLQGRSQYAMWANMLTAQGNARSAMVRNLLGG"
FT   gene            complement(787062..787508)
FT                   /locus_tag="YPD4_0641"
FT   CDS_pept        complement(787062..787508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0641"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57550"
FT                   /protein_id="ACY57550.1"
FT                   /translation="MKWLTASNGILLSILGLFLSLAALASSEGKKKPTLADAQLQMGFY
FT                   DLLSQQKEIYDARITATQGGVISTITSPNDNRFIFKGKFTEQTTQNSQLSFSYSPIFFN
FT                   NPTSGRMIEGFLDYLMHNTVFMTPMVVEGQPLLVGQSGIVLGEK"
FT   gene            complement(787489..788535)
FT                   /locus_tag="YPD4_0642"
FT   CDS_pept        complement(787489..788535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0642"
FT                   /product="putative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57551"
FT                   /protein_id="ACY57551.1"
FT                   /translation="MHTIIEKNMNKQSHIVNGWLIDLTSGFITHQETREKKRLGEYQLK
FT                   LINVLLEHAGEILSRDELTNLVWKRRVIGNNSLPNAIHTLRVALGDENKQQRIIQTIPK
FT                   IGYLLDASFCEIIDATKETETAEQTALAQTDDEEIVAPLNGVTLHEAVAASASDIAHSR
FT                   IAETNEEPADTAINAPLPPTQTGPVVMTRQHVTASQRPPWNIFSYWSRVAIALLVLITA
FT                   VAFYRLFPQNKGVSYTAIEQDQEAYSNIRLFQLVDSALSLQQEEKLNQRLKDTLYAINK
FT                   QSKAKSMSINIYYYVSLRRLDFTFSVESQCENKQLGMTIYHWRQNSQLLNNLIYREMER
FT                   KINEMVNC"
FT   gene            789161..790375
FT                   /gene="flaA1"
FT                   /locus_tag="YPD4_0643"
FT   CDS_pept        789161..790375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flaA1"
FT                   /locus_tag="YPD4_0643"
FT                   /product="putative flagellin"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57552"
FT                   /protein_id="ACY57552.1"
FT                   /translation="MSLSIHTNASAKTAINSLSNEGLANAKSSQRLSTGFRINSPADNA
FT                   AGLQITNRMEKFLNSAGQAKQNIQESIAMLQIADGGLAESVKTLNAMKKLATQAANDTN
FT                   SAADREAIQKEFSELGKELQNALNNTEYNSEKLFADGGKMRKELNFQSGTDAESSLKLD
FT                   LNSVIAELTESVTKPGLKANSGGTAEEKELARLEGLAKDAKSTAATTKSAETTLLVDDA
FT                   TGKGGKGGKGGNASIDIIIPAHKDTTGKDVAEKKIASGTAITPANITSMADAKAYWDKQ
FT                   EIETPKAVNEYVVKHSADSGVMNMQLADKDLAMKADKKLSDVIDAYGAFRATLGANQNR
FT                   LQSSSNNLDNMISNTAQALGSIKDTDFADEMKNHAQSEMLMQSSVMMLKKANAATQLIS
FT                   TLLQG"
FT   gene            790890..792089
FT                   /gene="flaA2"
FT                   /locus_tag="YPD4_0644"
FT   CDS_pept        790890..792089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flaA2"
FT                   /locus_tag="YPD4_0644"
FT                   /product="putative flagellin"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57553"
FT                   /protein_id="ACY57553.1"
FT                   /translation="MSLSIHTNASAKTAINSLSNAGLSNAKSSQRLSTGFRINSPADNA
FT                   AGLQITNRMEKFLNSAGQAKQNIQESIAMLQIADGGLAESVKTLNAMKKLATQAANDTN
FT                   SAADREAIQKEFSELGKELQNALNNTEYNSEKLFADGGKMRKELNFQSGTDAESSLKLD
FT                   LNSVIAELTESVTKKATPVKADVAGSTLEKEADVLDKATKAAKKAKEAAEGVQKTLETD
FT                   FAVAGNKASAKITIPEYKDALGKTVPEVVINSGTAITPANSTQMKDAVAALKATHDAAV
FT                   KAEATFQAKNSTGGGVMNMQLADKDLAMKADKKLSDVIDAYGAFRATLGANQNRLQSSS
FT                   NNLDNMISNTAQALGSIKDTDFADEMKNHAQSEMLMQSSVMMLKKANAATQLISTLLQG
FT                   "
FT   gene            792372..793577
FT                   /gene="flaA3"
FT                   /locus_tag="YPD4_0645"
FT   CDS_pept        792372..793577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flaA3"
FT                   /locus_tag="YPD4_0645"
FT                   /product="putative flagellin"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57554"
FT                   /protein_id="ACY57554.1"
FT                   /translation="MSLSIHTNASAKTAINSLSNAGLANAKSSQRLSTGFRINSPADNA
FT                   AGLQITNRMEKFLNSAGQAKQNIQESIAMLQIADGGLAESVKTLNAMKKLATQAANDTN
FT                   SAADREAIQKEFSELGKELQNALNNTEYNSEKLFADGGKMRKELNFQSGTDAESSLKLD
FT                   LNSVIAELTESVTKQAPKITGKSSSATGSLEKQAYDLDKAVTDTKSLVAGAEGVQKTLE
FT                   HDFAASGNKAVAEIKIPEYKDALGKTVPEVVIALGAVITSANSNQMKDAVAALKTTHDA
FT                   AVKAEATFQAKNSTGGGVMNMQLADKDLAMKADKKLSDVIDAYGAFRATLGANQNRLQS
FT                   SSNNLDNMISNTAQALGSIKDTDFADEMKNHAQSEMLMQSSVMMLKKANAATQLISTLL
FT                   QG"
FT   gene            793797..795074
FT                   /gene="fliD"
FT                   /locus_tag="YPD4_0646"
FT   CDS_pept        793797..795074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliD"
FT                   /locus_tag="YPD4_0646"
FT                   /product="putative flagellar hook-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57555"
FT                   /protein_id="ACY57555.1"
FT                   /translation="MITVEPEKQAAFSADKTVFRKRNRLEAQQKQINSQKVSSNKLQTS
FT                   VTDFRSALNQLNQRDSGLLKIKTTSSDDKLVSASATAQAVKGKYHLFVEQLAKTDQIAL
FT                   KGITDNQLTLAAGPIDLSVGKTTLTVDLTSVNSLEELANAINNASDKAKNSDGQGITAS
FT                   LVRTGSDVVLTLSSNKSGAAHKLDVSKLTTKISAATEQQLAAGQDAIVWLGEQNKGIKI
FT                   THDTNVLDKAIQGLTLSLQKEKVAVEVGVEIDNEASEEQLKTFVSKFNQLQKLVESSSS
FT                   VPNASAISTLLNNIIRSPIDGERIYAFGVTSGRDGELTIDSKQLQQTLSSNTQHFNEFF
FT                   NGKNGVVNKLTEALEPYINVTSGLFKLDNDRLSLDITAIEKELKVVKDDYDNAYDKYLV
FT                   VYTGIRNMLTKMNATLELFKPEKEQK"
FT   gene            795084..795464
FT                   /gene="fliS"
FT                   /locus_tag="YPD4_0647"
FT   CDS_pept        795084..795464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliS"
FT                   /locus_tag="YPD4_0647"
FT                   /product="putative flagellar protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57556"
FT                   /protein_id="ACY57556.1"
FT                   /translation="MMYDEPMAGLYQQTDIAIQAAATPHQLVMMLFDGLRDELICAKGH
FT                   IEAGRYEHKVKSINKCINILNGLTSVLNYEDGGDLSVTISKLYDYCVYRLYEASNLLSI
FT                   EIIAEVEGILAALYQGWEGMKH"
FT   gene            795466..795792
FT                   /locus_tag="YPD4_0648"
FT   CDS_pept        795466..795792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0648"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57557"
FT                   /protein_id="ACY57557.1"
FT                   /translation="MTILATAEALSGELESASQSKDWPRLLLLDERVAHLLVSIAKQKL
FT                   SSDCVQSLKLLQQSHQRAIQRCQAYQQVLKADMEQMRNRQEGISAYAAMAIRAYQDMAQ
FT                   EEGR"
FT   gene            795794..796957
FT                   /locus_tag="YPD4_0649"
FT   CDS_pept        795794..796957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0649"
FT                   /product="putative flagellar hook-length control protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57558"
FT                   /protein_id="ACY57558.1"
FT                   /translation="MITLNTTTLNTLSQVTDSFAPTKEEIKVPATARPEGVSVSNLANF
FT                   DAVLSQALVPHQPISLSPAAVEEVIAAFDAEGTVDSHEADLTLSADEQNQQLLDTLLQT
FT                   QPANVSPMALKPAVQSQAFQPVRSEGEQPTPLSDSVPVSLSTPERSLTQNESLFPLLRN
FT                   GPSASQVQIDSPVQIGSPVQIGSPVQIGSPVQIGSPVQIDSPVQIDSPVQIDRHVQINS
FT                   PIQIGSPVLNGSHETSTASRIDSPLTLANNREEWPQQLRMALGERLQVQADNRVQHATI
FT                   RLDPPDMGKIDISIHFEGGKLQVNINANQGEVYRALQQSSAELRQTLIGQNSTEVNVQV
FT                   SANSQQQQQQPQPRHSNHHGQADILAAQHFESQAEINADDGTLLITI"
FT   gene            796996..797466
FT                   /locus_tag="YPD4_0650"
FT   CDS_pept        796996..797466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0650"
FT                   /product="putative flagellar biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57559"
FT                   /protein_id="ACY57559.1"
FT                   /translation="MKTKKKVFSPKIRAFLLLISGMAAVFLFSRESVLKQMGYQPATVS
FT                   QSFTRGNKAVQFVEIKNMVITLKDNNTERYLQLELGMATGDDKDIKNVIAMVPVIQATT
FT                   VNLLSSMDYQAVRHTSILDLRRQLMNEYKQDFAGLNVPMPFDDVVISRMVFQ"
FT   gene            797472..798167
FT                   /gene="fliA"
FT                   /locus_tag="YPD4_0651"
FT   CDS_pept        797472..798167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliA"
FT                   /locus_tag="YPD4_0651"
FT                   /product="flagellar biosynthesis sigma factor FliA"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57560"
FT                   /protein_id="ACY57560.1"
FT                   /translation="MENREFEACLTLTAEEEGKYLNAYLPLVKRIVRQLSFQADSVIGK
FT                   EDMQQIALMGLLEALRRYGHPDGQFAAYAVHRIRGSILDQLREHDWRPRRLRQKTHKTN
FT                   EAIRQIAKRLGHEPNFEEISAELNLTADEYQEYLLLENAGAMESLDEILALEAHNDILQ
FT                   SRDLEENIIIEDNLKQAISTLDEREQMILHLYYQQELSMKEIAQVLDLTEARICQLNKK
FT                   LVQKIKSFF"
FT   gene            798183..799049
FT                   /gene="motA"
FT                   /locus_tag="YPD4_0652"
FT   CDS_pept        798183..799049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motA"
FT                   /locus_tag="YPD4_0652"
FT                   /product="flagellar motor protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57561"
FT                   /protein_id="ACY57561.1"
FT                   /translation="MQKLFGLLVIMGCVIGGYLMSGGSLSSFWQPGEIIIIFGSGIGAL
FT                   ILGNPGSVLQEMWHQILAVARRSEYTVEFQQQLLLLLYELLEMVDEGGLKRLDEHIEIP
FT                   ANSSVFQRYPLILQDLHLITFISDNFRLMAMGKINQHELESILEQELSAVEEELLVPSR
FT                   SFQRIGEAMPGFGICAAVLGIIITMQSIDGSIAMIGIKVAAALVGTFLGVFICYCLMDP
FT                   LSNAMEQEIKKKLALFECVRMVLVNHVAGKPSLLAVDAGRKMLPMDNKPTFATLDSWIN
FT                   KLITAGV"
FT   gene            799049..799960
FT                   /gene="motB"
FT                   /locus_tag="YPD4_0653"
FT   CDS_pept        799049..799960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motB"
FT                   /locus_tag="YPD4_0653"
FT                   /product="flagellar motor protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57562"
FT                   /protein_id="ACY57562.1"
FT                   /translation="MRNHASGGATTIIKRANRKKHHVRHSGAWKVAFADFTLAMMALFM
FT                   VLWIVGVVSEEERQEIVAQLNGKTIFAQQSFISIPSKSKSGGGKLSNSIDGKEQAKETK
FT                   SNLAIEVPEPEQSLEEVVDKSRHEMEELSRIIMQITSAYNAQSNLQMEVVPQGLRILIQ
FT                   DDQQRDMFQRSSAVLTPFFSRLLGELAPAFNEMDNKIIITGHTDASRYRDQLLYNNWNL
FT                   SGERALMAHKALVNGGLDEGRVLQINAMADQMLLDPTDPLAAKNRRIEIMVLTKTASDT
FT                   LYQFFGHHGENVVKPAAEKAEK"
FT   gene            800420..801016
FT                   /locus_tag="YPD4_0654"
FT   CDS_pept        800420..801016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0654"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57563"
FT                   /protein_id="ACY57563.1"
FT                   /translation="MNGIENHKKTNIFFIVERLYPRDSLAPSVGTVGPSLVQVHRMIYQ
FT                   LTKKQDVFLDGEKVDLSNITLWQRLKSITGGKITTKDSQEVKFAYVLDYAGSEFAAVPI
FT                   QGLRLEGNTNYFYKKFTKEYKISTPKLLHYGSDTIKNITLHGRSNVSFFMDNGGRNAPT
FT                   AAAKYNKNTGEISLIKSMHELSKSMQDIKNSGART"
FT   gene            801013..801468
FT                   /locus_tag="YPD4_0655"
FT   CDS_pept        801013..801468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0655"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57564"
FT                   /protein_id="ACY57564.1"
FT                   /translation="MMLTTPKWGLPLLIIVYAAIGFVVPNALVEVYFHGKHLMVDDAEA
FT                   FIRKPLIDAAMFAVGICVIYYLFTLVDKYDSLKKEMIFHVKFLLTNAVLLLVILYLSSR
FT                   DDVRLNEAVVSVTVDYINFYPYYIISTVISFIILFFLRKKKSNENNQ"
FT   gene            803610..804125
FT                   /locus_tag="YPD4_0656"
FT   CDS_pept        803610..804125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0656"
FT                   /product="insertion element DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57565"
FT                   /protein_id="ACY57565.1"
FT                   /translation="MKHPFSTRLAAVQHYLSGKATLRETARQFSVGKSPLTRWIRAFRR
FT                   QGEAGLEHHLSRTYTPEFRLCVVRYMMANRCSAADASAHFNIPNETIIQNWMKRYREGG
FT                   KEALNPSKTGPTMPKDKYEHDSKPFSEMTHAELEKELEYLRAENAYLKKRKALREEKAL
FT                   REQQKKPE"
FT   gene            804179..804778
FT                   /locus_tag="YPD4_0657"
FT   CDS_pept        804179..804778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0657"
FT                   /product="transposase for insertion sequence IS1661"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57566"
FT                   /protein_id="ACY57566.1"
FT                   /translation="MARSTYYYHASKPDGVIDDYADAVKAIGALSRRHAQRYGYRRMTV
FT                   ALRKEGFTLNHKTVRKLMNQHGLLSLIRRKKYRSYRADGGRASDNLLARNFTSEISGLK
FT                   WCTDVTEFRVGAQKLYLSVIQDLFNNEIISWHMSERAALILTCKTLEKALKVKGRKEGL
FT                   MLHSDQGWHYRTPMWRSMLVEAGIRQSMSTQRQLFR"
FT   gene            complement(804855..806018)
FT                   /locus_tag="YPD4_0658"
FT   CDS_pept        complement(804855..806018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0658"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57567"
FT                   /protein_id="ACY57567.1"
FT                   /translation="MSKWSEEKSWEWHKQQGWLRGFNYLPRTAVNWTEMWQQDTFDPAC
FT                   MTQELQWAAEAGYNTLRTNLPFVVWQHDPDGLMTRVEHFLDICQRVDIKVMLTLMDDCG
FT                   FSGDHPFIGQQKQPIPGLHNSQAAASPGRNVVMQPYLWGQVERYLKEIIGHFAHDERIV
FT                   IWDLYNEPTNRMIFTLAGEDAFDPALEEYSHQLMEKAFMWAREVNPTQPLTVGAWHIAN
FT                   ILDLGAPIYQHPTDIRALELSDIISFHAYVPLDLMNKAIGLLKEYKRPMLCTEWLARHA
FT                   ESKMHEQLPLFNAEGIGCYQWGLVKGATQTHIPWPEIKRTDNDYASRWFHDVFNEEGTA
FT                   YALNPKTWTSALLLFYLSPVFCRTHSACFQANALCIVIMDIFYNVTL"
FT   gene            806312..807061
FT                   /locus_tag="YPD4_0659"
FT   CDS_pept        806312..807061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0659"
FT                   /product="LacI-family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57568"
FT                   /protein_id="ACY57568.1"
FT                   /translation="MNKKTKVTMSHIAAKAGVSQSTVSLVLNGSYSIKLADDTREKVLR
FT                   IAQEMGYVHKAVERPIARDKIALIINGLINHDPFIEAISAVQQAAWQHNKLLAIFDQEN
FT                   EPEHCAALEEEICRGGYQGVIYASCMTSQLAPMFRNLSIPMVMLNGYCPELPDVPCILP
FT                   ADKIGAYKATSHLLQQGYKRIAILAGELWMDAANDRISGYRQALINHDICPDEGYIQVT
FT                   NWSLKEAYKKTLAIAGTHCQTRSHFLQ"
FT   gene            807614..808984
FT                   /locus_tag="YPD4_0660"
FT   CDS_pept        807614..808984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0660"
FT                   /product="Sodium:sulfate symporter-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57569"
FT                   /protein_id="ACY57569.1"
FT                   /translation="MADAPLSTAAPPSISRRNLAILITDILLFILLLNVLPFDTNANRG
FT                   LAFIGILWLTEALHVTITALLVPLIAVGTGLMDVNTGLRSFANPIIFLFFGGFALATAL
FT                   HIQGLDKLIANRLLLAAKGQLMVAVLMLFGATALVSMWISNTATTAMMLPLALGVIGNL
FT                   NLERERNTYVFILLGIAYSASIGGLGTLVGSPPNAIAAAQLGLDFVGWMKYGTPAMIIL
FT                   MPLMVATLYVILRPNLKHHFDIELEQLPWTAARRITIGIFGMTVIGWIFSSQLSQMLGG
FT                   VKQFDTLVALSAVVLIGISGVASWRQIQQNTGWGVLLLFGGGLTLSVILRDSGASAVMA
FT                   QGIVSIFGAYHWFIIILAVATFIIFLTELTSNTASAALLVPVFATVSEALGMPPLLLTM
FT                   IIGIGASCAFMLPVATPPNAIVYGTGFIRQPEMVKVGFWLNIICIIVVSLLAWYLWY"
FT   gene            complement(809164..809577)
FT                   /locus_tag="YPD4_0661"
FT   CDS_pept        complement(809164..809577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0661"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57570"
FT                   /protein_id="ACY57570.1"
FT                   /translation="MPFFYLQIRKNHLTLKNLDSQKVVSGTANFSTERLLIGEFFIAEA
FT                   CLYPLVSQVLPGFINQLKRRCLRTHILIHAQEMLEGGVSQVEQRIMREFTVPSFPKGYH
FT                   SLYAAPQTLSDDAVKRIILMGSETLLTAADLKI"
FT   gene            complement(810638..814954)
FT                   /locus_tag="YPD4_0662"
FT   CDS_pept        complement(810638..814954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0662"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57571"
FT                   /protein_id="ACY57571.1"
FT                   /translation="MAMPAVKHFDPVIGLDVHTVIIPPSPAPIPIPHPHVGFVLDLREC
FT                   VNGVKSVVGSIVFSFAAEAAADVMEDNPELLAAGMALVSKAGSALEAAANNPVVKTGLA
FT                   LKDAKDQLSGLKAGIIDTLGGNIGGGGGSNRPVKVNGTLRSTVGTHTFHIPGLHFPLGT
FT                   LFAPLIPSKDSESFMGSKTVMANGDPLSYMALPAMSCWFVGLPSTPKNAAHTQRKSLSL
FT                   PTSVMLPIPMGRPVVVGGMPVLNLLALMMGLFKIFRGSKLAKKLAEKLGLKSGFLKCTI
FT                   LDAEPVNSITGEVVVEQNDFVVEGRFPLVWDRYYGSQKAVTGVIGQRWQCPADIRLEVL
FT                   VDQGELGVVARFPDHETVFSLMPIEQGWDERVYDWQQGHALYRSGNQLVLRTRHEEEYF
FT                   FTLPNDWESTVIPFTAADRLTLPILRMADRYGNGWQFKRQGNSLLLALIELTQGLLSGR
FT                   EVHVIQDENAPISGMLNDFVLVNKTNGERRFLVGYRHDGEGNLIATLDADNHPYQFEYI
FT                   ADSQMVRHTDRNGLSFYYRYQRHSDGLDRVEHAWGDGGLFDYRFHYDRVYQETQITDSL
FT                   GHTTLLRYDERGLPFARVTPLGGVYSYQYDAQCRTIAEIDPAGNTHGWMYDQYANLTEE
FT                   TFADRSSVKTEYGDDHKPVRITDPGGRFWRQSWDAQGKVISQTTPGKIATHFTYDDLGQ
FT                   LVAVVDASQQRTELAYDAWGFLRVITDARGNATSFKHDFCGNLLKKVAANGDITRYQYD
FT                   KKQRLTGCTLPDARTIRCEYDREDNLLLYNENGSRITRFGYFGQGRLQSRTDPDGSLTE
FT                   YLYDTEEQLIGVKNQRGKTWQLKRNAEGRLIEEVDYWGQSRRYQYNAVGHLTGSHDPLG
FT                   QILAVTCDKLGRITEKNIAGDEQAWERYEYNVQGQLIGAVNPAVTVTRRYNQDGQLAQE
FT                   IQQQPQVSATVEYGYNAAGQQVEQRHLLQYADEDDIQVQQRIRYGYDVLGQCISQQIDD
FT                   HRPMAFSYDKIGRLTEQRLTPSLSHHLRYSAAGQLAGYQTRRKGMVWSETDYFYDQHGN
FT                   LTQREDSRQGSERYHYDVLGQIVGYQDPLGTLHRYRYDACGDRFSTVADNAEGRHTQQD
FT                   NGTAYQLDKAGQLVSRTDRFSQLALRWNTFGRLAGIKNEHHDHAYTYDALGRRVGKRHL
FT                   QRPTKLLDGLRVIDKETPSRGEPVWQDETWFMWDGDVMVGELQREVAPRVVTPETWDKP
FT                   DGIVYSGQFYVYQPDSFEPRAMQRYQQIAEAEDGEIAPLGEEQIYFYQNDPNGMPIRLQ
FT                   DGEGEVVWEAQFTPFGQLSVTGTSQLRQPLRMQGQYYDTESGLHYNRYRYYDPACGVFI
FT                   SQDPIGLKGGLNPYQFAVNTLGWVDPLGLWKKRRNNGQFAKKPGRKKTNLVIQHMEIAM
FT                   ILINQQKGILCVIVISVMLRNMVKQLKVRRDTLRSI"
FT   gene            complement(814968..816287)
FT                   /locus_tag="YPD4_0663"
FT   CDS_pept        complement(814968..816287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0663"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57572"
FT                   /protein_id="ACY57572.1"
FT                   /translation="METPGVSNPIERRFMQAHDDWLTFAGNKKAKLLLWQANEADEPLL
FT                   KTYFQVQEENACAVIQFDDVFETAEQFTDAIIKHIIHFYHQRREGSAAAGITADWHPPE
FT                   LTSPGSHQVLFTIAKSLIQHHPDVFPGFVWVFRPNIVVSEPRFTEWLLTLTADLCLDPW
FT                   LAERLRLVLYGELSDGIQSLSQAAPENIQLINGVYHMAGAPGEMVEESTERGPGADFRR
FT                   LFIALTETIPLNDPSRLARLQKQALNISQKEGWFDQSVVIYLLVGAAQLKWQDFPRALS
FT                   AYQSAAQEGENAIIADHPAGNKLVANALFGEASVYFSQKEYAMAAQCYESIAPYTEAAA
FT                   DAVLTIETWRMSAYCWWEDNYFTLAWNAGLNALKIGLPLGDDIKTNSSLGVAAYWMHQH
FT                   YGRWENYDDELRTVLSALYGDEWLDIITPLDQRNITLAAG"
FT   gene            complement(816313..818538)
FT                   /locus_tag="YPD4_0664"
FT   CDS_pept        complement(816313..818538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0664"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57573"
FT                   /protein_id="ACY57573.1"
FT                   /translation="MFADSNKAKVKERSAVNSASTGTAAISAAINAPSGLQFKLTAAGL
FT                   PPQTFAVVDFSLNEAFSSPFVLHVGLASADPAVDFSAVLDEDATLSIWREGILQRSITG
FT                   MIASFEQGNTGFHQTRYSMVIRPALWRTSLRRNSRIFQLESVEAIISTLLKENGINDFA
FT                   FGFRHSHPAREFCVQYQESDFDFIQRLTAEEGIFYYFEFSTGKNTVVYADDVGSLPKGA
FT                   SLPYNPNVAAQAQELSITTFTRSAQVRPAMVQLKDYTFKNPKWAAEFSEQARELQNQRP
FT                   DYEHFDFPGRFKDEQHGKDFTRYRLEALRNDANKGQGESNEFTLQPGQLFSLSAHPRDD
FT                   LNHAWQIVSIQHTGKQMQALEQESGDQGTVLFNQFSFIPPTQTWRPTPLPKPVTDGPQI
FT                   AMVVGPPSEEIYCDEYGRIRLQFQWDRYGQSNDQSSCWIRVTQPWAGQGWGMLAIPRIG
FT                   QEVVVDFLHGDPDQPIVTGRTYHANNLPPSALPGAKTQMALQSKTHKGEGYNELRFEDQ
FT                   DGKQELSMRAQRDMNTTVLNDRSTTVSGNHTETVTKDQAVTVSGNQTMDITQDQTITVT
FT                   GTQRIDVTQDRIIDVTAEQQTTVKADDRLLISGKQKTKIDLDQEYEVVGSQKKTIGANQ
FT                   TLKVGGYQKNTLEGYKKSKIGGDNTTTVGGHDKLTVGDTITITAGTSITLQCGASSIVM
FT                   DEAGNIKITGVNITSAASTTHTIKAKTVTSCGDTENIVEGGILKLNP"
FT   gene            complement(819124..819807)
FT                   /locus_tag="YPD4_0665"
FT   CDS_pept        complement(819124..819807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0665"
FT                   /product="Outer membrane autotransporter barrel"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57574"
FT                   /protein_id="ACY57574.1"
FT                   /translation="MNFTYGKAKADIHSFFGDGRINSAGYGLGTSLTWYGNNGVYVDGQ
FT                   LQTMWFDSDLSSRTAGHAVASGNNGRGYTSAIEAGKGYALGNGLSLTPQMQVTYSRVDF
FT                   DTFRDPFDSEVSLQEGDSLRGRLGVSLDKETTWSAKDGTTRRSHIYSHLDLHNEFLNGS
FT                   KVQVSGVEFATRDERQSVGLGAGGTYEWQNGRYAVYGNVNLLGATRNVSDNYAVGGTIG
FT                   ARVSW"
FT   gene            complement(819816..822893)
FT                   /locus_tag="YPD4_0666"
FT   CDS_pept        complement(819816..822893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0666"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57575"
FT                   /protein_id="ACY57575.1"
FT                   /translation="MFMPFREFISSHVGRHPLFNRAPVAVINPITLAIIVAFSTLALPQ
FT                   TARASCNNSGGSTYICEGENNAGIILSGTDITVETQLGFGIIEPGDIDPALSLIGSGAI
FT                   SYLDTNSSALDTAGAYSLSIQNDTSMIGQSTSTNVQANGSIGSGIYISSQSRDNSTIQV
FT                   DLSGMLSSGLNGTPALSIDSLADNDSTIILNIHAISGIAGIQSDNNSRYGTAITNVDIA
FT                   NDINVEYSGASIQNYSNSGTSILNLNSKSISTDFDALDINNSNYSGEVMTDINIDGDIS
FT                   SANSQAARIYNHTNSGLSSLRFRANNVTGEYAGLYIDNSSQNGAVTDIILTGDLTATSG
FT                   SALYANTYSEEGNVETAIKLNNVYSLYDALNIYGYNQTGNTLFDLDVSGTVTSENGTGI
FT                   KVMGTTFEGNSTILINVNNITSSSQSLDINNYNSSGSALSAITATGHLAAEWGQGVTFQ
FT                   TYSSLGDATTLIHVNDITSMGNGIYSLTEASRGTVTTDVTVTGQINVSDGEGITLNTQT
FT                   IDGNTLVNIDVNNIASEYDAIHLYNNNNTTGVDNGTGVDNGTSTIDLITRGALVSQQGY
FT                   GINLETNTADTYVTVGGLVHGGNGSAIGIHRLDNIQTSATLELQSGYALEGATQSLVFT
FT                   GNYVDINDAALDLANSHLVLGGTGDAVFDLTRIDNREEAILDGDPNRITGFGTLTKTNS
FT                   SIWTLTGSNMADGDANAFLSANIAGGILVLDNATLGLTPATTILNRLSAADIAADPTLV
FT                   ATETGALTLAEGGALSSLGDSVLSGNLISAGGILLSNTYTGGNGAATDDRLTVTGTYLG
FT                   ENNGSGEGAWLALDTVLGDDDSATDRLVINGDATGTTSVRVNNAGGLGDKTLNGINLIT
FT                   VDGLAQDDTFLLAGDYVTTDGYQAVVAGAYAYTLQADGEAATAGRNWYLSSELMLTEGV
FT                   RYQVGVPLYEQYPQVLAALNTLPTLQQRVGNRYGAPGALADLNFDDNQWAWGRIEGSHQ
FT                   VTDPARSTSGSQREIDVWKLQTGIDVPLYQSQAVHC"
FT   gene            complement(823549..825537)
FT                   /locus_tag="YPD4_0667"
FT   CDS_pept        complement(823549..825537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0667"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57576"
FT                   /protein_id="ACY57576.1"
FT                   /translation="MHGGNGTAIGIHRLENVQTSATLELQSGYALEGVTQALVFTGSYA
FT                   EINDAALDLANSHLVLGGTGDAVFDLTRIDNREEAILDGDPNRITGFGTLTKTNNSIWT
FT                   LTGANMADGDANAFLSANIAGGILVLDNATLGLTPATTILNRLSAADIAADPTLVATET
FT                   GALTLAEGGALSSLGDSVLSGNLISAGGILLSNTYTGGNGAATDDRLTVTGTYLGENNG
FT                   SGEGAWLALDTVLGDDDSATDRLVINGDATGTTSVRVNNAGGLGDKTLNGINLITVDGL
FT                   AQDDTFLLAGDYVTTDGYQAVVAGAYAYTLQADGEAATAGRNWYLSSELMLTEGVRYQV
FT                   GVPLYEQYPQVLAALNTLPTLQQRVGNRYGAPGALADLNFDDNQWAWGRIEGSHQVTDP
FT                   ARSTSGSQREIDVWKLQTGIDVPLYQSQGGSLLTGGVNFTYGKAKADIHSFFGDGRINS
FT                   AGYGLGTSLTWYGNNGVYVDGQLQTMWFDSDLSSRTAGHAVASGNNGRGYTSAIEAGKG
FT                   YALGNGLSLTPQMQVTYSRVDFDTFRDPFDSEVSLQEGDSLRGRIGVSLDKETTWSAKD
FT                   GTTRRSHIYSHLDLHNEFLNGSKVQVSGVEFATRDERQSVGLGAGGTYEWQNGRYAVYG
FT                   NVNLLGATRNVSDNYAVGGTIGARVSW"
FT   gene            complement(825654..827312)
FT                   /locus_tag="YPD4_0668"
FT   CDS_pept        complement(825654..827312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0668"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57577"
FT                   /protein_id="ACY57577.1"
FT                   /translation="MYIQFREPISTSPAQPDAGHRHLFSCAPAAAINPITLAIIVAFSA
FT                   LVLPQTARASCNSSGVGTYVCEGENHAGIILSGTDIAVETQPGFSITEPGGADPALSLI
FT                   GSGAISYLDTNRSALDTTGADSLYIQNDTSMAGQSTSINIQSNSSIGSGININNRSGAD
FT                   AAIQIDLSGTLSGNQNGSAALSIHSSAEGNSAFILNLDALSGSMGLQSYNDSRSGIATT
FT                   NINIVNDINVEYSGASINNTGNGETSIINFNSKNITTEFDGLNVYNTNYAGAAITNINI
FT                   DGDIRSANSQAATFYNSAYEGPSSLRLRANHVTGEYAGLYISNDSRKSSAITDILLTGD
FT                   LTSTSGAGLVFNSYVEEDDIGASIKLNNIYSYYEALSLSANTLNGDMQFDLDISGDIVN
FT                   EYGTGILMMGMASEGNSTIIINANNINSGSQSLKVNNYSHLGTAVSDITATGHLVSEQG
FT                   VGAIFSTYVSQGDAIAVINLNDITAAGSSVEIDTIASEGNSTTYLTVVGQINASNGEGI
FT                   TLISQATDGSTWSTLTSIISPVNTMLFTSITLLLA"
FT   gene            complement(828313..829794)
FT                   /locus_tag="YPD4_0669"
FT   CDS_pept        complement(828313..829794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0669"
FT                   /product="gluconate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57578"
FT                   /protein_id="ACY57578.1"
FT                   /translation="MTRHLRLYCQSEGEFESIKTIKFGPTNIAADTKARILRFNYWGKQ
FT                   EMEWINILWVMLGIGLMLVLNIRYQINSMVALLLAALLVGTLAGMDLLKLLHTIKAGFG
FT                   GTLGELAIIVVFGAVIGKLMVDSGAAHQIAQTLLRRFGLKYVEAAVIIIGLIFGLAMFY
FT                   EVAFIILAPLVIAIAVEAKIPFLKLAIPAVAAATTAHSLFPPQPGPVALVAAYGADMGM
FT                   VYIYGVLVAIPSVICAGLILPKFLGNLERPIPTFLKSDNPIDENNLPSFSTSILVPLIP
FT                   AFIMIFTTIANIWLVKGTTSYTILNFIGSSPIAMFIAMLVAFVLFGTGRGHKMEWVMHS
FT                   FEGAVKGVAMVILIIGAGGALKQVIIDTGIGDTIGMLMSAGGVSPYIMAWLITVLIRLT
FT                   TGQGVVSAMTAAGIIGAAVMDPVTGTITSVDPALLVLATAAGSNTFTHINDASFWLFKG
FT                   YFELSIKDTLKTWGLLELTNSVVGLAVVLLISMFV"
FT   gene            831196..831594
FT                   /locus_tag="YPD4_0670"
FT   CDS_pept        831196..831594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57579"
FT                   /protein_id="ACY57579.1"
FT                   /translation="MFSCIIKTTDNYFRHGLFILLKEALMDCHVNANATLADDADWHTK
FT                   MVFIDADSSYCHRTLEQTYQAYKNQQSGTPGIFIILRSKGALLPLNMSYNTSAHILYKS
FT                   DEQADIKSKIGVVIKNALGRKNTINPTV"
FT   gene            832030..832905
FT                   /locus_tag="YPD4_0671"
FT   CDS_pept        832030..832905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0671"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57580"
FT                   /protein_id="ACY57580.1"
FT                   /translation="MRSNNKFTLKKLALALMLAGCTISNAYAVLIPVAGAIQGSAPTLS
FT                   APSNSALHAVDLSSNATGAVLASGDTITLTYTYNDADEDLDNSINYVNWYYTKGGVDTQ
FT                   IATTNITNSPAKTNDGKGRSVLIIPATAIGADAIKVVIQEFSASGDPISGQTISVADTS
FT                   TGGGGTTTRPGPIAPGSNVTPGIYLSTDTLFTNNLLGSETILSANNVYVFKLWDSEAVG
FT                   VIDLTNAVHYNWRLLGDSATDSVAAPTTGFVTSVSNADFSVPMNTAADGTQLTGSVDGM
FT                   QGFQLTVDYN"
FT   gene            complement(833228..834985)
FT                   /locus_tag="YPD4_0672"
FT   CDS_pept        complement(833228..834985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0672"
FT                   /product="ABC-transporter transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57581"
FT                   /protein_id="ACY57581.1"
FT                   /translation="MIKLSGLSTLTGGRLKGLKGMVSIAIIDAFLASLPYAFLYYIVLD
FT                   MLSSHPDAIYQLKLTGFCGLLMLVRVILARVLYFHVAIIGFDAGAKIRIRLGEHLRRLP
FT                   MGFFYRSDMSSVNNTLLKDIDMIENIFTHLYAPIIATASVLCFFSLGLLLKDWRMALAM
FT                   LSTLPLAVCAYILTRRYAQRWQEYMQLLMFKLNDALMEYIDGLKELKAYRMTGAAFQRL
FT                   SQVLTTTYQQSLTAEKAGVWPIYSFNVLVECGFIVLLVALTWGWVGGRIPLSEVLIFLI
FT                   AAVRFFRPLLNMSMFLAELNYFGLAVERVEKVFAIPELVHGDLQPNITDMRIRLDNVCF
FT                   AYPDKPLLFNHLNLTIEKNKITALVGPSGSGKSTLASLIARFWDIEQGHILVGDKANEM
FT                   SLAEIDVDYWQRHLSVVFQKSYVLNETIANNLRVACPDATNEQLLSVCRAAQLLPLLDK
FT                   LPSGLDTEIGAGGVHLSGGELQRLAIARALLKDAPLIILDEATASLDPENEQDIQLAMQ
FT                   ALIRGKTVLVIAHKLSSIQYVDHIIVMDSGQIVEEGDHSTLIQHQGLYAELWSLQQQAQ
FT                   AWQPGRLGE"
FT   gene            complement(834982..836676)
FT                   /locus_tag="YPD4_0673"
FT   CDS_pept        complement(834982..836676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0673"
FT                   /product="ABC-transporter transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57582"
FT                   /protein_id="ACY57582.1"
FT                   /translation="MILAVGYSLLSLVPYVLIYQLIANFLYHPSAATSQLWWLVGMAVL
FT                   ALAGKAILQLASGLLSHQAAFQLLFELRRQVIERVGRLPLSVSHQHTTAKLKKIISDDI
FT                   GRIETFVAHHLPDMAAAIVTPIAAAILLFFFDWRLALVALIPLPIACLLQCWMFQGFNQ
FT                   RITVYYHVVADLHTSIVDFVKSMPLVKAFNMTVNSHQRYTNAVNAHNQLVREWLTETRT
FT                   ATALFKLSLDLGLLCIMPVGIMLFSQGEVTLAVIFMFMLLGIGLMEPLYNLLRFGNLFS
FT                   ALLKGVENIREFAHAKPQREGQTPLPIKHYDICFNQVSFRHPDAKENTLEQLSFVAKQG
FT                   EITALVGPSGAGKSTAAQLIPRLYEHQGGDICIGDTPIEMLPLEQLMSLTAFVFQDTFI
FT                   FNDTVMNNIRMGNDSLTEAEIINAAKAACADDFIEQLPERYQTVIGPETLSGGQAQRIA
FT                   IARAIAKNAPIVLLDEATAYADARNEVRIQQALSDLIKDKTVIVIAHRLNTLIHVNHII
FT                   VMAEGRKVAEGTHQTLLATHSLYQNMWAAHQAAKIWHFSTDAKGSLL"
FT   gene            complement(836751..838055)
FT                   /locus_tag="YPD4_0674"
FT   CDS_pept        complement(836751..838055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0674"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57583"
FT                   /protein_id="ACY57583.1"
FT                   /translation="MKYNANITSLFGLSSLFGLFSLFGLYCAQGVPLGLAIFALPGILR
FT                   SLGADMRLIGLVGLSMLPWAFKMLWASFIENHKPWFFRGLPTGLAWIQFCKVCSLIAMT
FT                   LLWFFAPETHVLALLLLVTLINFFYASQDVAVGALVVRVFAGSRHVRVNVSQIAGFSLG
FT                   MLLGGVVSLYVFSVWGWSVTVWWFLLLQGLCHLPFMFHLGRFAAENKLPVIPGSASLWK
FT                   IFRRKGWVPIVVMAVVFKFASTMGAALVSPLLVDMGVSLEQIALLAGGVLIISYIVGAI
FT                   LSGVLHRWFSSPQLTIFGLLGSMLCWLGMTLSLSFSAHNSLPVFVFFILEGFFFNLCCV
FT                   SIFAWFMCWSEGDEDQGIVQPGTDFTLLQCCEVLGGSIAMVLSGTLAYYLGFTYAFGVA
FT                   TVCAFLVVLLTLYCFRRSQSAYAGFQKDRHTVEIG"
FT   gene            complement(838045..838809)
FT                   /locus_tag="YPD4_0675"
FT   CDS_pept        complement(838045..838809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0675"
FT                   /product="putative thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57584"
FT                   /protein_id="ACY57584.1"
FT                   /translation="MIERLFRLIKPGTRQQMVCFHHAGGSAEYFLPWKTDLPPDTALYA
FT                   IQLPGHGGRINESLLHNLHQMADVIAQSYVYLPVRDTFFFGHSMGAALAFEVALRLQKA
FT                   GRGITTLYVSGRLPPHKNTNTDFYRQSDVSILNKITQLGGSTLDYQQPELKDLLLPIFR
FT                   ADFTAIETYQRQCTELLNCSVMACVGEQDTEVSVRQMSEWCQVTKGAFRLQVFPGGHFY
FT                   LNHAQKRLLAFINQSVAAQQSSKECKEYHDEI"
FT   gene            complement(838802..839929)
FT                   /locus_tag="YPD4_0676"
FT   CDS_pept        complement(838802..839929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0676"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57585"
FT                   /protein_id="ACY57585.1"
FT                   /translation="MIQPQKIVVCGTLFGQVYLSAFKTAFEGGELAGILAQGSERSRQL
FT                   AHAYGVPLYHHVDELPDDINMACVVIRSTIVGGKGSEITKALLKRGISVLQEHPVCLED
FT                   VAECLRLARQQGCHYQVNTHYPHVPAVRQFIAYLHEAMQTQKPCFIEATCGVQVICGLL
FT                   DIIGRVLGGHFSPYGFSVAGGDVLLRSLLENPAPYTQLQGVIAGVPLTLNLQNQLDPAA
FT                   PDNHFHIMHRLCVGLPSGNLLLVNTHGPVIWSPYFHIPRVRTPFGCREVIDPDDAPHYF
FT                   LPPLSQLFSQESDNLLSVLHHQWPSAIRHALREFIEQQQHSSPAYAQFLLSLTQVWKTL
FT                   MEKVGNPESVHFVEPMMASPKVATFLSQWQGERDD"
FT   gene            complement(839926..841002)
FT                   /locus_tag="YPD4_0677"
FT   CDS_pept        complement(839926..841002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0677"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57586"
FT                   /protein_id="ACY57586.1"
FT                   /translation="MRQPKTILVVGGQGAVGQAAVTQLSQRGYWVITAGRREHPNHPHH
FT                   IVFDLFDHKALADSCRQVDLVLNAAGPASDIEAHIALTALAEGKHYVDVAGDPVIERTL
FT                   LVPMAASSSACVLGAGFIPGLAAMLPRYAVDCLSPVTQLTVYSGGIETFTPTSAHDFLS
FT                   SQYTGRAQGKSGYVWYDGGLCKESLKKAVSIPTAQRLFDALPYFSFEHERLVTVHSLSH
FT                   LAAYNLIADQRLLVGLGGEGGGGGAAQTLIAFSQQLTRQEGEQQHLFMVAKGLLAGQPA
FT                   ALQLQIRFTNSYQLTGTIAALAAHHVLCTHRVGLYWLTDLLPIKVLLSQLNALALFSHF
FT                   HIHCQLDNNAVNFQEGAL"
FT   gene            complement(840999..846791)
FT                   /locus_tag="YPD4_0678"
FT   CDS_pept        complement(840999..846791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0678"
FT                   /product="putative siderophore biosysnthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0678"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57587"
FT                   /protein_id="ACY57587.1"
FT                   /translation="MNINLDSSSATQATDLLVNLEQQEVRFWLEGERIKFRAPEGVMTG
FT                   AVMASLKALKPQLVAILAVREQQETLPIDTENRFVAFPLSHVQAAYFVGRQSVFEYGGV
FT                   GCHGYFEILAPCWDKAKLECIWEQMIIRHDMLRAIITPNGEQRILPSVAPFVIEQVDVS
FT                   SETVRQAMSHRVYQTDKWPLFDLKISHQNGKDCLHFSIDLLIADFLSVQILLAELFKGY
FT                   LGQTFPAAPLTASFRDVICYERQQQSGRAYGDARQYWFSRLPTLPACPQLPTCVQLPTG
FT                   SPSPAMQTNASEIPRFVRYRHQLAPSCWRRLQQGCQQQGVSPSAFLLTVFSEVIGRWSE
FT                   NRHFTLNLTVMNRPNIHKDIDKLVGDFTSVSLLEVDLRSPKTVYERVKQIQKQLWQDLE
FT                   HRTFSGIEVMREWGRQQGVGHARMPIVFTSALVGEGKNQVQEAISETQLDLVFDYGISQ
FT                   TPQVWIDCQIMVLQGRLQLNWDVMADVFPKGVVAAMFSTFIDSVERIDSVECIDSIECI
FT                   DRVKCLCMEEVGTGEALCDSPLFWHSALSLPLPESQQQRRKQVNATEKTLTPRCLHDGI
FT                   LARAAQQPQAIALVDPQHCLTYAALITRAQALAAKLNSHQRYAVLMEKRHEQVVAVLGI
FT                   FIAGSAYVPVDIHQPPARILTILSDAAVSGVVTASPQACLADAHFREINLSLLAQIPDA
FT                   IEAKILPLPHDLAYVIYTSGSTGQPKGVMISHDAAYNTLADMQQRMALTPDDRVLALAR
FT                   LSFDLSVFDIFGVLGAGGALIFPDEGDLQNPARWAHDIAQHQITLWNSVPAQMKMLTDY
FT                   LRAEQITLPSLRYILLSGDWIPVNLPPAIAQIAPHCTQLALGGATEAAIWSNYWRIDPQ
FT                   ITYPVSIPYGVPLTNQQFRVVNPWGEDCPDWGAGELLIGGRGVAQGYWQDEAKTQAHFF
FT                   IDTQGLRWYRTGDLGRYTSEGVIEFLGRRDHQIKVRGYRVETGEIEAQLLKLPEVAQAV
FT                   VMQTTQAIQTEQAEQATQIAQATQATQATQATQAAQAAQTAQTTQTTQTTQTAQATQIA
FT                   QTTQATPTTPTTQATPTTHTELQAYIEAAQVAAASDYTQSLREQGRTALAHLQSAAQQA
FT                   GDALDRPCIDRLFSLLDKVALMQMVKALSDMQTVNTHHAVTLDAIMEKGQIASVNRQLL
FT                   RRWLRALTQHQYLQQINDTYRLISVVAEQEIRLCWQQCEQLITQLDDNRGLLTYLERSS
FT                   QCLPELLQGKEDPLNLLFPDGRLDVATQAYQNNLISQFMNRLLLKAAEQKVKNQAQGRV
FT                   LKVFEIGAGVGGTSNVLIPLFAEGNAEYTFTDISPFFLNEARKRYQHYDFIHYQLFDFN
FT                   QSPVQQGLDCGQYDLVVAANVLHNAIIARHGLNNLRQLLAPGGWLLIIEATRDNYQLMT
FT                   SMEFKQGLTAFEDERLALDSPFLPQQNWIHALQDVGAEMLWAYPPTDDVLHKMGQSFIF
FT                   AQFNSQRMSCEPDALLAYLQQQLPDYMVPAKLVILDKLPVSANGKIDRKQLPRLPESQQ
FT                   RQAPALQDTDSPLEKTLLALGRTLIGNNAMGVDDDFFTSGGDSLLITQWINQVREVLGE
FT                   DKVPWEGCLRQVLQQPTARALAAYLRNIREEEPESQRPQMAVTCLKESACLKERSGLKE
FT                   RSEEPVVILHEGSGTVLPYLSLVDKLSGPIYGVNVTDSAAFLSIPAERLICQLASTYLP
FT                   EIQKVGDQCHLVGYCMGGLLAFEIARQALENGRPVSSLTIISSYQIPYHINDPLMIDLV
FT                   MSWTLGVEPPWNLLKADLEGIYHAILADKPAVITVNAVVERAKANGLTALANEYACLQQ
FT                   QSNEVRLSQLLTAIEQHSTASSHVSRQPFDVFRHSIQGVCQYQPNYFAGDMTFVCQQGD
FT                   TYLLPALQQDMTAFWQTYCLGQINRLTLPGDHFTCLSADNISPLIQHLEQCKGVRG"
FT   gene            complement(846804..848492)
FT                   /locus_tag="YPD4_0679"
FT   CDS_pept        complement(846804..848492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0679"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0679"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57588"
FT                   /protein_id="ACY57588.1"
FT                   /translation="MQRLAQYLHEQGVRESAHVGVALPRGCDQIIAVLAIQWLGAAYVP
FT                   ISVEWPACRRSQVITLADIHFLIGDRTLGWPEEVDVLSVESEPVSDERPTPRVVSADSL
FT                   AYLIFTSGSTGVPKGVAVSHGAAVNTIESVNRQHQINPQDTALALSALYFDLSVWDVFG
FT                   VLSAGARLVLIPQQAQREAAIWLSLVQQHQVTVWNSVPALLEMMLLFNEQIFNEQDEQP
FT                   PALPSLRVVMLSGDWIVPELPQRLRRFAPNAHCVAMGGATEAAIWSNYWIADTALTGWC
FT                   SVPYGVPLPNQQFRIVNEQEEDCPDWVAGELWIGGQGVAQGYYGDSAGTEQQFILRDGQ
FT                   RWYRTGDTGRYRPDAIIEFLGRKDQQVKISGYRVELEEITLALKSYPSIEDVVAFVIQH
FT                   NDRSVLAAVAVTPTPLDRQAVTAFLRERLPEYAIPSRLGHCCAWPLTDNGKRDQHALRA
FT                   FVTPSFEPTETPQVTQPMTAMEQLLCEQLQLLLNVVSIQSHDNFFALGGDSFIAIRLTS
FT                   VLRRNYGVELPLWKIFSVQTIAQIALVMEPAHQSAGRIQFVEDSI"
FT   gene            complement(848500..854958)
FT                   /gene="irp2"
FT                   /locus_tag="YPD4_0680"
FT   CDS_pept        complement(848500..854958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="irp2"
FT                   /locus_tag="YPD4_0680"
FT                   /product="HMWP2 nonribosomal peptide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57589"
FT                   /protein_id="ACY57589.1"
FT                   /translation="MATARQLAEVLSQHTALARAVVAAWRTKRSHHFPIRALIQYHSLS
FT                   DLIAQLHQVTGEKSDPRCRFEKAQSPKQWLAGGAFDWAAVTPSEGAVSAEVLALLPLYP
FT                   FTRQRYWAEGLLAESTPLSSPSVIAHPLDFSFVRTWVAETLAIASGALSDEDDLLSLGL
FT                   DSLQMLDLVDECKKRHITLTLARLFEKTTLGAWEQYWDSICRSGVCGESVSAVTPLTEE
FT                   QTTDEYWQGEPFVLTPVQQAYWQGRQKGQTLGQVACQVYLELDCPSLADERLHQAVTQL
FT                   FHRHELLRMRINEQGMGVIQEIEPVTVTQYHWDQLSARAGAKERYALRARLSHRMADLT
FT                   DESGFQLIASHDGQNTRLHINVDMVIADAMSLQILLEELGLLLSSQNTPFAPLDYHFPQ
FT                   YLLEQKSTPSTGESEAYWQQRLIAGLPLAPQLPLAIKPEQIDKPIFQHREWRLASEHWA
FT                   KLQQIARQHRLTPSMLLAGCFAETLRGWAKLPDFSLNLTIFNRRGAHPQLAKLVADFTS
FT                   LLILACEVKENESLLDHFRRLNQQFMVDLDHGDYSAVHVLRQWSQQRGEQVTLPVVFTS
FT                   NLGRELLGENAPGALHYLVSQTPQVWLDCQVMEYQKALLISWDTVDALFPEGMLDQMFA
FT                   FMQQLLQSIVENEQVLQSPVQAYVDDKVLAHRQQPLSGVHGVPFEAKTLHQGFWQQVAL
FT                   VPNNIAVINASGVLTYREMAIRVGDLAGYLQQRIARQGHVGICLPKGIEQVIAVLAVLS
FT                   IGAVYVPLDITAPSERLQQLIAQADIGVLISDHEISANCDTVNINITGGFPSPFTPSVF
FT                   TSSAAAPSIFVPSIFVQPDEPAYLIFTSGSTGVPKAVVVTHQAAMNTIDEINRRYVDDG
FT                   KIILFALSALNFDLSVYDIFGPLSVGGSLVLPNAGDEKEAKQWLSALHQHQVTHWNSVP
FT                   ALFEMLLIAAEQGTQALPRSLQQVLLSGDWIGLDLLPRLRALGSQARFTTLGGATEAAI
FT                   WSNALDIAVIPEEWVSIPYGYPLAHQYYRVVDQAGRDCPDWVTGELWIGGRGVALGYYR
FT                   EPEKTAAQFVSVHRAGFYRTGDYGRFWPNGCLEFLGRQDRQIKLHGYRIELAEIEAVAE
FT                   HLATIKRAVVLYLDQPQKHLYLFVEPQNQVSTLFSATVDDVLPETRLVTDIREQENTIT
FT                   AFLLCHVLSNVLKLDLAEYQSTQVLQEKGGISEAYQPLFLAWLHWLVEQGVLLSRDDQF
FT                   KTTGIQPVRPEVTEPHLLPLLMTLEQKASWIGEVVTGRGNPLLLLDDTLLSPEILVANT
FT                   HDAQVVIDVLCQRIARLSRQLQRPVNVTELNGRTGLFASRVLSRLGTEVLSYCLLESAN
FT                   SLRQHAKYRLSGYSHETDVIATPDEQQQLADILIVNNSLHRFDALPEGIAMLQSLCHGG
FT                   TEIVLFESLALSPLSLLTVLLLQHPNGFRDQRQGALSPLLDLPAWQSLLTDSGIAIQQL
FT                   SIIEPYSALFVCQPQITKVPVSREQIKQHLQQHLPAYMVPSSITVLETLPLTPNGKIDR
FT                   TSLYKQAVEYGQLSHDGEAPRVLSAQQKPPDERERSDKRELSDKKEQCVARLWQQVLGV
FT                   TPQSDSNFFLCGGDSLHATRIVALLEKEGTVGVPLSQVFLLPVLRDFAHSLAFRHAPVQ
FT                   EAQLVHCAAQRYSPFELTDVQRAYLMGRQSGFPLGGVATHYYQEYEYQEYEYQENEIYQ
FT                   EHESHQQYKGTPFDRERLERALTLLVARHDALRIVFDEQGTQRVLPHQPSPALQVIHCG
FT                   AVEWETVTATQRDRLSHYVSEPTQWPLFHATLIQSDEGRNRFCLGLDNLVLDGLSMQIF
FT                   FKELAVLYEDHTATLPSVEIGFRDYLLAESSSPHRQVSEDYWRESLPMLPDAPRLPLVC
FT                   DPALVGTPKFKRWQAVLSASDWQMLLHKAKQHQITPSCLLLTCYAQVLAKWSESASLTI
FT                   NVTLFDRKPCHPDINHIMGDFTSLLLLGCRQEKGEGWLATAQRIQQQLWRDLEHREVSA
FT                   VWVLRELNRQRGTTHIHMPVVFTSALGAQVDGYPDSAFQAPLWGISQTPQLWIDHQVFE
FT                   RDGELHFNWDVVEALFPAGVIDAMFAAYCQLLEKLCVTEHWHDSVEIALPAPQQQSRQR
FT                   VNATHQAMIFSPMHCRVAHAMAAYAQQTALIWGGQPPQLSTT"
FT   gene            complement(855166..855945)
FT                   /locus_tag="YPD4_0681"
FT   CDS_pept        complement(855166..855945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0681"
FT                   /product="insertion sequence IS100, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0681"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57590"
FT                   /protein_id="ACY57590.1"
FT                   /translation="MMELQHQRLMALAGQLQLESLISAAPALSQQAVDQEWSYMDFLEH
FT                   LLHEEKLARHQRKQAMYTRMAAFPAVKTFEEYDFTFATGAPQKQLQSLRSLSFIERNEN
FT                   IVLLGPSGVGKTHLAIAMGYEAVRAGIKVRFTTAADLLLQLSTAQRQGRYKTTLQRGVM
FT                   APRLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQTFAGDAALTS
FT                   AMLDRILHHSHVVQIKGESYRLRQKRKAGVIAEANPE"
FT   gene            complement(855945..856967)
FT                   /locus_tag="YPD4_0682"
FT   CDS_pept        complement(855945..856967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0682"
FT                   /product="transposase for insertion sequence IS100"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57591"
FT                   /protein_id="ACY57591.1"
FT                   /translation="MVTFETVMEIKILHKQGMSSRAIARELGISRNTVKRYLQAKSEPP
FT                   KYTPRPAVASLLDEYRDYIRQRIADAHPYKIPATVIAREIRDQGYRGGMTILRAFIRSL
FT                   SVPQEQEPAVRFETEPGRQMQVDWGTMRNGRSPLHVFVAVLGYSRMLYIEFTDNMRYDT
FT                   LETCHRNAFRFFGGVPREVLYDNMKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFSPRLC
FT                   RPFRAQTKGKVERMVQYTRNSFYIPLMTRLRPMGITVDVETANRHGLRWLHDVANQRKH
FT                   ETIQARPCDRWLEEQQSMLALPPEKKEYDVHLDENLVNFDKHPLHHPLSIYDSFCRGVA
FT                   "
FT   gene            complement(856981..860394)
FT                   /locus_tag="YPD4_0683"
FT   CDS_pept        complement(856981..860394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0683"
FT                   /product="nonribosomal peptide synthetase/polyketide
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0683"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57592"
FT                   /protein_id="ACY57592.1"
FT                   /translation="MNLLNNETRWVREALFEQATKSKYDVALRYCDKDDVDSYSYSQLI
FT                   SLGYSLATQIEIENNPPGPAILLMPGGSLFVISFIACIIRGVPAVPVHLTNHFKLGRSI
FT                   DTLSHILADSHGEYIFTLSSLSDEIKKQGWHRTHQIVFVDQQLTGSRRYFPTKKNYDAL
FT                   YYPSHLPVYLQYSSGSTAKPKAVCNYDHNMRVQHHILLELHLHCQPKIITANWLPFYHD
FT                   LGMFSGLLLPLLSGGCCNFMPSVHFITEPFRWLKMINDYQANSGAAPDFAWDLCTTMVT
FT                   DEHICQLDLSSIKMAMNGAEPIRPETMANFAARFASTGFDAHSFTPGYGMAEATLTVSH
FT                   KPIDTDYCCLAFNPMALAAGKAILDPQGCRLVSSGHVVRAWQLQIVDPQTCQPLPEANI
FT                   GEVWVRGGSVAGGYWQQPELTKATFHNTLAGNSHHDYLRTGDLAFVYQGELFICGRLKD
FT                   LIIVAGQNYMPKDIETAIEYACDDIHTGGVCVCQHFDSGEFIVMAEVYRHLTSTALQRI
FT                   AQQIVATVARHFQLKSDKVILLARGKLLKTSSGKIRRSHMLSLYFTQQLSALYVQESQR
FT                   KTQDEMLFDQESVLFEQEAILFDWLHKTGCELLGCEAINPDSGLHQAGLTSLLAIQFCQ
FT                   SINHFLGCHLNVADLFAYPTLRQLTLFLSQHQEDIASSSSTEAGDDRDVAIVAISCRLP
FT                   GQVGVSWADYCTELSAGNSAVRHEKNRLRHCVLPIGALEDIDQFDAAFFNISEREAILL
FT                   DPQQRHILELSWHLFEQAGWQPEQLKQGDIGFYIGQSGSEYGQMLLQKNDPDYAKSYLA
FT                   TGICSSATSGRLAKFYGTRGPALTIDTACSSSLVALDSAMLSLQQKQCSAAVVGGVNLL
FT                   LSAQIEQTLINAGMLSPKGHCATFSDDADGYARGEGAVLFLLKPYRQAVIDGDPVLAII
FT                   EGSVVAQDGESSSLTAPNPHAQAAMMSQLLQRASLAPDDISLLETHGTGTSLGDPVELS
FT                   AIDRVYGQRKTPLRLGASKSQVGHLEAAAGGFALARAVAQIQQQKAFGHPTLNSYNPLI
FT                   AEKLSRYYFDKDTCPWVIKRVAINAFSFTGTMAAAVLRKPTAVARSIKSITSIKSATSI
FT                   KSVTSINVTNGAIVIHTQRLKSDPGGNLLS"
FT   gene            complement(860545..862617)
FT                   /locus_tag="YPD4_0684"
FT   CDS_pept        complement(860545..862617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0684"
FT                   /product="putative TonB-dependent outer membrane receptor"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0684"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57593"
FT                   /protein_id="ACY57593.1"
FT                   /translation="MMVFYRKFFTVTVLISLPCLAWSQSHNNSKDELDTITVVAQKINQ
FT                   QQQKTPISISVLTGFDLERENIENIYESIMRIPNVYMVKAGNPSDAGFFTMRGTTPGME
FT                   GIQSVGFFIDGVYANTFDTELLDVDRIEVLRGPQATLYGRNTESGVINVITKDPEFSPE
FT                   YKIGLSYGNYNRTQVTTVLGGSINDSEQFSYRAALKYLYGNGYFKRDYDGKNNVDNLND
FT                   FSGRFKLRWQPMDDGWDVMTTFDIQNRRNGNTSFTALDKIKSGQKYVDSNYIGKSDVDA
FT                   YKGQVNAVYTFDDIDFTSVSAYVDERKVDNQDLDFTRLSISELLMNRKTKQFSQEFRLN
FT                   SKYSGPFNWLIGSYYFYQDDENEIDFRYLPYNLAQLRKSDIKTNNYAVFGNVNYYLLND
FT                   VELVAGARYDYEKKKLNFLMDNGFNPYQPYSHDNNSNSFGAFLPKVGLNYYITGDAMLY
FT                   TSIARGYKSGGFNTLGPQSSRAYNAEYMTTYEAGVKTEWFDRTVRWNTSLFWNDMKDQQ
FT                   VEVAYYPISYSVNSGKSLSRGLESELAWRITRGLTVSANVGYTDAYFKNFPTEIKVDNN
FT                   YIPVNYKGNRPANSPGYTYSIGADYNFLNGYFVNATYNVKGSTYLDNANSKKQPAYGLL
FT                   DLTAGYENKDYGVNVWIKNILDETYVTRAFKMDDGIWYGRAGEPINFGVNFNVKF"
FT   gene            complement(863005..864237)
FT                   /locus_tag="YPD4_0685"
FT   CDS_pept        complement(863005..864237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0685"
FT                   /product="peptidase T"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0685"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57594"
FT                   /protein_id="ACY57594.1"
FT                   /translation="MTIALSEQLTNRFFRYLAVSSQSDAASPTLPSTEGQHKMAQMLAE
FT                   ELRQLGLEDILIDEHATVTARKPGNQPTAPRIGFITHIDTVDVGLSPDIHPQRLRFTGS
FT                   DLCLNAEQGIYLRTAEHPEILRYQGEEIIFSDGTSVLGADNKAAVTVVMTLLENLTADD
FT                   CHGDIVVAFVPDEEIGLRGAKALDLARFDVDFAYTIDCCELGEVVYENFNAASAEIDII
FT                   GVTAHPMSAKNVLINPIRVAYDIISEFSPQETPEHTEGREGYVWFTDMTANPNSAKLKI
FT                   AIRDFDNVSFAARKAYIGEVVAKVSAQYPRAKISYSVTDVYSNISNSIGEDKRAIDLIF
FT                   SSMAELNIEPKVIPMRGGTDGAALSTQGLLTPNYFTGAHNFHSPFEFLPISSFVKSYQL
FT                   TRTICLSAAKA"
FT   gene            complement(864315..865871)
FT                   /locus_tag="YPD4_0686"
FT   CDS_pept        complement(864315..865871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0686"
FT                   /product="putative integral membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0686"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57595"
FT                   /protein_id="ACY57595.1"
FT                   /translation="MSDVKPQNDRQTGILNAIERIGNAMPDITMLFIYALGVCWALSFG
FT                   LSFINFDYFHPLTGDQIKVTNMLAPVELVTFITTMVKNFINFPPLAITIVATLGIGIAE
FT                   GSGFIQVMLKKMLNVTPQRILTPAVVFIGVVSHVASDSAYVILMPVAAMMFYASGRHPL
FT                   AGIAAAFAGLAGGFSASYTPSIIDPIMQGFTQGAAHIIDPSYNVNVLCNYFLSFGSTFG
FT                   VILVCWFITDKIVEPRLLKSMPLNSDLSGLQSNNELQKVTPQESKAFKRAGLVMLLMLI
FT                   GLAAALYPENSLLRSPDGSLTRPDAPIMQAIVPLLFFMFAIPGLIYGFSSGTFKSTKDV
FT                   TASMENITRSLVSFLVFSFFCAQFLYSFSHSNIGTLMAISGADFLRTLAMPAGFTILGV
FT                   ILLSCALDIIITSASSKWSILAPILVPMLMAVGISPELTQASFRVSSTVNISTPMFAFY
FT                   PLIIMYCRQYCSKTGVGTLCAMMLPYTLGLTVVLTLMLYLFWGLDIPLGFQSGYTYPAT
FT                   Q"
FT   gene            866590..868407
FT                   /locus_tag="YPD4_0687"
FT   CDS_pept        866590..868407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0687"
FT                   /product="putative antigenic leucine-rich repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0687"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57596"
FT                   /protein_id="ACY57596.1"
FT                   /translation="MNLSNITSNESMPNIEPDREIHSARTSTAALTPADYYAIWEKWEN
FT                   DPRTVAGEQRGQAVARMKECLENNTERLDLDELGLTSLPDTLPPCNKLNIIENKLTELP
FT                   TTLPDNLQTLNAAFNQLRTLPNTLPASLLSLNVYGNELERLPESLPEGLKKLDVGRNES
FT                   LQRPNRLPPNLESLGMANCRLTELPTLPNSLEKLEVDNNQLHTLPDTLPALLSSLLVSS
FT                   NRLTALPENLPGSLRDIYAKDNQLSQLPDLAHLPQNCSIRLDGNPFSTSTLQALQHLYI
FT                   NLDYQGPRISCRELDNLPPVSLRNIVATWVPPEQQKSLAEDWAKIEKETNSGDFNVFLC
FT                   RLATTQNVKNIPEFKQQIAAWLLQLAGSFTLREQTFLIAQEASATCEDRITLTHNDMQK
FT                   AVMLHEVEKGKYDEKLPELIARGREMFRLEQLENIAREKVKTLKTLNVHSVDDIEVYLA
FT                   YQVKLRGSLELSSVNKEMRFFGVSDVTTDDLLSAETRVKTAENQDFPRWLSQWSPWKSV
FT                   VQRIEPERYAAAVEKQYHALENIYPDKLAAELAANGMTGDVDANRIVGKRINDEIMEEI
FT                   DMALTHEVLSAKGASSLLDNLWMESLISF"
FT   gene            868615..869490
FT                   /locus_tag="YPD4_0688"
FT   CDS_pept        868615..869490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0688"
FT                   /product="putative antigenic leucine-rich repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0688"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57597"
FT                   /protein_id="ACY57597.1"
FT                   /translation="MYLSNITSNVSMPNIGPDREIHADRPAATALTPADYHAIWEKWEN
FT                   DPRTVAGEQRGQAVARMKECLENNAERLNLSSLDLTSLPDTLPPCNELNIICNNLTELP
FT                   TTLPDNLQTLKASYNQLRTLPNTLPASLLSLKVHMNELERLPEPLPEGLKTLDVGCNTS
FT                   LQLPSRLPPVLESLDISNCNLTELPTLPNSLKELDAHGNQLRILPDTLPISLLRLNVAY
FT                   NQLTALPENLPGSLRCIYTEYNQLSQLPDLAHLRQNCNICLDGNPLSPSTLLALLRLST
FT                   KPNYQGPRIS"
FT   gene            870086..871933
FT                   /locus_tag="YPD4_0689"
FT   CDS_pept        870086..871933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0689"
FT                   /product="antigenic leucine-rich repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0689"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57598"
FT                   /protein_id="ACY57598.1"
FT                   /translation="MPNIEPDREIHSARTSTAALTPADYYAIWEKWESEAIPGTDEQRR
FT                   FAVECMKDCLEKNTYHLCLRDLNLASLPDILPPCNELDLMGNKLTELPATLPDNLQKLN
FT                   ASFNQLRTLPDTLPASLLSLNVYGNELERLPESLPEGLKELDVNDNESLQLPNRLPPNL
FT                   ESLGIASCGLTELPTLPNSLKRLDADSNQLRTLPDTLPISLLNLSVTSNQLTQLPETLP
FT                   ASLSFLMVLSNRLTKLPENLPGSLRCISAEYNQLSQLPDLARLPQNCEILLEGNPLSTS
FT                   TLQVLQHLRINPYYQGPRINWSELDNLPPASLRNIVATWLPPEQQNRLAGDWANIETEA
FT                   NSAAFSVFLHRLATTQNANNIPEFKQQIAAWLLQLADSPTLREQTFLIAQEASATCEDR
FT                   ITLTHNDMQKAVMLHEVEKGKYDEKLPELMARGREMFRLEQLENIAREKVKILKTLNVN
FT                   SVDDIEVYLAYQVKLLNSLQLSSVNKEMRFFGVSHVTADDLLSAETRVKTAENQDFSRW
FT                   LSQWSPWKSVVQRIEPERYAAAVEKQYHALENIYPDKLAAELAANGMTGDVDANRIVGK
FT                   RINDELMGEIDMALTHEVLSAKGASSLLDNLWMEYLISP"
FT   gene            complement(872036..883153)
FT                   /gene="yapH"
FT                   /locus_tag="YPD4_0690"
FT   CDS_pept        complement(872036..883153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yapH"
FT                   /locus_tag="YPD4_0690"
FT                   /product="putative autotransporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0690"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57599"
FT                   /protein_id="ACY57599.1"
FT                   /translation="MNTIFKVIWNASLNVWVVVSELAKGRIKTKSSRNLISEGVLPKFE
FT                   QSMVSKLFRKNLLALSLGSIVFLSTGPVFAADITVSTQAELSAALSNGTYDKIILGADI
FT                   TLIGSLTVNMTSNQVVIDGQGKFGLTVNNTTNYGLVVSSGSGTLTLQNMSKIDSANYYS
FT                   MVVLNGANTAVNVIYNNIDFLGSSQLIYMGAYGAATNSIMTFGDILNDVVVNDRAQEIG
FT                   EVNKLAFTGRFHVTHTGSSVTSFVSTGGANNTSTMDFASGADVKIDRTGSTGDLTSTGV
FT                   NAFAYTFADGASFELIANQNVFSGTTTNRGLEIGSYNSIDGFGSGVKIVLQSRSDGSII
FT                   SGNGIDNATTNAAGINNNASGDANVIYNLGTGSILKATNTGILATKNANNASDIYIRSA
FT                   GDITAATGISATHNGTGTVKIKNDGTITSTTAGIAISSASIKEISVDNTDGTITATAGT
FT                   GVNVLASAILNLFGGTINTSATANGITFAGTEGGHTLTDLTINLLGTGIALSNVAGVNL
FT                   TLSNVTLNTLNGTALNSLTGLTLVDSLNGRNTINIEGAGIGIAATNTELNTFDAEALDI
FT                   NVNGAGIGIQATGGGVNLSASNLIINVANTLGTALQITDGIDNTTTIGNEIQLNAENAT
FT                   AINFLGSSSKTLNNNGTIKGSVIFAGVADHIINNNGTLDGTLTTGAGNDTLVLDSSSQS
FT                   NDVINLGDGNNSVTIQNGATVSSIITGNGNDTFTINGMSVGSTYLGSLDAGTGLNTLNF
FT                   NASTDELAAATSLQGFTNINLVDSHITLVSDDNIGSGMVNIDSSSELLFGSTFDGILHA
FT                   TLGAGTGSAIVNNSANVSLEQASMFAGTWQVNQGGALTASNSNQLGSAKIGLDGTLNLD
FT                   NIALFNHVLTGNGTLNVAKNLATTAFDFGSTVGGAFSGIVNLTKTTFALSADNAAALAS
FT                   ATLKLSDDSVTTVGTTDRTLHGLDLSGGTLIFDGAVPQSQTSGVVTVTDLALNSGTVNI
FT                   TGSGSWDNTDPLATNVSILEQDRAGSTLELINATNVTGDIDALDLLVNGTAITSGTQGV
FT                   QSAIQQGGSTVANAIHNYGLASSNSNGDSGLYVNYTLSALELLADGADALLLATESGLT
FT                   ANRVLNAELFGVGGLVVDAQNGALTLANGSNRYEGTTTVTAGELILGANGAFGQTSLLD
FT                   IASGASANINGYSQTVGAVTNVGTVTLGSGGVLTSGLLTNGGILDLTGGALNLTAGGAS
FT                   TVAGGLTGAGTLNINGGNLSVSAANSGLSGQTHIADVASVTLTDTGTLGTSAVEVLGTL
FT                   NLNGANAAMTNVLSGDGTINTNAAVTLSGNNSFSGAHQIGTDGELTVGQASNLGASSAT
FT                   VNLGTLTSHLILNGVSESIANVLSGVAGSTVDIIGGADTALTANNSGFLGQYALAGNSK
FT                   LTVASTNNLGASSSVALAGAGDTLSLSGFNGTFGNSVTGSGVLQVTDDAEVTLTSSNGV
FT                   SNAVTIDIADATLNLDDIALFNHVLTGNGLLNVAKNDASTAFDFGSTVGGAFSGIVNLT
FT                   NTTFALSADNAAALARATLKLSDDSVTTVGATDRTLHGLDLNGGTLIFDGSPPQSQANG
FT                   VVTVTDLALNSGTISITGAGNWENEHPVTPPNVSLLEQDRGDILLELINAANVTGNANN
FT                   LDLLVDGTAITSGTQGVESAIQQGGSTVANAIHNYGLTSSNGNGGSGLYVNYTLSALEL
FT                   LANGANALLLATESGLTANRVLNAELFGVGGLVVDAQNGALTLANGNNRYEGTTTVTAG
FT                   ELILGANGAFGQTSLLNIASGASANINGYRQTVGAVTNSGAVTLGNGGVLTSGLLTNGG
FT                   ILDLTGGALNLAAGGSSTVAGGLTGAGTLNINGGDLAVSATNSGLSGQTHIADVASVTL
FT                   TGTGTLGTSAVEVLGTLNLNGANAAMTNVLSGGGVINTNAAVTLSGNNSFSGAHQIGTD
FT                   GELTVGQASNLGASSATVNLGTLTSHLILNGVSESIANVLSGVAGSTVDIIGGADTALT
FT                   ANNSGFLGQYALAGNSKLTVASTNNLGASSSVALAGAGDTLSLSGFNGTFGNSVTGSGV
FT                   LQVTDDAEVTLTSSNGVGNTVKVDIADATLNLNDIALFDHVLTGNGTLNVAKNLATTAF
FT                   DFGSTVGGAFSGIVNLTNTTFALSADNAAALARATLKLSDDSVTTVGTTDRILHGLDLN
FT                   GGTLIFDGSPPQSQANGVVTVTDLALNSGTISITGAGNWENEHPVTPPNVSLLEQDRGD
FT                   ILLQLIDADNVTGNANDLELMINGTTISAGQGVQSTVQQGGYTVANATHNYGMTSNGGS
FT                   GLYVNYTLSALELLADGANALLLATESGLTANRELNAELSGVGGLVVDAQNGALTLANG
FT                   NNRYEGTTTVTAGELILGANGAFGQTSLLNIASGASANINGYRQTVGAVTNTGTVTLGN
FT                   GGELTSTDTLINTGMINVTDGILNLENGGASSISGGLTGNGILNIKGGDFTISIDNNGL
FT                   AGQTNISDGASVTLGNGGTIIGTGNLGSSVIDVLGDLNLVADNSLANVISGDGTINTTA
FT                   TVTLSGNSSFSGAHQIGTNGELTVGQASNLGASSATVNLGTLTSHLILNGVSESIANVL
FT                   SGVAGSTVDIIGGADTALTANNSGFLGQYALAGNSKLTVASTNNLGASSSVALAGTGDT
FT                   LSLSGFNGTFGNSVTGSGVLQVTDDAEVTLTSSNGVSNAVTIDIADATLNLDDIALFNH
FT                   ALTGNGLLNVAKNDASTAFDFGATVGGAFTGTVNLNNSTFDLSGNNTTVLAQATLKLSS
FT                   GNLTSVGNGVQNIGTLAMNGGTLLFDNIVDNAGIITSDGTIAANSINTTGGGEVRVNLP
FT                   SNLAPSLDGLSVMELDEGEIIVTLATGAATGTGHELTLTDENGDPISAVTYQGVHNAGS
FT                   TSAAATGSFNYGMTTGEDYDGLYVNYGLTALELLSTGSEALVLTAILANNGTQSNDLSA
FT                   QITGSGDLAFASANDGSTASLSNSTNSYTGTTWVSSGNLRLDADSALGQTSLLAMSTAT
FT                   HVDINGTQQVVGELATEGGSTLDLNDGKLTVTGGGQIDGALTGGGELVLSGGLLNVSYD
FT                   NAGFTGSTDIANGAVAHLSQAQGLGNGTINNNGTLHLDNTIGTLFNALTGSDGEVLLSN
FT                   NASVQLAGDNSGYSGLFTNQAGSILIANSAEHLGGSSIANSGALILDTGSVWELTNTIS
FT                   GTGTLVKRGSGTVKIEGDTVSAGLTTIEEGLLQLGSSAVTQTLSLEESLQERALLVSFA
FT                   SNMANLTSNVLITANGSLGGYGQVTGNVENYGNLIMPNALTGGDFGTFTIDGNYTGDEG
FT                   MITFNTILAGDTSVTDRLVITGDTAGQSYVTVNNIGGVGARTFEGIKIIDVGGDSAGQF
FT                   TLNGRAVGGAYEYFLYQGGASTPDDGNWYLRTEADDRRPEPASYTANLAAANNMFVTSL
FT                   ADRMGETLYTDVFTGEQKTTSLWLRNEGSHNRSRDDSGELKTQDNRYVMQLGGDVAQWS
FT                   RNAQDLWRVGVMAGYANSSSSTVAQVAGYRSTGSVDGYSVGIYGSWLADNADDTGAYVD
FT                   SWVQYSWFDNRVSGQDLATEKYDSKGFTASVEGGYAFKVGESVNQSYFIQPKAQVVWMG
FT                   VKADDHTETNGTVISGDGNGNIQTRLGAKAFINPSDKAKVSGPAFKPFVEANWIHNTKD
FT                   FGTTLDGVTVKQAGTANIAELKLGVDGQVNSQLNLWGNIGQQVGNKGYSETSVVLGVKY
FT                   NF"
FT   gene            complement(884007..884594)
FT                   /locus_tag="YPD4_0691"
FT   CDS_pept        complement(884007..884594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0691"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0691"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57600"
FT                   /protein_id="ACY57600.1"
FT                   /translation="MKKTFVVTARLTMIALAAITYSHMASAQSSPSSSVTAQQTDFLAQ
FT                   QGLAGKSAEQMVDAIDQSPQTRPLPYSASVTHTELILSDGQQKFVYPLGDRFYLSFAPY
FT                   INQTHPCFNHSLSGCRGELANTPFEVKITDNSGKVIMHQQVTSYQNGFIGVWLPRNIEG
FT                   TLEVSYQGLTAVSPFATGAESQTCLTTLQLQK"
FT   gene            884872..886362
FT                   /locus_tag="YPD4_0692"
FT   CDS_pept        884872..886362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0692"
FT                   /product="enterotoxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0692"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57601"
FT                   /protein_id="ACY57601.1"
FT                   /translation="MDIFSSFNLYNKELYSNSPTHPAFDKSKPYISELKSREEKNLNGE
FT                   VNFKDNVDKLIMCRHLSSQYILDSLSDEDTGKVDLDKFSSKDIIANRITSNVEELYEQL
FT                   QLQAKEIYFIPNNEFGICLSKIFKSMERKSENTQSILLESFNHAMAVRLRIKENENNNT
FT                   KRYVISVYDPNMTNVTVRCEVDDLVKVRDFQVKDFINHHLFGNFYKSYNPTESSEISTL
FT                   YICKKPANESVPECTGKKITFYDWIALPASSINLYTFLIEGFSQEIKNLKNQLEIIYKK
FT                   NPEKLMEILTAKSTDGIMGFEQALLNDHADAINAFGELLQLVPENKRSELLVNNKKTKY
FT                   TLFDIVCSREKNKTTMAFKNIVSLISKNERYKLIESKVNILDTVINSLITKKDSSHLNE
FT                   IFELISLAPEEHVINLLSNIDITQSLEYSLYHNDTKSINIITKMLKGLSEQGRENIPFL
FT                   RKLDESIVNMYIQLGKKIAVSAYRELLALKPGTLKESK"
FT   gene            complement(886497..889616)
FT                   /locus_tag="YPD4_0693"
FT   CDS_pept        complement(886497..889616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0693"
FT                   /product="putative integral membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0693"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57602"
FT                   /protein_id="ACY57602.1"
FT                   /translation="MLHFFIRRPKFAIVIALVITLVGWVSLYVIPVEQYPDITPPVVSV
FT                   SAVYPGASARDVAQAVASPLEAQVNGVSHMLYMESTSANNGSYQLSITFASGTDPDMAA
FT                   VEVQNRISQVSAQLPAEVNENGISVRKRASNLLLGVSVFSPQQTHDALFVSNYTSIQLR
FT                   DAIARISGVGDVQVFGARDYSMRVWLDPQRMESLNVSVQDIVAALQQQNVQAAAGQIGS
FT                   SPSMPNQQQTLTISGQGRLTDARQFADVIIRSNPQGGMIRLGDVARVALGAQNYQVSAA
FT                   QNQTESAFLVVYPVPGANALNVANGVRDEMARLSAAFPADLTYEINYDSTLPVTATLHE
FT                   IAVSLTLTLIVVLAVVYLFLQSLRATFIVALTVPVSLLGTFAVLYVFGYSANTLSLFAI
FT                   ILALTIVVDDAIVVVENVERLLSNDPHLSPAEATRQAMSQIAGPIIATTLVLMAVFVPI
FT                   AILPGIIGELYRQFAVTLSAAVILSSINALTLSPALCAVLLKRRTLATTGMFGTINKGL
FT                   DRARDGYVGLTGRINRRAVFSIAALLLVGLATWWGYSRLPTSFLPEEDQGYFFVSLQLP
FT                   DGASLNRTQTVMDQMYQQVSTNEAVEDVIKITGFSLLSGNNAPNAGFAIVMLKPWGQRP
FT                   HIDRVLASIQANLAAIPSAMIMAVNPPAIAGLGSASGFDLRIQALLGQSPQELAQVSQG
FT                   IIFAANQDPTLSRVFTTFSASVPETNLSIDRDRAALLQVPVSRIFQTLQTSLGGMNAGD
FT                   FTLNNRMFRVQLQNDMNFRQRTAQINNLNVRSDNGALVSLANLVTLTPSVGAPFISNFN
FT                   QFPSVAISGSAADGASSGQAMAAMEALLAQNLPQGYSYSWSGMSWQEQQTGGQVVFIYL
FT                   AALVFAYLFLVAQYESWSIPLVVVLSVVFAVGGAVAGLSAMGFANDVYAQIGLVLLIGL
FT                   AAKNAILIVEFSKARREEGASIAEAAQDGAKQRFRAVMMTAISFILGVMPLVFASGAGA
FT                   MSRQIIGITVFGGMLMATAVGILFIPALYLHIQRLREWTKNRKQDVDESL"
FT   gene            complement(889629..890738)
FT                   /locus_tag="YPD4_0694"
FT   CDS_pept        complement(889629..890738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0694"
FT                   /product="putative drug efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0694"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57603"
FT                   /protein_id="ACY57603.1"
FT                   /translation="MSAATAPLPAVTVAVVASITPDNAVQYLGRIEAIQAVDVTTRTEG
FT                   FIARRLFTEGKMVKQGELLYEIDPALHQASVAQAQAQLDSATASANHAQVNLTRLQRLG
FT                   NNRSVSQAEVDEAQAQRDISRAAVAQAQANLQIQQLQLSFTQIHAPISGQMGHSRFNVG
FT                   SLINPASGTLVNIVQLDPIRVAIAVNERDYITATYQRAVAREKNIENPLLLLGTFTPRI
FT                   QLANGKQYPESGVFESVDNQIDKQTGTVIIRTRFANPRHLLLPGGVVNVSLAADDAKPV
FT                   TVIPIAALQQNKQGHFVLVVTDKAVVEVRPVTLGEQFEQQYAVTDGVKVGEKVIVAGLQ
FT                   HVRPGMAVNASTVNDGTVNDRVAAPLTAN"
FT   gene            891546..893912
FT                   /locus_tag="YPD4_0695"
FT   CDS_pept        891546..893912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0695"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57604"
FT                   /protein_id="ACY57604.1"
FT                   /translation="MQQDSLKTRIKDNAFWGDAYQHLHVKMDTDWAFISQNMGPSLYKD
FT                   FSLEGVFVIDGQGKTRYSVINGQLVNTDLQSWLHKDITPLIDIARQRAEKPYIAVDTLE
FT                   IAGQPALIAAAALTPGEDPRVQWVAGPPSVLVFINILTPAELSALGENYGIHNLRMPRN
FT                   SQDATSKPSLVIASSDNSTLTLHWDQEMPGTPLLNILLPLLALVALIIGLTAWLVIRRA
FT                   ISEAQATDRSRAALAASEERFRHVAESASDWLWETDAELQVTYLSPRFLIISGWSVDHW
FT                   LGLNLDSLLNCDITSLRTWLQHTHLTDSRNELQCTYFSAKGSKRVCRIHAKPIIQQGEI
FT                   VGFRGTASDLTREIEAEKRIEHLSLHDALTGLPNRTLMTEFLENKLHNLAAVEHPLVIL
FT                   NVNLDKFKPVNDIFGHVTGDQVLYQVAERLRSCLRDKDLVSRQGGDEFVLIISNLSSSY
FT                   EIELLCARVITRLQTPYVINDQEIYLGASIGITLAPQDSMQAEELLRFADIAMCEAKNS
FT                   PRNRWRFYASEMNDRLMQRIELEKFLRLAVKKSEFCLYYQPRYRTDDMQLIGAEALVRW
FT                   NHPVLGLLMPDQFIALAEETGLITAISDWTLLQACQDAMTWPTSLIVSVNISAIEFRGQ
FT                   CLIERVRQALLVTGLPSHRLELEITERIMIEDADGALKIMTALKTLGIRLSIDDFGTGY
FT                   SSLNYLHRFPFDGLKIDKSFIDKLTESHEGQSIVEGIINLGHAISMTVIAEGVETAEQL
FT                   TYLQSLHCDEVQGYFLAKPMPVEALSLVFSEDLSV"
FT   gene            complement(894108..894893)
FT                   /locus_tag="YPD4_0696"
FT   CDS_pept        complement(894108..894893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0696"
FT                   /product="IS1661 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0696"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57605"
FT                   /protein_id="ACY57605.1"
FT                   /translation="MARSTYYYHASKPDGVIDDYADAVKAIGALSRRHAQRYGYRRMTV
FT                   ALRKEGFTLNHKTVRKLMNQHGLLSLIRRKKYRSYRADGGRASDNLLARNFTSEISGLK
FT                   WCTDVTEFRVGAQKLYLSVIQDLFNNEIISWHMSERAALILTCKTLEKALKVKGRKEGL
FT                   MLHSDQGWHYRTPMWRSMLVEAGIRQSMSRKGNCLDNAVMENFFSHLKAEMYHRKKYDS
FT                   ATVLKRDIVEYIHYYNTERISLKTGGMSPAEYRTQVEKQ"
FT   gene            complement(894947..895462)
FT                   /locus_tag="YPD4_0697"
FT   CDS_pept        complement(894947..895462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0697"
FT                   /product="insertion element DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0697"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57606"
FT                   /protein_id="ACY57606.1"
FT                   /translation="MKHPFSTRLAAVQHYLSGKATLRETARQFSVGKSPLTRWIRAFRR
FT                   QGEAGLEHHLSRTYTPEFRLCVVRYMMANRCSAADASAHFNIPNETIIQNWMKRYREGG
FT                   KEALNPSKTGPTMPKDKYEHDSKPFSEMTHAELEKELEYLRAENAYLKKRKALREEKAL
FT                   REQQKKPE"
FT   gene            895734..897158
FT                   /locus_tag="YPD4_0698"
FT   CDS_pept        895734..897158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0698"
FT                   /product="Sodium:galactoside symporter"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0698"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57607"
FT                   /protein_id="ACY57607.1"
FT                   /translation="MSLDSQHLCSLKDEGDKRLKINMNNSGMKIPMKELASYFGYGMGQ
FT                   CFSFGLVGTFILFFYTDIMGISPVAASMIFLIARVWDAIHDPLIAGVMDTINMRRGKFR
FT                   PYLLFTPFLIFLVTVAAFYNIEASLMTKTIYAGVTYILWGTLYALSDIPFWSMSTVMTD
FT                   EPQERAKTATCAMLGVNAGIGATMILFPYISGLFAENSADRGYFAGVVILMVLGVILML
FT                   NGFFNTKERVNVTVTEKVTLKQTFIVVWQNKPLFFILSAFFMNVFSNIVNTFYIFFFTY
FT                   NMGDAELVSVIGLITFTCALACLGTPFLTRHFKKRDLFITLCVLEIIARVGFWFTGYNN
FT                   VVSVMVWLTVITAIFMMTNPLISAMIADTVEYSYYHTGKRCAAITFSGQTFVGKLSVAV
FT                   AGGVSGLILSILGYMPNVAQSTWTLNGLFFCISLLPAVGAVVRILIMRKYKFTEDEHAI
FT                   LREELKQGRFHSSVGK"
FT   gene            complement(897417..899597)
FT                   /gene="iutA"
FT                   /locus_tag="YPD4_0699"
FT   CDS_pept        complement(897417..899597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iutA"
FT                   /locus_tag="YPD4_0699"
FT                   /product="putative ferric siderophore receptor"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0699"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57608"
FT                   /protein_id="ACY57608.1"
FT                   /translation="MKHKHLWVLNPCLLVMLTPAAWAEDQLVVSANRSHRSVAEMAQTT
FT                   WVIEGQELEQQVQGGLEIKDILAQLIPGIDVSSQGRTNYGMNMRGRSIMVMIDGVRLNS
FT                   SRSDSRQLDSIDPFNIAHIEVISGATSLYGGGSTGGLINIVTKKGQEGKQVELQIGGKT
FT                   GFNSHNDHDENISAAMSGGTERAFGRFSVSYQRYGGWYDGKGNEVLIDNTQTGLQYSNR
FT                   LDVMGTGTLNIDENQQLQLTTQYFNSESDGKHGLYLGQNFSAVTGTGQASNSAALNSDR
FT                   IPGTERHLINLQYSNTDFWGQDLVAQVYYRDESLTFYPFPTLKDGKVSTIGASQQKTDF
FT                   YGSKLTLNSEPIDSLTLTYGIDLEHESFNANQQFFNLAKAQQSGGMTLENAYNVGRYPS
FT                   YTTTNLAPFLQTRYDINPIFTLSGGVRYQYTENKVDDFVGYAQQQAIASGSATSADPVP
FT                   GGKTDYNNFLFNAGLLAHLTESQQTWFNFSQGFEIPDLAKYYGSGSYTLVNGHYQLQNS
FT                   VNVNDSKLEGIKVDSYELGWRYTGDNLRTQMAGYYSLSDQTISINKTDMTINVLPDKRR
FT                   IYGVEGAVDYFFDNSEWSAGATFNLIKSETKVSGKWQKLTIDAASPSKATAYIGWAPGD
FT                   WNLRVQSQQTFDVSDSKGDKIDGYNTIDFLSSYALPVGKLSFSIENLLDKEYTTVWGQR
FT                   APILYSPTYGSPNLYSYKGRGRTFGVNYSVLF"
FT   gene            complement(899669..900997)
FT                   /gene="iucD"
FT                   /locus_tag="YPD4_0700"
FT   CDS_pept        complement(899669..900997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iucD"
FT                   /locus_tag="YPD4_0700"
FT                   /product="putative siderophore biosynthesis protein IucD"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0700"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57609"
FT                   /protein_id="ACY57609.1"
FT                   /translation="MNQPLDFIGIGIGPFNLSIAALGSEVSGFNSKFLERKPHFSWHPG
FT                   MMVPDCHMQTCFLKDLVSTVSPTNTYSFLNYLVQHKKFYRFLTTEHRTVSREEFADYLR
FT                   WAASGMSSLEFSQDIQSVDFDDQQRHFVVTTPRNVYHARHVCLGIGKRIKLPDCVTEQN
FT                   DRCFHASEMALRNPDLTGKRVTIVGGGQSGADLFLNIFLAAWGQPKQLNWISRRNNYNA
FT                   LDEAAFANEYFMPEYVESFYTLNDSAKQHMLAEQRMTSDGITSESLLAIYRAMYHQFEV
FT                   LHEKPWARLLPSRSLTNMHTRGNGYQLLTHHHLDQGTETFDTDVVIFATGYQQDRPAFL
FT                   DPLADRLQTTADCQYQVAPDFVLDWQGPRENCLFAVNAGMHSHGIAEPQLSLMAWRSAH
FT                   ILNRALGRTQFDLTSTPAVIQWRSQQSGVPAHPEHPVLNCIDI"
FT   gene            complement(900994..902742)
FT                   /gene="iucC"
FT                   /locus_tag="YPD4_0701"
FT   CDS_pept        complement(900994..902742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iucC"
FT                   /locus_tag="YPD4_0701"
FT                   /product="putative siderophore biosynthesis protein IucC"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0701"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57610"
FT                   /protein_id="ACY57610.1"
FT                   /translation="MITTDYANWQQVNRHMIAKILSELEYERTLHAELHGETGRITLPG
FT                   AVYTFNGKRGIWGWLHIDPATLRCEGVPLAADHMLRQLALVLKMDDSQVAEHLEDLYAT
FT                   LRGDMQLLSARHGMSAEALIALNDDALQCLLAGHPKFIFNKGRRGWGLTALQHYAPEYQ
FT                   GQFRLHWVAAKRGSFIWCVDAEYPLDNLLNSAMDPAERQRFDRRWRECQLNDDWVPVPL
FT                   HPWQWQQKIALHFLPQLAEGELIELGEFGDHYLAQQSLRTLTNVSRRVPFDIKLPLTIY
FT                   NTSCYRGIPGKYISAGPAASRWLQQVFAQDRTLHESGAEILGEPAAGYMLHQTYATLAK
FT                   APYRCQEMLGVIWRENPSCYLREGEHAILMATLMETNNQGHPLIAAYIARSGLSAEAWL
FT                   EQMFRVVVVPMYHLMCCYGVALIAHGQNITLVMKDHAPQRILLKDFQGDMRLVDKDFPQ
FT                   AASLPNVVKDVTVRLSADYLIHDLQTGHFVTVLRFISPLMQACNLSEYRFYQLLAQVLE
FT                   RYMAQHPDLADRFTLFNLFKPQIIRVVLNPVKLTYSEQDGGSRMLPDYLQDLDNPLYLV
FT                   TKELAQ"
FT   gene            complement(902739..903689)
FT                   /gene="iucB"
FT                   /locus_tag="YPD4_0702"
FT   CDS_pept        complement(902739..903689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iucB"
FT                   /locus_tag="YPD4_0702"
FT                   /product="putative siderophore biosynthesis protein IucB"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0702"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57611"
FT                   /protein_id="ACY57611.1"
FT                   /translation="MGPHAKLIHSGGSFYCEHLGKALTLGLGLDGSAVLHLPGPLPPGW
FT                   LVQALDQLFIAAPQLTGIALPYAEWRDAPQAMALFALISSDYVAREIFYQLPLWLGAER
FT                   NRTAGQMQYDTERHLWYPQRPPRPDGEVYRRFDPNIKRTLSFRLPEVDHDAPQFTRWMN
FT                   SPRVDAFWEMSGPLDVQAAYLQRQLDSPYCYPLLGCFDDQPFGYFEVYWAAEDRIGRHY
FT                   RWQPFDRGLHMLVGEENWRGAQYIHSWLRGLTHYLYLDESRTTRVVAEPRIDNQRLFHH
FT                   LPAAGYHTLKEFDFPHKRSRLIMNQRADFFREGTR"
FT   gene            complement(903673..904743)
FT                   /gene="iucA2"
FT                   /locus_tag="YPD4_0703"
FT   CDS_pept        complement(903673..904743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iucA2"
FT                   /locus_tag="YPD4_0703"
FT                   /product="aerobactin synthetase (subunit alpha)"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0703"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57612"
FT                   /protein_id="ACY57612.1"
FT                   /translation="MHPWQADHLLKQDWCQQLVQQNALHDLGEAGERWLPTSSSRSLYS
FT                   PSNRDMVKFSLSVRLTNSVRTLSVKEAKRGMRLARLAQTPRWQELQARYPTFRVMQEDG
FT                   WAGLRSADFTLQEESLLVLRDNLLFSQPDSQTNVLVTLTQAAPDGGDSLLASAVRRLAA
FT                   RLNLPLQQAAFCWLDAYCQHVLLPLFSTEADYGLVLLAHQQNILVEMQQDLPVGMLYRD
FT                   CQGSGFTQSALPWLAEIGEAEAENSFSEQQLLRYFPYYLLVNSSLAVTAALAAAGFDSE
FT                   ENLMVRVRDALSALRTCAKNTLCLDYVLDSPHWHCKGNFFCYLHDHNENTIVDPAVIYF
FT                   DFVNPLHQGVIHGATR"
FT   gene            complement(904836..905444)
FT                   /gene="iucA1"
FT                   /locus_tag="YPD4_0704"
FT   CDS_pept        complement(904836..905444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iucA1"
FT                   /locus_tag="YPD4_0704"
FT                   /product="aerobactin synthetase (subunit alpha)"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0704"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57613"
FT                   /protein_id="ACY57613.1"
FT                   /translation="MTIPVETLATDVAAQCFLNALIRETQDWQIVPAAGHQPYPQLHIP
FT                   LSSSHAIHIALCHISPTQHHHYLFPAYLHQQGNDRQDDDTPVKLGIEQLVTLLLEKPTV
FT                   KGELSDDVVARFRQRVLESHDNTQQAINIRLDWPSLRDKPLNFAQAEQGLLAGHAFHPA
FT                   PKSHQPFNEKQAQRYLPILPPASHYAGLQSINATCAAIA"
FT   gene            905695..906702
FT                   /locus_tag="YPD4_0705"
FT   CDS_pept        905695..906702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0705"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0705"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57614"
FT                   /protein_id="ACY57614.1"
FT                   /translation="MVLPVLVSRTHLSLSVWAGLLTLGSMLFLVGSAWWGRQSEIRGCK
FT                   FVVIMALAGYLLSFVLLALAVWGLSAGWLSEMAGLGWLIVARIIYGLTVSGMVPASQTW
FT                   ALQRAGYEQRMAALATISSGLSCGRLLGPLCAALALSIHPIAPLWLMAIAPLIALLVVY
FT                   RQYNDPPLPPVVHQQNRLRLNMLPYLLCALLLAATVSLMQLGLAPHLSRLFSHSATTVS
FT                   HHVAILLSIAAGCTLLAQFLVVRPQRFTPPQLLLVAALLMVLGLGLMCVQPLVLFYLGC
FT                   ALGFFRRRDGDTGLPTDVERPVIYWQRLRRDRYQPYIGLWHECIDGAGSRKILW"
FT   gene            complement(907098..907931)
FT                   /locus_tag="YPD4_0706"
FT   CDS_pept        complement(907098..907931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0706"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0706"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57615"
FT                   /protein_id="ACY57615.1"
FT                   /translation="MTNKIMPKVNREGRRSFLQKSIAVVATGVVTHAFSAPNITLEKDT
FT                   KPQPGTCILSVEQMAGPYIKSNMPIRRNIAENENGVPLLLKITVIDSNSCRPLEYYYVD
FT                   IWQCNARGRYSGWSYVDPDKDAPSGEVASINRTDEKSFLRGSQVTDSHGLVRFTSIYPG
FT                   FYAGRAVHIHFAIKPPKASPQEVDKYSFISQLYFPEEFNSEIEQRAEYSLRKIKRLINS
FT                   DDEIFNEANGENAVLAVSKINENDINDGVLAEITIAINKDILSKRIDPKDILKIT"
FT   gene            complement(908308..909684)
FT                   /locus_tag="YPD4_0707"
FT   CDS_pept        complement(908308..909684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0707"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0707"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57616"
FT                   /protein_id="ACY57616.1"
FT                   /translation="MLTRRKFLMMSAGAGLLLSVPMLARTGVQPAQAATAITQVFGDGI
FT                   RLTAVAVEYPTEVSAEGLNPADFHVEGRTVTGVWTSTSTNPADIAPSGRYMIIALSPDD
FT                   KNATLAEQVQPNSKNNSNKSANGRGGPGNAGDIPAYDTVYRTAQATVLRLPSVHTASGD
FT                   TLPASEKALTTQYVENLIVDDFQQLEFYDEKTGKKLKYNLFIPKDYSPDKDYSPDKNYS
FT                   PDKAWPLVLFMHDAGATSDVTRTTLYQGLGAIAWASPEDQAQRPCFVLAPQYEEIIADD
FT                   DSKTSDMLDTTIDLINVLSEQYNIDKSRIYATGQSGGCMMTIAMNIKYPDFFAASFLVA
FT                   GQWDPALVKPLAQQKLWILVSQDDNKAWPGQNAIIDVLEKEGVQISRAIWDGTWNEEQF
FT                   RQAFEQIEAEKSPINYVAFREGTVIPEGQSTEGASGHRNTWRIAYTISPIREWIFRQQR
FT                   "
FT   gene            910246..910989
FT                   /gene="yspR"
FT                   /locus_tag="YPD4_0708"
FT   CDS_pept        910246..910989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yspR"
FT                   /locus_tag="YPD4_0708"
FT                   /product="quorum-sensing transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0708"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57617"
FT                   /protein_id="ACY57617.1"
FT                   /translation="MHSVFNRSNEVIETLRDYIDRKLTIYDSPKYTYMVINKKNPGDIF
FT                   IVTSYPNEWAELYTNNNYQNIDPVVLIAFRRFSPFSWDENITVLSELKLSKIFTLSKKY
FT                   NIVNGFTFVLHDTMNNLAMLSLIMDDSALNGVESRVLNDRDRLQMLLIETHEKMLTLSQ
FT                   RNMNIQERQGKGMPGKAILSPRENEVLYWASMGKTYQEIAIITNITPRTVKYHIGNVVK
FT                   KLGVINAKQAIGLGVELEIIKPILA"
FT   gene            complement(910970..911497)
FT                   /gene="ytbI"
FT                   /locus_tag="YPD4_0709"
FT   CDS_pept        complement(910970..911497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ytbI"
FT                   /locus_tag="YPD4_0709"
FT                   /product="N-acylhomoserine lactone synthase YtbI"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0709"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57618"
FT                   /protein_id="ACY57618.1"
FT                   /translation="MEFDEYDNSDTRYLLGIYQGQLICSVRFIELHLPNMITHTFNALF
FT                   DDVALPKRGYIESSRFFVDKTRAKLLFGNHYPISYLFFLSIINYSRHNGYTGIYTIVSR
FT                   AMLTILKRSGWQVEVIKEAHITEKERIYLLHLPIDRDNQARLLLQVNQRLQDPCSVLST
FT                   WPISLPVMPESA"
FT   gene            913023..913445
FT                   /locus_tag="YPD4_0710"
FT   CDS_pept        913023..913445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0710"
FT                   /product="CAAX amino terminal protease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0710"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57619"
FT                   /protein_id="ACY57619.1"
FT                   /translation="MQDMLIPGLALLGLTAIFQFFGQPEPWVESLLQPSTFTQILLVIT
FT                   ICVFAPISEEIIFRGFLLNAGIGFGRRGRLLAVVITSLLFALVHTQYLYPATFVSLFVF
FT                   SAILCEVRIRTGSLLMPMVLHSANNIASVAWVLTLS"
FT   gene            913896..914291
FT                   /locus_tag="YPD4_0711"
FT   CDS_pept        913896..914291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0711"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0711"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57620"
FT                   /protein_id="ACY57620.1"
FT                   /translation="MMNKFFKIISINLLAISLGGCGMMLNPLLMKQAEVEPNNLPDGKL
FT                   GQPYYAKLRITGGGGAIASFKGESMPVGSGLVLTSDNPERPPGRDELVIKGIPVISGDI
FT                   TFRVSGALFSSADKGYFGKEYKLKIAE"
FT   gene            916567..917067
FT                   /locus_tag="YPD4_0712"
FT   CDS_pept        916567..917067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0712"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0712"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57621"
FT                   /protein_id="ACY57621.1"
FT                   /translation="MSSSSFQNEIPKARINIKLDLHTGGAQKKVELPLKLLVMGDYSNG
FT                   QEQRPLSEREKLNINKNNFNSVLAEFQPSLKLAVPDTLAGDNTDTAVSLTFNDMKDFEP
FT                   ENVARQIPQLRALLAMRNLLRDLKSNLLDNATFRRELENILKDDALSDELRAELAALAP
FT                   KEG"
FT   gene            917116..918654
FT                   /locus_tag="YPD4_0713"
FT   CDS_pept        917116..918654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0713"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0713"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57622"
FT                   /protein_id="ACY57622.1"
FT                   /translation="MSVQENRAQGTATTVLKNSPAAQGVYAALFEKINLSPVSSLAGIE
FT                   AFQNNDALAEATTDERVTAAVSVFLDLLKQSAKKVEKLDKTLLDGHIAALDDQISRQLD
FT                   AVMHHPDFQRVESTWRGVKSLIDQTDFRQNVRIELLDISKDHLVQDFEDAPEISQSGLY
FT                   AQTYIQEYDTPGGEPIAAAISNYEFDRSPQDIALLRNISKVAAAAHMPFIGSVGPEFFG
FT                   KENMEDVAAIKDIANYFDRAEYIKWKAFRDSDDSRYIGLTMPRVLGRLPYGPDTVPVRS
FT                   FNYVEQVKGPDHDRYLWTNASFAFAANMVKSFIKNGWCVQIRGPQAGGAVTNLPIHLYD
FT                   LGTGNQVKIPSEVMIPETREFEFANLGFIPLSYYKNRDYSCFFSANSAQKPALYDTADA
FT                   TANSRINARLPYIFLLSRIAHYLKLIQRENIGTTKDRRLLELNNWVRGLVTEMTDPGDD
FT                   LQASHPLRDAKVTVEDIEDNPGFFRVKLYAVPHFQVEGMDVNLSLVSQMPKAKA"
FT   gene            918771..920018
FT                   /locus_tag="YPD4_0714"
FT   CDS_pept        918771..920018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0714"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0714"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57623"
FT                   /protein_id="ACY57623.1"
FT                   /translation="MAVMHPWGVLQATFELDALAQGRLKAARLHVRFQDGVLVDTECAD
FT                   VLPPTLTLAASLPAEASDATVMLAIPQLYANGGNCLQPDERGERPVRYRQAWRDVQNQF
FT                   GDDKKQVAVMYHQLTLRLDTQENGDYQVCPVARLLRDAQGRWTLDPGFIPPMLSLQASA
FT                   WCGEQLELLMVQLRARLQRLMGMRRESNARMADFAVADVSLFWLLNALNSAEPVLGNFQ
FT                   RYPQVHPERLYQELARLAGSLLTFSLEHEVTAIPVYQHEQLTRVFPPLFALLNILLEAS
FT                   LPSRVVAIELVHEPRINQWRATLRDPRLREGADFYLSVRSSLPAAQLQTQFPQLCKAGA
FT                   PDEVGNVVNVALSGIPLRPLSHVPAAIPLRLENQYFSLDLSHPAATQMMETGACVFYVP
FT                   GTLGEIQLELFAVLRA"
FT   gene            920015..920701
FT                   /locus_tag="YPD4_0715"
FT   CDS_pept        920015..920701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0715"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0715"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57624"
FT                   /protein_id="ACY57624.1"
FT                   /translation="MNPHLTEHPPVGDIDALLQDTWLQVISLRQGVTCAEGEGQAFWQR
FT                   CVADIERVHQALKDAGHSEQSCQHIRYAQCALLDETVKGRGVQDDAYFVWCHSPLQAHF
FT                   FNTLDAGSQLYERMRAVLREPAPDRAVLTCFHRVLMLGFLGGYASPAASEREQLIDQLS
FT                   VQVPAFSVAPSRGILASAASRNRLGIWLRYWPVRLGLAALMVALLWWGLDHWLSGLLAT
FT                   LLPEPV"
FT   gene            920701..921813
FT                   /locus_tag="YPD4_0716"
FT   CDS_pept        920701..921813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0716"
FT                   /product="OmpA-family membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0716"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57625"
FT                   /protein_id="ACY57625.1"
FT                   /translation="MSRWWQRGLWLWAGLLAVILCLAFLPLSPWGRWLMLAWVVLICML
FT                   GGSRAGRQAAGASSDPLFAGLATENGLLPENSRLPVVLVCGDGLASWFGRERSHQSAQG
FT                   CWLRVDDISTLRQFARQLLWQRPEWAAQLAVMMVVNPQQRRDERLLAADLQELRWQLMQ
FT                   LRRDSRHPVPLLLSSTVATSVARDTVWLSQQQTPPLTLWSTVSTPGSLADWQRAESRAV
FT                   QAERLKQAVLFSSQHDWLNAQVLPVLQAPNADVAPLAPQQIIQQQVASLADPVPASLWQ
FT                   HWLAAHTTLTQVAGWHPPPPAAHDALPLPDFVFSALPLGSGVSSRRRVLRHGVTLLTLA
FT                   AMVALCSSAWQNRQLLHRVALISVSTTAWR"
FT   gene            921810..922436
FT                   /locus_tag="YPD4_0717"
FT   CDS_pept        921810..922436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0717"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0717"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57626"
FT                   /protein_id="ACY57626.1"
FT                   /translation="MTDYSPKAQAVAVLRRDAGLLDEGYRNGEPLRLGLGLYRGERLRP
FT                   PLLAAIKSYIPPPPPPPAPPAPKTVRLDSLSLFDVGKFTLNAGSTKMLVTALIDIKAKP
FT                   GWLIVVAGHTDITGDAQANHILSLKRAEALRDWMLSTSDVSPTCFAVQGYGATRPIADN
FT                   DTPDGRALNRRVEISLVPQADACQVPDVKTASQDESDVSTQEMEK"
FT   gene            922440..922931
FT                   /locus_tag="YPD4_0718"
FT   CDS_pept        922440..922931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0718"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0718"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57627"
FT                   /protein_id="ACY57627.1"
FT                   /translation="MAIPVYLWLKDDGGADIKGSVDVQSREGSIEIVAQDHNLYIPTDN
FT                   NTGKLTGTRIHTPFVFTKEIDASTPYLYKAVTTGQTLKTAEFKWYRIDDAGQEVEYFNT
FT                   KLENVKVVKVAPKMHDVKDPAKEKHNHLELVELRYEKITWTFKDGNIIHSDSWNERATA
FT                   "
FT   gene            923319..925961
FT                   /locus_tag="YPD4_0719"
FT   CDS_pept        923319..925961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0719"
FT                   /product="putative ATPase subunit of ATP-dependent
FT                   protease"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0719"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57628"
FT                   /protein_id="ACY57628.1"
FT                   /translation="MTTHSAHLLRRLNPYCAQALAGAATLCQTRAHAEITVEHWLLKLL
FT                   EQGEGDITVIARRYEWDMDSLWQGLLSHLDTLPRTVQGKPQLSAALQQLIKNAWLDASL
FT                   QENADAVRSVHLMAALIATPSLLVAEAAWPLLSLSTTQLQRLLPLLDNQSDERPEVQQA
FT                   AALADSPVNLTDEAATVTSASGQPQLNDALQAALDKFTLDVTAKARANQIDPIFGRDSE
FT                   IRQMIDILSRRRKNNPILVGEPGVGKTALVEGLALRIADGNVPDSLKTVSVRTLDLGLL
FT                   QAGAGVKGEFEQRLKNVIEAVQQSPSPVLLFIDEAHTIIGAGNQAGGADAANLLKPALA
FT                   RGELRTIAATTWSEYKQYFERDAALERRFQMVKVDEPDDDTACLMLRGLKERYATHHGV
FT                   HILDAAITAAVTLSRRFLTGRQLPDKAVDLLDTAGARVRMSIDTLPTALMEINAELAAL
FT                   AMEQQAIEQDLLLLPNVSSTRLPEIEQRRAALAVGQHTLEQQYKEEKRLTTLIIEARQD
FT                   IANAAHLVALQEELVQIQGNAPLLSLDVDVRTVAAVIADWTGVPLGSLLKDEQTNLLSL
FT                   ENRLGERVIGQDAALGALAQRLRAAKTGLTSENGPLGVFLLVGPSGIGKTETALALADS
FT                   LFGGEKSLITINLSEYQEAHTVSQLKGSPPGYVGYGQGGVLTEAVRKRPYSVVLLDEVE
FT                   KAHRDVLNLFYQVFDRGFMRDGEGREIDFRNTVIVMTANLGSDHLMQLLDEQPDAPDST
FT                   LHELLRPILRDHFQPALLARFQTLIYRPLQVDALKRIVAIKLNQVAQRLHCHYGLSCQI
FT                   EDSLTDTLVAACLLPDTGARNIDSLLNQQILPVLSQQLLSRMSEQQRTTSLTLGWHEED
FT                   GITLTFEGE"
FT   gene            925964..928312
FT                   /locus_tag="YPD4_0720"
FT   CDS_pept        925964..928312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0720"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57629"
FT                   /protein_id="ACY57629.1"
FT                   /translation="MNTFLPTIRFDHSHHKLVVRDSTAAVDVLGFEGHESLSQPFCYDI
FT                   QFTSADKAIGPATMLMHDASLTLAAPMAEAFGVTVQQTQRVIQGVVTGFKRLSASKEEC
FT                   RYELSLQPRLALLSRSHQNGIYQDMSVPQIVEKILRERHDMRGQDFVFTLAREYPRREQ
FT                   VMQYGEDDLTFIRRLLAEVGIWFRFTADPKLNIDVVEFYDDQRFYQQGLTLQAVPPSGM
FT                   HDSGMESVWDLSSAHQVVEKSVSTGDYNYRTATADLTAGADITRGDTTTYGEAYHYADN
FT                   YLTAGSEGREPESESGAFYARLRHERYLNNQARFAGVANAAALAPGQELNVTGNDVPAQ
FT                   FGKGVIITRITSHARRDRSYEVHFEAIPYSEDYCFRPALIRKPTMAGTLPARVTSTTAN
FT                   DTYGHIDKDGRYRVNLMFDRDSWESGYESLWVRQARPYAGDSYGLHLPLLAGTEVAIAF
FT                   EDGNPDRPYIAYVLHDSAHGDHVTISNYKRNVLRTPSNNKLRLEDERGKEHIKLSTEYG
FT                   GKSQLNLGHLVDNEKQPRGEGFELRTDSFGVLRAEKGLFITADGQAKAQGQVLEMQPAI
FT                   SLLKSAQEQMEAISADAQTATASPADLQVQISLLQQNLTELKQAVLLLSAPKGIALSSG
FT                   EHLQMSASDNLIATAGKNADVSVAKNFFIGVGNTLSIFVRKLGMKLIANQGPITVQAQN
FT                   DLMELLARKAITITSTEDEIKITAKKRITLNAGGSYITLDENRIESGTAGEYLTKAGYY
FT                   GRLDKAKLPTEFPALAAKTEDPIKRWLFS"
FT   gene            928328..930625
FT                   /locus_tag="YPD4_0721"
FT   CDS_pept        928328..930625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0721"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0721"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57630"
FT                   /protein_id="ACY57630.1"
FT                   /translation="MIISPLFLKDKSNSEDDASWVSRMMHVDPERGFPLNSHRSWHGGI
FT                   HIPHTDSGGTPEKIRAIADGTVHSLRQPVGDKKGIPPYNYNGATDCGYVLLKHETEIGS
FT                   GENAKVVYFSLYMHLASIDAAVKTGEKIYRKDPIGTVGQVDGGNAVHFQIFCDDTNLTK
FT                   LVGRTTPELDLTKNGRTDAVYGDMYFYLPTGTKFYSHAPANNATTTTEAETYTSTEPLF
FT                   VSMSFDKGKCTMLTRKKGVFSIGKYSEVGEKLENADGADYEYNLYAQAKKLYPQSQSAG
FT                   YELLRFGRAINTDYETLVPADAPLWRTISYPGGKGVVNLALPAVKKFSDGDFPHWTGWQ
FT                   LIDDDTDENSQCNSEQVLCRIGDDMQGLICHLPLEWDASTLEKRLSWLKTTVINESLAN
FT                   QKASHQVDDTGNNASGYAFDNINPDMSVLNAQSTPSFEQAAKDTAMAEADWNALIEHAK
FT                   ALCFDVSGLPVGRVWHFNPISFIAHFRKCGWLDPEKIKSILTSALNKKRNVRKITLIEK
FT                   ASDSNYTFLNLAMRKYNILTPNRQSHFLGQGAVESDSLTAMQEVSQEQVIVNGKQTGGG
FT                   IVIKSTLNESELGHWYGSEPSELDIYYSGNKYNKNGGLIAGSYSWSNGNCGDVDAQKFR
FT                   GRGFKMLTGRDKYADYWVYRGWLLKSSFDAYWWDDVKYKSKNLKAMKKRPAIIDDPHKI
FT                   TASPYNCIDSGSFFITCFRRSTVKEIDKDQAESADDSVVTKVTQAINGGDIGLSQRKVM
FT                   TNNAKGKLNDKY"
FT   gene            930612..931379
FT                   /locus_tag="YPD4_0722"
FT   CDS_pept        930612..931379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0722"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0722"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57631"
FT                   /protein_id="ACY57631.1"
FT                   /translation="MINIKKLTLKYFYILFFTPHLAHATYYNEVSFDDYIVLLDKNENA
FT                   ILHVKKNHTDIQCVIKNWNIKYNNGAGVISLTTDKKAILLANTQAYLYVDEVINCKEGG
FT                   VSLHKVPVPNSPPFGTVIDLNFDKKIYLSVVLEDIRTLSYTAIVSKFDSNKNIINAKGF
FT                   ENKQTTNKDNSFYLEGSSGGYGGKISINGKYIFPVNLDCSSDSFPGVWDLENKKRVVFS
FT                   SHKNSSITIDEKCHKLFNGVASLEELGGELVSK"
FT   gene            931816..932172
FT                   /gene="insB"
FT                   /locus_tag="YPD4_0723"
FT   CDS_pept        931816..932172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="insB"
FT                   /locus_tag="YPD4_0723"
FT                   /product="insertion sequence protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0723"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57632"
FT                   /protein_id="ACY57632.1"
FT                   /translation="MGNKKQQRWLWYAWESRLKRIIAHVFGRRSKKTFRQLLGLLSGFN
FT                   IVFWCTDNFSAYEMLPDEKHIRSKLYTQRIERENLNIRNRLKRLNRKTLGDSKSAEMHD
FT                   RIIGTFIEREHYLV"
FT   gene            932780..933415
FT                   /locus_tag="YPD4_0724"
FT   CDS_pept        932780..933415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0724"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0724"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57633"
FT                   /protein_id="ACY57633.1"
FT                   /translation="MQPAISLLKSAQEQMEAISADAQTATASPADLQAQISLLQQNLTE
FT                   LKQAVLLLSAPKGIALSSGEHLQMSASDNLIATAGKNADVSVAKNFFIGVGNTLSIFVR
FT                   KLGMKLIANQGSITVQAQNDLMELLARKAITITSTEDEIKITVKKRITLNAGGSYITLD
FT                   ENRIESGTAGEYLTKAGYYGRLDKAKLPTEFPALAAKAKPPTQKYPFS"
FT   gene            complement(934000..934075)
FT                   /locus_tag="YPD4_t7"
FT   tRNA            complement(934000..934075)
FT                   /locus_tag="YPD4_t7"
FT                   /product="tRNA-Phe"
FT   gene            934744..936906
FT                   /gene="speC"
FT                   /locus_tag="YPD4_0725"
FT   CDS_pept        934744..936906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speC"
FT                   /locus_tag="YPD4_0725"
FT                   /product="ornithine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0725"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57634"
FT                   /protein_id="ACY57634.1"
FT                   /translation="MTLLKIATSARLASYVETQRGVVYLNQTDFTDVAAVVMSVEDANA
FT                   GILSMLHDLGFAIPAFIAVTAEQTVSADYLPLIKGVITLGEANKAFYNAQVEAAASEYQ
FT                   KNLLPPFFSTLKKYVEMNNSTFACPGHQGGEFFRKHPAGRQFFEFYGETIFRSDMCNAD
FT                   VKLGDLLIHEGAAKDAQKYAAKVFNADKTYFVLNGTSAANKVVTNALLTRGDLVLFDRN
FT                   NHKSNHHGALIQAGATPVYLETARNPFGFIGGIDAHCFNEDYLRQQLREVAPERAEEAR
FT                   PFRLAIIQLGTYDGTVYNARQVVDSIGHLCDYILFDSAWVGYEQFIPMMKDFSPLLLEL
FT                   NENDPGIIVTQSVHKQQAGFSQTSQVHKKDNHIKGQKRHCNHKRFNNAFMLHASTSPFY
FT                   PLFAALDVNAKIHSGDSGRRMWMDCVKLGIETRKSLLARCSMLRPFIPPVVGGKNWQDY
FT                   ATDVIANDARFFNFVPDERWHGFEGYNQDQYLVDPCKLLLTTPGIDASTGRYTSFGIPA
FT                   AILATFLRENGIVPEKCDLNSILFLLTPAENTAKMAHLVDMLVQFERYVEQDAKLCDVL
FT                   PTIYRKNEERYHGYTLRQLCQEMHDLYVSHDVKQLQKDMFRKASFPQVVMNPQDANIQF
FT                   IRDNIELIPIAEAEGRIAAEGALPYPPGVLCVVPGEVWGGAVQRYFLALEEGINLLPGF
FT                   SPELQGVYIEKGDVSWRRIFGYVITQ"
FT   gene            937462..938421
FT                   /locus_tag="YPD4_0726"
FT   CDS_pept        937462..938421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0726"
FT                   /product="putative sugar ABC transporter periplasmic
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0726"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57635"
FT                   /protein_id="ACY57635.1"
FT                   /translation="MKKRLIGLLLAGVTISMSVSAAEPLKIGFANRTLNGAFFNGLTEY
FT                   MKIHAKEKGYTLITTDARGDLNKQIADVEDMLSQGINYLILNPQDPQAGLRITEIAKRA
FT                   GVPTVILDSDIALEAPVITRVQANNAKNNNLIGEYAVGQFGDKPMNCIFLSGNQGNLVG
FT                   QARRDNFLLGVAEAQLRKYNRTNVNFLSQGWGNWDQQGGLKAMEDIIVAQGDKINCVYS
FT                   EMDDMALGAIRALKAANKLDNVKVYAHDGYKKGLEAVKKGELQATASNNPDLLTSTVLE
FT                   VIGQYQAGQTSFPDYVYIPSILITKDNVDKYYKEDSIF"
FT   gene            938467..939966
FT                   /gene="mglA"
FT                   /locus_tag="YPD4_0727"
FT   CDS_pept        938467..939966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mglA"
FT                   /locus_tag="YPD4_0727"
FT                   /product="putative sugar transport ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0727"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57636"
FT                   /protein_id="ACY57636.1"
FT                   /translation="MDQYAIEVIQVTKSFGGIHALKSINLQIRTGSIHAIIGENGAGKS
FT                   TLMKILSGIYTKDSGRIMIHGEEKNFTSPIHSKESRIGIIYQELALSPDLTVAENIFLD
FT                   DLGFGTGMINWKRLNEKASLILNELGFQIDPRARVGDLSVAYQQMVEIAKSLAKDVNIL
FT                   ILDEPSAVLSGKEVAILFTQLRKLKARGVTIIYISHRLEELMVIADVITVIKDGETVKT
FT                   LDPQSCSEDEIITSMVGRKLESLYPEKNVPGNEVVLEVKALSTRALLHGINLTLHKGEI
FT                   VGLAGLVGAGRSEVARCLFGIDKIAGGTVSKAGTPIQINHPSQAMSHGIGLVPESRKEQ
FT                   GAILVRPIRENMTLSNLKAVSGWMGFIRRRQERETSQKLQQKLAIKLGSVEDPIASLSG
FT                   GNQQKVVIAKWLNTDCHILILDEPTRGVDVGAKAEIYNIIHQLAERGYSILVISSEMVE
FT                   VINLCHRIYVMSEGRITKELQHDEISEENIMRYAIPKRETI"
FT   gene            939999..940982
FT                   /locus_tag="YPD4_0728"
FT   CDS_pept        939999..940982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0728"
FT                   /product="sugar transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0728"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57637"
FT                   /protein_id="ACY57637.1"
FT                   /translation="MGSIVKEVDDVRQVSLMKRTALFLLDNSTTVVFIVMLIAAGFFSD
FT                   RFYSGDNITNVLRQSVPLGLAALGMLFVILTGGIDLSIGSIMAFVSVLVGLLIPEFGLW
FT                   PALIAGVGIATLMGAFSGFLVTWFNIAPFIATLAMMTIARGVALIISKGQPVFIDNDAF
FT                   VNFGTGYFLGIPLPVYVFLGFAIICQLVYKNSVFGRLVVSIGSNETATRFAGIRVNNYK
FT                   LAVYAISAFACGAAGIISATRTGVGSPVLSIGFELDVIAAVVVGGASLAGGHGNVVNTI
FT                   IGVFILSIISNLMNLMNISGYNQQVVKGVIIIIAVMVQSLKSRSKA"
FT   gene            complement(941065..943098)
FT                   /locus_tag="YPD4_0729"
FT   CDS_pept        complement(941065..943098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0729"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0729"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57638"
FT                   /protein_id="ACY57638.1"
FT                   /translation="MLAEDTIIVERNRSQTDSYQATTSVTANRSPANIIDTPQNVTVVT
FT                   HPVLEDYDVTNLGEALYFVSGITQSNTLGGTQDALIKRGFGNNRDGSILHDGIRSIQAR
FT                   NFTPTSERVEVLKGPSSMLYGMNEPGGLINVISKKPQLDPHVHLEANASSFKGGGGQLD
FT                   VTGPLGESGFAGRLIIDHQETDYWRNFGRNRQTVVAPSLDWYGENTTVHLAWERMEYLV
FT                   PFDRGTVIDPRTGKPVDTPRDRRFDESYNATRGDQDTVTFSINHDLNEFWSTQLNYAFS
FT                   RNSYSDNQARATAFNAETGVLTRQSDATANAKSHSQAVQWVVNGDLDWGFTHHQLMFGI
FT                   DYEARRVFRGDMIRGSKNNGFNVYDPIYGTLPPSTAVSAADSDQRENIDSRALFIQDSM
FT                   RLNEHWLLLGGLRYDSFDVMAGKGRPFKKNTDSSDSRLVPRAGVVYNLNDWSSLYVSYT
FT                   ESFKPNVSIATAIDALPPEYGKSWEAGYKIDINNRVTGTLAVYDIHKRNIMVSELVDGE
FT                   TVTRTAGKARSRGLELDMAGKVTDSLSLIGSYAYTDARLTEDPDNNGNDLPNVARHTAA
FT                   LFLSRDFGSTSLISGDEVKAGIGARYVGKRAGDAANSFWLDNYTVADAFIAWKMPLSGY
FT                   QLKWQLNVKNLFDKTYYPSSANNLRIAIGEPRQVVLQGSIDF"
FT   gene            complement(943202..944302)
FT                   /locus_tag="YPD4_0730"
FT   CDS_pept        complement(943202..944302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0730"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57639"
FT                   /protein_id="ACY57639.1"
FT                   /translation="MRLLLLIFLLCTWAVSAKTITDITGQRIEIPDNPQRIVLGESRML
FT                   YTLALLEPGYPAARVVGWPLDLKKYDPQSWALYTDKFPQMTHIPALGSTGLRDINPEKV
FT                   LELAPDLVILPVLAKTTHEEIALISLLKQAHIPVIRVDLRVDLLNHTIPSLRLLGEALN
FT                   RQDRAEAFISLYQSHMDRIHQRIAAYQGPHPSVLLQLHLGRGDECCTTTLKGNLGQLLE
FT                   FAGGNNIAAAQVKGVFGQLSEEYVLARSPEIYIATGMATAGSQAKTLALGPQVSTAQAQ
FT                   ESFRRVIATQSKLQHLPAIQNGHAWGLWHNFYLSPLHVVAAEFFAKTLYPHLFADVSPQ
FT                   DTLQTIYQQFLPLDFTGTFWSHLDNE"
FT   gene            complement(944602..945678)
FT                   /locus_tag="YPD4_0731"
FT   CDS_pept        complement(944602..945678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0731"
FT                   /product="membrane-bound lytic murein transglycosylase C
FT                   (Murein hydrolase C)"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0731"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57640"
FT                   /protein_id="ACY57640.1"
FT                   /translation="MKKILALLVIAPLLVSCSGNKNQVENEVFVKDTNGFEILMGQFAH
FT                   NIENIWGLKEVLIAGPKDYVKYTDQYQTRSHINFDAGTITIETIATTNPAAHLRQAIIT
FT                   TLLMGDDPGSIDLYSDVNDIQISKEPFLYGQVLDNNGEPIRWEWRAAHFADYLLQNKMQ
FT                   TRTSGLHVISFVTIQLVPNHLDKRAHKYLPLVRKSAARYGVEESLILAIMQTESSFNPY
FT                   AVSRSDALGLMQVVQHTAGKDVFKLKGKSGQPSRSYLFDPENNIDAGTAYLSILQNTYL
FT                   GGIQNATSRRYAVITSYNGGAGSVLRVFHSDKNKAVGIINTMSPGDVFQTLTTKHPSGE
FT                   SRRYLVKVNSAQKNYRRY"
FT   gene            complement(946311..947429)
FT                   /locus_tag="YPD4_0732"
FT   CDS_pept        complement(946311..947429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0732"
FT                   /product="A/G-specific adenine glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0732"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57641"
FT                   /protein_id="ACY57641.1"
FT                   /translation="MMQAQQFAHVVLDWYQHFGRKTLPWQLDKTPYQVWLSEVMLQQTQ
FT                   VATVIPYFQRFMLRFPDIQALAAAPLDDVLHLWTGLGYYARARNLHKAAQMVVEHHQGE
FT                   FPTTFDQILALPGIGRSTAGAILSLSLGQHFPILDGNVKRVLARCYAVDGWPGKKEVEG
FT                   RLWQISEDVTPANGVGQFNQAMMDLGAMVCTRSKPKCELCPLNIGCMAYANHSWARYPG
FT                   KKPKQTLPEKTAWFLLMQNGSQVWLEQRPPVGLWGGLFCFPQFAEQEELIHWLQKQGIP
FT                   ANETQQLTAFRHTFSHFHLDIVPIWLNTASVRGCMDDGAGLWYNLAQPPSVGLAAPVER
FT                   LLHQLLKDPLAKDELTQQQLTKQSPTQPALFD"
FT   gene            947764..948483
FT                   /locus_tag="YPD4_0733"
FT   CDS_pept        947764..948483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0733"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0733"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57642"
FT                   /protein_id="ACY57642.1"
FT                   /translation="MINDVISPEFDENGRALRRIRSFVRRQGRLTKGQQLALDSYWPVM
FT                   GVEYQAAPVDLNTLFGREAPIVLEIGFGMGTSLVTMATNNPQQNFLGIEVHSPGVGACL
FT                   SSAHDAGLSNLRIMCHDAVEVLENMIPEASLDMVQLFFPDPWHKARHNKRRIVQTPFVE
FT                   LVKSKLKVGGVFHMATDWQPYAEHMLEVMSGVSGYLNLSEQNDYVPRPDSRPLTKFELR
FT                   GQRLGHGVWDLMFERKE"
FT   gene            948483..948809
FT                   /locus_tag="YPD4_0734"
FT   CDS_pept        948483..948809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0734"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0734"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57643"
FT                   /protein_id="ACY57643.1"
FT                   /translation="MAKNRSRRLRKKMHIDEFQELGFSVQWAFDEGTSVDVIDETVDAF
FT                   IDEVIEANGLAFDGSGYLQWEGLICLQEIGHCTDEHRALVTKWLEARKLKNVETSELFD
FT                   IWWD"
FT   gene            948920..949846
FT                   /locus_tag="YPD4_0735"
FT   CDS_pept        948920..949846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0735"
FT                   /product="glutaminase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0735"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57644"
FT                   /protein_id="ACY57644.1"
FT                   /translation="MVTTLDNALLNDILQQVRPLIGQGKVADYIPALAEVPANKLGIAV
FT                   CTLDGQIFQAGDADERFSIQSISKVLSLTLALSRYSEQDIWQRVGKEPSGQPFNSLVQL
FT                   ELEKGKPRNPFINLGALVVCDMLQSRLSAPKQRLLEVVRQLVKDDSISYDPRVARSEFE
FT                   HSDRNAAIAYLMKSFGNFDNDVLTVLQTYFHYCAMRMSCVELARCFVYLANQGRSISGS
FT                   ESLITPMQARQINALMITSGMYDGAGEFAFRVGMPGKSGVGGGIIAIVPDEFCIAVWSP
FT                   ELDHAGNSLAGTAALERLAQQMGRSIF"
FT   gene            949958..950488
FT                   /locus_tag="YPD4_0736"
FT   CDS_pept        949958..950488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0736"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0736"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57645"
FT                   /protein_id="ACY57645.1"
FT                   /translation="MLHKIKVLRTAGLALLMLTAGQAQAEYQCSVKPQDDVIISPQSVQ
FT                   IVGASGNLQISPDGDVTRNGKTLTLTDAQRQQAFRYQTALRKDLPWIDQGAQQRLEKAR
FT                   VSLDKVIVQQLGSSSNVRNRLTTLSEQLKQQMARIIEKRSDGLAFHHQAIAQVEKEAVS
FT                   WSSRAWVACCRIA"
FT   gene            951208..960522
FT                   /locus_tag="YPD4_0737"
FT   CDS_pept        951208..960522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0737"
FT                   /product="virulence determinant"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0737"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57646"
FT                   /protein_id="ACY57646.1"
FT                   /translation="MAGFYIDKLSLSQRLSIVSETYDRVNKNNKKEKLKYSYDDIEMIK
FT                   KRFVKYIDAQLYSLIREGLSVPATLTQEEKIKITDLAIDAALFNDYERFNELIIYISSL
FT                   GISVTPPLPQEEGGSRLYIYFSGDIHAYMDVWRGDLLLGSGTELSDIQSITGLRFMIDM
FT                   AESLKLNIINPADKAMVDLINHLRYEMISYASSFCATYSAERGGTVYLSSPDGLRINNY
FT                   FWNSELPVLRALQKKGLIGDIRILHKPLEFYKDTPLDELGDLLTAKDISMTVEYQFLPV
FT                   WLQEKLLVDIYQQWLDEEFQPSLLAVRKEIINTIDIDRHAPEVELLRYFLRKIHEQLDE
FT                   ITEFKVLKEAERIDSIKKKLAVGSEIESWLDNVPAIDVNERKIILESLLQKESLLFSNV
FT                   RDIKKSIIPLDFNSDVININTSLLKNTFIPFNLLRESWDVIISDRSLVEGTLTIHFSVG
FT                   RKIMIKVDANRNQLKQMATLERFLLANFTPRNTPQDLKIIDNVIMSGDVVLAERRDDKG
FT                   WHNDQQMIEKVKLSEFDYFLKSNDLGVKINDNGFVLYLISDPEDNRDVIIKPNDDYNLK
FT                   SIKDFIENNYLFFDDVPEYLIVKKNVENKECIFAHDEGETYQVAYRDGEAWVLLSKMNT
FT                   SDQIKNLNEITMSVNLNNAESRSVALILSLLNKHARLVSILPDTHPKVMENFLDIDSLL
FT                   KNSTHPFEHPLYRKLLNSISNDINKYMESLNEIKDSYHLLPFDVRPGQYMNTWSKIDRD
FT                   TVIEYSFKQNDKNHHLQFIVLLQDDSLSKRVGEIIASYNNNKSIVLQFDARSSEARIAY
FT                   GTQNNITEMGKFELSFVTHGTTDGVYSFSVANVIEIYKLTINSFALPPPVKIRLVICSI
FT                   ADNGQGAQGFNGTHPALGIVNMMHQEGFDIPILAYTTKVGVSVEHPGELVVFNSEKPGE
FT                   VLKNIDDYQVLYHYKNNILLTDGVPVVELLLKDVRNKIKSVDQLIESYSQYLVPFFSDD
FT                   NGVVDRELLELTINDFDTYSKFENFLDIIRQRPELRNSDNWQLVVANNATGFLITTLDE
FT                   PVVKYPDIVKVNEWDLPAIANIDKTATASQYDMQIVFQCENNPTVNRAATRLAGKHAKN
FT                   SIIIQLDVDNNHRAFIIDDNTHAEWREISHNELVTKLKIQPENGKIRWQVVGHGRSEGG
FT                   NDKHPTLAGQRPEQLTARLNQFSDYLQTEHQINISPQQVSLVGCAMSSSDRYTSFAHKF
FT                   MSHLNENGIRTNVSASTKAIEVDPQGHKHDVDTPDIDSYNNKYLSSIKGTEKLYWNRWG
FT                   EITTERKKDINGRLNNIDSLLDKLITRQLSVNQLNKKQQRKLAEIFPQLTDKKLNKGEL
FT                   LLTLHDSWRMQALKYDLLFLQKISDRPDFDTELWRVTDRWRITETDGNTLQDVRIKSGS
FT                   QHKTDLATYPHSITSDPDLKTSAPELKTSNPKARTAIFGRFGYGMQGYGFISALRLSAD
FT                   YQRWMSNGDLTEKQEEEIQLQLAMAWGGIGANLATDGLQYAFGKWGIGYLQKLVSKGGR
FT                   LSPALLSQLTLLKRNPALLLAPGFLKDLRKLALNQFAHGAARFSMPLLSALTSGIDIYQ
FT                   AYHAFSQLATETDPHVRRDLIASGVFSTINATIGLGVAFAMAMGGTAATAAGPAGIALA
FT                   FTMIIVGDIYSAVSQIERIRDIVPDMTGSQRFENGLRLFLKFGLTPGLDNQIRYNQTME
FT                   SVYQRQRDYYEALLASKQGVDTLFYSRGEAVLKAIPFIKRDERSQTERDLEKISIFSGD
FT                   PFTNAKIYTTYAEMGKHEYYELDKINDVDDYVIADFFEDNNRSVVKLQNKNLHQAFSEL
FT                   DIDSTYSPFILSADVDRNGLNDFIVINEKYNTTIASRKNSVGMTVIDDYVSRWHYELYT
FT                   WLAQPDGSYLKIDTRLEWEKLFHAIEVDKFNEVVFPVLGDFNGDNVFELVIFHDDKMTT
FT                   YHYDSLDFNQSGKDNHNVINIGDFIEPVRLAFEGEKSKNYPYSLVGDINNDGFDDILLL
FT                   NKSGDMLHLMGNSSGVFRQHKTKLSSELTSLLSSSNLHRSQLQLTDLNKDGGLDLVIIL
FT                   NDGIYYQALGDKIDGEYHFDTPSMVNKITIKNEGGDSVRYQQNRLSQIDKHKIIAISPS
FT                   DQGENRLISLSDSGELLAHPLREIKENDVAALFDLGGGDDVAKGYHKKKNIFTIGSGFK
FT                   QYQGGENADTFILTSAVASKSHILSGGEGNDTVALGEVLGNEIDSIIDISNGYYSQVNG
FT                   GVEKQVALLYDFENILGHENVNDTIIGNDVDNYLNGMGGDDKIWGNGGNDLLALQSGLA
FT                   QGGTGLDSYHILKSTHEKSLQIRIEEVSENNNTDMQISNIFLEHKLNQIKSIELDNIDV
FT                   LININNDNGFMTQIRLVGVYNINNNQKQQVLNFTIQTVDGFTMVPLWPSYLNEITEFSP
FT                   NMVAYYSSLVDRNYKELVGKGDPDDIVVRFSLDNGYQQQQVTHLQRVEGEKDIVLRQAI
FT                   LPDFIRLSPQEHSMLMGFLPRYELLGDNKDNLLQVLSGEGLLEGRGGQDTYLIQEKEGS
FT                   PTDIIINNFDDSLASDNLVLSSWLLCDVIVERSDDDLLLRYRDQPEKHQSIRLVNYMND
FT                   ERYRHLKITDKSGQSQYRDPVTGTFIDYQINLDKNGHPFIAAQQAPVVSSGNDEVVITS
FT                   ATFLPGNYIDTGDGNDAIIYIRGHEGTMLKGGGGDDTYYYSAGSGAINIADTSGLDHLY
FT                   LDKHILLHTLSAERRENNLVLNIADNTSGRIIFVDWYLADENKVEFIWVEDSQITFDEL
FT                   FSLRPYSDEYYQLCQHLKSMGLSLTVRQLADLDSQDGYNTLNQLRTIKAWVTKNPIYDV
FT                   ADLDYLVAMSSIAWRGNARNTDPLPLIEQKIDAFFQPLIAERISLTEEHVTWIQREEFD
FT                   TVDIAKWVKNYHLRSQNEINYLLEQLGLLKESPLSDKALDFTFKNRIDLAQADIELCQQ
FT                   ECGINRQSLINLAMKYHVTGRGHFELLISNIQVLKEYGVVVSESEQPLVLRKPIDLRQY
FT                   FNQKNLTKDHVGRLAEHDMSFDELTLLLDKNIPIEQAFTQRLQTQLGPLKLFNDERVFN
FT                   KGDVFDQDISQLAEAMGGLESTESYSLPLERQTVMAITTHQFVSDSIAAY"
FT   gene            complement(960712..961842)
FT                   /locus_tag="YPD4_0738"
FT   CDS_pept        complement(960712..961842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0738"
FT                   /product="coproporphyrinogen III oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0738"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57647"
FT                   /protein_id="ACY57647.1"
FT                   /translation="MLKLPPLSLYIHIPWCVQKCPYCDFNSHALKGDVPHQEYVEHVLA
FT                   DLDADVPLVSGREISTIFIGGGTPSLLSAEAMQQLLDGVRARLPVASDAEITMEANPGA
FT                   VEADRFSGYQRAGINRISIGVQSFSAQKLTRLGRIHGPDEARRAAELATSLQLRSFNLD
FT                   LMHGLPDQTLEEALDDLRQAIALNPPHLSWYQLTIEPNTGFSSRPPILPDDDALWDIFQ
FT                   QGHQLLSAAGYLQYETSAYAKPGYQCQHNLNYWRFGDYLGIGCGAHGKITFNDGRILRT
FT                   IKTKHPRGFMQGKYLDKQYEVAAVDRPFEFFMNRFRLLEAAPRADFYHFTGLTESTIRP
FT                   QLDEAIAKEYLIETTEYWQITEKGKLFLNSLLELFL"
FT   gene            complement(961835..962263)
FT                   /locus_tag="YPD4_0739"
FT   CDS_pept        complement(961835..962263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0739"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0739"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57648"
FT                   /protein_id="ACY57648.1"
FT                   /translation="MQRKPQDLPAIADDSGLAVDALGGAPGIYSARYAGTDASDQENLE
FT                   KLLVALQNVPDEKRGAQFHCVLVYMRHAEDPTPLVFHGQWPGVIAHQPAGAAGFGYDPI
FT                   FYVPALGKTAAELTREEKHAVSHRGQALKLMLDALRDA"
FT   gene            complement(962529..962831)
FT                   /locus_tag="YPD4_0740"
FT   CDS_pept        complement(962529..962831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0740"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57649"
FT                   /protein_id="ACY57649.1"
FT                   /translation="MGHAVSAVLSTENGLILKLYIQPKASRDQIVGLHGDELKVAITAP
FT                   PVDGQANTHLVKFIAKQFRVAKSQVIIEKGELGRHKQIKVINPQQIPPEVTILLE"
FT   gene            complement(962816..963370)
FT                   /locus_tag="YPD4_0741"
FT   CDS_pept        complement(962816..963370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0741"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0741"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57650"
FT                   /protein_id="ACY57650.1"
FT                   /translation="MLTLTFLAKTVIDLYVMVLLLRIWMQWVHSDFYNPLSQFVVKITQ
FT                   PIVGPLRRVVPSMGPIDSASLLLAFLLMTIKYPLLLLIDSGSLSLSIYNLLFGLIALVK
FT                   AVGYLIFWVMIIRALMSWISQGRSPVDYLLLQLTEPLMAPIRRILPAMGGIDFSAMVVI
FT                   LILYLLNFLGMDLFGAMWVML"
FT   gene            complement(963658..964479)
FT                   /gene="proC"
FT                   /locus_tag="YPD4_0742"
FT   CDS_pept        complement(963658..964479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="YPD4_0742"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0742"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57651"
FT                   /protein_id="ACY57651.1"
FT                   /translation="MQHRNITFIGAGNMARAIIAGLVAGGYPAKMISVCAPSAKNRDAL
FT                   ATEFGVISSDDNIRESQKAEVVVLAVKPQLMADVCQQLQKQVDFSDKLVLSIAAGVQVA
FT                   RFYALLGNKLNLVRIMPNTPSLVGKGMSGLYAPEQVSAADRDFTTELMSAIGKVCWVDN
FT                   EDGINSIIAAAGSSPAYFFLFMEAMQQETERLGFDSETARQLVQQAASGACALVEANPH
FT                   VPLSALREQVTSKGGTTAEAIRVFNEQHLPEMVANAMRAAIARAKEMEKLF"
FT   gene            complement(964612..965220)
FT                   /locus_tag="YPD4_0743"
FT   CDS_pept        complement(964612..965220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0743"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0743"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57652"
FT                   /protein_id="ACY57652.1"
FT                   /translation="MLAVSKTKPVAAIEKAIAAGQYAFGENYVQEGVDKIHSFVDNKTL
FT                   EWHFIGPLQSNKSRLVAENFAWCHTVDRLKIAQRLSAQRPAAMPALNVLIQINISDEQS
FT                   KAGISLSELPALADSISTLPNLCLRGLMAIPAPEHDYQRQLAVFTQMNQAFLTLKARYP
FT                   QIDTLSMGMTDDMDAAISAGSTLVRIGTAIFGARVYNAD"
FT   gene            965330..966454
FT                   /locus_tag="YPD4_0744"
FT   CDS_pept        965330..966454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0744"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0744"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57653"
FT                   /protein_id="ACY57653.1"
FT                   /translation="MDFTSLNNQHSDLNNPVFSRIKAKRIDLENPDLASDGFNKQDFAN
FT                   KVAASVDHNASDLHLCTGFHPVLRIDGELKTFTDWPKVTAGWLNGLRRHMLSDAQESRL
FT                   QQQGQVDCAYTTVGSQRLRANIFQQRQGQSIAFRIIPAICPSLTQLAAPPILNQLIQQD
FT                   NGLILVTGATGSGKSTTLSAMISAINQQQARHIITLEDPIEFIHSSQSCLIQQRELGRH
FT                   THCFSRALNGALRQDPDIILLGELRDLETIRLALTAAETGHLVLATLHTRTATQAIDRL
FT                   IDVFPPEEKAVIRTQLAASLRGVITQKLCRQNGGGRIAVFEILTQTTAVSHLIREGKTY
FT                   QLPTVIQAGGQWGMQTFEQSIAQRQKQGVLAINH"
FT   gene            complement(966563..967678)
FT                   /locus_tag="YPD4_0745"
FT   CDS_pept        complement(966563..967678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0745"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0745"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57654"
FT                   /protein_id="ACY57654.1"
FT                   /translation="MSVQDTMLQQQALPGTPRQDGFFMPAEWAPQDAVWMLWPYRQDNW
FT                   RGKAIPAQQTFAKVAEAISRATPVFMGVPAEFMAQAKATMPANVTLVEMASDDAWMRDT
FT                   GPTMVINGAAERRAVDWQFNAWGGLNGGLYADWQQDEKVAVQVSDFLKNAHYSAPLILE
FT                   GGSIHTDGEGTLLTTAECLLNPNRNPHLNQAQIEQLLCDYLGVTHFIWLQDGVYNDETD
FT                   GHIDNMCCFVRPGEVALHWTDDQQDPQYARSVAAFEVLSNTVDAKGRKLKIWKLPAPGP
FT                   LYNTEEETFDVLTSDAVPRTAGERLAGSYVNFLISNQQIIFPLLDSRTDGQANDLLQQM
FT                   FPGYAIVGVPAREILLGGGNIHCITQQIPAA"
FT   gene            complement(967682..968566)
FT                   /locus_tag="YPD4_0746"
FT   CDS_pept        complement(967682..968566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0746"
FT                   /product="putative carbon-nitrogen hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0746"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57655"
FT                   /protein_id="ACY57655.1"
FT                   /translation="MTKVTVAATQMACSWDLPKNIENAEKLVRQAHAKGAQIILIQELF
FT                   AAPYFCIDQSPEHYALAQELDNSPLIKHFSKLAAELEVVLPLSFFEKANNAYYNSLVMI
FT                   DADGSVLDVYRKTHIPNGPAYQEKQFFIPGDTGFKVWQTRYAKVGVGICWDQWFPETAR
FT                   SLALLGAEVIFYPTAIGSEPAYPEIDSQPHWTRVQQGHAAANLVPVIASNRIGTEKSKY
FT                   IDGLEMTFYGSSFIADQTGALLAQANKTDEAVLVHEFDLQEIAAQRASWGLFRDRRPEM
FT                   YQTLATSDGKTRR"
FT   gene            complement(968746..969168)
FT                   /locus_tag="YPD4_0747"
FT   CDS_pept        complement(968746..969168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0747"
FT                   /product="Holliday junction resolvase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0747"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57656"
FT                   /protein_id="ACY57656.1"
FT                   /translation="MANRTIIAFDFGTKSIGVAIGQEVTGTARALTAFKAQDGTPDWQQ
FT                   VEKLLKEWQPNLVVVGLPLNMDGTEQPLTARARRFANRLHGRFGVQVALQDERLSTVEA
FT                   RANLFDRGGYRALDKGSVDAASAVIILESWFDEQAG"
FT   gene            complement(969168..969731)
FT                   /locus_tag="YPD4_0748"
FT   CDS_pept        complement(969168..969731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0748"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0748"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57657"
FT                   /protein_id="ACY57657.1"
FT                   /translation="MNLQHHFLIAMPSLQDPQFKRSVIYICEHGEKGAMGLVINKPLEQ
FT                   LTVETILEKLKIKSPSRDPAIRLDNVVLAGGPLAEDRGFILHSPQEGFASSIHISPETM
FT                   ITTSKDVLETLGTSGQPKNLLVALGYASWRQGQLEQELLDNVWLTTEADTHILFNTPIA
FT                   ERWQAAANKLGINIFNIAPQAGHA"
FT   gene            complement(969847..970806)
FT                   /gene="gshB"
FT                   /locus_tag="YPD4_0749"
FT   CDS_pept        complement(969847..970806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gshB"
FT                   /locus_tag="YPD4_0749"
FT                   /product="glutathione synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0749"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57658"
FT                   /protein_id="ACY57658.1"
FT                   /translation="MIKLGIVMDPISSINIKKDTSFAMLLEAQRRGWELHYMEMGDLYM
FT                   RGGDGRARTRRLNVKQDKDNWFSFGAEQDLPLYDLDVILMRKDPPFDTEFIYATYILER
FT                   AEDKGTLVVNKPQSLRDCNEKLFTAWFPELTPDTLVSRSKDHIRKFHQEHGDIILKPLD
FT                   GMGGTSIFRVKQDDPNLSVIIETLTELSSRFCMAQNFLPAIKEGDKRVLVVDGEPVPYC
FT                   LARIPAQGETRGNLAAGGRGEARPLSESDWEIARTVAPILKQKGLIFVGLDIIGDRLTE
FT                   INVTSPTCVREIEAAFPEISITGMLMDAIERRLADKKA"
FT   gene            complement(970832..971563)
FT                   /locus_tag="YPD4_0750"
FT   CDS_pept        complement(970832..971563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0750"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57659"
FT                   /protein_id="ACY57659.1"
FT                   /translation="MRIPRIYHPQPLQANTELALTDEAANHVGRVLRMTEGQSLQLFDG
FT                   SNQIFDAEIIRADKKNLIVRLAEGQWEDRESPLNLHLGQVISRGEKMEFTVQKSIELGV
FT                   NVITPLFSARCGVKLDGERLTKKIQQWQKIAIAACEQCGRNTIPEIRDAMQLADWCAES
FT                   DDSLKLNLHPRASNSINTLPSSLNKVRLLIGPEGGLSADEIAMTSRLGFTDILLGPRVL
FT                   RTETTALTAITALQVRFGDLG"
FT   gene            complement(971815..972522)
FT                   /gene="endA"
FT                   /locus_tag="YPD4_0751"
FT   CDS_pept        complement(971815..972522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="endA"
FT                   /locus_tag="YPD4_0751"
FT                   /product="endonuclease I"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0751"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57660"
FT                   /protein_id="ACY57660.1"
FT                   /translation="MLRNILFLLVLSSPLLPLISHSHGINNFSQAKAVAAKIHQDAPGS
FT                   FYCGCQIDWQGKKGIPDLNSCGYQPRKNAARAARIEWEHVVPAWQFGHQRQCWQQGGRK
FT                   NCAKDPVYRQIETDLHNLQPAIGEVNGDRNNFMYSQWNGGSGQYGQCAMKVDFKNKLAE
FT                   PPVRARGAIARTYFYMRDQYQLRLSSQQSKLFGVWDRQYPVTDWECLRDERIAKTQGNH
FT                   NPYVQRACQRPKS"
FT   gene            complement(972620..973183)
FT                   /gene="sprT"
FT                   /locus_tag="YPD4_0752"
FT   CDS_pept        complement(972620..973183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sprT"
FT                   /locus_tag="YPD4_0752"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0752"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57661"
FT                   /protein_id="ACY57661.1"
FT                   /translation="MVMSACIWLSTVLFFRIMSTLRIPIALQQAVMQCLRHYLQLANQH
FT                   LGTAYPEPKVNYHQRGTNAGSAYLQSFEIRLNPVLLLENKQPFIDEVVPHELAHLLVYR
FT                   QFGRVAPHGKEWRWMMEQVLKVPASRTHQFEVASVRSKTFNYQCKCQQHALTIRRHNKV
FT                   LRGESEYRCRQCGEKLQFITINPD"
FT   gene            complement(973325..974479)
FT                   /gene="metK"
FT                   /locus_tag="YPD4_0753"
FT   CDS_pept        complement(973325..974479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metK"
FT                   /locus_tag="YPD4_0753"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0753"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57662"
FT                   /protein_id="ACY57662.1"
FT                   /translation="MAKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETY
FT                   VKTGMVLVGGEVTTNAWVDIEEITRRTIREIGYVHSDMGFDANSCAVLSAIGKQSPDIN
FT                   QGVDRENPLEQGAGDQGLMFGYATNETSVLMPAPITYAHRLVERQAEVRKNGALPWLRP
FT                   DAKSQVTFQYDDGKIVGIDAVVLSTQHSEDINQKDLHEAVMEEIIKPVLPAEWITAHTK
FT                   YFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARY
FT                   VAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVEAFGTEKIPADQLTLLVREFFDLRPYG
FT                   LIKMLDLLHPIYRETAAYGHFGREHFPWEKTDKAALLRDAAGLK"
FT   gene            975686..977665
FT                   /gene="speA"
FT                   /locus_tag="YPD4_0754"
FT   CDS_pept        975686..977665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speA"
FT                   /locus_tag="YPD4_0754"
FT                   /product="arginine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0754"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57663"
FT                   /protein_id="ACY57663.1"
FT                   /translation="MSDDNLISRPLTAGAHVSLRSMQEVAMNDRNASKMLSTYNVAYWG
FT                   GNYYDVNELGHISVCPDPDIREARVDLAQLVKKMQLEQGQRLPALFCFPQILQHRLRSI
FT                   NAAFKRARESFGYEGGYFLVYPIKVNQHRRVIESLVNSGEPLGLEAGSKAEMMAVLAHA
FT                   GMTRSVIVCNGYKDREYIRLALIGEKLGHKVYLVIEKMSEIKMVLEEAERLNVVPRLGV
FT                   RARLASQGSGKWQASGGEKSKFGLSATQVLQLVDMLREANSLESLQLLHFHLGSQLSNI
FT                   RDISTGVRESARFYVELHKLGVNIQCFDVGGGLGVDYEGTRSQSDCSVNYGLNEYANNV
FT                   IWGIGDACNEHGLPHPTVITESGRAVTAHHTVLVSNVIGVERNEFCEPQPPEAGAPRAL
FT                   ESLWDTWQEMQEPENRRSLREWLHDSQMDLHDVHTQYAHGMLDLTHRAWAEQLYLSICN
FT                   EIQKQLDPSNRAHRPIIDELQERMADKLYVNFSLFQSMPDAWGIDQLFPVLPLEGLDKP
FT                   PERRAVLLDITCDSDGTIDHYIDGDGVATTMPMPPYDPENPPLLGFFMVGAYQEILGNM
FT                   HNLFGDTAAVDVYVFPDGTVEVEQTDEGDTVADMLEYVQLNPEKLLEHFRGQVKETDLD
FT                   TELQAQFLEEFEAGLYGYTYLEDE"
FT   gene            977825..978145
FT                   /locus_tag="YPD4_0755"
FT   CDS_pept        977825..978145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0755"
FT                   /product="putative Rieske protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0755"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57664"
FT                   /protein_id="ACY57664.1"
FT                   /translation="MGWFSVCKVNDIKPDFPFSAQAGNNRVGIYLVEGEYFAMEDICPH
FT                   AYALLSQGINDGEIIECPLHGALFNVRTGQCLREPGDRDLNTYAVRINGDQIDVNLDGD
FT                   GE"
FT   gene            complement(978435..979187)
FT                   /locus_tag="YPD4_0756"
FT   CDS_pept        complement(978435..979187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0756"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0756"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57665"
FT                   /protein_id="ACY57665.1"
FT                   /translation="MKIRTSMIALSLAALLSGCQSLNTEGLMQSGAQAFQAATLNDADV
FT                   KALSEKSCVEMDQKAQIASADSQYGKRMAKIAAALGDNINGTPANYKVYVTKDVNAWAM
FT                   ANGCIRVYSGLMDMMTDNEVEGVVGHEMGHVALGHTRKAMQVAYGTTALRTAIASAGGV
FT                   VGTLSQSQLADLGEKLVNAQFSQKQESEADDYSFDLLKKRGIDPNGLVTSFEKLASMEA
FT                   GRNSSMFDDHPSSQARAEHIRQRIAAEK"
FT   gene            979678..981672
FT                   /gene="tktA"
FT                   /locus_tag="YPD4_0757"
FT   CDS_pept        979678..981672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tktA"
FT                   /locus_tag="YPD4_0757"
FT                   /product="transketolase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0757"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57666"
FT                   /protein_id="ACY57666.1"
FT                   /translation="MSSRKELANAIRALSMDAVQKAKSGHPGAPMGMADIAEVLWRDYL
FT                   NHNPTNPHWADRDRFVLSNGHGSMLIYSLLHLTGYDLPMEELKNFRQLHSKTPGHPEYG
FT                   YTAGVETTTGPLGQGIANAVGFAIAERTLGAQFNRPGHDIVDHHTYAFMGDGCMMEGIS
FT                   HEVCSLAGTMKLGKLTAFYDDNGISIDGHVEGWFTDDTAARFEAYGWHVVRGVDGHNAD
FT                   SIKAAIEEAHKVTDKPSLLMCKTIIGFGSPNKAGTHDSHGAPLGEAEVAATREALGWKY
FT                   PAFEIPQDIYAAWDAKEAGKAKEAAWNEKFAAYAKAYPELAAEFKRRVSGELPANWAVE
FT                   SKKFIEQLQANPANIASRKASQNALEAFGKVLPEFLGGSADLAPSNLTIWSGSKSLSDD
FT                   LAGNYIHYGVREFGMSAIMNGIALHGGFIPYGATFLMFVEYARNAVRMAALMKIRSVFV
FT                   YTHDSIGLGEDGPTHQPVEQMASLRVTPNMSTWRPCDQVESAVAWQYALERKDGPSALI
FT                   FSRQNLAQQPRTAEQLANIAKGGYVLKDCAGQPELILIATGSEVELAVAAADQLTATGR
FT                   KVRVVSMPSTDAFDKQDAAYRESVLPSAVSARVAVEAGIADYWYKYVGLNGAVVGMTTF
FT                   GESAPAELLFKEFGFTVENVVAKAQALLK"
FT   gene            981929..982438
FT                   /locus_tag="YPD4_0758"
FT   CDS_pept        981929..982438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0758"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0758"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57667"
FT                   /protein_id="ACY57667.1"
FT                   /translation="MRSGNCKCSTRNQKGVPMRDEKSLAHTRWNCKYHIVFAPKYRRQV
FT                   FYREKRRAIGSILRKLCEWKNVNILEAEYCVDHIHMLLEIPPKMSVSGFMGYLKGKSSL
FT                   MLYEQFGDLKFKYRNREFWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGS
FT                   PFTGRK"
FT   gene            983060..983794
FT                   /locus_tag="YPD4_0759"
FT   CDS_pept        983060..983794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0759"
FT                   /product="D-erythrose 4-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0759"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57668"
FT                   /protein_id="ACY57668.1"
FT                   /translation="MVLDCSGVYGSREDGEAHVASGAKKVLFAHPGGHDLDATVVYGVN
FT                   HQDLRAEHRIVSNASCTTNCIIPIIQLLDIAYGIESGTVTTIHSSMNDQPVIDAYHQDL
FT                   RRTRAASQSIIPVDTKLAAGITRIFPKFCDRFEAISVRVPTINVTAIDLSVSVTHPVGV
FT                   AEVNQLLQKAARGAFRGIVDYTELPLVSMDFNHDPHSAIVDGTQTRVSGQHLIKTLVWC
FT                   DNEWGFANRMLDTTLAMAKSGF"
FT   gene            983897..985060
FT                   /gene="pgk"
FT                   /locus_tag="YPD4_0760"
FT   CDS_pept        983897..985060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgk"
FT                   /locus_tag="YPD4_0760"
FT                   /product="phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0760"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57669"
FT                   /protein_id="ACY57669.1"
FT                   /translation="MSVIKMTDLDLAGKRVLIRADLNVPVKEGKVTSDARIRASLPTIE
FT                   AALKQGAKVMVTSHLGRPTEGEYNEEFSLLPVVNYLKEKLSSPVRLAKDYLDGVEIAAG
FT                   ELVVLENVRFNKGEKKDDEALSKKYAALCDVYVMDAFGTAHRAQASTHGVGKFAPIACA
FT                   GPLLSAELEALGKALGNPARPMVAIVGGSKVSTKLTVLGALSKIADKLIVGGGIANTFV
FT                   AAQGHNVGKSLYEADLIPEAKRLLETCDIPVPTDVRVATEFSETAAATLKPANEIKDDE
FT                   QILDLGDESAERLAEILKNAKTILWNGPVGVFEFPNFRKGTEIVARAIAESEAFSIAGG
FT                   GDTLAAIDLFGIADQISYISTGGGAFLEFVEGKKLPAVVMLEERAKQ"
FT   gene            985180..986259
FT                   /gene="fbaA"
FT                   /locus_tag="YPD4_0761"
FT   CDS_pept        985180..986259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fbaA"
FT                   /locus_tag="YPD4_0761"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0761"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57670"
FT                   /protein_id="ACY57670.1"
FT                   /translation="MSKIFDFVKPGVITGDDVQKVFAVAKENNFALPAVNCVGTDSINA
FT                   VLETAAKVRAPVIVQFSNGGAAFIAGKGVKTDAPQGAAILGAISGAHHVHQMAEHYGVP
FT                   VILHTDHCAKKLLPWLDGLLDAGEKHFAATGKPLFSSHMIDLSEESLEENIEICSKYLT
FT                   RMSKIGMTLEIELGCTGGEEDGVDNSHMDASSLYTQPQDVDYAYEKLNAISPRFTIAAS
FT                   FGNVHGVYKPGNVKLTPTILRDSQDYVSKKHNLPHNSLNFVFHGGSGSTAEEIKEAVSY
FT                   GVVKMNIDTDTQWATWEGILNYYKKNEGYLQGQLGNPEGADKPNKKYYDPRVWLRAAQV
FT                   TMITRLELAFKELNAIDVL"
FT   gene            986697..987566
FT                   /locus_tag="YPD4_0762"
FT   CDS_pept        986697..987566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0762"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0762"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57671"
FT                   /protein_id="ACY57671.1"
FT                   /translation="MEELNVVEGINNASTWLANNQDLLIQYAVNIIAALLILIVGSIIA
FT                   KVLSGMLNRVMRLRGIDVTVADFLSAMVRYSILAFTIVAVLGRLGVQTASVIAVIGAAG
FT                   LAVGLALQGSLSNFAAGVLLVAFRPFKAGEYVDLGGVAGTVVQVQIFSTTLRTVDDKII
FT                   VVPNGKIIANNIINTSREPNRRTDMIVGVAYDADIDVVKKVLGDIIAADSRIIHEKGVT
FT                   VRLNEMAPSSLNFAVRVWTTNGDAQEVFWDLTENFKRALDAHKIGIPYPQMDVHLHQVA
FT                   KAEAEKPE"
FT   gene            987829..988446
FT                   /locus_tag="YPD4_0763"
FT   CDS_pept        987829..988446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0763"
FT                   /product="arginine exporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0763"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57672"
FT                   /protein_id="ACY57672.1"
FT                   /translation="MLAVYLHGFILSAAMILPLGPQNVFVMNQGIKRQHHLMSASLCAL
FT                   SDIILICAGIFGGSALLSRSPLLLALVTWGGVAFLMWYGWGALMAAWRGDGVASSATSV
FT                   TQGRWRILVTLLAVTWLNPHVYLDTFVVLGSLGGQLLPDIRPWFALGAVTASIVWFFAL
FT                   ALLAAWLSPWLNRPVAQRIINLFVGGVMGFIAFQLARQGFGL"
FT   gene            988636..989415
FT                   /locus_tag="YPD4_0764"
FT   CDS_pept        988636..989415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0764"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0764"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57673"
FT                   /protein_id="ACY57673.1"
FT                   /translation="MKLKTLALAAMIGLGTLPLALQAQAAEVPEGPHVVTSGTASVEAT
FT                   PDIATIAIEVSVSAKDAADAKKQVDTRVAQYFDFLNKSGIEKKDVKAANIRTQPEYDYQ
FT                   KSGEAVLKGYRAVRQVQVTLRQLDKLNDLLDGALKSGLNEIRAVELGVASPETYREQAR
FT                   KKAIENTITQAGALADGFKVKLGPVYSIRYHIANYQPMPVARMYKSAGAASDTAVEQTY
FT                   EQQTINFDDQVDVVFELQTGANPASIAATANKTVAAQ"
FT   gene            complement(989426..990334)
FT                   /gene="iciA"
FT                   /locus_tag="YPD4_0765"
FT   CDS_pept        complement(989426..990334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iciA"
FT                   /locus_tag="YPD4_0765"
FT                   /product="chromosome replication initiation inhibitor
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0765"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57674"
FT                   /protein_id="ACY57674.1"
FT                   /translation="MKRPDYRTLQALDAVIRERGFERAAQKLCITQSAVSQRIKQLENL
FT                   FGQPLLVRTVPPRPTEQGQKLLALLHQVELLEEEWLGNDNGVDTPLLLSLAVNADSLAT
FT                   WLLPALKPVLADLPIRLNLQVEDETRTQERLRRGEVVGAVSIQPQPLPSCLVDQLGALD
FT                   YLFVASKAFAERYFPNGVTRSALLKAPAVAFDHLDDMHQAFLQQNFDLSPGSVPCHIVN
FT                   SSEAFVQLARQGTTCCMIPHLQIEKELASGELIDLTPGLLQRRMLFWHRFAPESRTMRK
FT                   VTDALLSYGRQVLRQDSFIGQ"
FT   gene            990676..991332
FT                   /gene="rpiA"
FT                   /locus_tag="YPD4_0766"
FT   CDS_pept        990676..991332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpiA"
FT                   /locus_tag="YPD4_0766"
FT                   /product="ribose-5-phosphate isomerase A"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0766"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57675"
FT                   /protein_id="ACY57675.1"
FT                   /translation="MTQDELKKAVGWAALDYVKPGTIVGVGTGSTAAHFIDALGSIKHQ
FT                   IEGAVSSSDASTAKLKSYGIPVFDCNDVDVLDIYVDGADEINGQMQMIKGGGAALTREK
FT                   IIAAIARKFICIADESKQVGVLGKFPLPVEVIPMARSYVARELIKLGGLPEYRQNVLTD
FT                   NGNVILDVHNLSILDAIALENQINGIAGVVTVGLFANRGADVALIGTANGVKVIG"
FT   gene            991639..992880
FT                   /gene="serA"
FT                   /locus_tag="YPD4_0767"
FT   CDS_pept        991639..992880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serA"
FT                   /locus_tag="YPD4_0767"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0767"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57676"
FT                   /protein_id="ACY57676.1"
FT                   /translation="MAKVSLEKDRIKFLLVEGVHQSAVDNLRAAGYSNIEYHKGALDAE
FT                   SLKASIRDAHFIGIRSRTHLSEDVFAAAEKLVAVGCFCIGTNQVDLKAATKRGVPVFNA
FT                   PFSNTRSVAEMVLGELLLMFRGIPSANAKAHRGEWNKLAVGSFEARGKKLGIIGYGHIG
FT                   TQLGILAESIGMKVFFYDIENKLSLGNAQQVRQLSDLLNMSDVVSLHVPENHTTKNMIG
FT                   AEQLAQMKPGALLINASRGTVVDIPALCDALSSNHLSGAAIDVFPEEPATNKDPFNSPL
FT                   CEFDNVLLTPHIGGSTQEAQENIGDEVAGKLAKYSDNGSTLSAVNFPEVSLPAHGDNTR
FT                   RLLHIHENRPGILTSINTIFAEQNVNIAAQYLQTSADIGYVVIDVETDDADNAEKALQA
FT                   MKAIPGTIRARLLY"
FT   gene            complement(993145..993741)
FT                   /locus_tag="YPD4_0768"
FT   CDS_pept        complement(993145..993741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0768"
FT                   /product="putative 5-formyltetrahydrofolate
FT                   cyclo-ligase-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0768"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57677"
FT                   /protein_id="ACY57677.1"
FT                   /translation="MPQNPQHALERQRIRAEIREHRRLLTPVQQQQSAHLAAQHIAEHP
FT                   KIQQAHTVAVFLSFDGELDTQPIIEQLWQQKKQVYLPVLHPFSPGNLLFLRYRPESPLI
FT                   RNRLKILEPQLDVREVLPLHQLDVVITPLVAFDRHGQRLGMGGGFYDRTLQRWQQNGPY
FT                   PIGLAHDCQLVDKLPSEYWDVPLPEIVTPAKVWQW"
FT   gene            complement(994105..994434)
FT                   /locus_tag="YPD4_0769"
FT   CDS_pept        complement(994105..994434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0769"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0769"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57678"
FT                   /protein_id="ACY57678.1"
FT                   /translation="MSAQPVDIQVFGRSLRVNCPPEQQDALNMAAEDLSQRLQDLKVRT
FT                   RVNNTEQLVFIAALNVCHELAQERLKTRDYASNMEQRIRMLQQTIEQALLEQGRISDRQ
FT                   DTQFE"
FT   gene            994771..995349
FT                   /locus_tag="YPD4_0770"
FT   CDS_pept        994771..995349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0770"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57679"
FT                   /protein_id="ACY57679.1"
FT                   /translation="MSIENTLPTYPSLALALSQQAVALTPAEMHGLISGMLCGGSKDNG
FT                   WQTLVHDLTNEGVAFPQALSLPLQQLHEATQEALENEGFMFQLLIPEGEDVTVFDRADA
FT                   LSGWVNHFLLGLGMLQPKLAQVKDEVGEAIDDLRNIAQLGYDEDEDQEELAQSLEEVVE
FT                   YVRVAAILCHIEFTQQKPTAPEMHKPTLH"
FT   gene            995437..996750
FT                   /gene="pepP"
FT                   /locus_tag="YPD4_0771"
FT   CDS_pept        995437..996750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepP"
FT                   /locus_tag="YPD4_0771"
FT                   /product="proline-specific aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0771"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57680"
FT                   /protein_id="ACY57680.1"
FT                   /translation="MTQQEYQNRRQALLAKMAPGSAAIIFAAPEATRSADSEYPYRQNS
FT                   DFSYLTGFNEPEAVLILVKSDETHNHSVLFNRIRDLTAEIWFGRRLGQEAAPTKLAVDR
FT                   ALPFDEINEQLYLLLNRLDVIYHAQGQYAYADNIVFAALEKLRHGFRKNLRAPATLTDW
FT                   RPWLHEMRLFKSAEEIAVLRRAGEISALAHTRAMEKCRPGMFEYQLEGEILHEFTRHGA
FT                   RYPAYNTIVGGGENGCILHYTENECELRDGDLVLIDAGCEYRGYAGDITRTFPVNGKFT
FT                   PAQRAVYDIVLAAINKSLTLFRPGTSIREVTEEVVRIMVVGLVELGILKGDIEQLIAEQ
FT                   AHRPFFMHGLSHWLGMDVHDVGDYGSSDRGRILEPGMVLTVEPGLYIAPDADVPPQYRG
FT                   IGIRIEDDIVITATGNENLTASVVKDPDDIEALMALNH"
FT   gene            996819..997997
FT                   /gene="ubiH"
FT                   /locus_tag="YPD4_0772"
FT   CDS_pept        996819..997997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiH"
FT                   /locus_tag="YPD4_0772"
FT                   /product="2-octaprenyl-6-methoxyphenyl hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0772"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57681"
FT                   /protein_id="ACY57681.1"
FT                   /translation="MSVIIVGGGMAGVTLALAISSLTHGQVPVALVEAQQPNDRQHPGF
FT                   DARAIALAQGTCQQLARIGAWSALADCATAIDHVHVSDRGHSGFVNLRAEDYGVPALGH
FT                   VLELHDAGERLFALLMKAPGVTLHCPAKVVDVVRTAESARVTLDDGQQLAAKLLVAADG
FT                   SHSALAQSCAIQWQRQDYQQVAIIANITTSELPNGRAFERFTRNGPLALLPMSQGRSSL
FT                   VWCHAKHDQQQIDSWDDARFLAELQQAFGWRLGKMLQAGKRHSYPLQLLIASRHISHRL
FT                   ALVGNAAQTLHPIAGQGFNLGLRDVMSLAETLAEAAAMGNDLGDYTVLSHYQQRRQQDQ
FT                   QATIGVTDGLIRLFANRYGPLVAGRNLALMAMEQMPTIRDTFARRTLGWVER"
FT   gene            998170..999390
FT                   /gene="visC"
FT                   /locus_tag="YPD4_0773"
FT   CDS_pept        998170..999390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="visC"
FT                   /locus_tag="YPD4_0773"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0773"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57682"
FT                   /protein_id="ACY57682.1"
FT                   /translation="MQSFDIVIAGGGMVGLALACGLQGSGLRIAIIEHQPAPMPLTAPL
FT                   TGELALRVSAINAASERLLQKIGVWETIQALRASPYHGMEVWDKDSFGKIAFHADEYGF
FT                   SHLGHIIENQVIQQALWQRASQLPEVTVLAPASFKQVAWGETEAFITLTDDRMLSARLV
FT                   VGADGAHSWLRQHADIPLTFWDYAHHALVATIRTDEPHQATARQVFHGDGILAFLPFSD
FT                   PHLSSIVWSLPPERAAELAVLPAEQFNRELAMTFDMRLGQCQLESERQTFPLTGRYARS
FT                   FAAHRLVLVGDAAHTVHPLAGQGVNLGFMDVAELVSELRRLQRQGKDIGQHLYLRRYER
FT                   RRKHSAAMMLASMQGFRDLFAGNNPAKKLLRDIGLTLADHLPGVKPQLVRQAMGLNDLP
FT                   EWLERSQ"
FT   gene            1000111..1001208
FT                   /gene="gcvT"
FT                   /locus_tag="YPD4_0774"
FT   CDS_pept        1000111..1001208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvT"
FT                   /locus_tag="YPD4_0774"
FT                   /product="aminomethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0774"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57683"
FT                   /protein_id="ACY57683.1"
FT                   /translation="MAKQTPLYDQHVACGARMVDFHGWMMPLHYGSQIDEHHFVRQDAG
FT                   MFDVSHMTIVDLHGNRTREFLRYLLANDVAKLTQPGKALYTGMLNESGGVIDDLIVYFL
FT                   SEDYFRLVVNSATRDKDLAWISQHAEPYQVEVTVRDDLALIAVQGPQAQQKVATLLTTE
FT                   QQQAIAGMKPFFGIQTGDLFIATTGYTGEAGYEIALPKQQVVAFWQQLLAAGVKPAGLG
FT                   ARDTLRLEAGMNLYGQEMDEKTSPLAANMGWTVAWQPEDRQFIGRAALERQRMKGTEQL
FT                   VGLIMTEKGVLRNELPVYFFDAAGNQHVGVITSGSFSPTLGFSIALARVPAGIGEHAVV
FT                   QIRNREMPVRVTKPGFVRAGKAIVL"
FT   gene            1001277..1001663
FT                   /gene="gcsH"
FT                   /locus_tag="YPD4_0775"
FT   CDS_pept        1001277..1001663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcsH"
FT                   /locus_tag="YPD4_0775"
FT                   /product="glycine cleavage system protein H"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0775"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57684"
FT                   /protein_id="ACY57684.1"
FT                   /translation="MSNVPTELKYALSHEWVRADGDGVYSVGITEHAQELLGDMVFVDL
FT                   PEVGSDVSAGSDCAVAESVKAASDIYAPISGEIVAVNTELENSPELVNSAPYTDGWLFS
FT                   IKAADESELDNLLDADAYLAAIEE"
FT   gene            1001875..1004754
FT                   /gene="gcvP"
FT                   /locus_tag="YPD4_0776"
FT   CDS_pept        1001875..1004754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvP"
FT                   /locus_tag="YPD4_0776"
FT                   /product="glycine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0776"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57685"
FT                   /protein_id="ACY57685.1"
FT                   /translation="MTQNLSQLEHNDAFIQRHIGSSVEQQQQMLAAVGASSLSTLIQQI
FT                   VPADIQLPGPPPVGEAATEHQALAELKGIASQNQCYKSYIGMGYSPVLTPPVILRNMLE
FT                   NPGWYTAYTPYQPEVSQGRLEALLNFQQLTQDLTGLDLASASLLDEATAAAESMALAKR
FT                   ASKLKDANRFFVADDVHPQTLDVVLTRAETFGFDVIVDRAEKVLELDGIFGVLLQQVGT
FT                   TGELHDYSALLAELKKRKIITSVAADIMALVLLTAPGAQGADVVFGSAQRFGVPMGYGG
FT                   PHAAFFACRDEFKRSMPGRIIGVSRDAAGNTALRMAMQTREQHIRREKANSNICTSQVL
FT                   LANIASLYAVYHGPQGLQRIAGRIHRMTDILAAGLQHAGLTLRFKHWFDTLTVEVKDKA
FT                   AVLARALSFGINLRTDIHGAVGITLNETTSREDIQTLFALFVGDNHGLDIDQLDAAVSQ
FT                   HSQSIQDSMLRRDPILTHPVFNRYHSETEMMRYMHRLERKDLALNQAMIPLGSCTMKLN
FT                   AAAEMIPITWPEFAELHPFCPPEQAAGYQQMIGQLSQWLVQLTGYDAVCMQPNSGAQGE
FT                   YAGLLAIRRYHESRNQANRHICLIPSSAHGTNPASAQMAGMSVVVVACDKQGNIDLHDL
FT                   RQKAEHAGDELSCIMVTYPSTHGVYEETIREVCQIVHQFGGQVYLDGANMNAQVGITTP
FT                   GYIGADVSHLNLHKTFCIPHGGGGPGMGPIGVKAHLAPFVPGHSVVQIDGMTTQQGAVS
FT                   AAPFGSASILPISWMYIRMMGADGLKQASQVAILNANYIATRLKNAYPVLYTGHDGRVA
FT                   HECILDIRPLKEATGISEMDIAKRLIDFGFHAPTMSFPVAGTLMVEPTESESKVELDRF
FT                   IDAMLAIRAEIEKVAQGEWPLEDNPLVNAPHTQAELVGEWTHPYSRELAVFPVAGVLEN
FT                   KYWPTVKRLDDVYGDRNLFCSCVPISDYE"
FT   gene            1005132..1005569
FT                   /locus_tag="YPD4_0777"
FT   CDS_pept        1005132..1005569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0777"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0777"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57686"
FT                   /protein_id="ACY57686.1"
FT                   /translation="MINNRFIGSWSLISQHFILPDNSIHYPMGQNMLGRINYEKQGTMA
FT                   AQLYRGDRAKFTTEDWLQGSDSEIKNAFLTALTYFGRYHIDEEQGIVTHTVEGCLFPNW
FT                   VGNQQIRHYQFEEDRLTLRTPPLQMNNSSLVGVLIWQKVKK"
FT   gene            1007010..1008755
FT                   /locus_tag="YPD4_0778"
FT   CDS_pept        1007010..1008755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0778"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0778"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57687"
FT                   /protein_id="ACY57687.1"
FT                   /translation="MVVQSGGAYITGNTYVQGGLFLNGQKATNLAPATISSTSTDAVVG
FT                   SQLYNLVQDGTRYFHANSVNPTDSLASGLETIAVGPATVVSGDNGVGIGNTALVGAAAT
FT                   GGIAIGFGTQVTAAGATAIGSAAQAQGAQSLALGAGAVTSQANSIALGAASINTVGAQS
FT                   SYSAYALTAPQASVGELGIGTALGNRKITGVAAGSASSDAVNVAQLTAVGDQVQQNTAN
FT                   ITSLGGRVTTIEGSMASIANGGGVKYFHANSTQPDSVASGTNSVAIGPASLASGNAALA
FT                   SGAGAVAIGDGAAASADGSVAIGQGSGDNGRGVENYIGKYSNASNTSSGTVSVGNTATG
FT                   ETRTVSNVADGLQATDAVNLRQLDGIAASIVVVENNVSGLQNGTDGMFQVNNSSGLAKP
FT                   SATGANSATGGAGSVASGNNSTAFGSGAKATAANSAALGANSVADRANSVSVGSVGNER
FT                   QITNVAPATQGTDAVNFDQLKSISNQTNAYTNQRYSELKQDLRKQNSVLSAGIASAMSM
FT                   ASLTQPYTSGSSMTTIGAASYRGQSALSLGVSSISDSGRWVSKLQASSNTQGDFGIGVG
FT                   VGYQW"
FT   gene            1008859..1009962
FT                   /locus_tag="YPD4_0779"
FT   CDS_pept        1008859..1009962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0779"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0779"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57688"
FT                   /protein_id="ACY57688.1"
FT                   /translation="MSSFKTLGFFFLSLSLLFSSLLVLLSLLLFAGLLLFPSLLPFSRF
FT                   LPFAGFSPASGFSLATKYDEGFSGNVSYRGDLNDSPKTDPLWIPLPALPLIQQAVTELV
FT                   PTVQGQYQEHVMSQVCALARGERTQEQVAQTLRSYDIDISNIPPQGHPLSLLVSTDQSS
FT                   RVIGCAAYIASSVMAIPKSDEFMVSTDKPADALPGKKNEAASKEKTLSIDPKKLAQYLQ
FT                   TQLAVAKANADIFAIIAVELEKKPGLTVNEYSVQIKKVFSEVASAYLQRVKALYAVGAG
FT                   VNYKLITYSDEGFKFISNDGYLFEYGYDSLSLYFNRIPWYGSGKILGKEYFFSVSYIEP
FT                   NLVKRIREEKREEKSEGVLNQESGVAP"
FT   gene            1010164..1010865
FT                   /locus_tag="YPD4_0780"
FT   CDS_pept        1010164..1010865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0780"
FT                   /product="putative hemolysin III"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0780"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57689"
FT                   /protein_id="ACY57689.1"
FT                   /translation="MKNKSGTQPLFATPSVPAAQTATPTPAYPWAEELANSLSHGIGVV
FT                   FGIVGLVLLLVQAVNSGADTKALTSYSLYGSSIILLFLASTLYHAIPHRRAKLWLQKFD
FT                   HCAIYILIAGTYTPFLLVGLDSPLARGLMAVIWGLALIGVIFKLAFAHRFEVLSLVTYL
FT                   TMGWLSLIVIYQLAVKLEIGGLALLAIGGLLYTVGVIFYASKRIRFGHAIWHGFVLGGS
FT                   VCHFMAIYLYV"
FT   gene            1011123..1011620
FT                   /locus_tag="YPD4_0781"
FT   CDS_pept        1011123..1011620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0781"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0781"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57690"
FT                   /protein_id="ACY57690.1"
FT                   /translation="MIMRLSKALMVCAIALFATLVVFGNMTDYNTNFVFVHHVLQMDTI
FT                   FPDATISYRAIHSPWLQQLGYIGIILLETLTAVFCWVGGIGLLINRKAPAKVFNRKKGI
FT                   AIIGLTLGFLTWQVVFMSIGGEWFGMWMSKQWNGVPNAFRFFVTTILVLIYLVQPDGEL
FT                   DE"
FT   gene            complement(1011693..1012685)
FT                   /locus_tag="YPD4_0782"
FT   CDS_pept        complement(1011693..1012685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0782"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0782"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57691"
FT                   /protein_id="ACY57691.1"
FT                   /translation="MAYHTPFAAQPPVASSGLPLTLISLDDWALVTLTGADRVKYLQGQ
FT                   VTADIDALSADQHVLCAHCDAKGKMWSNLRLFYRGEGLAFIERRSLLDNQLSELKKYAV
FT                   FSKVVIEPQPDAVLIGVAGSQAKTALAEIFTELPSAEHPVTQMGNSTLLHFSLPAERFL
FT                   LVTDTEQAQQLVEKLAGRAQFNDSKQWLALDIEAGFPIIDAANSAQFIPQATNIQALNG
FT                   ISFTKGCYTGQEMVARAKYRGANKRALYWLAGNASRVPAAGEDLEWQLGENWRRTGTVL
FT                   SAIQLNDGTVWVQAVLNNDLAADSVLRVRDDALGTLAIQPLPYSLAEDK"
FT   gene            1013306..1013674
FT                   /locus_tag="YPD4_0783"
FT   CDS_pept        1013306..1013674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0783"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0783"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57692"
FT                   /protein_id="ACY57692.1"
FT                   /translation="MAHGILVILTLVAPWPLGYTALWLVLLTLVVFECIRSQKRIKSCQ
FT                   GEIRLKPGNLVRWKRHEWTVVKPPWITRYGVLLHLQQTGGHATRKRLWLSADSMSEDEW
FT                   RQLCLLLRHSFESDDGTM"
FT   gene            1013674..1014372
FT                   /locus_tag="YPD4_0784"
FT   CDS_pept        1013674..1014372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0784"
FT                   /product="response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0784"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57693"
FT                   /protein_id="ACY57693.1"
FT                   /translation="MKPLIWLVEDEPSIADTLIYTLESEGFTLRWFDRGEPALAALSSG
FT                   SPALAIVDVGLPDINGFDLCRRMLAAAPDLPVIFLTARSEELDRIVGLEIGADDYIAKP
FT                   FSPREVSARVRTILRRLQKSHLLAVTSTSYQFGHFSLDEAGARVTYHQQILGLTRYEYL
FT                   LLKTLLLAPERIFSRQQLMDIVWAQAEESQDRTVDTHIKTLRSKLRTVYAEDSPIRTHR
FT                   GLGYSLGYQP"
FT   gene            1014397..1015815
FT                   /gene="creC"
FT                   /locus_tag="YPD4_0785"
FT   CDS_pept        1014397..1015815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="creC"
FT                   /locus_tag="YPD4_0785"
FT                   /product="putative histidine kinase sensor"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0785"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57694"
FT                   /protein_id="ACY57694.1"
FT                   /translation="MKIGVRLLLGYFLIVAIAGYFVIRIFLQEVKPGVRRATEGTLVDT
FT                   ATLLAQFARQDILQNKVADGQLAQAFSSLNLRPIGANIEGIRKDRNEYRVYLTDTDGQV
FT                   IFDSSGRALGQDYSRWNDVWLTLRGEYGARSSRTDPDDAESSVMYVAAPVIVENRIVGV
FT                   LSIGKPNLSMVPVIKRSERKILFAGGLLLGIALLIGLGFVWWINRAIGKLVDYAERVAE
FT                   GQAVALPAMGSSELNDLALALESMRLKLDGKAYIEQYVHTLTHELKSPLAAISGAAELL
FT                   RESPPPETAQRFLINIEQQSARIQQLVDKMLVQARLESRVDLQLSPLEISHILKQSFSA
FT                   KEAQAVSRGVTLRLKSVDNAMLIGDGLLLSQALNNLIDNALDFTPAGGEISVSGERQDD
FT                   TYLITVEDSGSGIPGYAQEKIFDRFYSLPRANSVKSTGLGLNFVREVAAIHQGSICLEN
FT                   RLPQGVSARLTLPL"
FT   gene            1015936..1017393
FT                   /locus_tag="YPD4_0786"
FT   CDS_pept        1015936..1017393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0786"
FT                   /product="inner membrane protein CreD"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0786"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57695"
FT                   /protein_id="ACY57695.1"
FT                   /translation="MFKSVLFWKIVTLLGLMLLMMIPKGMLLHVIDERSGYRQSVIDKV
FT                   SDSTSRSQKILGPLIVVPYREWVETEVDGKKQGKWTHFYHYILPNVMTVKGTPDVEVRQ
FT                   LGIYKTQVYQGEFDFHGEFEVSSLDDLDREGVIIGKPSLVLALSDARGIQRISPLSVGK
FT                   TKINFEPGAFSGHSVQGVHAPLTIEQVLQGKFDVDFTMSLAGTTSLSVVPVGRNSELTL
FT                   QSNWPHPNFVGNFLPLQRKVDEKGFRAHWSSNWLANSMNTNFTGGDAAFHFGSLPAFTT
FT                   SLIEPVDHYQLTERAIKYAILFIGLTFFSFFLFESLTSLRLHPMQYLLVGAALVLFYLM
FT                   LLAFSEHIGFTLAYLLASLSCSLLIAIYLSAVLGGWLRGTLFACGLLLLYGILFGLLQS
FT                   EDNALLLGAGLLFVVLTVVMLLTRRLDWYQVADTQRLTEWRAPEPSAEESPSKTAPEGE
FT                   SMKDDNKKKDDHVKKDANEKDEFRLWK"
FT   gene            complement(1017483..1018001)
FT                   /gene="fldB"
FT                   /locus_tag="YPD4_0787"
FT   CDS_pept        complement(1017483..1018001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fldB"
FT                   /locus_tag="YPD4_0787"
FT                   /product="flavodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0787"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57696"
FT                   /protein_id="ACY57696.1"
FT                   /translation="MKIGLFYGSSTCYTEMVAEKIRDILGEDLVDLHNLKEVSPRLMEE
FT                   YSILILGIPTWDFGELQEDWEAIWPQLTQLNLKGKIVAMYGMGDQFGYSEWFLDALGML
FT                   HDHIAPLGVKFIGFWPTDGFEFTSPKPLSADGKQFVGLALDEVNQYDLSEERIEQWCEQ
FT                   ILLEMEALL"
FT   gene            1018108..1019007
FT                   /gene="xerD"
FT                   /locus_tag="YPD4_0788"
FT   CDS_pept        1018108..1019007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerD"
FT                   /locus_tag="YPD4_0788"
FT                   /product="tyrosine recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0788"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57697"
FT                   /protein_id="ACY57697.1"
FT                   /translation="MKQQDNPLIEQFLDALWLERNLAENTLASYRLDLHALVGWLTHHN
FT                   SDLLRASPQDLQSFLAERIEGGYKATSSARLLSAMRRLFQYLYREKLREDDPTALLSSP
FT                   KLPQRLPKDLSEAQVDALLNSPNVDIPLELRDKAMLEVLYATGLRVSELVGLTISDVSL
FT                   RQGVVRVIGKGNKERLVPLGEEAVYWIENYMEHGRPWLVNGASLDVLFPSNRSQQMTRQ
FT                   TFWHRIKHYAILAGIDSERLSPHVLRHAFATHLLNHGADLRVVQMLLGHSDLSTTQIYT
FT                   HVATERLRQLHQQHHPRA"
FT   gene            1019038..1019754
FT                   /gene="dsbC"
FT                   /locus_tag="YPD4_0789"
FT   CDS_pept        1019038..1019754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbC"
FT                   /locus_tag="YPD4_0789"
FT                   /product="thiol:disulfide interchange protein (DsbC)"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0789"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57698"
FT                   /protein_id="ACY57698.1"
FT                   /translation="MKKSLLLLPMLMAALSGVANADDSAIQQTLKKLDIQQADIQPSPI
FT                   PGISTVMTESGVLYISADGKHLLQGPLYDVSGDQPINVTNQALLKKLEALSSEMIVYKA
FT                   PEEKHVITVFTDITCGYCRKLHEQMKDYNALGITVRYLAFPRQGLSSQAEKDMRSIWCM
FT                   ADRNKAFDDAMKNNDISPATCKTDISKHYQLGVQFGIQGTPAIVLQNGTIVPGYQGPKE
FT                   MLQMLNAHQASLKAGG"
FT   gene            1019761..1021494
FT                   /gene="recJ"
FT                   /locus_tag="YPD4_0790"
FT   CDS_pept        1019761..1021494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recJ"
FT                   /locus_tag="YPD4_0790"
FT                   /product="single-stranded-DNA-specific exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0790"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57699"
FT                   /protein_id="ACY57699.1"
FT                   /translation="MTLKTQLRRREAADDSHLPAQLPPLLRRLYASRGVKDAQELERGV
FT                   KGLLAWQKLDGIDAGVTLLQQALADRRRIVIVGDFDADGATSTALAVLALRSMGGSNLD
FT                   YLVPNRFEDGYGLSPEVVEQVAARGAELIVTVDNGISSHAGVDLAHAKGIQVLVTDHHL
FT                   PGETLPAADAIINPNLAGCDFLSKSLAGVGVTFYLMLALRARLRECGWFEQRTLAVPNL
FT                   AELLDLVALGTVADVVPLDANNRILVHQGLSRIRAGKCRPGIRALLEVANRDARQLVAN
FT                   DLGFSLGPRLNAAGRLDDMSIGVALLLSDDIAQARALAIDLDTLNQTRREIEQGMQVEA
FT                   LQLCDQLERTSSELPYGIAMYHPEWHQGVVGILASRIKERFHRPVIAFAPAGEGLLKGS
FT                   GRSVAGLHMRDALERLDTLNPGLILKFGGHAMAAGLSLEEGKFDEFRQRFADLVGEWMD
FT                   ASQLEGVIWSDGELNGAELSLETAELLRDGGPWGQSFPEPTFDGKFRILQQRLVGERHL
FT                   KLMVEPLNGGPLLDGIAFNVDTTLWPDSSVREVKLAYKLDINEYRGNRSVQLLVQHLWP
FT                   Y"
FT   gene            1021839..1022771
FT                   /gene="prfB"
FT                   /locus_tag="YPD4_0791"
FT   CDS_pept        1021839..1022771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfB"
FT                   /locus_tag="YPD4_0791"
FT                   /product="peptide chain release factor RF-2"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0791"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57700"
FT                   /protein_id="ACY57700.1"
FT                   /translation="MGKERSTLEEIVTTIDQLEQGLEDVSGLLELAVEADDEETFNETI
FT                   AELEVLDGKLGQLEFRRMFSGEYDRANCYLDLQAGSGGTEAQDWASMLLRMYLRWAESR
FT                   GFKTEIIEESDGDVAGLKSATVKIIGEYAFGWLRTETGVHRLVRKSPFDSGGRRHTSFS
FT                   SAFVYPEVDDDIDIEINPADLRIDVYRASGAGGQHVNKTESAVRITHIPTNIVTQCQND
FT                   RSQHKNKDQAMKQLKAKLYEFEMQKKNADKQVLEDNKSDIGWGSQIRSYVLDDSRIKDL
FT                   RTGVETRNTQAVLDGDLDKFIEASLKAGL"
FT   gene            1022781..1024298
FT                   /gene="lysS"
FT                   /locus_tag="YPD4_0792"
FT   CDS_pept        1022781..1024298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="YPD4_0792"
FT                   /product="lysyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0792"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57701"
FT                   /protein_id="ACY57701.1"
FT                   /translation="MSEQKPQVAEQAQELNSELQARREKLAVLRGKGIAFPNDFRRENL
FT                   SDQLHAEFDSKENEELEALNIDVTVAGRMMTRRIMGKASFVTLQDVGGRIQLYVSRDDL
FT                   PEGVYNEEFKKWDLGDILGARGKLFKTKTGELSIHCSELRLLTKALRPLPDKFHGLADQ
FT                   ETRYRQRYLDLIANDESRHTFKVRSQVMSGIRSFMVEKGFMEVETPMMQVIPGGASARP
FT                   FVTHHNALDIDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGVSPRHNPEFTMMELY
FT                   MAYADYKDLIVLTEELFRTLTETILGSSVVQYGEQTFDFGKPFAKLTMKEAICKYRPET
FT                   NVADLDDMDKAVAIAESLGIKVEKSWGLGRIQCEIFEETAESHLIQPTFITEYPAEVSP
FT                   LARRNDDNPFITDRFEFFIGGREIGNGFSELNDAEDQAQRFADQVSAKEAGDDEAMFYD
FT                   EDYITALEHGLPPTAGLGIGIDRMVMLFTNSHTIRDVILFPAMRPVK"
FT   gene            1024492..1024565
FT                   /locus_tag="YPD4_t8"
FT   tRNA            1024492..1024565
FT                   /locus_tag="YPD4_t8"
FT                   /product="tRNA-Gly"
FT   gene            1024731..1025945
FT                   /gene="int"
FT                   /locus_tag="YPD4_0793"
FT   CDS_pept        1024731..1025945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="int"
FT                   /locus_tag="YPD4_0793"
FT                   /product="integrase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0793"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57702"
FT                   /protein_id="ACY57702.1"
FT                   /translation="MKLNARQVETAKPKDKAYKLADGGGLYLLVNTNGSRYWRLKYRFA
FT                   GKEKLLALGVYPDVSLAVARVKRDEAKKIVAGGGDPSQNKQQEKLARQGEATNTFEAIT
FT                   REWYQRRYDRWSESYRLEMMSTFESDVFPYIGYRPIKEIKPLELMAVLSKLEKRGATEK
FT                   MRKVRQRCGEVWKYAIITGRAEYNPAPDLASAFAPHKREHYPHLTINEIPEFLSSLASY
FT                   SGSMLVKLAMRLLILTGTRPGELRQAEWAEFDFDNALWEIPAVRMKMRRPHMVPLPDQA
FT                   ITILKQIQPISGRYQFVFPGRIQHSKPISEMTLNVLIRRIGYGGRATGHGFRHTMSTIL
FT                   HEQGFNTAWIETQLAHVDKNSIRGTYNHAQYLDGRREMLQWYADYMDSLENGENVIHGR
FT                   FGKRA"
FT   gene            1027133..1027495
FT                   /locus_tag="YPD4_0794"
FT   CDS_pept        1027133..1027495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0794"
FT                   /product="putative DNA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0794"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57703"
FT                   /protein_id="ACY57703.1"
FT                   /translation="MAKLQYIHDEAGKPQFVVLPVAEYQQLISNAKYEDIPYVADNDDD
FT                   QTIPNEVVQIMVNDGVSLLAAWRIYRGFSQYEIAELLGTTQSAVSQWEAVDSRPQKKTR
FT                   EKLAAIYKCRAAQMIL"
FT   gene            1027955..1028353
FT                   /locus_tag="YPD4_0795"
FT   CDS_pept        1027955..1028353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0795"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0795"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57704"
FT                   /protein_id="ACY57704.1"
FT                   /translation="MMKCPVCGGVELIHEARDVPFTYKGRKFIVEGVIGQHCPACGETV
FT                   MTEAESDVYAAKTMLLRKMVNTESIAPAYIVQIRKKLGLNQREASEIFGGGVNAFSRYE
FT                   KGKALPHPSTIKLLQVLDKHPELLNEIR"
FT   gene            complement(1028753..1031044)
FT                   /locus_tag="YPD4_0796"
FT   CDS_pept        complement(1028753..1031044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0796"
FT                   /product="putative primase"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0796"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57705"
FT                   /protein_id="ACY57705.1"
FT                   /translation="MNQFITEVAAQARGKWGFILDALAISHSKQHSPCPACGGKDRFRF
FT                   DDRQGAGTWFCNQCEPQSGDGLDLVKNVRQCSLTEAAQLVADILGVSPKSKAPDLASLM
FT                   AKTTPGESRYLINKGLSSHKLPILPDGSLLLILQNMAGDCTGAQIIRPDGTKKLIAGSR
FT                   KKGTFIPLKPLPEQAETVVLAEGYATAQSLELLLPAAVIIAAIDAGNLLPVAQAFRIYW
FT                   PAAKIIIAADNDINPQDTANVGQLSAEKAANAVNGWVTLPPTPHKADWDDYRQQAGTGQ
FT                   ARNSFYHGLYQPPPVSQLAENKGLHPTLSQMAASQRGQLLAEHYGQIAVHAESETVYHY
FT                   DDERWDKLPDGVLRRELVMIFNANDTPYSPAGIRNAIEAMKLQIPIMGEPPRHLIGFQN
FT                   GVYDLKAKQFRPHRANDWLQHHNDIIFTEPQPDENLAHHAPHFTKWLAHAANDELPKMA
FT                   RIKAALFMILSNRFDWQLFLEVTGEGGSGKSVFTYIATLLAGRQNTASGNMAALDQARG
FT                   RAQFVGKSLITLPDQVKYVGEGAGIKAITGGDLVEIDGKYEKQFSTLLTAVVLATNNEP
FT                   MSFTERQGGIARRRVIFAFNHPVKEADKDPLIGEKIAAELPVVIRCLLAEFADQDKARK
FT                   LLLEQRDSREAMGVKRDADPLYGFCAHIVELGEAVGMYMGTLAISPHAPRIYLYHAYLA
FT                   YMEAYGHQRSLSLTKFGKDFPKVMEEFGAEYKKARTDKGFRYNMDLSDTANDWLPALAL
FT                   PHHPQPEEPH"
FT   gene            1031344..1031670
FT                   /locus_tag="YPD4_0797"
FT   CDS_pept        1031344..1031670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0797"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0797"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57706"
FT                   /protein_id="ACY57706.1"
FT                   /translation="MNYTIEYYDDDVITQLLAQPISLQANFISLAKRMKRYGIKMVDAV
FT                   PMHYHEDVFELCFYEPKGWNRVIFMAQIDWQIVILHIVVQKTAYMPWKEKGKAAKRMKE
FT                   LRFG"
FT   gene            complement(1032211..1032543)
FT                   /locus_tag="YPD4_0798"
FT   CDS_pept        complement(1032211..1032543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0798"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0798"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57707"
FT                   /protein_id="ACY57707.1"
FT                   /translation="MEGWVKANGFHWPLPLGAALVPEQRQAEESWGGFAGKETALAFIA
FT                   GMAITLARNNPQYRRGVKMNKTAIARVATQAMFNAGFSGEMVTEKQMSNLISEALLVSL
FT                   PGADNP"
FT   gene            complement(1032798..1033163)
FT                   /locus_tag="YPD4_0799"
FT   CDS_pept        complement(1032798..1033163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0799"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0799"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57708"
FT                   /protein_id="ACY57708.1"
FT                   /translation="MINPAEKLKAKQQEFISIRELIQRISRLHPTMSQAQIANWLLIEL
FT                   TDARPVSPPLLIQDALGVTRSPGFDDPQFCYFDLLSAAMANPKMDGAPCDGWIPESYKP
FT                   DEFNHRPDEEDDHELPF"
FT   gene            1033432..1034574
FT                   /locus_tag="YPD4_0800"
FT   CDS_pept        1033432..1034574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0800"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57709"
FT                   /protein_id="ACY57709.1"
FT                   /translation="MPKFNHYDLALLNPSFDSPLVDALTELELLRHLRLETDVHPLLFA
FT                   QLKSIFHMLESLGSARIEGNHTTLADYVESKVEGAEDSTDQLKEIGNIEHAMNFIDEHL
FT                   HAGEDITEYFVRELHAMTVNGLEREGDKTPGAYRSHGVSIAQSTHLPPEFIHVPAYMQE
FT                   LVGFMNRADAPKYDLMKVALAHHRFGWIHPFGNGNGRTVRLLTYSLLIKYGFNVKTSGR
FT                   VLNPTAVFCNDRERYYSMLAEADTGAVEGLEQWCLYVLTGISAELKKVDKLSDLHFLNS
FT                   KVLYPALEYSKGRGVINETESKILKRTISQGTVKTSDLKEVLPGLKPAQITYQIGKLVD
FT                   RGLLQPVEVGSRIYTAGFSKSDLMRGVIHALRKEGFIPDF"
FT   gene            1035333..1036619
FT                   /locus_tag="YPD4_0801"
FT   CDS_pept        1035333..1036619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0801"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0801"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57710"
FT                   /protein_id="ACY57710.1"
FT                   /translation="MMNDAYELIGSPTSGQSSIAPSFTETSESPPDVTPVFAKSCLREK
FT                   GCTDAGTEGEPHRNFGKMGFYQTIPPSPTSPTDNNEVDQRAQTARRKPVETEPDVKTPW
FT                   YKRVLGRTSAAPAAVVVPVSTGAGLAALEQAGIQGMRFVGGNLMTAGRWMVGSSPVGAA
FT                   IMGMMPGTLNEGETDLLDKLKLENIAKNGGSAPTRVRFRWVDSGNGRLKAEGYHMSAEG
FT                   GLDRVPVRKMTLNVFTGNYEFWEDGAAGPTILWTPNDPGFKAPSNTGNNDGPIIRTTIT
FT                   VLPMPEADETGEHSTTLPMPEEKDFRDYILIHPLLDLPPLYIYLSKNPDTPIWTKTKRL
FT                   EPVSNAYEHWVKHGHEFSDQPFNNAKEYVESTHDFVNNPPEGTLTKTRPNGDELFYHPQ
FT                   LNTFAVKTKDGVPKTMFKPSDKMGYWNKQ"
FT   gene            1038127..1040286
FT                   /locus_tag="YPD4_0802"
FT   CDS_pept        1038127..1040286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0802"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0802"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57711"
FT                   /protein_id="ACY57711.1"
FT                   /translation="MGMLGMAVPPSQASSDNTGCVWGKYCPLSGVPFLDVYNDTRVNMM
FT                   LLVGEPKNFILPRLTMPADITRSRNYHFGEFYYDEMSFPKREKSLTDENNDSPSEETPF
FT                   DKMAKTLGINSASFKGTNARYREARHISNNPASVEQFFTALLADSSLTADDRHNLALWR
FT                   SNIFHNVDAPVDGGITPPPFNIVPGSHVDAFSDYLHGANAFYRGDYPEATALFSALQKS
FT                   SQAWVAETATYMLFRVALNESSTNASDKYGMFETKNINQDAARQALDYSRAYLVAYPQG
FT                   IYAESIQGLERRIYWYLSDWQQLARLYEETLLAAPNAEALWDTVSEVDAKFISKDAFGG
FT                   EPFISDMQAPLLTFTQTLRWLRLGGRQSGSELEVTQEKLASYKPMFVDADRLPLWQYLQ
FT                   TAWLYYHEQDYAGVVATVSAVDSLPATDIVTFSQQILYGDALVAQQQWSQAEAHWRKLL
FT                   GLVQSPQQQQYLQLKLAAVLVNSDQIEAIFTADSPIKNLRYRSLILKTKAQKALLQQQV
FT                   ISGANDEEKTIALHTLLLRDLMLGDYQGYEQDKQLSPHIQQSVDQKSFADVDLAAFDWQ
FT                   GDNVEQGYACAALDGTVKALVKNKTDGHALNCLGEFFRVTDININTYQEGEGNEVLNVA
FT                   VHAHETVITQPNRFDYYQHVINDPKAEPEDKSYALYRAVMCYAPSGYNQCGGEDVDIAT
FT                   RKRWFSSLKTQYKGSRWAERLNYYW"
FT   gene            1040256..1041023
FT                   /locus_tag="YPD4_0803"
FT   CDS_pept        1040256..1041023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPD4_0803"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPD4_0803"
FT                   /db_xref="EnsemblGenomes-Tr:ACY57712"
FT                   /protein_id="ACY57712.1"
FT                   /tran