(data stored in ACNUC7421 zone)

EMBL: CP001597

ID   CP001597; SV 1; circular; genomic DNA; STD; PRO; 94830 BP.
XX
AC   CP001597;
XX
PR   Project:PRJNA33543;
XX
DT   04-MAY-2009 (Rel. 100, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Bacillus anthracis str. A0248 plasmid pXO2, complete sequence.
XX
KW   .
XX
OS   Bacillus anthracis str. A0248
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus;
OC   Bacillus cereus group.
OG   Plasmid pXO2
XX
RN   [1]
RP   1-94830
RA   Dodson R.J., Munk A.C., Bruce D., Detter C., Tapia R., Sutton G., Sims D.,
RA   Brettin T.;
RT   "Genome sequence of Bacillus anthracis A0248";
RL   Unpublished.
XX
RN   [2]
RP   1-94830
RA   Dodson R.J., Munk A.C., Bruce D., Detter C., Tapia R., Sutton G., Sims D.,
RA   Brettin T.;
RT   ;
RL   Submitted (09-APR-2009) to the INSDC.
RL   Los Alamos National Laboratory, Los Alamos, NM, USA
XX
DR   MD5; 6897b28b774da084500f9a00cdba8334.
DR   BioSample; SAMN02603932.
DR   EnsemblGenomes-Gn; EBG00001443528.
DR   EnsemblGenomes-Tr; EBT00001821280.
DR   RFAM; RF00230; T-box.
XX
CC   The authors wish to acknowledge the Intelligence Technology
CC   Innovation Center for funding the sequencing and the NIH/NIAID for
CC   funding the annotation at the Pathema Bioinformatics Resource
CC   Center.
CC   The NIAID funded Bioinformatics Resource Center PathoSystems
CC   Resource Integration Center (PATRIC; http://patricbrc.vbi.vt.edu/)
CC   is responsible for annotation updates of this record.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..94830
FT                   /organism="Bacillus anthracis str. A0248"
FT                   /plasmid="pXO2"
FT                   /strain="A0248"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:592021"
FT   gene            complement(11..1567)
FT                   /locus_tag="BAA_B0001"
FT   CDS_pept        complement(11..1567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0001"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45892"
FT                   /protein_id="ACQ45892.1"
FT                   /translation="MGKSPSIILTSQYTIPNKKSFTTYVDYCMRQKALLKDGHTLTNTE
FT                   LTELSRLQNAIDSFDMERGSPHSNQKKVSVSEKEAEAKVLLTSPNSFNTTTDFEKYVSY
FT                   MGRKYALESKKKMTKTEEEEVSLLNKHIEDLSPEEMKEGKKEGIKAEEILSGVFSKDKN
FT                   VITSTDLNEIKELVGKAQNKGSVYYQDVISFDTDFLIEQKLYDPVTDILDENRIRNASH
FT                   KMMEQLFKDEQIEENNGFWFASIHRNTEHIHIHFGTVEKENRRKLVEVKVDEETFYEPK
FT                   GKRKQSTLDHMKTTFANSLVDRTSELSRISNLRNNLVQEVKKEYLQSKEKQPNREVTLL
FT                   QEIYNGLPSNKKDWTYGSKRMPNETRNKIDELTGLLMKDNPIFKEYQEAVEKESNFQKG
FT                   LYGESEREDKDYAKNQMKDMQKRMGNSLLKELKKKKPYEDNPLYQFQQKNEQIKKKYER
FT                   ERSEKRREYSTYSPYKPPLIRKKDVRNIEAALNDDLTKWRAEQEYERVQERIARQQEMD
FT                   Y"
FT   gene            complement(1586..2182)
FT                   /locus_tag="BAA_B0002"
FT   CDS_pept        complement(1586..2182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0002"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45893"
FT                   /protein_id="ACQ45893.1"
FT                   /translation="MTYVKLFQFRGNQIHVDIVQDFQRQYPEYPREADVLRHAIVLLDE
FT                   KMREGKGQDDVSLLKKEVKDLKQSVNTMKQQMDVLIKLNMELIAQSGSNLSLEKLEQEV
FT                   KSEIASSVTKKSEGKFPRTVKREPIEENVQEHQRIQREVKTTSFVKKPLPMITDDVQIV
FT                   MKKGKPHQVVPTRLGTGYQEIEWEQIPEHRRKELE"
FT   gene            complement(2194..2481)
FT                   /locus_tag="BAA_B0003"
FT   CDS_pept        complement(2194..2481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0003"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45889"
FT                   /protein_id="ACQ45889.1"
FT                   /translation="MEIHVRNVDPYHLKEIDKRCKEIGKKLGRRYYRWEYINMMFEQHF
FT                   NQEYSRNKEDKFDEAVSNVSITLDRQSDKLQEYIDATHELVAAMIKLNEE"
FT   gene            complement(2789..3637)
FT                   /locus_tag="BAA_B0004"
FT   CDS_pept        complement(2789..3637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0004"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45864"
FT                   /protein_id="ACQ45864.1"
FT                   /translation="MSIKFWMNKEGRKPANTKRKAYLFTLGSFVTMFFVLCISPVFSGA
FT                   TYKFEEMKIGEYQSLSSTVKIAVAKKEYNPDNQTLRIDYELRADNDSQILSNMKYKVEN
FT                   KYIKQKDNNVKTKVYRASDNYIVVISENVPEEFGVVSSVVKPEYIHPELQNDVDDLKER
FT                   SMKMYVLENEKLINRELKKKSKDFYEREYLAFSQQALRKEIEKKMEDKSSAMKQLKIKN
FT                   EQLTKEMEYQTEGEKVKTKNTINSNESTINNHQKEIDVLKEDIKMKEKKIQLLDEKKKT
FT                   I"
FT   gene            complement(3634..3909)
FT                   /locus_tag="BAA_B0005"
FT   CDS_pept        complement(3634..3909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0005"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45902"
FT                   /protein_id="ACQ45902.1"
FT                   /translation="MLLSELKPNHDYAKEGKYLILSLRKKKGVRKDKFIEIPITWFDYN
FT                   FGEKVEWLIVREYQPSVNGKEKYTNCKLENIHAQVSVVNVKGERMK"
FT   gene            complement(3998..4606)
FT                   /locus_tag="BAA_B0006"
FT   CDS_pept        complement(3998..4606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0006"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45842"
FT                   /protein_id="ACQ45842.1"
FT                   /translation="MNNLSKILSGALVLSLSFNGIWAYNTTKEFDKKDKKYRVTVSEKE
FT                   KQIGDLKVKLEQKDKKINEGGAGENKKEGNSTLDLQNKYREVANQFVHAYLDYSVQNKG
FT                   ERRNNLLKITDKKVVDIVAPNTDDLGDPNFKSHVNKAAIYINSEGDVSKKCTALLDIEY
FT                   TIEGLENKQTTINSVVKITLEKQGEEIKVVEYNPYPVKR"
FT   gene            complement(4632..5774)
FT                   /locus_tag="BAA_B0007"
FT   CDS_pept        complement(4632..5774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0007"
FT                   /product="NLP/P60 family protein"
FT                   /note="identified by match to protein family HMM PF00877"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45863"
FT                   /protein_id="ACQ45863.1"
FT                   /translation="MAATQETAIDKYKKVKRIKWIVRLLGGSTGVVIAAAITLLLIVSM
FT                   AIFGGQSSTGTPNGGISGTATVKNLPPEVMRWQAMVEQECAAQGVPELVPYVLAIIMVE
FT                   SNGISEKLPDIMQSSESQGWAMNTISNPKDSIYYGVMHLKGAFDDAKMLGINDLLAIVQ
FT                   TYNFGRNYVHWLAANNKTHSIQTADYYSLTVVAPAGGNRNGTTIGYSQPVAVAYNGGYR
FT                   YINGGNFFYAEMVKQYLSFDGAGGTSGQIPGGSETFKVMMDEVLKYNGNPYVWGGKSSS
FT                   QGFDCSGLTYWAYKTAGITIPISAATQYDFTVEVDPKDAQPGDLVFFRGTYGGPNHVSH
FT                   VGIYIDANTMYDSNGSGVGYHQFTSSYWQQHYAGIRRVPR"
FT   gene            complement(5776..7710)
FT                   /locus_tag="BAA_B0008"
FT   CDS_pept        complement(5776..7710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0008"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45871"
FT                   /protein_id="ACQ45871.1"
FT                   /translation="MVKLGKKEQQKYRTEGYDLDFISRVQPQGGIKFNEKYIAQGDCYV
FT                   ACLHVYSLAEDIPPLWLTALMNNKDTISSVDVATANKEEVVKDINRSITELKDRMTSER
FT                   RSTDRDDAHWELQNLTDFARSITQQGEIVKLVKLRIYIYDPVLEQLEKRIGDIKKEIAG
FT                   QNYKAQVYVFKQKEEWQTLFASYDDQIEYLGVKSGYPLPSKNIGFGIPFHHQDLKDPRG
FT                   IYLGQTSTGGAFILDPFFSTGTRTSFSGFIFGKMGAGKSTLLKQLEEGLVAKDCFIRGF
FT                   DKARDYYTVVQQQGGKIIDLSGVQDSEEVETGMINPLEVFATKITNTGAVDEKGSFIQH
FT                   ISKVTNMIRFLNTEFDDTVIQEFRKHLYAFYIEWGLVPQKGSDRPYKVTGYPPNHYPIL
FT                   EDFYKYLSNLKLEAGATPQRHRDLEAIKLQVEDMITVYGDMFNGHTTLKNFENEQIVFF
FT                   DIDGISKYDKSVFNCQLFTALTLIWSHALKNGRQMKYLREEKNLSIEDVKYFMVFLDEC
FT                   HNVINSQNEFANRYVLEFEREMRKFFAGIFFATQSPQEMLPPPGSTVDVSTMKAIFELT
FT                   QYKIFLNMDNSVLETLKSVLGESLTESEFRILPELKRGEAIVQVSSTETYNVMFDPDEK
FT                   QLERFKGGQ"
FT   gene            complement(7727..8395)
FT                   /locus_tag="BAA_B0009"
FT   CDS_pept        complement(7727..8395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0009"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45920"
FT                   /protein_id="ACQ45920.1"
FT                   /translation="MKVATAEAKKVNRKRQIESEKSNGKQSFISTIFASFKNTDASIVD
FT                   IAPYKRLEQKTGILVDHRNNLQVYLKVKTTDLLSMNQDDLKRFMNQLTSLCRVYHEPFK
FT                   ILSLTYSTETTEQQVYWKRMALRFQGRMSQEVSEKKEEHLWYQRYSLAIENLNRVLWVE
FT                   KNLKELAFFIVVYGKNETELIKNVKDMKRYGGRQFNLQNMKAKEVEKLIFKLQNMNSEM
FT                   "
FT   gene            complement(8459..8773)
FT                   /locus_tag="BAA_B0010"
FT   CDS_pept        complement(8459..8773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0010"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45868"
FT                   /protein_id="ACQ45868.1"
FT                   /translation="MEMMRNPKNTKQEIKLAFFYIIDGAIIALMLVLASYMPKVVPVGG
FT                   FGRIMFYVLFGTFGLFLCIKPHNSPTNRNIFVILDMLKMDNKNYHPIEVNTISSETKRK
FT                   "
FT   gene            complement(8776..8979)
FT                   /locus_tag="BAA_B0011"
FT   CDS_pept        complement(8776..8979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0011"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45908"
FT                   /protein_id="ACQ45908.1"
FT                   /translation="MNNWIFAILMLGVAIVLSIIATFFKQIFTIFKRRKKKEPVWVTVT
FT                   NAEYLDRDFWKGKEQKDKKEHD"
FT   gene            complement(8981..9235)
FT                   /locus_tag="BAA_B0012"
FT   CDS_pept        complement(8981..9235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0012"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45885"
FT                   /protein_id="ACQ45885.1"
FT                   /translation="MKVIDIANRRRIYFEMKQQELRASILMTVAGFIIAFAILVFQISF
FT                   ELGHLYHYIVTFAFLTYLSLHLYSNNKLARKIEKKQQGY"
FT   gene            complement(9253..12111)
FT                   /locus_tag="BAA_B0013"
FT   CDS_pept        complement(9253..12111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0013"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45915"
FT                   /protein_id="ACQ45915.1"
FT                   /translation="MATMKIKEWFFQSKKALVIGILAVITLFVSFTFTPIAYAFDWYEF
FT                   LGLKDVDTEKVVAFLQNEWIQYADFLGSIWQSIQGGIIKTLLYIVSALEGLIPDTFSFF
FT                   DILKDAGLNDFASSIIKGLFYALFVLVIVWLGIRTIIQHKPPRFKSVGVNILVMIGLLG
FT                   GLNELMADMQKMSTDFFSETTNTSKAKDGLAWDLVKQNTADLIYLSKTGFEPIQSKKEN
FT                   EPAISSTDSKPKNGMSKDIFLKAQLGDVVTPKVIEMLTSQKDIPKETEYLVYKITNDGD
FT                   KETVEKINDSVFNPFKDKFPGGYVRYPMNFGTIFWGLLALGVAYLFTVFVFVMTIFEIA
FT                   MKKIIAPIVFVTDIETGEKTKMVIQDIFKGFLVFAFTGLNLRVYTIIVNYLAEKDINAF
FT                   LYIVAMVCLTVALINGSESILKYFGVDVGLKEGKNHLTGMVGGAMAAKGAIKGAGRMFS
FT                   GAKNLMSGGSGQTREDTPKRSEMDSNHESAESQGEQKNTAKGGGMQAKKFARNTGAAMS
FT                   YAANRGVGGMMNDAGNKVAETVGGAVDKGKEKVSGVAKGVSDSVKGTVSEFKGGQAEGK
FT                   QKAQENADRQTLNTIGKGIQNNANAGIEPSASPKIANRPNVASISNERQQGNIKGERQT
FT                   AEREIELQNKLRNTGKEEGKQGNVKSERQTAEREIELQNKLRNTGSTEGQQGNVKGERQ
FT                   TAEREIEIQNKLRNTGGTEASQGNMKSGSQTVQREVNVLDTLRSTGGTGTINSDAKAGV
FT                   ATIQRDVNVQNNIRGSEAVDSNVRAGSTTVQRDVNVQNNVRGSEAVESNVRAGSTTVQR
FT                   DVNVQNNVRGSEAVESAVRAGSTTVQRDVNVQNNVRGSEAVESSVRAGSTTVQRDVNVQ
FT                   NNVRGSEAVNHTVRAGATTVQRDVNVQNNVRGSSEVTADVRVGTTTVQRDVNVQDNVKE
FT                   VRKSRLRPRGSTQNRTDQLRRR"
FT   gene            complement(12111..12929)
FT                   /pseudo
FT                   /locus_tag="BAA_B0014"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            complement(12931..14766)
FT                   /pseudo
FT                   /locus_tag="BAA_B0015"
FT                   /note="conjugation protein, trag/trad family; this gene
FT                   contains a frame shift which may be the result of a
FT                   sequencing error"
FT   gene            complement(14815..16677)
FT                   /locus_tag="BAA_B0016"
FT   CDS_pept        complement(14815..16677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0016"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45912"
FT                   /protein_id="ACQ45912.1"
FT                   /translation="MQKEQSKTFRKFLKKNKAGNGQQLGLKVAEGLIQRYIEQHQQSDQ
FT                   VLLLLQDIENEKAYEFELPVQVGSEFSLLNAISKDLEKGTDFDLGMEIKQGIFESYRAE
FT                   EGGAAIEHEEESPKKKKGGLFAKLFGKKEEELPHVNNEVKKEFASGDGNLFEEMPMHEL
FT                   NSKGTNHFEQNDIQELQEHAAALDQKEEDPFAIEEEEKDQLPTGIDLEKTAEELPTPTN
FT                   EVDSVQSLEEELLHSDLDNLKTNKEPEMEAQTQDVVFPDYEEYLNLSEAETKQERYDSR
FT                   FTIKHLLNRFGMSEEADTELEKKKLQYAKNVLSGKAFLLIQDKYYQEVNNLRDETRLGL
FT                   EKIYKEVMMRDYQKEAEERLQDIFEQGFQTRLVQLNEFEKKEIEEMQKKLIAFTEKQRL
FT                   DLEAFKLKQEAELTAYQSELEGRKNTLVNARQEELKKEIEAEKRKTTSEKSYELKVEGK
FT                   KELIDEKNGYLSDFIERIENLMNTVNEQQEMELTILENEIQQLTPEWKEEIQAERISEQ
FT                   EKQRQEMEREKLELEKQALHLQMRNQEGAEKKDKERIRELQNIIEDLTDKLQKSYHAGL
FT                   GQQPPQPMYQQPVYQQPMYQQPTMQPQEPAPQQTTVSKKNGEHF"
FT   gene            complement(16781..17059)
FT                   /locus_tag="BAA_B0017"
FT   CDS_pept        complement(16781..17059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0017"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45924"
FT                   /protein_id="ACQ45924.1"
FT                   /translation="MDLFTIFAMKLLTYNDFFDSVSSALTSWTGKLQGLGIAVIIFCVC
FT                   IIAFMFMFGEGPSRTAKKWLLYIVVGGVLLWGAGTFASTVQGVTAGF"
FT   gene            complement(17077..17328)
FT                   /locus_tag="BAA_B0018"
FT   CDS_pept        complement(17077..17328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0018"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45888"
FT                   /protein_id="ACQ45888.1"
FT                   /translation="MASTTRRNKVEKAPYQDAVTVILNKEGKTYESWSQEIVNSNCLSL
FT                   LQGENPKWRNKMLEVAAMEIIADSVVKQEEKRQNQTHN"
FT   gene            complement(17347..17493)
FT                   /locus_tag="BAA_B0019"
FT   CDS_pept        complement(17347..17493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0019"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45869"
FT                   /protein_id="ACQ45869.1"
FT                   /translation="MLENNVFRLMILMGGVIALIAIITICSDGIPEVEDVFQHFISHKN
FT                   TKY"
FT   gene            complement(17512..17874)
FT                   /locus_tag="BAA_B0020"
FT   CDS_pept        complement(17512..17874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0020"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45900"
FT                   /protein_id="ACQ45900.1"
FT                   /translation="MLDSSIMLIVKWFVGLMLIMMMVAVSLFCIQLSDVNLYKQQVNYQ
FT                   IERHGGLTKEAGAYLKDYSEKQYQGALSVKSDQLNKKVNFGDVVDYQVVANLKIILFNL
FT                   PDVEMKFHGSATSQVR"
FT   gene            complement(17914..18663)
FT                   /locus_tag="BAA_B0021"
FT   CDS_pept        complement(17914..18663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0021"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45875"
FT                   /protein_id="ACQ45875.1"
FT                   /translation="MRVVTAKSIKKNRYNRMFAEEDLYSMLEEMGNTQQMINKFQKKRI
FT                   TQTILLSFFGLLLGLFFTSWCYLLALGLPFFFYRSKYTHVTKTYNAFKFERHLNFSKFT
FT                   RLLIPYLKESGESTSLYQVFRKILNRMDNPVDKNSLAKLMSEMTDKPNDIQPFTDYAMR
FT                   SSGSDMSINIMQTIYDFQQNSSDTNVINELGQMASAELQRAIDEIIAFKLRRFNFFPTK
FT                   IVMSSFILVVGFAAAVLVHHLSSINLS"
FT   gene            complement(18660..19493)
FT                   /locus_tag="BAA_B0022"
FT   CDS_pept        complement(18660..19493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0022"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45859"
FT                   /protein_id="ACQ45859.1"
FT                   /translation="MKISTFNAKTKKKKFVNAEEINAFKVAYGKPLNRKDYLRYAIIPG
FT                   LVTGVFSFLLLYIWWLSLIFGLMGSVYGLKVLMPKVIKRAYERDSFRERNKFVNNMTSL
FT                   LANDSQTLLTSLQRASDRSQGELRADLKILLASVMGADQEQVLQAFKQMSNKYRDDITF
FT                   DQYLEQLETCVLEGRTNLETLKDIKTHHNEMKEKKDDYERKKEGHLKDMKMLCGVIVVF
FT                   VLAITFSFGFKTYITAFARHPIGWITSGIYMTLMCFFFKSFTTYLFDDSIMEVKA"
FT   gene            complement(19526..20857)
FT                   /locus_tag="BAA_B0023"
FT   CDS_pept        complement(19526..20857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0023"
FT                   /product="bacterial type II/IV secretion system protein"
FT                   /note="identified by match to protein family HMM PF00437"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45852"
FT                   /protein_id="ACQ45852.1"
FT                   /translation="MKMFGAKKGNGHNKDFYDFNPKNLETIRNDLKNRHAELVIDALLK
FT                   EEARQEIKRIIKRDYPVHFMDIDEDKVDDVIEYVVSELVGTGVIERLIKDRPDITDISY
FT                   NGSHLIVESSDYKEIYKDNEHQITEQYITRLIQKFAHAVGKEFTPKNPIFDGVYGSIRI
FT                   NAVHSQNTNGNSTMSLRIVRPNLVLNEKNFETFAPQFIYDFFKVVMESRNNILISGETG
FT                   TGKTEVLKLLFSFVRFDHKAIMIEDVPETHVKSLFPDKDVFSWLTGNGVTVTDEIVAAL
FT                   RNNPRWIMISELRGKETYEMIQAVLSGHHVVTSLHSVDAETSPKRLVNMSKIGYQVDEK
FT                   SLEEDIMRYFNFGFHIKRVVVKTTDTTGKPIKRVVRYLAKIVEYSVEGCQMVFEQKYRN
FT                   GKFTFSTGTLSEEFHDKLAEIDLSYELPKYTDEVAFKKGLIISR"
FT   gene            complement(20874..21266)
FT                   /locus_tag="BAA_B0024"
FT   CDS_pept        complement(20874..21266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0024"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45913"
FT                   /protein_id="ACQ45913.1"
FT                   /translation="MKELKEHPFILMIIVLGLFLVSIGGYYYRENFATDSITQGVTETV
FT                   RASVISNADNSSRVQSGELFIVKSDFEKDFKKRIESNKLVKISSGATYEFKYLDNKNGS
FT                   TKAIRAIIHDGDQTYQATYKVSIASS"
FT   gene            complement(21320..21469)
FT                   /locus_tag="BAA_B0025"
FT   CDS_pept        complement(21320..21469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0025"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45867"
FT                   /protein_id="ACQ45867.1"
FT                   /translation="MLDQNTDRSWWMIGAVVVGAALVGVVSVAFPDLTHSVINVFTDKL
FT                   SSVK"
FT   gene            complement(21544..21918)
FT                   /locus_tag="BAA_B0026"
FT   CDS_pept        complement(21544..21918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0026"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45848"
FT                   /protein_id="ACQ45848.1"
FT                   /translation="MNVLTYSSAKKQIIFMALYFVITGIVIRLIGYSLQGSLSAFTQAG
FT                   IGDLLSGNFSVKDMFHFDFSFDMSQFDGFSLNMWGVFIKDKIHSVVNDMMPTTLGAINM
FT                   LMLSKYLTLERAIKLGIKLY"
FT   gene            complement(21938..23413)
FT                   /pseudo
FT                   /locus_tag="BAA_B0027"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            complement(23410..26172)
FT                   /pseudo
FT                   /locus_tag="BAA_B0028"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            complement(26304..26633)
FT                   /locus_tag="BAA_B0029"
FT   CDS_pept        complement(26304..26633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0029"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45847"
FT                   /protein_id="ACQ45847.1"
FT                   /translation="MNTITIKFGEGTAAWKDMQEVVKILNDKGYSTQPYGDIGTVKLTK
FT                   VIEEGMKVSTEEKIAEPDPAAMNKTKEGTFKRILVEANYPWELIKDWTEEDCEAELGAI
FT                   ERANK"
FT   gene            complement(26684..26920)
FT                   /locus_tag="BAA_B0030"
FT   CDS_pept        complement(26684..26920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0030"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45854"
FT                   /protein_id="ACQ45854.1"
FT                   /translation="MAYQVPKCDCGNNLMYMFDKLYHEEFKITKNGVPFKHRYDFCDIL
FT                   EDAWREKLGCTSCDNGYEVEYDKLGRFIRGVLL"
FT   gene            26871..27014
FT                   /locus_tag="BAA_B0031"
FT   CDS_pept        26871..27014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0031"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45878"
FT                   /protein_id="ACQ45878.1"
FT                   /translation="MYIKLLPQSHLGTWYAIMPPTSQQNSNLIDFAKFVCSKNKINLKE
FT                   CV"
FT   gene            complement(27111..27227)
FT                   /locus_tag="BAA_B0032"
FT   CDS_pept        complement(27111..27227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0032"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45881"
FT                   /protein_id="ACQ45881.1"
FT                   /translation="MLGQNRLIFPAMIIVMMVLLVVFDLLLSFIISFTEKLV"
FT   gene            complement(27305..27793)
FT                   /locus_tag="BAA_B0033"
FT   CDS_pept        complement(27305..27793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0033"
FT                   /product="putative liporotein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45840"
FT                   /protein_id="ACQ45840.1"
FT                   /translation="MCKRFKFLLAVSALFISITVVLAGCGGSSVPYKKDDTYKDSKDNF
FT                   ITITAENEWRVKGSQNSEANYKVESTEYKGDSHSVVAISVKEKINGSDPLLVVNDYHYY
FT                   ILSPRENGFSLTPIGTSHPNSAQWKEFQEGFKGANDKEEFLKKEVANVNKQNIFKKTN"
FT   gene            complement(28068..28598)
FT                   /locus_tag="BAA_B0034"
FT   CDS_pept        complement(28068..28598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0034"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45858"
FT                   /protein_id="ACQ45858.1"
FT                   /translation="MSMEYQERYVRKVATILSSKTKHTTGCLIEGESDVCLEFQIELIN
FT                   ALQDNHGLVYHLDFNDYTSETDCLAALKKARKQLRSNKQDGKTLFLSLASFERVEKKTM
FT                   DAVKILIGSRSLGINLVVSANKRFVHLVGLTEYLVTMNKSDVVLSELYRYSTQKILASL
FT                   KNENVSWGEANES"
FT   gene            complement(29105..29407)
FT                   /locus_tag="BAA_B0035"
FT   CDS_pept        complement(29105..29407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0035"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45899"
FT                   /protein_id="ACQ45899.1"
FT                   /translation="MREKEFSKSTHRLKVTKEMDIGTLLNRAHKVSTFDGKNLIVLDNG
FT                   NLYDQAGRREVPVTNMFRYIKSVRNSDGIVIAKKNKPCGKLMQVIFERKAKQKVK"
FT   gene            complement(30283..30447)
FT                   /locus_tag="BAA_B0036"
FT   CDS_pept        complement(30283..30447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0036"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45844"
FT                   /protein_id="ACQ45844.1"
FT                   /translation="MVQNEKIIFVVTSIALVAGIMFATASNKDQSNNIVKKDSEKLVAK
FT                   MVGPGGGMG"
FT   gene            complement(30434..31291)
FT                   /pseudo
FT                   /locus_tag="BAA_B0037"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            complement(31282..31650)
FT                   /pseudo
FT                   /locus_tag="BAA_B0038"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            complement(31906..32085)
FT                   /locus_tag="BAA_B0039"
FT   CDS_pept        complement(31906..32085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0039"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45928"
FT                   /protein_id="ACQ45928.1"
FT                   /translation="MENKQPEQKYDLSRIYTYTEHPDKISGRCDNCGNTAFKSSIKDFI
FT                   YLRECRKCGMKKSI"
FT   gene            complement(32163..32927)
FT                   /locus_tag="BAA_B0040"
FT   CDS_pept        complement(32163..32927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0040"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45841"
FT                   /protein_id="ACQ45841.1"
FT                   /translation="MGKNYPIDRDSRGRYRHSYVFMRGANVEVKLLNHEELLKGKITTI
FT                   EEYYCVLDVEGTSGSYQVTVNFSEVKYIKHEEFPTVEERSPKYSKGDKKTSFVFKIGEK
FT                   IGCVFKDGKGIKGTLLSEDAYYLYVKSEKENYYTIMKGALSYIAHVKHEPLLLTNDFYT
FT                   EEMKLADYKKPTEYVFSVGDTITVYFPSGKNVSGVVLDESKYWVLLQTEKRQITIFKGS
FT                   YSYFKHETYETKAYLYVENRKLRKQLRSGDTN"
FT   gene            complement(33130..34668)
FT                   /locus_tag="BAA_B0041"
FT   CDS_pept        complement(33130..34668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0041"
FT                   /product="plasmid replication protein"
FT                   /note="identified by match to protein family HMM PF08708"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45861"
FT                   /protein_id="ACQ45861.1"
FT                   /translation="MNTVQKAIELILHKGLRKYKSKNSKAGLVSIANQEKFESKVLNGK
FT                   KNKKGSIFITRKKEDLRAKFGTRGVVLSSEEAVLDHVGQASHWTPNVYNFGTYGQNGLR
FT                   TIVGHTEKNLQQINCFVIDIDSKSFPMTAINDVALNAGFGVPTMILETTKGYQVYYVLD
FT                   KAVYVSNNKNFIAIKSAKRISQNLREMFADSLPNVDLTCNHFGFFRMPSVQNIVMFFEE
FT                   NVYTFKELQEWSKRQDDNKGNEQFHNVIESPFAKNAPVEQPKQMDELWFKQVISCTNVS
FT                   PKQTKAGRNNAIFTLSLACFQSQYAIKDTMDLMDQFNSNLEQPLEHTEVRGIVMSAYSG
FT                   KYQAAHKDYIERLLQTYGMGQASAFRAPSVLWKKHKKQRKDRVRSHWHEWEADIITFLS
FT                   MNSNNKPVLYFTQSELCEALNVPRSTLNTVLKKSTKIYKTVEGKGKTAKTGLSTLGMLI
FT                   AFALKENGKRRESYLNYLQGLFPKTGNILEQAKTSNVMEEQETLYGILEGLPAG"
FT   gene            35069..35236
FT                   /locus_tag="BAA_B0042"
FT   CDS_pept        35069..35236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0042"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45872"
FT                   /protein_id="ACQ45872.1"
FT                   /translation="MFYVSFIFYKFLRISYVYYQTKSYCVEKLVVYNVTTSFFVCKQIN
FT                   FKKPLQFTHV"
FT   gene            35574..36440
FT                   /locus_tag="BAA_B0043"
FT   CDS_pept        35574..36440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0043"
FT                   /product="ATPase, ParA family"
FT                   /note="identified by match to protein family HMM PF01656"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45904"
FT                   /protein_id="ACQ45904.1"
FT                   /translation="MEHKRPLTITVANSKGGVGKSTIVRHLSYHLALKGYKVLTADMDP
FT                   QANTTKTMILTRKRVNDEYFAFDKTLMRAVQDGSLENMQLNIIENLDLLPSHSDFENFE
FT                   SLLTSKFGHAETSDPNYHEIETNKINYFRNLLEPLKQNYDFIIIDSPPTASYYTKSSAM
FT                   ASDYVLVAFQTQSDSLDGANDYITRFLARLVEEYNAQLDVVGILPNQLHSAGKIDTTVL
FT                   QDAKDIFGENNLFKNLIPYAKRIQSVPRIGLNVDQYWDKKLFNEVFEPFTDEFLERINK
FT                   MEELRNE"
FT   gene            36433..36819
FT                   /locus_tag="BAA_B0044"
FT   CDS_pept        36433..36819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0044"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45877"
FT                   /protein_id="ACQ45877.1"
FT                   /translation="MSNEQGKGMGFFGNKGKPASEKKDEKKTKLDLDYKPDLNPSTPYD
FT                   PTLPVKATLVNGDKRGTLRIPLETKHEFDALLEISEYQYTYELLGEMLDTWMKKLTPEQ
FT                   LRLFHASLENIKRKAAIKEAKKKK"
FT   gene            37018..37251
FT                   /locus_tag="BAA_B0045"
FT   CDS_pept        37018..37251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0045"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45911"
FT                   /protein_id="ACQ45911.1"
FT                   /translation="MRTLIIITLVVIGLVFFNVISLHTIGTLAAIIGVIIAIALGAYFL
FT                   YRLALGFFALFATFIGVILVICLITYAVTNLV"
FT   gene            37571..37723
FT                   /locus_tag="BAA_B0046"
FT   CDS_pept        37571..37723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0046"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45898"
FT                   /protein_id="ACQ45898.1"
FT                   /translation="MISLEPYLYESLEQIALELITEGLDYIYTEDLPVQHFIEFKLTSS
FT                   YCKPL"
FT   gene            37723..37839
FT                   /locus_tag="BAA_B0047"
FT   CDS_pept        37723..37839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0047"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45850"
FT                   /protein_id="ACQ45850.1"
FT                   /translation="MISAQTGVFRKKNGITFYTQNKVKESNYKRRILSPGIR"
FT   gene            complement(38199..38327)
FT                   /locus_tag="BAA_B0048"
FT   CDS_pept        complement(38199..38327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0048"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45918"
FT                   /protein_id="ACQ45918.1"
FT                   /translation="MDEKEENSLFKKYIYVELRLGGFNNQKLHFKFFLYLSFIFLL"
FT   gene            38460..40055
FT                   /locus_tag="BAA_B0049"
FT   CDS_pept        38460..40055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0049"
FT                   /product="surface-layer N-acetylmuramoyl-L-alanine amidase"
FT                   /EC_number="3.5.1.28"
FT                   /note="identified by match to protein family HMM PF00395;
FT                   match to protein family HMM PF01520"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45870"
FT                   /protein_id="ACQ45870.1"
FT                   /translation="MNTKGIIAKLTAGALIANLLICPANTLAEKKTFTDVPNWAQQSVN
FT                   YLMKKALDGKPDGTFSPSEKIDRGSAAKLMAMVLGLQINKQAKPSFQDAKNHWASPYIA
FT                   AVEKAGVIYGDGSGNFNPSKDIDRASMASMLVEAYKLNNRIIGDLPTQFEDLKGHWGAK
FT                   LANALVALGISKGTGDGWKPNGIVTRAEAVQFIAQTDMKKADTSKRMYMNRHFITYHQP
FT                   SLSSGVTSNQHAPQIIVVKEQRADGWIKIVTNIGDKWTPLYEKRETIHSTFTTYPEASH
FT                   SSKVLGTHSPQTVTVIEEKGSWIRIRTNAGFQWLDKNQLTLPKKQNNFLEGKTIIIDPG
FT                   HGGIDGGHKGIYMNESPVVYDTAVRVQKLFAQKTPFTALLTRDAYSRPGKNATDSLGKR
FT                   VEFAKKNKGDIFVSIHANGFNGNAHGTETFYYKAPTQKSNPYVNDSRILAEKIQKRLIT
FT                   ALQTRDRGVKIGNLYVLRENTMPSVLTELGFVDNKADGKKLDSPEWRQRAAEAIYAGIL
FT                   DYYEWKGHNMSAYY"
FT   gene            complement(40296..40655)
FT                   /pseudo
FT                   /locus_tag="BAA_B0050"
FT                   /note="transposase in Marinococcus halophilus; this gene
FT                   contains a frame shift which may be the result of a
FT                   sequencing error"
FT   gene            complement(40683..40841)
FT                   /pseudo
FT                   /locus_tag="BAA_B0051"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   premature stop which may be the result of a sequencing
FT                   error"
FT   gene            complement(41207..41371)
FT                   /pseudo
FT                   /locus_tag="BAA_B0052"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            complement(41533..41862)
FT                   /locus_tag="BAA_B0053"
FT   CDS_pept        complement(41533..41862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0053"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45873"
FT                   /protein_id="ACQ45873.1"
FT                   /translation="MRGVVNQNVLHHIGYEVLQETFVLIRNVFSYSNQGEYSVTYVREI
FT                   ADALYNIPHSIQKQHDTFLEFEFKLLEETLMQMEFGKVAAQNIPHFRMYAARVQQLLRK
FT                   RYKEV"
FT   gene            complement(42445..42756)
FT                   /locus_tag="BAA_B0054"
FT   CDS_pept        complement(42445..42756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0054"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01906"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45866"
FT                   /protein_id="ACQ45866.1"
FT                   /translation="MIVTTTAEIQGKEIIEYIDIVNGEAIMGANIVRDVFASVRDVVGG
FT                   RAGAYESKLKEARDIAMDEMKELAKQKGVNAIVGIDVDYAIIRAGMLMVAVSGTAVRI"
FT   gene            complement(42805..43470)
FT                   /locus_tag="BAA_B0055"
FT   CDS_pept        complement(42805..43470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0055"
FT                   /product="caax amino protease family protein"
FT                   /note="identified by match to protein family HMM PF02517"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45890"
FT                   /protein_id="ACQ45890.1"
FT                   /translation="MNFIKTNTKEISMLIIYALFVPFQIGLFILLGISLLTNSNIVESE
FT                   FALSAISLTIPAIVGIIFFRKEIIESFTYFKEKTILKIVSIPMVVLFTVIVEQIVMRFL
FT                   ATGQPENQEQLLETGAEIPLILTLLVFGILGPILEEIIFRHIILNRFSNYIGTAIASII
FT                   SIIIFTLFHTSQLSDIAIYLPGAVILTAAYLISNRSLAYVIAIHVLNNSIAFIQLHMS"
FT   gene            44181..44645
FT                   /locus_tag="BAA_B0056"
FT   CDS_pept        44181..44645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0056"
FT                   /product="pXO2-47"
FT                   /note="identified by match to protein family HMM PF04463"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45894"
FT                   /protein_id="ACQ45894.1"
FT                   /translation="MILVSSCLAGKPVRYNGTACLNDTIQKLIDEKKAIPVCPELLGGF
FT                   VTPREPAEILGGDGYDVLEGKAKVMERSGNDVTELYINGAMKTLNLAQEMQASHVVLKE
FT                   YSPSCGSKEIYSGEFVGKKVTGVGVTTALLESKGIKVISELELDQLINKI"
FT   gene            45022..45612
FT                   /locus_tag="BAA_B0057"
FT   CDS_pept        45022..45612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0057"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45917"
FT                   /protein_id="ACQ45917.1"
FT                   /translation="MTKVDKVKEKIIETSLYLFNTNGITRTSIQDIMTATELPKGSIYR
FT                   RFKNKEEIVLAAYDKSGEIMWSHFHKAMENKKTAIDKILAIFLVYQDAANNPPIAGGCP
FT                   LLNSAIESTGVFPELQKAAAKGYDDTVMLMASLIKEGIEKQELKEDIDIISLASFLASS
FT                   MEGAIMASRVSNDNIHHQYFIEQIKHHLYSYSK"
FT   gene            46049..46906
FT                   /pseudo
FT                   /locus_tag="BAA_B0058"
FT                   /note="IS231-related, transposase, internal deletion; this
FT                   gene contains a frame shift which may be the result of a
FT                   sequencing error; identified by match to protein family HMM
FT                   PF01609"
FT   gene            46897..47436
FT                   /pseudo
FT                   /locus_tag="BAA_B0059"
FT                   /note="transposase for insertion sequence element D; this
FT                   gene contains a frame shift which may be the result of a
FT                   sequencing error"
FT   gene            complement(47588..48022)
FT                   /pseudo
FT                   /locus_tag="BAA_B0060"
FT                   /note="bacitracin transport permease; this gene contains a
FT                   frame shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF01569"
FT   gene            complement(48019..48186)
FT                   /pseudo
FT                   /locus_tag="BAA_B0061"
FT                   /note="undecaprenyl-diphosphatase; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            complement(48285..48458)
FT                   /locus_tag="BAA_B0062"
FT   CDS_pept        complement(48285..48458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0062"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45851"
FT                   /protein_id="ACQ45851.1"
FT                   /translation="MKNKYKFTSDIKDYKSRVSIGIGKLEEDGTMSIIRRVNSYKFQNR
FT                   LELTIYNLNFII"
FT   gene            complement(48575..48757)
FT                   /locus_tag="BAA_B0063"
FT   CDS_pept        complement(48575..48757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0063"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45897"
FT                   /protein_id="ACQ45897.1"
FT                   /translation="MMDIKIEIYQDEKDMEKTEVAVKTEKTAIPFKWENPLEDTYTKMG
FT                   YSESSPISAGGTFMG"
FT   gene            complement(48808..48924)
FT                   /locus_tag="BAA_B0064"
FT   CDS_pept        complement(48808..48924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0064"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45910"
FT                   /protein_id="ACQ45910.1"
FT                   /translation="MYEKEIKTLAGICVLSSSLLSNTASNNTTVKAEERNYE"
FT   gene            complement(49971..51419)
FT                   /gene="acpB"
FT                   /locus_tag="BAA_B0065"
FT   CDS_pept        complement(49971..51419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpB"
FT                   /locus_tag="BAA_B0065"
FT                   /product="capsule synthesis trans-acting positive regulator
FT                   AcpB"
FT                   /note="identified by match to protein family HMM PF05043;
FT                   match to protein family HMM PF08279; match to protein
FT                   family HMM PF08280"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45903"
FT                   /protein_id="ACQ45903.1"
FT                   /translation="MEKDIKRQIQILEIITSEEKWFTTIEISKILRCCNKTIMKDISFI
FT                   KDFLPEDWHIKIKKGKGVRIYLPYNKHRNEITFLLFRESLTFRILQHLFERETKTIATL
FT                   AERLYIQVPSILPALKRVENYLKKFGLKLRKKPLRLEGDEVRIMIMYLDLYLKSYNDTE
FT                   WPFEKLKKEVIFQYLGTLEESLGISLHVVSKRHLSFFIAILLKRKQQGYKVQLNRKFLY
FT                   FNTETPDYVKIGRIFEKLEREFGVSLTVQDKILLTISIKSSKYVYKDINKEKEESVQYF
FT                   KEGNLSIYELVKDFINSLEEKLKVDLISDEEFIFALVDYFKRTIYHLQYLCMFERPQKQ
FT                   TIQYMQTEHSETFSAVKEVYTEFVKKNEIADYVSVEEIAKVTMYIEASRLRYTSNYKKV
FT                   LLVTGESESWAEYLAATLAKRFGDKIQISTVFFAKKSDHDVNADFIISTIPLDLGSTPI
FT                   ICINSIPTERDYTNIQYYLDLQDG"
FT   gene            52488..52826
FT                   /locus_tag="BAA_B0066"
FT   CDS_pept        52488..52826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0066"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06486;
FT                   match to protein family HMM TIGR01655"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45879"
FT                   /protein_id="ACQ45879.1"
FT                   /translation="MLAIVRVGCDVSSPSKIGTVEYYVQIQREGEIKGNERVYTLLTYD
FT                   KEGTEKKVTFTSQKPNNEKLKENAFLRLYIKQEDKEKADIPDTEVKSYEEIQKDDLPAK
FT                   TKEQLGVK"
FT   gene            complement(53190..53333)
FT                   /gene="capE"
FT                   /locus_tag="BAA_B0067"
FT   CDS_pept        complement(53190..53333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="capE"
FT                   /locus_tag="BAA_B0067"
FT                   /product="polyglutamate capsule biosynthesis protein CapE"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45855"
FT                   /protein_id="ACQ45855.1"
FT                   /translation="MVKKVFGWIMPILIVGLLLVTMGTFKRSETLTTDEQKKISDYLQA
FT                   NP"
FT   gene            complement(53348..54934)
FT                   /gene="capD"
FT                   /locus_tag="BAA_B0068"
FT   CDS_pept        complement(53348..54934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="capD"
FT                   /locus_tag="BAA_B0068"
FT                   /product="capsule anchoring protein CapD"
FT                   /note="identified by match to protein family HMM PF01019"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45883"
FT                   /protein_id="ACQ45883.1"
FT                   /translation="MNSFKWGKKIILFCLIVSLMGGIGVSCSFNKIKDSVKQKIDSMGD
FT                   KGTYGVSASHPLAVEEGMKVLKNGGSAVDAAIVVSYVLGVVELHASGIGGGGGMLIISK
FT                   DKETFIDYRETTPYFTGNQKPHIGVPGFVAGMEYIHDNYGSLPMGELLQPAINYAEKGF
FT                   KVDDSLTMRLDLAKPRIYSDKLSIFYPNGEPIETGETLIQTDLARTLKKIQKEGAKGFY
FT                   EGGVARAISKTAKISLEDIKGYKVEVRKPVKGNYMGYDVYTAPPPFSGVTLLQMLKLAE
FT                   KKEVYKDVDHTATYMSKMEEISRIAYQDRKKNLGDPNYVNMDPNKMVSDKYISTMKNEN
FT                   GDALSEAEHESTTHFVIIDRDGTVVSSTNTLSNFFGTGKYTAGFFLNNQLQNFGSEGFN
FT                   SYEPGKRSRTFMAPTVLKKDGETIGIGSPGGNRIPQILTPILDKYTHGKGSLQDIINEY
FT                   RFTFEKNTAYTEIQLSSEVKNELSRKGLNVKKKVSPAFFGGVQALIKDERDNVITGAGD
FT                   GRRNGTWKSNK"
FT   gene            complement(54931..56166)
FT                   /gene="capA"
FT                   /locus_tag="BAA_B0069"
FT   CDS_pept        complement(54931..56166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="capA"
FT                   /locus_tag="BAA_B0069"
FT                   /product="capsule biosynthesis protein CapA"
FT                   /note="identified by match to protein family HMM PF09587"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45909"
FT                   /protein_id="ACQ45909.1"
FT                   /translation="MRRKLTFQEKLLIFIKKTKKKNPRYVAIVLPLIAVILIAATWVQR
FT                   TEAVAPVKHRENEKLTMTMVGDIMMGRHVKEIVNRYGTDYVFRHVSPYLKNSDYVSGNF
FT                   EHPVLLEDKKNYQKADKNIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIK
FT                   AFKEADLDYVGAGENFKDVKNIVYQNVNGVRVATLGFTDAFVAGAIATKEQPGSLSMNP
FT                   DVLLKQISKAKDPKKGNADLVVVNTHWGEEYDNKPSPRQEALAKAMVDAGADIIVGHHP
FT                   HVLQSFDVYKQGIIFYSLGNFVFDQGWTRTKDSALVQYHLRDNGTAILDVVPLNIQEGS
FT                   PKPVTSALDKNRVYRQLTKDTSKGALWSKKDDKLEIKLNHKHVIEKMKKREKQEHQDKQ
FT                   EKENQVSVETTT"
FT   gene            complement(56178..56627)
FT                   /gene="capC"
FT                   /locus_tag="BAA_B0071"
FT   CDS_pept        complement(56178..56627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="capC"
FT                   /locus_tag="BAA_B0071"
FT                   /product="capsule biosynthesis protein CapC"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45880"
FT                   /protein_id="ACQ45880.1"
FT                   /translation="MFGSDLYIALVLGVTLSLIFTERTGILPAGLVVPGYLALVFNQPV
FT                   FMLVVLFISILTYVIVTYGVSRFMILYGRRKFAATLITGICLKLLFDYCYPVMPFEIFE
FT                   FRGIGVIVPGLIANTIQRQGLPLTIGTTILLSGATFAIMNIYYLF"
FT   gene            complement(56642..58036)
FT                   /gene="capB"
FT                   /locus_tag="BAA_B0072"
FT   CDS_pept        complement(56642..58036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="capB"
FT                   /locus_tag="BAA_B0072"
FT                   /product="capsule biosynthesis protein CapB"
FT                   /EC_number="6.3.2.-"
FT                   /note="identified by match to protein family HMM PF08245"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45907"
FT                   /protein_id="ACQ45907.1"
FT                   /translation="MKNIKIVRILKHDEAIRIEHRISELYSDEFGVVYAGNHLIFNWYQ
FT                   RLYLSRNILISKKSKSRKGLIQMIFIIGICTVFLIIYGIWEQRCHQKRLNSIPIRVNIN
FT                   GIRGKSTVTRLITGVVQEAKYKTVGKTTGTSARMIYWFTDEEQPIKRRKEGPNIGEQRR
FT                   VVKEAADLEAEALICECMAVQPDYQIIFQNKMIQANVGVIVNVLEDHMDVMGPTLDEVA
FT                   EAFTATIPYNGHLVTIESEYLDYFKEVAEERNTKVIVADNSRISEEFLRKFDYMVFPDN
FT                   ASLALAVAEALGIDEETAFRGMLNAHPDPGAMRITRFADQSKPAFFVNGFAANDPSSTL
FT                   RIWERVDDFGYSNLAPIVIMNCRPDRVDRTEQFARDVLPYIKAEIVIAIGETTAPITSA
FT                   FEKGDIPTQEYWNLEGWSTSEIMSRMRPYLKNRIVYGVGNIHGAAEPLIDMIMEEQIGK
FT                   KQAKVI"
FT   gene            59485..59784
FT                   /locus_tag="BAA_B0073"
FT   CDS_pept        59485..59784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0073"
FT                   /product="transcriptional repressor PagR"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45916"
FT                   /protein_id="ACQ45916.1"
FT                   /translation="MTIITNHEIEYKDFEENGELLKIMGHPMRLKIINELYKHKMLNGI
FT                   QITKILNLPQSTVSQHLCKMKGKILKGNRKGLEIYSSINNPKVEKIIALLIPIE"
FT   gene            complement(59796..59951)
FT                   /pseudo
FT                   /locus_tag="BAA_B0074"
FT                   /note="IS231-related, transposase; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            complement(59987..60235)
FT                   /pseudo
FT                   /locus_tag="BAA_B0075"
FT                   /note="transposase for insertion sequence element; this
FT                   region contains one or more premature stops and/or
FT                   frameshifts"
FT   gene            complement(60608..60727)
FT                   /pseudo
FT                   /locus_tag="BAA_B0076"
FT                   /note="transposase for insertion sequence element; this
FT                   gene contains a premature stop which may be the result of a
FT                   sequencing error"
FT   gene            complement(61426..61977)
FT                   /locus_tag="BAA_B0077"
FT   CDS_pept        complement(61426..61977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0077"
FT                   /product="signal peptidase I"
FT                   /note="identified by match to protein family HMM PF00717;
FT                   match to protein family HMM TIGR02227"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45876"
FT                   /protein_id="ACQ45876.1"
FT                   /translation="MKIIKLLITYGITLLLSLVIALMINIFVFRTYTVEGESMEPTLQE
FT                   QELIYTSRLDYWFNSLPKYNDIVIIDSYTEKKRTFLDDIKNTNLIELFIEPQTKFFIVK
FT                   RVIGKPGDTLEIKDRIVYRNGKQLTETYIKEAMYTAMDQKWIVPKNHIFVMGDNRNHSK
FT                   DSRVMGYIPIERVLATVISK"
FT   gene            complement(62330..63265)
FT                   /locus_tag="BAA_B0078"
FT   CDS_pept        complement(62330..63265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0078"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45857"
FT                   /protein_id="ACQ45857.1"
FT                   /translation="MSLGTTDILQKPIAAHAHYVQSQSTDDVWKWVLDSRGKVTTTFVD
FT                   VLNTSPGQVKEVIRFDVDNRNMGEAATFKTPQRTFKSVNSITKTSFKEFTFGQEVTGEF
FT                   GVPYFKKLGVKLTAGQKFGENNSTLESTETTTQYGGDSITVPANKHYAIDYVFTTTNFS
FT                   GKFQNKREIPGTSNIRVAGFWDPDTGTQRRSEKFLNEKTKYGVVKNLQIAYDELKNNPD
FT                   QGNLFHDELLSRKNIKIHLGFTNGDDYYLKPEEVKEKILDRVYLDDDKKKVYVLEDAAE
FT                   FNGQSGIDLSIKVIDRTNNTEKELPKILLF"
FT   gene            complement(63412..63822)
FT                   /locus_tag="BAA_B0079"
FT   CDS_pept        complement(63412..63822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0079"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF09385"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45849"
FT                   /protein_id="ACQ45849.1"
FT                   /translation="MEEIKCLLCRYLKERQEKFISDWKKKVIIRERDPYKEEIIKNGEH
FT                   LLSAFIMYLKEEISLQEIEITSKKIARERIDAKVNIAEFIHNTNVAKIEIMNILTLLNP
FT                   DLQQYQALVKKINQFFDHLIYYTVHSYYEQKA"
FT   gene            64063..64470
FT                   /pseudo
FT                   /locus_tag="BAA_B0080"
FT                   /note="anthrax toxin expression trans-acting positive
FT                   regulator; this gene contains a frame shift which may be
FT                   the result of a sequencing error; identified by match to
FT                   protein family HMM PF08279; match to protein family HMM
FT                   PF08280"
FT   gene            64496..64954
FT                   /pseudo
FT                   /locus_tag="BAA_B0081"
FT                   /note="anthrax toxin expression trans-acting positive
FT                   regulator; this gene contains a frame shift which may be
FT                   the result of a sequencing error; identified by match to
FT                   protein family HMM PF00874"
FT   gene            65026..65487
FT                   /pseudo
FT                   /locus_tag="BAA_B0082"
FT                   /note="anthrax toxin expression trans-acting positive
FT                   regulator; this gene contains a frame shift which may be
FT                   the result of a sequencing error"
FT   gene            65598..65741
FT                   /locus_tag="BAA_B0083"
FT   CDS_pept        65598..65741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0083"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45922"
FT                   /protein_id="ACQ45922.1"
FT                   /translation="MTITFDIKIKLTYILEHVKNINNFYLNQMHIRALNGQSSVYFPIS
FT                   ES"
FT   gene            66031..66648
FT                   /locus_tag="BAA_B0084"
FT   CDS_pept        66031..66648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0084"
FT                   /product="amino acid efflux protein"
FT                   /note="identified by match to protein family HMM PF01810;
FT                   match to protein family HMM TIGR00949"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45896"
FT                   /protein_id="ACQ45896.1"
FT                   /translation="MDLNIWITVLLVGTIGVISPGPNWAVIIKNSLYSRSLGVSTVAGI
FT                   ATGSLIHIVYCLIGIGVIISKSILLFNTLKWIGVAYLLYIGIKLLRSKKQSPAAIIKNN
FT                   ESTTWKAFRSGFLTDMLNPKATLFYLAIFTQVIEPNTNIFVQSVYGLTVWSVEILWHMV
FT                   LVFFLTHKSVRNYFLSISHWIERVTGTALILLGIRLAFLKND"
FT   gene            67712..67846
FT                   /pseudo
FT                   /locus_tag="BAA_B0085"
FT                   /note="putative transposase; this gene contains a frame
FT                   shift which may be the result of a sequencing error"
FT   gene            69482..70933
FT                   /gene="acpA"
FT                   /locus_tag="BAA_B0086"
FT   CDS_pept        69482..70933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpA"
FT                   /locus_tag="BAA_B0086"
FT                   /product="capsule synthesis trans-acting positive regulator
FT                   AcpA"
FT                   /note="identified by match to protein family HMM PF05043;
FT                   match to protein family HMM PF08279; match to protein
FT                   family HMM PF08280"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45845"
FT                   /protein_id="ACQ45845.1"
FT                   /translation="MEKDISRKIDLLNILIEEKRWFTLFELEKNLNCSSKTIRKDISII
FT                   NDLLPKTIFIHSKKGKGVKLSLPQNQSISEAISNLLKKSLTFLAIQQLLEERSNTVTSL
FT                   ADKLYLPISSTNIVLKRVSKYIKKFGLSLEKKPLRIVGDEFQIILMFSERYLESYPDTE
FT                   WPFTEYKEEMLIDYINYIEEKLEIVFYSNDKRRMAFIMTILFKRIKQGHKVKFSEWIIK
FT                   ETMESIYYKKIFEGKNVIKVNKNRSLNIEEQVLLVIMVKLSRYVSKDENNLKQEELVLY
FT                   KEGESTTYTYVKNFISILEQELKIDLNNNEEFVYGMIEYCREAFHILKFIPILKAPEKD
FT                   TCKYIKKHYEETFYLVKRAYNKWGAEMKLTDIPDEEIAKVTMRIVAIGKQHNINRKKVL
FT                   LITGEGKSWEEYMKSRINKRYGDQLKFVGGHAKILNGNTDNIDNIDIDFIITTVPLNFS
FT                   WKSIVYVSPILQERDFYEIGIFASK"
FT   gene            71448..71699
FT                   /locus_tag="BAA_B0087"
FT   CDS_pept        71448..71699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0087"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45886"
FT                   /protein_id="ACQ45886.1"
FT                   /translation="MKEVTIREFIKGVNDKKNLRVILENDFLSMQSNKVLNLECRIGKI
FT                   VINDWEVNIKNCKILTVEKEYIITDDYSNTKLIVYPSV"
FT   gene            72018..72179
FT                   /locus_tag="BAA_B0088"
FT   CDS_pept        72018..72179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0088"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45865"
FT                   /protein_id="ACQ45865.1"
FT                   /translation="MGREIKTFRRNATAAGCFAVQDLSAWIIRILINEDMVNTVLETLQ
FT                   PVSKGLYI"
FT   gene            complement(72213..72353)
FT                   /locus_tag="BAA_B0089"
FT   CDS_pept        complement(72213..72353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0089"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45860"
FT                   /protein_id="ACQ45860.1"
FT                   /translation="MVMKKYLNKKIFLLVPHAHQAKILKYPQNENFIILQFFMRIQLVF
FT                   S"
FT   gene            72628..72963
FT                   /pseudo
FT                   /locus_tag="BAA_B0090"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            72960..73508
FT                   /pseudo
FT                   /locus_tag="BAA_B0091"
FT                   /note="caax amino protease family protein; this gene
FT                   contains a frame shift which may be the result of a
FT                   sequencing error; identified by match to protein family HMM
FT                   PF02517"
FT   gene            complement(74065..75624)
FT                   /locus_tag="BAA_B0092"
FT   CDS_pept        complement(74065..75624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0092"
FT                   /product="oligopeptide ABC transporter"
FT                   /note="identified by match to protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45856"
FT                   /protein_id="ACQ45856.1"
FT                   /translation="MLKKVTPIVAAVLGASFLLTACSSDKKEDTAKATDGESMNVMKNV
FT                   FEGLYTLGEGNKPIPAVAKSYDVSEDKKIYTFHLRDSKWSNGTPVTAEDFVFSWKRAVN
FT                   PDTAAEYAFLFFDIKNAKKINSKELPVDQLGIKAIDDKTLEVQLEQPVPYFIDLTTFAT
FT                   FLPINEKYFESKGKQYGLEADQLVYNGAFTLDNWKHEQSFQLKKNPNYWDAKTVKLEEI
FT                   NFDIVKDKSTEINLYESGQLDRVGLTGEFVDKYRKNPDFKERSEVTVQFLRMNQKNEVL
FT                   KNKNARLAISQAMNKKAFVDTVLNNGSLPADGFIPADFAKISDGKDFRKENGALVKDDV
FT                   KAAKEHWKNAKQELGKEQVTLELLTSDNVFAKKNAEYLKGELEKNLEGLTVNVKPQPRK
FT                   QQIQLLLNSDYELGVDVWGPDIPDPITFLDLFTTDSTYNFDKYSNKQYDELIHQVKTNL
FT                   AGDENARWEAMKQAEKILLEDGAVAPFYQQGRSYLQRSSVKGIVTNDFGGEFNYKWTEV
FT                   KK"
FT   gene            complement(75771..75914)
FT                   /locus_tag="BAA_B0093"
FT   CDS_pept        complement(75771..75914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0093"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45914"
FT                   /protein_id="ACQ45914.1"
FT                   /translation="MVVVKSVKNENKEPFFRRGLKNINTKECIVNILIICDSYIKIYNL
FT                   YN"
FT   gene            complement(76116..76295)
FT                   /locus_tag="BAA_B0094"
FT   CDS_pept        complement(76116..76295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0094"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45925"
FT                   /protein_id="ACQ45925.1"
FT                   /translation="MKQKQIGFEVNHNEVYRCNKCGGAAWRVVWLSTGRRTITMEWVFV
FT                   YCPTCDELRRQKYK"
FT   gene            complement(76666..77259)
FT                   /locus_tag="BAA_B0095"
FT   CDS_pept        complement(76666..77259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0095"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45919"
FT                   /protein_id="ACQ45919.1"
FT                   /translation="MAGMEIVYTANEVYSRLGVSGSTLRKYSDVLEREGYEVRKNSRGR
FT                   REYTEFDVVLLQHLVELSKEDGMTLEKAAKLIVKEYGIANKKEEMKEVNPMPYHVQYQL
FT                   HEQYSAMVAELNRVQQANLLEMEKRLSDRIDQRNALIEEDMSDRKEREERIEKRLERRD
FT                   ENLMKMIREIQEAKRIMEEVAAAKEKKLWWKFWE"
FT   gene            77487..78752
FT                   /locus_tag="BAA_B0096"
FT   CDS_pept        77487..78752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0096"
FT                   /product="impB/mucB/samB family protein"
FT                   /note="identified by match to protein family HMM PF00817"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45923"
FT                   /protein_id="ACQ45923.1"
FT                   /translation="MYDYSILPNRIILCVDLRSFYASVSCIKMGLDPMHTKLAVVGDVN
FT                   RNGSIVLAATPPLKALGVKKMARLYEIPRRKDILVVNPIMGTYIKCSNYITKLALQYVP
FT                   IEDFHQYSIDEFLLDITDSIHLFASDPYEFALKFKREIYEHTRIECTIGIGPNPLMSKV
FT                   ALDIEAKKNKEGIAHWKYEDVPTKLWSIRPLHKFWGISYKTEEKLNRKGIHTIGDLAHY
FT                   PLTYLKQSFGKIGEELHLHSNGIDFSRISEKYVPATTSVGKSQILMRDYTIEEFPIVLL
FT                   EHIEEVCYRLRRQNKLAQTVHFSVGYSKSYNGGIRKTHTLSRPTNLTMDIYKICTYFLH
FT                   QQYTGEPIRSINISLTNLLQEGEEQISLFDNVTQREQEVKLTKVMDEIRTRFGKNSILR
FT                   GISYTHSATTRYRNTLIGGHKS"
FT   gene            78749..79090
FT                   /locus_tag="BAA_B0097"
FT   CDS_pept        78749..79090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0097"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF08863"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45874"
FT                   /protein_id="ACQ45874.1"
FT                   /translation="MNNANMPKGRGMVKWAPFAALTSQFDGIREIIKEQNKVTRPILTT
FT                   AEKERIENILLCSLLSEEEILITYYEDGYLLSGYMTVVDIDPLNSAVICTDAFYNTMKL
FT                   QFSNIIDVK"
FT   gene            79114..79488
FT                   /locus_tag="BAA_B0098"
FT   CDS_pept        79114..79488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0098"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45905"
FT                   /protein_id="ACQ45905.1"
FT                   /translation="MQAEQTRKNAAGAIIHNDINNHPHLNIPMIINEQDGQIYEVFSVG
FT                   FHSNDAIAMVTTDGFSTTRVHTPIVTVKNDDGSFQAYRLPLELEYWVFSCLQAASAGKN
FT                   PFPCKVAFGIIDNKFYVEFK"
FT   gene            complement(79788..81314)
FT                   /locus_tag="BAA_B0099"
FT   CDS_pept        complement(79788..81314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0099"
FT                   /product="FunZ family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45884"
FT                   /protein_id="ACQ45884.1"
FT                   /translation="MVKKVPLKKLYIGNIDGESEATRGDFNQLFYTKNRKFEEIMRPEK
FT                   FIIAGRKGSGKTILAKYVHNKVNENKGSYCEISTKNDYTLRKLIDLPNRELKREEISHF
FT                   CKWTFLIKFCDVILDGAKWKKKIPGTAEYKLHKFRKKIHTENIFKIKDFNESFGSKSSL
FT                   KADVKTKTPKELGIAAAREDNAQVSTNYIPKEYFELLGQLEDMLFKCIKKDKEIVLIYD
FT                   DLDELEEKIGEDSFYHRTLIAMIETVKNLNLVFRDLGKKNTKIIVLLRSDIIDEIHKFS
FT                   ANSNKLVTESKVNLYWIDKSYKGAEHPLMEMILNKIQKSVKEYESLSKDELYKMIFSHR
FT                   INEKDIISYLLDYSFGRPRDITRYLNLIIEKNPNAIAFNPKAFKDCAKEYSKWFYDELQ
FT                   NEVSINENKSMLLDGLQLINDLKKASFNYNTIEKFYNGKSGNYPNIKNLKETMRHLYKM
FT                   GVIGNSWIHGRDGNTNIYRYAWGYRDDAVSDPNFSQYFAVHYGLRKYFSI"
FT   gene            complement(81476..81721)
FT                   /locus_tag="BAA_B0100"
FT   CDS_pept        complement(81476..81721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0100"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45887"
FT                   /protein_id="ACQ45887.1"
FT                   /translation="MLFMLDEIMTPREACDRWGITQEALRMKLKRGKDSELVDKLIREG
FT                   KLKYYRPIEKKRGEWILTVEAMKILFPKSNRSFIIK"
FT   gene            complement(81833..82072)
FT                   /locus_tag="BAA_B0101"
FT   CDS_pept        complement(81833..82072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0101"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45927"
FT                   /protein_id="ACQ45927.1"
FT                   /translation="MKKKKSSKVSKNYNRMREMKRGSEKSNLNKIKVSIKIGNKFSFVR
FT                   EKWTRIGLKAWLFNAGLHITLQVVLTLMKYFLLS"
FT   gene            82880..84505
FT                   /locus_tag="BAA_B0102"
FT   CDS_pept        82880..84505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0102"
FT                   /product="pXO2-73"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45926"
FT                   /protein_id="ACQ45926.1"
FT                   /translation="MKDVESHLIAHLKKINTAPFLFIGSGFSKRYLNLEDWAGLMKKFS
FT                   NLMPYEFEYYSSTANKDWAEVAELMAKDFHPIWWKEQQFENNRKEFKDRISSKQSPLKV
FT                   EVAKYLNSIEYKYGLDEKNDKEIAALKKIVIDGIITTNWDLLLEQIFEEQEMQVYIGQK
FT                   ELLFSHPLEINEIYKIHGCSSIPDSLVLTTSDYKGYNEKNAYLAAKLLTVFIEHPVIFL
FT                   GYSISDDNIQQILKAITRCLDQDNIHKLKDRLIFVERAGQEEDSFENNSSLTIGKITVP
FT                   ITRVKTNDYEKIYNALAQNKRKFSMKMMRQMKSQIYELVKTNDPEEKIYVVDGEYDDTQ
FT                   DIEFVIGLGVKNVVEEMQSNHEISASKELSEHGYGGISDIELFNELLSDEPKYDYDSIV
FT                   KISLPQILRSNQYVPLFRYVLESSVEDELLDSKIKNKLKMRYTDFLTETQKKNIKNLSW
FT                   DWQFKNLDEVLKGFPDIKVAIEQIPLLGQKNLNCDDLKDFLIKNSKFVKEKNTPERTGI
FT                   RRLFRIYDWLKYGQSKDLRKRLGK"
FT   gene            84821..85639
FT                   /locus_tag="BAA_B0103"
FT   CDS_pept        84821..85639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0103"
FT                   /product="site-specific recombinase"
FT                   /note="identified by match to protein family HMM PF00589"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45846"
FT                   /protein_id="ACQ45846.1"
FT                   /translation="MNWESLYKKDFEAFFNYLIEERQYSDKTVHRIYIALNRLYEYLDL
FT                   PSPIESVIHIAPPNRALRTEDFISSQEERHLKEVSASLEGLTEKQRSTRPMILERNLSI
FT                   IILLLDYGLSLHELVSLRMKHVHFENNTLSIPEDTIINRTIQLKEEDKLHLYNYYKTIP
FT                   KPVRPRYHSDDPLFVAFHFRLGTYVWSYDDDAPKFLTEISVQKMIRLEIKRANLRKGIS
FT                   AQHFRNTFILRMFQQLCKDEHIMKQVGFKTHESLKRYRKYYYANSNENKG"
FT   gene            85711..85893
FT                   /locus_tag="BAA_B0104"
FT   CDS_pept        85711..85893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0104"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45843"
FT                   /protein_id="ACQ45843.1"
FT                   /translation="MKKNKESYSIHVYTLRDKTTKSIKIESWRSLREEMQVLGITDSDI
FT                   FQIQMIEITPNKKAP"
FT   gene            complement(85989..86426)
FT                   /locus_tag="BAA_B0105"
FT   CDS_pept        complement(85989..86426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0105"
FT                   /product="ImpB/MucB/SamB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45882"
FT                   /protein_id="ACQ45882.1"
FT                   /translation="MSTEKLYSTADLAEELEMTKQGMNQAVKAGRIEAPAYYIGAYKGW
FT                   TEEQVERIKGKIYEKEQEIKDIVRCIPYGLTPSGSEYLKHNPELALKYLEQAIKECENE
FT                   MEKVINSDDKKYIGMDIFVGSCKERFEQIRDNLTRNSKNNS"
FT   gene            complement(86641..87087)
FT                   /locus_tag="BAA_B0106"
FT   CDS_pept        complement(86641..87087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0106"
FT                   /product="caax amino protease family protein"
FT                   /note="identified by match to protein family HMM PF02517"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45921"
FT                   /protein_id="ACQ45921.1"
FT                   /translation="MNVKRVVQKGKWVLMTTGLAIVSSLFFFYIKGYFGIDTGNAEQVN
FT                   AKVELNIFYLIVPLLIAPVIEECIFRKFLPLGIGTLFERINRTTAIIIANGIFAAVHFD
FT                   WFFFPYFVNGCLYAWSYEKTRDIKVPIVAHVTFNSFVFLATSLY"
FT   gene            complement(87233..88402)
FT                   /pseudo
FT                   /locus_tag="BAA_B0107"
FT                   /note="DNA topoisomerase; this region contains one or more
FT                   premature stops and/or frameshifts; identified by match to
FT                   protein family HMM PF01131; match to protein family HMM
FT                   PF01396"
FT   gene            complement(88457..89257)
FT                   /pseudo
FT                   /gene="topB"
FT                   /locus_tag="BAA_B0108"
FT                   /note="DNA topoisomerase III; this gene contains a
FT                   premature stop which may be the result of a sequencing
FT                   error; identified by match to protein family HMM PF01751"
FT   gene            complement(89634..90668)
FT                   /locus_tag="BAA_B0109"
FT   CDS_pept        complement(89634..90668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0109"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45895"
FT                   /protein_id="ACQ45895.1"
FT                   /translation="MEQQKKNIKRYTEEEIEKAASLDIVDYCMQNDIPVKPDSERYYRL
FT                   TEHDSLIIDRKKNQFYWNSRGVNGNIIKFVQEVEDASFPGAMQRLLDGEQDYEKASEIT
FT                   FVSEPYDYEHFEQKEVSRFDRAREYLIEERKIDPQVVDALHNKGLIKQDKYNNVLFLWK
FT                   DRETGAVMGGSEQGVVKSDKYKRGAWKSIQKNSTANYGFNVLNGEPRNLKFYESDIDLL
FT                   SYATLHKHNLKDTHLISMEGLKPQVIFNYYMKACERIGDVPDSLSLCVDNDKAGKAFVE
FT                   RLIHFRYEKNDGSIVAFKPEYPQAPSEEKKWDWNDECKRVAKQQEQREQGRRAAYLQQR
FT                   GMER"
FT   gene            complement(90748..91299)
FT                   /locus_tag="BAA_B0110"
FT   CDS_pept        complement(90748..91299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0110"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04307"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45891"
FT                   /protein_id="ACQ45891.1"
FT                   /translation="MKYKTHLTTSLAVALPVLASTGNLTVGNVIAVSFGALLPDIDEQH
FT                   SWIGRRTRGVSDLMNTVFGHRGITHSLFGLVLVLIPILFAVGMTPLSFTNGMCILAGYF
FT                   LHLVEDSFSKKGIKWLLPLSNRNFQSGFHVFYYSYNGIAEKMILMISTIVVVYELYSYG
FT                   MASFQFGASGILESFKALFS"
FT   gene            complement(91321..92307)
FT                   /locus_tag="BAA_B0111"
FT   CDS_pept        complement(91321..92307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0111"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45853"
FT                   /protein_id="ACQ45853.1"
FT                   /translation="MMDNHEVVTAIQQKTALEIEEKLGVDLDKHWENYEIQLSEDNRVI
FT                   EEIHPDMRLSLGELLSVVNRCGTEKEMENFNQIADYLEPYYEAELIQEEFYDMPIAKLT
FT                   TDRQQNVKVECLSEYVSNSDIAFDFNDSIFNAVNHISHSITKSHNEIMNGDVEYQGLYP
FT                   INEDMVIYCESTGKPLQQDEAAYHFEGYGYVVAEEVSPEELEGKDAYYTTIGYEDVEEK
FT                   RLAPIRYIEEKKIEDGELRFNPVEEIVNDHKTEAEEVFQMESAKTVSSVMKGHGAIVVQ
FT                   ESKTTPEVARRYVGKDTVHEEEQQQISQTREQARRHYMMKQMLGRDY"
FT   gene            complement(92371..94146)
FT                   /locus_tag="BAA_B0112"
FT   CDS_pept        complement(92371..94146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0112"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45862"
FT                   /protein_id="ACQ45862.1"
FT                   /translation="MRMTYTKKKYTPKTKEQIKEETKEIMDKVLTDITKYYNSPEDMLE
FT                   LANFMAQFSNYSPRNMQLIKSQFPHAYACASFKTFKDAGFHVNKGEKAMKVFHPYVKEF
FT                   VRDPKTKLPIPLTKLTAEQKQQVKNGELKVEKQTNYYLKATAFDISQTNASPEDLPKIF
FT                   PNRQFNFEVTEENKELLKLGIQALAEKENIKIKDMGQGALIKELGTIHGAYVEVADSSF
FT                   AQIVMNTRNTETKELSVAIHELAHAKLHNKKVASLEHVPTEEFEAELTSYIVCKHYGMD
FT                   TSEASVPYIAEWTKNGQDIEEKDKSIMRVHETASSFINTIDKKISELQREREKNREQNK
FT                   KEIEDVYVVRYGALTSTEEKIITVRELRERADRDKSYSDVENANTLNDKEYIEAFNKAN
FT                   EENCIALEHNEIKKLMVVIQWSEADLEKNKAIPFGEANAIMSKRIAEIDAESKRAEEKG
FT                   EYVPYEKTRYHLILPKEMDKDFNRMEVVTMDRLDLGDGIYKSPYEQILNEKRQLSDEVK
FT                   QALQQEINEYEQTKGQSNPEKLRAVNTTEISEIQQGKVDRFLSNKTEKDEDAAAIKQQE
FT                   ARRMARMAYMQRMER"
FT   gene            complement(94137..94346)
FT                   /locus_tag="BAA_B0113"
FT   CDS_pept        complement(94137..94346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0113"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45901"
FT                   /protein_id="ACQ45901.1"
FT                   /translation="MSQNNFYMVEHVDQVKNEVHLSKYLFNKQVIVKVSEKEAAAYAEF
FT                   MNGAVEHDSIPFVKYDEERGLICE"
FT   gene            complement(94369..94797)
FT                   /locus_tag="BAA_B0114"
FT   CDS_pept        complement(94369..94797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_B0114"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_B0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45906"
FT                   /protein_id="ACQ45906.1"
FT                   /translation="MEKKVYYSIVSSTRFSRNEENRTIIEDNIKKGENHFLIRNDDYGE
FT                   CFEVDFEKNITEEENENWILEAVIDFAKKYRITEFELWKKHEGDSTYDKGFGIVIEGSM
FT                   DNPILKFKEVYSGSLDDWNITWGKGKQTYEKIYFKLAL"
XX
SQ   Sequence 94830 BP; 29846 A; 17847 C; 13488 G; 33649 T; 0 other;
     ttcctttaga ttaataatcc atttcttgtt gtcgtgcaat tcgttcttgt actcgttcat        60
     attcttgttc tgctcgccat ttcgttaaat catcgttcaa cgctgcttct atatttcgta       120
     catccttctt tcgaattaat ggcggtttgt atggagaata tgtagagtat tctcttcttt       180
     tttccgaccg ctccctttca tatttctttt taatctgttc atttttttgc tgaaactgat       240
     acaacggatt gtcctcatat ggtttctttt tcttcaattc ttttagtaag gaattaccca       300
     tacgcttctg catatctttc atttgattct ttgcgtaatc cttatcttcc ctttccgatt       360
     caccatacaa acctttttga aagttagatt ctttttctac agcttcttgg tattccttaa       420
     aaatcggatt gtctttcatt aacaatcctg tcagttcatc aatcttattt cttgtttcat       480
     tgggcattct tttgctgcca tatgtccaat cttttttgtt actaggtaac ccgttgtata       540
     tctcttgtaa taaagtaacc tccctatttg gttgcttttc tttggattgt aaatattcct       600
     ttttaacttc ttgcactaag ttatttctta gatttgatat tcgactcaac tcacttgtac       660
     gatctacgag ggaattcgca aaagtagttt tcatatgatc taatgtactt tgttttcgtt       720
     ttcctttcgg ttcataaaaa gtttcctcat ccaccttaac ttcgactaac tttcttcgat       780
     tctctttttc taccgttcca aaatgaatgt gaatatgttc tgtatttcga tgaatagatg       840
     caaaccaaaa gccgttattc tcttcaattt gttcatcttt gaatagttgt tccatcatct       900
     tatgacttgc atttcgaatc cgattttcat ctaatatatc cgttacaggg tcatataatt       960
     tttgttcaat taaaaaatct gtatcaaatg agataacatc ttgataataa accgagcctt      1020
     tattttgtgc ttttcccacc agctctttta tttcatttaa atcagtggag gtaatgacat      1080
     ttttatcttt cgagaaaaca cccgacaaaa tttcttctgc ttttatccct tccttcttgc      1140
     cctctttcat ttcttcagga gacaaatctt ctatatgttt attgagcaat gacacctctt      1200
     cttcttccgt ttttgtcatt ttctttttgc tttctagcgc atattttctc cccatataac      1260
     taacatactt ttcgaaatca gtcgtagtat taaaactgtt tggagaagtt aagagcacct      1320
     ttgcttctgc ttctttttca gatacactca ctttcttttg gttagaatgt ggacttcctc      1380
     tctccatatc aaaagagtca attgcgtttt gcaatcgact cagttcggtt aattctgtat      1440
     ttgttaatgt atgtccatct ttcaaaagtg ctttttgtct catgcaataa tctacatacg      1500
     tagtaaaact ctttttgttt ggaatggtat attgagatgt taatatgata cttggtgatt      1560
     tccccatacc ttattctcct tcaagttatt ctaattcttt ccgtctatgt tcgggaattt      1620
     gttcccactc tatttcttga tagcctgttc ctaatctcgt aggaactact tgatgcggct      1680
     tacctttctt cataacaatt tgcacatcat ccgtaatcat cggtaacggt ttttttacaa      1740
     aagaagttgt tttaacttcc ctctgtatgc gctgatgttc ttgcacgttt tcttctattg      1800
     gttcacgttt aacagttcga gggaacttcc cttctgattt ctttgtaaca gaagaagcaa      1860
     tttcactttt aacttcctgc tccaattttt ctaaacttaa attgcttcct gattgtgcga      1920
     taagttccat gtttaactta attaatacgt ccatttgttg tttcattgta ttaacggatt      1980
     gctttaaatc tttcacttct tttttcaaaa gcgatacatc atcctgacct tttccttctc      2040
     tcattttttc atctaatagt acaatggcat gtcgcaacac gtctgcttct ctcggatact      2100
     ccggatactg tctttgaaaa tcttgtacga tatcaacatg tatttgattc cctctaaatt      2160
     gaaataactt tacatacgtc atttataaca cctctactct tcgtttaact ttatcattgc      2220
     agccacaagt tcatgtgtag catctatata ctcttgtaat ttatcgctct gtctatctaa      2280
     tgttatagaa acatttgaaa ctgcttcatc aaatttatct tctttatttc tgctatattc      2340
     ttggttaaaa tgctgttcga acatcatatt aatgtactcc caacgatagt aacgtctgcc      2400
     taacttcttt ccaatttcct tgcatctttt atctatttct ttcaaatgat acggatcgac      2460
     attccgaaca tgaatttcca tatacccacc tactttattt tttctttatc aactaactac      2520
     tcataatttc taactgtaca gatcgtttat atctccctct aactcgatat aaacttaatt      2580
     aaaaaccagg gagaaaaaag agcataagga aacctaatcc cactttgagt tcaaagtggc      2640
     gagataggct gtgcctatca ggtttctaaa gcttcttaac tgggacgcgt tttttcagat      2700
     tgtatgtgct ttgtatgcgt tttttagcac ttcgtatgcg ttttgtatgt gcctgtatgc      2760
     gctttgtatg cgtctaaaat gcaccttttt atatcgtttt tttcttttca tccaacaatt      2820
     gaatcttctt ttctttcatt ttgatgtctt cttttaacac atcaatttcc ttttggtgat      2880
     tattaatagt agactcattt gaattgattg tgttttttgt tttcactttt tcgccctctg      2940
     tttggtactc catttccttt gttaattgtt catttttgat ttttaattgc ttcatagctg      3000
     aagatttatc ctccattttc ttctctattt cttttctcaa tgcctgttgc gaaaatgcaa      3060
     gatattctct ttcatagaaa tctttcgatt tcttttttag ctctctgtta atcagttttt      3120
     cattttctaa cacgtacatt ttcatgctac gttcctttag atcatcaaca tcattttgta      3180
     attcagggtg aatatattca ggcttcacaa ctgaagatac aacaccaaat tcttcaggaa      3240
     cattttcact aatcaccaca atgtagttat cacttgctcg ataaactttc gtttttacgt      3300
     tgttatcctt ttgtttaatg tacttattct ctactttgta tttcatgtta cttagaattt      3360
     gcgagtcgtt atctgccctt aactcataat caattcgtaa cgtttgattg tcgggattgt      3420
     attctttttt cgcaactgca atcttcaccg tggaggacaa actttgatac tcacctattt      3480
     tcatttcttc aaatttgtat gtcgctccac taaaaacagg ggaaatacaa agtacaaaaa      3540
     acattgtgac gaaacttcct aaggtaaata aatatgcttt tcttttcgta tttgcaggct      3600
     ttctgccttc tttgttcatc caaaatttaa tactcatttc attctttctc ctttcacatt      3660
     tactacactc acttgtgcgt gaatgttttc cagtttacag tttgtatact tttctttccc      3720
     gttaacactt ggctgatatt ctcgtacaat gagccattcc actttttctc caaagttata      3780
     atcaaaccat gtaatcggta tttcaatgaa cttatctttt cgaaccccct tctttttccg      3840
     aagacttaaa attaaatact tcccttcttt tgcataatca tgattgggtt ttagttcact      3900
     caaaagcatg atgtaactcc ttcctattag atttatttgt taaacaaaaa gccccttact      3960
     ttttaataag ggactttact attgcttcat tttctattca tcgtttcact ggatacggat      4020
     tatactctac cactttaatt tcttctcctt gcttttctaa tgttattttt acaacactgt      4080
     taatcgttgt ttgtttattt tctaacccct caattgtgta ctctatatca agtaaagccg      4140
     tacatttctt agaaacatca ccttctgaat taatgtatat tgccgcctta tttacatgtg      4200
     atttgaaatt tggatcgcct aaatcgtctg tattaggtgc tactatatct actacctttt      4260
     tgtctgttat ttttaacaag ttgtttcgtc tttcaccttt attttgcacc gagtaatcta      4320
     gataagcatg tacaaattga ttcgcaactt ctctatattt gttctgtaaa tctaatgttg      4380
     aattaccttc ttttttattt tcgcccgctc ccccctcatt tatcttttta tctttctgct      4440
     ccaactttac ttttaaatct ccaatttgtt tctctttttc cgatacagtc acacgatatt      4500
     ttttatcttt cttatcaaac tctttcgttg tgttatatgc ccatattccg ttaaacgaca      4560
     gtgataaaac caatgctcca cttaaaatct ttgatagatt attcatttat tttgcactcc      4620
     atttcttttt ttcatcttgg tactcttcga attcctgcat agtgttgttg ccagtatgat      4680
     gaggtaaatt gatggtatcc aacaccgcta ccattagagt catacattgt atttgcatca      4740
     atatagatac ccacatgact gacatgattc ggaccaccat atgtccctct aaagaaaact      4800
     aaatcgcctg gttgtgcatc cttcggatca acttctacag taaagtcata ttgcgttgct      4860
     gccgatattg ggattgtaat acctgccgtt ttatacgccc aatacgttaa accgctgcaa      4920
     tcaaatcctt gcgaagaact ctttccaccc cacacataag gattaccgtt gtacttcaaa      4980
     acttcatcca tcatgacctt aaatgtttct gaaccgcccg gaatttgccc tgaagttcca      5040
     cctgctccat caaaacttaa atactgcttc accatttctg cataaaaaaa gttaccgcca      5100
     ttgatatagc gataaccacc attgtaagca actgcaacag gttgactgta tccaattgtt      5160
     gttccgtttc tattaccgcc agcaggtgca acaaccgtta aagagtaata atccgcagtt      5220
     tgtatagaat gggttttatt atttgctgct aaccaatgca cataattacg accaaagtta      5280
     tatgtttgta caatggctaa taaatcatta attcctagca tttttgcatc atcaaaagca      5340
     ccctttaaat gcatcacacc ataataaata gaatctttcg ggttagaaat tgtattcatc      5400
     gcccaacctt gtgattcgga tgattgcata atatcgggta gcttttcaga aataccatta      5460
     ctctctacca taatgattgc tagcacatag ggaacgagtt ctggtacacc ttgcgctgca      5520
     cattcctgtt ccaccatcgc ttgccacctc atgacttcag gcggtaagtt cttcactgtt      5580
     gcagtcccac ttataccgcc attcggtgta cccgtagaac tttgcccgcc aaaaatagcc      5640
     atgcttacaa ttaagagaag ggtaatggct gccgcaatta ccactcctgt agaaccacct      5700
     aacaagcgaa caatccattt tattcttttt actttcttat acttatctat ggctgtttct      5760
     tgtgtagctg ccatcttact gaccaccttt aaagcgttct aattgtttct cgtcaggatc      5820
     aaacatcacg ttatatgttt cagtagaact tacctgtaca attgcttccc cgcgtttcaa      5880
     ctcaggtaag atacgaaact ctgactctgt taaactttca cctagaacac tttttaaagt      5940
     ctctaacacg gagttatcca tgttcaagaa tattttatat tgagttaatt caaagatcgc      6000
     tttcatcgta gacacatcaa ctgtacttcc cggcggtggt aacatttctt gtggtgattg      6060
     tgttgcaaaa aatatacccg caaagaattt tcgcatttca cgttcgaact ctaggacata      6120
     acggttagca aattcatttt gtgaattaat aacgttatga cactcatcaa ggaaaaccat      6180
     gaaatactta acgtcttcta ttgataagtt tttctcttct cgtaagtact tcatttgacg      6240
     accatttttt aaagcatgac tccaaatcaa agttaaggca gtaaacaact gacagttaaa      6300
     aactgattta tcatattttg aaatgccatc aatatcaaag aaaacaatct gttcattttc      6360
     aaagttttta agtgttgtat gaccgttaaa catatcaccg tacaccgtaa tcatgtcctc      6420
     tacctgcaat tttattgctt ctaaatcacg gtgacgttgt ggcgttgccc ctgcttctag      6480
     ttttaaatta ctaagatatt tatagaaatc ttctagaatt ggatagtgat taggagggta      6540
     tcccgttact ttatacgggc gatcacttcc cttttgaggt acaagccccc actcaatata      6600
     gaaagcatat aggtgtttac gaaactcttg tatcaccgta tcatcaaact ctgtattcaa      6660
     gaatcgaatc atatttgtga cttttgaaat gtgttgaata aatgaacctt tctcatcaac      6720
     tgcacctgta ttggtgattt tcgttgcgaa tacttctaaa ggattaatca ttcctgtttc      6780
     tacttcttcc gaatcttgca ccccgcttaa atctataatt ttaccgcctt gctgctgtac      6840
     aactgtgtaa taatctcttg ctttatcaaa cccacgaatg aagcaatcct ttgcaaccag      6900
     accctcttcg agctgtttaa gtaatgtcga tttaccagcg cccatcttac caaaaataaa      6960
     accactaaat gatgttcgag tacctgtaga gaagaacggg tctaaaataa atgctccacc      7020
     tgttgaggtt tgtcctaagt aaattcctct tggatctttt aaatcttgat gatgaaaagg      7080
     aataccgaaa ccaatatttt ttgaaggtaa tggatatcca cttttcactc ccaagtattc      7140
     tatttgatcg tcatagcttg caaacaatgt ttgccactct tctttttgtt taaatacata      7200
     tacttgcgct ttatagttct gccccgcaat ttctttctta atatctccaa ttcgcttctc      7260
     taattgttct aatactggat cataaatata gattcttagc ttcacgagtt ttacaatttc      7320
     gccttgctgc gtaatcgaac gagcgaagtc agttaaattt tgcaattccc aatgagcatc      7380
     atcacgatcc gtagaacgac gttctgatgt catacggtct tttaattccg tgatggaacg      7440
     gttaatatct tttaccacct cttctttatt tgcagtcgct acgtctacac ttgaaatcgt      7500
     atctttattg ttcataagtg ccgttagcca tagcggagga atatcttcag ctaaagagta      7560
     cacatgtaaa catgcgacat agcagtcacc ttgcgctatg tacttctcat taaatttaat      7620
     gccaccttgc ggctgcaccc tcgaaataaa atctaaatca tatccttcag tacgatattt      7680
     ttgttgttct ttttttccta acttcaccat tgttcgtttc ctccttttac atttctgaat      7740
     tcatgttttg caacttaaag atcagcttct caacttcttt tgctttcata ttctgcaagt      7800
     taaattgtcg tccaccatag cgcttcatat ccttcacgtt tttaattagc tctgtttcgt      7860
     ttttcccata tacaacaatg aagaacgcca attcctttaa attcttttcc acccacagca      7920
     cccgatttaa attttcaatc gctaaactat agcgctgata ccataagtgt tcttccttct      7980
     tttcagacac ttcttgactc attctgcctt gaaatcgtag cgccatgcgc ttccagtaca      8040
     cctgttgttc tgttgtttct gtagagtacg taagagacaa aatcttgaac ggctcatgat      8100
     atacacgaca taaacttgtt aattgattca taaatcgttt taaatcatct tggttcatag      8160
     aaagtaagtc tgtagttttc acttttaaat acacctgcaa attatttcta tgatcgacta      8220
     agattcctgt tttttgttcc agtcgtttat acggagcaat atcaacaatt gatgcatccg      8280
     tatttttaaa agaagcaaag atcgttgaaa taaaactttg ttttccatta cttttctctg      8340
     actcaatttg tctctttcgg tttacctttt tagcttcagc tgtcgcaact ttcatcttca      8400
     tctttccttt cgtgagatat aaaaaggaga gcgctatatc tgcactctcc tttcattcct      8460
     atttcctttt tgtttcgctg ctgatggtat ttacttcgat tggatgataa tttttattgt      8520
     ccatcttcaa catatccaaa atcacaaata tatttctgtt tgtagggctg ttatgtggtt      8580
     taatacatag gaacaatcca aacgtcccaa acagcacata aaacataatc cttccaaacc      8640
     caccaactgg aactaccttc ggcatataac ttgctagaac taacattaga gctataatcg      8700
     ctccatctat gatatagaaa aaggctaact taatttcttg ttttgtattt ttaggattac      8760
     gcatcatttc cataattaat catgctcctt cttatctttc tgttccttgc ccttccaaaa      8820
     atctctgtct agatattcag cgtttgttac cgttacccac acaggctctt ttttctttct      8880
     tcttttaaaa atcgtaaaaa tctgtttaaa aaaagttgcg attatgctta acacaatcgc      8940
     aactcctaac atcaagatag caaatatcca gttattcatt ttaatatccc tgctgcttct      9000
     tctctatttt tcttgctaac ttattgttcg agtacagatg gagagaaaga taagttagaa      9060
     aggcaaaagt aacaatgtaa tgatataagt gacctaactc aaaacttatt tgaaaaacca      9120
     gtatagcaaa ggcaataatg aatcctgcta ccgtcattag gatactagct cgtaattctt      9180
     gttgcttcat ttcaaagtaa attcttcttc gattcgcaat atcaattact ttcatgatta      9240
     cccctcctaa tcttatcttc tacgcaattg atctgtccga ttttgtgtac ttcctcttgg      9300
     tcttaatctt gattttctaa cttctttcac attatcttga acatttacat ctctttgtac      9360
     tgtagttgtc cctaccctta catccgcagt tacttcacta ctacctcgaa cgttattttg      9420
     aacatttaca tcacgctgta ctgtcgttgc tcctgctctt acagtatgat ttactgcttc      9480
     acttcctctt acattgttct gcacatttac atcacgctgc actgttgttg aacctgctct      9540
     tacactactt tctactgctt cgcttcctct tacattgttt tgcacattta cgtcacgctg      9600
     tactgttgtt gaacccgctc ttacagcact ttctaccgct tcacttcccc ttacattgtt      9660
     ttgtacattt acatcacgct gcactgttgt tgaacctgct cttacattac tttctaccgc      9720
     ttcacttccc cttacattgt tttgcacatt tacatcacgc tgtactgttg ttgaacctgc      9780
     tcttacattg ctatctaccg cttcgcttcc tcttatatta ttttgtacat ttacgtctct      9840
     ctgtatcgtt gctacccctg cttttgcatc actattgatt gttcctgtcc cacctgtact      9900
     tcttaatgta tctagaacgt tcacttcacg ctgtactgtt tgtgaccctg atttcatatt      9960
     tccttgcgat gcttcagtac ctcccgtatt tcttaattta ttttgtattt caatttctct     10020
     ttccgctgtt tgtctttcgc cttttacatt gccttgctgc ccttcagtac ttcctgtatt     10080
     tcttagtttg ttttgtaatt cgatttctcg ctctgctgtt tgtctttcgc ttttcacatt     10140
     accctgtttc ccttcttctt ttcctgtatt tcttagtttg ttttgtaatt caatttctcg     10200
     ttctgctgtt tgtctttcgc cttttatatt gccctgctgc ctttcattag aaatagaagc     10260
     tacattcgga cgattagcta ttttagggct agcagatggc tctataccag catttgcgtt     10320
     attttgaata cctttaccta ttgtatttaa cgtttgacga tcagcgtttt cttgcgcctt     10380
     ctgtttacct tcagcttgac cgcccttaaa ttctgataca gttcctttca cactgtctga     10440
     tacacctttt gcaacgcctg atactttttc ttttccttta tcaactgcgc cgccaacagt     10500
     ctcagccacc ttgtttcccg catcgttcat catgccgcca actccacgat tcgcagcgta     10560
     actcatggca gcacccgtat ttctagcaaa tttcttcgcc tgcataccgc cgcctttggc     10620
     agtattcttt tgttcgcctt gtgattccgc actctcatga ttcgaatcca tttcagagcg     10680
     tttaggcgtg tcttcacgtg tttgtccact tccaccactc attaagttct tcgcaccgct     10740
     aaacatacga ccagcgccct ttatagctcc tttcgctgcc atagctccgc caaccatacc     10800
     cgttaagtga ttctttcctt cttttaatcc aacatcaaca ccaaaatatt ttaagataga     10860
     ttctgaacca ttaattaatg ctactgttaa acaaaccatt gctacgatat ataaaaatgc     10920
     attgatgtct ttttctgcta aataattaac gataatcgtg tagactcgta aatttaaacc     10980
     cgtaaaagca aatactaaaa atcctttaaa gatatcctgt ataaccattt ttgttttttc     11040
     gcccgtttca atatccgtaa cgaacacaat tggagcaata attttcttca tggcaatttc     11100
     aaagatcgtc ataacaaata caaaaacagt aaataaatag gcaactccta gagctaataa     11160
     cccccaaaat atagtaccga agttcattgg gtatcgaaca tagccccctg ggaacttatc     11220
     tttaaatgga ttaaacacac tatcatttat tttttctacc gtttctttgt ccccatcgtt     11280
     cgtaatttta taaaccaaat attcggtttc tttaggtata tctttttgcg atgtcaacat     11340
     ttctataact ttaggtgtta ctacatcacc tagttgtgct ttcaagaaaa tatccttact     11400
     cattccgttt ttcggtttac tgtctgtaga cgaaattgct ggttcattct cttttttact     11460
     ttgtattggt tcaaatcctg ttttacttaa ataaattaaa tcagctgtat tctgtttgac     11520
     taaatcccaa gctaaaccat cttttgcttt actagtattt gtcgtttcag aaaagaagtc     11580
     tgtggacatc ttctgcatat ctgccatcaa ctcatttaat ccacctagca agccaatcat     11640
     tacaaggata ttaacaccaa cggatttaaa acgtggtggt ttatgttgaa tgattgttct     11700
     aattcctagc catacaatga ccaatacgaa taaagcgtaa aataaaccct ttatgataga     11760
     tgaagcaaag tcatttaatc cggcatcctt caaaatatca aaaaaggaga aggtatcagg     11820
     tattaaacct tctaacgctg atactatata aagtaatgtc tttattatcc ctccctgaat     11880
     tgattgccaa atagacccta aaaaatcagc atattgtatc cattcatttt gtaaaaaggc     11940
     tacaaccttt tcggtatcta catctttaag tccaagaaat tcataccagt caaaagcata     12000
     tgcaattggt gtaaatgtga aacttacaaa tagtgttata accgctaaaa tccctataac     12060
     taaagctttc ttactttgaa aaaaccattc ttttattttc atagtagcca ttacttttct     12120
     acctttccgc ctaatttcaa atcaattttt ttcaacatat ccaataattt ttctagatgc     12180
     ctcttcattt cattatctga agaatgttct attaaaaatt ccacttcttc tgtcttagga     12240
     aagatggtat ccgttgcgta atctaataac atttgtacaa gtcgtttttg aatatcctct     12300
     gaattgtttc tatttctttt ctctttcaca agaccaataa gtgctttaat aatttcatta     12360
     atatcaattg gctctgtttt tactaccgga ttagactgct gctttttgat atactctttt     12420
     tttgcaactg gatttacgat aaaatccaag aaattcaaat ataagtctgt taaatctaat     12480
     cctgtatgca gcgatggtat atcaatctca tttaaatctt tggatgtatc aaaatcctta     12540
     cctaagaatt gccaacgata aggcatgctt gtttctcttg tatttaaaat cggatatgct     12600
     ctgactttct ttctttttaa atcctgtcta tgtaatgcac gaagcaataa tgtttcccct     12660
     tcaataaatt gcgccaagcg ttcaggagaa ataatgcgct gctgatctgc attctttgtt     12720
     atcttgttat ctgtttctaa gtgactttca ttagaagatt taccaatgac cgttttatgt     12780
     cccgctcgat gtgatatttc ttcaattgtg tctttattgg tagacataat ataaatatga     12840
     ttttggcagt tatctttaat ttctgtcgct tctttgtcat acagtttttc aatttgcgaa     12900
     taggactgaa gcaccaaatt aaacaacata ttacgacctg cgcagaccgt taataccccc     12960
     catatcatca ataggtggca tattaccaaa ctcgtctagc aagaaatgaa cacgcctgta     13020
     acactttttc cccttcgtat cattacaatt catagataac tctgtataca gctgcttaac     13080
     aaaaatactt gctagtgcgt gattagattt atcaaaatcg gggacaatca taaacacggc     13140
     tgtaggctta tccgaatacg ataactttgc ttttggttgt aaaggaaaag tattagcctt     13200
     caaagtgagc gtaacttgac gttgatactc aggtttatgt tcacatcccg ctttcttttg     13260
     atagacaact cttccttttt catctagcag tttttcaaac tgtaagctat acaataatct     13320
     gtacttcttg tttggattct cttcatcttg ataacgaatt aataataaat ccccatcctc     13380
     taaggattca tcaaagttta tgttgcacat acctagagct ttcaccttaa tttgatagct     13440
     tccaacctcc gttttttctt gattattctt atgaaatgat actgttaccc gtttatttaa     13500
     gaatcgttca tccaattgga aaaataggtt tttaggaaaa ccgacctgtt ttaaatccaa     13560
     acttgatttt gatgtcattt tcgcaaacat tttatccgca aaagtttgta atccctgatt     13620
     ggctgttgct agaatagacc ccttcgcttt ttcacccgca aagctagttg atccatactg     13680
     catttttgct acatttcctt gtggtaagct cttaaagtat tcatctaata cgcttttttc     13740
     aataaaatca ttgggatctt ctttgtaata gaacgttcct aattcattta gcatttgaga     13800
     tacattgtgc atagtaactt tctcgataca gttattcttc acacaatagt ccacgatagc     13860
     gagaataata ccgttaatcg cattttgtgc tgaagtatta aagaatgcat tatcaccagc     13920
     attcgggttg ttataaagag agaaagttaa tgtatttgct cgtttagccg cttcttggtc     13980
     atcgccattc acccatgcat caatgactaa ctgcaaaggg ttatacgaca ttccttgtaa     14040
     ggggtctaag atatttaaaa cttgaacatc ataccctcgt ttttctaatg tctctttaga     14100
     tgcactgtat agctctccct ttggatcgtt tacaaccata cttgattgat tttttgctct     14160
     actcaaatta tcaatcattg gtacgacaat cgtttcccct ttacctgaac gagaaacccc     14220
     tagtattgct gtatttacgg tgtctgtatc aacataatat ttgtccttat aatgtgatac     14280
     agggacacca ccataccctt caaacgtgtc tgtcttttcg ggaatttctc tatactgttc     14340
     ttgaatttct tcaattgtag taaaacggct atcccccttt tgaccataag ctacattttc     14400
     gtcacttcga taattaacct ttgaatacac caaaaaaccc atcaccgtag aagctaataa     14460
     gccaaacaag tacatatttg cgggcagaac aggaagaaat acatttttta ttgatatgct     14520
     tttctcccaa tctgcgctga acacatcgaa tatagttggc ttctcaaccg ttttcgctaa     14580
     ttcattcaca atggattggt acgttcctgc tacaaaattt aatccaccta aaggaaaaag     14640
     caccgcaagt gaagaaattg cgagtgcttt tttgtttatc ttattctttt cttgtggcag     14700
     gtcttcccca tcaattttgt aattatgatg aaggtactta ttccgcttga attttaataa     14760
     tgccatgttc gcatttcctc cttactaata cctattcagc atctattaat ctagctaaaa     14820
     atgttctccg ttttttttag atacagttgt ttgttgtggt gcaggttctt gcggctgcat     14880
     tgtaggttgt tgatacatcg gttgctgata tactggctgt tggtacattg gctgtggtgg     14940
     ttgttgacct agcccagcat gatatgactt ttgtaattta tctgttaaat cttcaattat     15000
     attttgaagt tcacgaatcc tttctttatc tttcttttct gctccctctt ggtttctcat     15060
     ttgtagatgt aaagcttgtt tttctagttc taatttctct ctttccattt cctgtcgttg     15120
     cttctcttgt tcactaatac gttctgcttg aatttcttct ttccattctg gtgttaactg     15180
     ttgaatttca ttctctaaaa tggttaattc catttcttgt tgctcattga cagtgttcat     15240
     aagattttct attctctcta taaaatcaga taaatacccg ttcttttcat cgatcaactc     15300
     ttttttgcct tctactttta attcatacga tttctctgaa gttgtttttc tcttttcagc     15360
     ttcaatctct ttctttaatt cttcctgacg agcatttacc aacgtattct tacgcccttc     15420
     tagttctgat tgatatgccg ttaattcagc ttcttgcttc agtttaaaag cttctaaatc     15480
     taatcgttgt ttttcagtaa aagcaattaa ttttttctgc atttcttcta tttctttttt     15540
     ctcaaactca tttaattgga ctaaccttgt ttgaaagcct tgttcaaaaa tgtcttgtag     15600
     cctttcttcc gcttcttttt gataatcacg catcatgact tctttataaa tcttttcaag     15660
     acccaaacga gtttcatctc ttagattatt tacttcttga taatacttgt cctgaatcag     15720
     caaaaatgct ttaccactca acacattttt tgcatattgt aattttttct tttcaagctc     15780
     tgtatctgct tcctcactca taccaaaccg atttaataag tgcttgatag taaagcgtga     15840
     atcatacctt tcttgctttg tctctgcttc gctaaggttc aaatattctt cataatcagg     15900
     aaaaactaca tcttgggttt gtgcttccat ttcaggctct ttatttgttt tcagattatc     15960
     taaatcacta tgaagcaact cttcttctaa actttgaact gaatcaactt catttgtcgg     16020
     agttggtaat tcttcagctg ttttttctaa gtctattcct gtaggtaatt gatctttttc     16080
     ttcctcttca attgcaaatg gatcttcttc tttttgatct aacgcagcgg catgttcctg     16140
     tagttcctgt atatcatttt gctcaaaatg atttgtcccc ttactattca attcatgcat     16200
     tggcatttct tcaaagagat ttccgtctcc actcgcaaac tcttttttca cttcgttatt     16260
     aacatgtggc agttcctctt ctttttttcc aaacaattta gcgaacaatc cacctttttt     16320
     cttttttggt gattcttcct catgttctat agctgcccca ccttcttcag ctctgtaact     16380
     ttcaaatata ccttgtttaa tttccattcc taagtcaaaa tcagttcctt tttcaaggtc     16440
     ttttgaaata gcattgagta aagaaaattc acttcctact tgtacgggca attcaaattc     16500
     ataagccttt tcattctcaa tatcttgcag taacaataac acttgatctg attgttgatg     16560
     ttgctcaata tatctttgaa tcaacccttc agctaccttt aatcctaatt gctgtccatt     16620
     ccctgcttta ttcttcttta aaaacttcct aaaagtttta gattgttctt tttgcaaaaa     16680
     ctctacaata tacactctct taacctcatt tcatgtatag gatttttttt aaaacaaaag     16740
     agaagcccac aattagtaag ctcctcttcc agtgtgtttc ttagaaacca gctgtaacgc     16800
     cttgaactgt acttgcgaaa gttcctgctc cccataaaag aacgccacca acaacaatgt     16860
     acagtaacca ttttttcgct gttcggctcg gtccttcgcc gaacatgaac atgaaggcaa     16920
     taatacatac acagaaaata ataaccgcta taccaagtcc ttgtaacttt ccagtccaac     16980
     ttgttaaggc agaactcaca gagtcaaaga aatcattgta agttagtaat ttcatcgcaa     17040
     aaatagtaaa tagatccatt ttaaattccc tctttcttaa ttgtgtgttt gattttgtct     17100
     tttttcttct tgtttaacaa ctgaatctgc aataatttcc attgcagcga cttctaacat     17160
     tttgtttcgc cacttaggat tttctccttg taacagggac aggcagttgc tattcacaat     17220
     ctcttgtgac caactttcat atgtctttcc ctctttgttt aaaatcactg ttacagcatc     17280
     ctgatacggt gctttttcca ccttatttct tcttgttgta ctagccatat tttctaactc     17340
     ctttacttaa tacttcgtat ttttgtgaga gataaaatgc tgaaatacat cctcaacttc     17400
     aggaattccg tctgaacaaa tcgttatgat cgctatgagc gcaatcacgc cacccataag     17460
     aatcattaag cgaaacacat tgttttcaag catttcttta acaccttctc tctagcgcac     17520
     ttgtgaagtt gcagaaccat gaaacttcat ttctacgtca ggcaaattaa aaagaataat     17580
     ctttagatta gctacaacct gataatctac tacgtcacca aagtttactt tcttgtttaa     17640
     ttggtcactt ttaacgctta aagctccttg atactgcttt tcgctataat cttttagata     17700
     ggctcccgct tcttttgtta agccaccatg tctctcaatt tgatagttaa cttgttgttt     17760
     atacaagttc acatcgctta attgaataca aaaaagagat actgccacca tcatcatgat     17820
     taacattagc cctacaaacc atttcactat taacataatg gaactatcta gcataattca     17880
     cacctactca ttttctttcc cctcccttat gatctatgag agattaatgg atgataagtg     17940
     atggactagc accgctgctg caaaccctac tactaatatg aaagaactca taacaatttt     18000
     agtagggaag aagttaaatc ttcttagctt aaaagctatg atttcatcta tcgcacgttg     18060
     taattctgca cttgccattt gccctagctc attaattaca tttgtatcac tagagttttg     18120
     ctggaaatcg tatatggttt gcataatatt aatcgacata tcgcttccac tggaacgcat     18180
     agcgtaatcc gtaaaaggct gtatatcatt gggcttatcc gtcatttcag acattaactt     18240
     agctaatgaa ttcttatcta ctggattgtc cattcggttc agtatctttc gaaaaacctg     18300
     atacaagctt gttgattcgc ccgattcttt caaataagga atcagcaacc ttgtaaactt     18360
     agagaagttc aaatgtcttt caaacttaaa agcattatac gttttggtca catgcgtata     18420
     cttagagcga taaaagaaga aaggcaaccc caaagctaac agataacacc aactcgtaaa     18480
     aaacaagcct agtaacaatc cgaaaaaact caataagatt gtttgggtta ttcgtttctt     18540
     ttgaaacttg ttaatcattt gttgggtgtt ccccatttct tctaacatgc tgtataaatc     18600
     ctcttcagca aacattcgat tatagcggtt ctttttaatg cttttagctg ttactactct     18660
     catgctttga cctccatgat tgagtcatca aaaagatatg tagtaaagga tttaaagaag     18720
     aaacacatta atgtcatgta aataccactt gtaatccagc caatcggatg ccttgcgaat     18780
     gccgttatat acgttttaaa gccaaaagaa aaagtaatcg caagtacaaa cactacgatt     18840
     accccacaaa gcattttcat atcttttaga tgcccttctt ttttccgctc ataatcatcc     18900
     tttttttctt tcatttcatt gtgatgcgtt ttaatatctt tcaatgtttc cagattcgtt     18960
     ctcccctcta acacgcatgt ttcaagctgt tctaaatact gatcgaatgt aatatcatca     19020
     cgatatttat tcgacatttg tttaaaagcc tgaagtacct gttcttgatc cgcccccatt     19080
     acgcttgcta ataatatttt taagtccgct ctcaattctc cttgcgagcg atcactcgct     19140
     ctttgtaaag aagttaagag cgtttgacta tcattcgcta acagcgaagt catattatta     19200
     acaaacttat ttctttcccg aaatgaatca cgctcatatg cccttttaat gactttaggc     19260
     atgagcactt ttagcccata taccgaaccc attaatccga aaatcaatga caaccaccat     19320
     atatagagca atagaaaaga aaatacccct gtaactaatc ctggaataat cgcatatcga     19380
     agatagtcct ttctatttaa gggcttccca tatgcaacct tgaaagcatt aatttcttct     19440
     gcattcacaa atttcttttt cttagttttc gcattaaatg tagagatttt catccttcat     19500
     acctcctttc caaagaactc tttccttacc tactaataat taagcccttt ttgaaggcta     19560
     cttcatccgt atacttagga agctcatagc tcaaatcaat ttctgccaat ttgtcatgga     19620
     attcttctga taatgttccc gtagagaatg taaatttgcc gttccggtat ttttgttcaa     19680
     ataccatttg acaaccctca actgaatact ccactatttt tgctaaataa cgaacaactc     19740
     gtttaattgg tttccctgtt gtatcagttg tttttactac tacacgctta atatggaaac     19800
     caaaattaaa gtaacgcatg atatcttctt cgagcgactt ttcatctacc tgatatccga     19860
     ttttggacat attcacgagc cttttcggtg atgtttctgc atcaaccgag tgcagcgaag     19920
     tcactacatg gtgtcctgat agtactgcct gaatcatttc gtatgtttct tttccacgaa     19980
     gctcagaaat cataatccaa cgtggattat ttcgtaaagc agctactatt tcgtccgtta     20040
     cagtaactcc gttcccagtt aaccaactaa atacatcttt gtcaggaaac aaggacttaa     20100
     catgcgtttc agggacatcc tcaatcataa tcgccttatg atcgaatcgc acaaacgaga     20160
     ataaaagttt taaaacttcc gttttccctg ttcctgtttc acccgaaatc aagatgttat     20220
     ttcgactctc cattaccact ttaaaaaagt catatataaa ttgaggggcg aatgtttcaa     20280
     aattcttctc attcagtacc aaattaggac gaacaatcct caatgacatg gtagagttac     20340
     catttgtatt ctgactatgc accgcattaa tacggattga accatacaca ccatcaaaga     20400
     tagggttttt aggagtaaac tctttcccta ctgcatgagc aaacttctga atcaatcgtg     20460
     tgatatattg ttcagtaatt tgatgctcat tgtccttata aatctcttta taatcacttg     20520
     attccacgat taaatgacta ccattatagg atatatccgt aatatcagga cgatctttaa     20580
     ttaatctttc tataacgcct gtcccaacaa gttcagacac aacatattca atcacatcat     20640
     cgactttatc ttcatcaata tccataaaat gaacaggata gtctctcttt atgatgcgtt     20700
     tgatttcttg tcttgcttct tcttttaata gcgcatctat aactaattca gcatgtctat     20760
     ttttcaagtc atttcttatc gtttctaaat tcttaggatt gaaatcataa aaatctttat     20820
     tatgaccatt tccttttttt gcaccaaaca ttttcatatg tttctccttt ctttcacgat     20880
     gatgcaatac ttactttata agtcgcttga tatgtttgat ctccgtcatg gataatggct     20940
     cgaattgcct tagtagagcc attcttatta tctaggtact taaattcata tgttgcaccg     21000
     ctgctgattt tcacaagctt atttgactca atacgtttct taaaatcctt ttcaaagtca     21060
     ctctttacaa taaacagctc gccactttgc acacgagagc tattatctgc atttgagatt     21120
     acactcgctc gaactgtctc tgtaacgcct tgtgtaatcg agtccgtagc gaaattctct     21180
     ctatagtaat aaccacctat ggaaactaag aaaagcccta aaacgattat catgaggatg     21240
     aatggatgtt ctttcagctc cttcactcct tcccaaacaa ataaggagag aaaattctct     21300
     ctccccttgt tggatataat tatttaactg aggaaagttt gtctgtaaat acattgatta     21360
     ctgagtgcgt taagtcagga aaagcaacag aaacaacccc tactaaagca gcacctacaa     21420
     caactgcacc aatcatccac caactacgat ccgtattttg atctaacatg ttacaacatc     21480
     ctctcaattt ttgttttttt atataaaaaa gagacgtaat aagaatcacg tctctttttc     21540
     tacctaatac agcttaattc ctaatttgat agcgcgctct aatgttaggt acttgcttaa     21600
     cataagcatg ttaatcgctc ctaacgtagt aggcatcata tcatttacaa cactatgaat     21660
     tttgtctttt ataaaaactc cccacatatt caagctaaat ccatcaaatt gactcatatc     21720
     aaaactaaag tcgaaatgga acatatcttt tactgagaaa ttccctgaaa gtaaatcccc     21780
     gatgcctgct tgtgtaaaag cggaaaggct gccttgcaac gaatatccaa ttaaacgaat     21840
     tacaatcccc gtaatgacga agtatagcgc catgaaaatg atttgttttt tggctgaact     21900
     gtatgttagg acattcactc tgttctcaac tcctttccta tcgctttaac caagcaacat     21960
     cttcatccga ccagcccgaa ggcttgccat ttgagaaagg atttctcgga tcaacaggct     22020
     ctacaagtat ttcatcatct tttaacgtgt cagagccaat cgttccgtac ataaatgcat     22080
     agacatgtaa tggctgcgtc acttcaaaat tcactttatt agccccaatt ggcaactcag     22140
     attttacaaa aatattgtaa tctcctaaat cagcccatat tggagcgtat aatttacgct     22200
     tcccatcttt taatgcattc ttgatacgag aatctttgtc tttgacctgc tgatccgtaa     22260
     ataaagcacc tgttttctgt tccacattga catgtggtaa ttcaaaagta aaatcattgt     22320
     tcctcttatc tgaactaatg tttttatttg tttcttcaag cggaacatag gtattaccct     22380
     ctttttgctc gtaattcaaa tgtgaatcaa tcaatttctt atcaattaaa gcacctactt     22440
     taatatcata aggaactgct aattcattgt tataactggc ttctgttttt aactcaaaac     22500
     cgtaaccagt tttttgttta ggaagctgtt tcagcggaat agtaagtgtt tcatggaaaa     22560
     cttccatttc ttttccgact tcacgctccg tcataataac gcctttgtat ttcaattccg     22620
     tagattcttt actatttgcc ttaacagttt cttcagaaga agtatagcca tccgtatcta     22680
     ccttattttt accttctgca acaaaaatag attctttatt tatcttttcg aatctgactt     22740
     cataatttct tttacttttt ttctttaaaa acttacgatc cactttgaat tttatctctt     22800
     caggtagctc tccaatcgta tacaccttac tgccaacaag cctattatct gctttatcat     22860
     acaagttaac cgtaatctca tccttgcttg aatcctcata cacaatatct ttatctaacc     22920
     ttacggttac aggaagtcca ctttcagctg gtgcagtatc aatccttatt tttctaagac     22980
     ctatatttgc attcgctaca atggtatacc gtacttgatt cgagataggt gataacttgt     23040
     aatcaacaga cgtattaacc actgtcttac tgacatattg atcgccaaat ccattcttat     23100
     gcgtaccgta aacgaggttc atttttgcaa catcgctgct gcttaatgaa tcatttatat     23160
     acaataaaat agagaccact tttgataagt cctgctctcc tgtatacctg taccaaccat     23220
     ttgactgtaa atcaattttg ttggggttat tcgattcaat aaaactatta tttagccata     23280
     tttcaacatt tttatgattt gggttatcca ttgttaattg ttttaagaat gttacaccat     23340
     gaaaggcaga accgttttca tccttatttc tagggacatg cgttaatgct tttacatgtg     23400
     cttcatcttt cacagttgta tatggctgca ccccaatttc ataatcacta ttttttttac     23460
     ctgtaacttt tttatggttt cactcacacc aaccataccg atttttacaa tagaaatatt     23520
     cttagagctt gttcgaaact tctctaatct agtatccata gaactactta atacattttg     23580
     aatctctagt cctacttgat ttccttgcgg aagcaacaca ggattaatac gagtctcaaa     23640
     atttattttt ttaagtactt tgttactacg agttaaggta tcataccaaa tcaaatgatt     23700
     gcttccatca ctttgctgtt caatctttgg ctcaatgtat tggtcaccat atttcgcagt     23760
     tccaactaca taatcaagtc cttttggtat cttcactctc atttctattt tttcatctag     23820
     gtaagtaaag tccatttcac caggtaattt caccagatta tcaacagtta cattcacatt     23880
     atccgaactg taataagtcg ttttattggt tgtcacctca ctgcttgttt caccgttcat     23940
     aatgcctaac gtttcaaagt taacactact ttttacaggt gattgcaact ttgtcataac     24000
     tccgttttca tcatactccg tatagttgtt ataagccctg ttttcagcaa cacggtaacg     24060
     tgtttttcta tcggcagtag gaaaaatatc agctgctgtt gcaattatgt ttggtgtacc     24120
     tttttcattt acactaccaa cttttctagt ttttactttg aagaaaattc ctctttcaat     24180
     gattgttcca tgactaaaca tatcttggat atcattttta atggctgcga tttctccata     24240
     ttttctagct tcatcatacg tagtgtacca ctcatagtct tcttctttat tttgtgttat     24300
     agcttgaaac gagttatcat ttttccttgc tataccataa tagacctttt gtttatctga     24360
     attgcttata gttgttccaa gcaaggacgt atagccccga ctgattatat cccttgccgc     24420
     tctctctcca gcttcttttg ttaaatagaa tgaatctgta ttccatttat aaacaataat     24480
     cgctccacct tcagtaacag catgaacatt taaatcagca tgcatcttaa catcttgtcc     24540
     aacaatagtt gttgcatcac ctttagaaac agtactatac ccaagattcg gtgtacctag     24600
     ttctttacca tcaggagtaa agaacgcatt ttgaagagag tatgatccat taaccgtgtt     24660
     tctttcggtg attgttgtac tggtacttgt gttataagaa atcacattcc ctttgctgtc     24720
     ctcataagag tcaacaatgc atttcaaatc ataataaaca ttattaggtt tattaatctg     24780
     attgtttttt cctaatgaac ggtattcgtt aggagtatgg atcaaaaatg ctactgttga     24840
     aaatgccttt tggttcttag aaaaagaagg gacatttgtt gtatgagcgt gcatggtcgg     24900
     gaaagttgat ccaataacat aatctttaac acttgcctta taaacaactt tttccttacc     24960
     aacctcaggt ttagagattt ctgttttacc actgtcccac acactattaa tcgtatattt     25020
     ttcaatatca tccgcattcc atttatcttt aggtatatat gaccttgcgg taaatgctac     25080
     atgagggttt acttgcatat agttttcaat ccctaattca aagctttctg tgttttcttg     25140
     cggtattttt tttgcttcag tatcaatgtc accgtaatta aagattttaa taggggtatc     25200
     ttcactttcg aaatctaata ccgtttctgc caacgattta tcatcccaag ttactctccc     25260
     gctaaattca aagtgataat ttatctttcc atttggaaaa gtagctcccc ttaaatcatt     25320
     acgatacggt aaattggcaa tataaaaagt aattgtattt ccaaatacat ttgagcgatt     25380
     actttccgct gcattaggat tatacgcacg atacaatcta aagttcaaag tactataact     25440
     ttgatttata cgagccttca cattaacctt tcctgatgta gtaactggac ttatattttc     25500
     aaatgattgt tctatttgtt catttaaaat atccttacct tccacactca taacctgaat     25560
     tttaatgtta ggctttagtt ttattccatg ttcagcacct tgtacctcca ctgtaacagg     25620
     aatcattaag gagttacctg tttcttttaa cgtgtattcc atatcaaaag aaacaatgcc     25680
     cttctctaaa tcttccttac caccaacagc aaactttgca tttacacgtt tgtttgtaat     25740
     tccattttcc agtgtaccgg tgattttcag cttaatatct ttcagcttat cgtgtttctt     25800
     tgggttaatt gtcaccttca atggatacgt taccgtatca aacgttctta caatgccgtt     25860
     attcgggcta gagtcattgc cagcttcatt acttttgtca aagggttctg taccatctac     25920
     aatgtcagag ggcttaataa acgcttcaaa atcaagtaag tcactaccct ttttcccatt     25980
     tgccacaact acctcattag gagctaaccc caggcttttt atatctgatt tttcttgcag     26040
     cacagttaca tcgtctgttt ttttctcctg atccgttgtg ttttctgcat atccaataga     26100
     gacaaaatca gcaagactcc caagcaaaag gattacagta aatactagga tgaatatctt     26160
     tttaaaattc aataccattc ctccttttcc ttaaaacgaa tgaaaaagga ttggtggact     26220
     tctagttttt ataaacattt gaatcctccc ttgaattttt gaccaaaaca aaaagcctat     26280
     cgaaatgata ggcttcagct taactatttg tttgctcgtt caatcgctcc aagttctgct     26340
     tcacagtcct cttctgtcca atcttttatt aattcccacg gataattggc ttcaactagg     26400
     attctcttaa aagttccctc cttcgtttta ttcatggcag cgggatcagg ttcagctatt     26460
     ttttcttcag tactaacttt cattccttcc tcaattacct tagttaactt tactgttcct     26520
     atatctccat aaggttgcgt actataacct ttatcattca aaatcttcac tacttcttgc     26580
     atatccttcc atgctgccgt accttctcca aatttaatag taattgtatt catccttcat     26640
     tcctcctttt tataaaattc aaatttgaaa ctaattaacg cttttataat aaaacgcctc     26700
     tgataaacct acctaacttg tcatactcca cttcataacc attatcgcaa gatgtacacc     26760
     ctaatttttc tctccaagcg tcttcaagaa tatcgcaaaa atcatatcta tgtttaaatg     26820
     gaactccatt tttggtaatt ttaaactctt catggtacaa cttatcaaac atgtacatta     26880
     agttattacc acaatcacat ttaggaactt ggtacgccat tatgccacct acttctcaac     26940
     aaaattcaaa tttgatagat tttgcaaagt ttgtttgcag taaaaataaa atcaacttaa     27000
     aagaatgtgt ataacaagat tctcaattcc tatccaaact aatgtgatta atgatataaa     27060
     aacaaaccac aaaagggcat ctttcacagt taatttataa tctttcattg ctacaccaat     27120
     ttttctgtaa aactaataat gaaagaaagt aacaaatcaa aaactactaa taataccatc     27180
     atgactatta tcattgcagg gaatatcaaa cgattttgac ctaacatttt acttcctcct     27240
     tattaatttt gaatcattgg caataaaaaa gagcagaacc attaatatga ttctgctctc     27300
     taatttaatt tgttttctta aatatatttt gtttattaac gtttgctact tcttttttca     27360
     agaattcctc tttgtcattt gcacccttga atccctcttg gaattctttc cattgagcac     27420
     tattaggatg tgatgtaccg atcggtgtta atgagaatcc attttctctt ggagacaaaa     27480
     tataatagtg atagtcattt acaacaagta atggatcact accatttatt ttttctttta     27540
     cagagattgc cactactgaa tgcgaatcac ctttatattc tgttgactca accttataat     27600
     tagcttcact attttgacta cctttaactc tccattcatt ttcagcagta atagtaatga     27660
     agttatcttt actatcctta tacgtatcat cttttttata agggactgaa gaacctccac     27720
     accctgccag tactactgtt atagatatga ataaagccga tacagccaat aaaaacttaa     27780
     accttttaca catggtgtct acactccatt tcatttatat tcattacatt aatatattaa     27840
     catatgaaca tttgagaccc cactactttt atagcgctac actaccactt tactgtaaat     27900
     gaacgagcca atgattaccc ctcagcaaag taatattaaa aactttaaag gtatgaatga     27960
     cattcatttt attgcagcag acatctatct tttgtccgag atcgtatttt tcatcaagct     28020
     caaataaatc tacgtgaata ctttttgttc ttaatatctt ctcgacttta tgattcattt     28080
     gcttcccccc atgatacatt ttcatttttt agggaagcta gtatcttttg agtgctatag     28140
     cggtacagct ctgacaatac tacatctgat ttgttcatcg taactaagta ttctgttaat     28200
     cctactaaat ggacaaatct cttattcgca ctaactacta aatttatacc taatgagcgg     28260
     ctgcctatta atatttttac tgcatccatt gttttcttct ctacacgttc aaaggaagct     28320
     agagaaagaa ataatgtctt tccgtcttgc ttatttgacc tcagttgttt acgtgccttt     28380
     ttcaacgctg caaggcaatc agtttcgctt gtataatcgt tgaaatctag atgataaaca     28440
     agtccatgat tatcttgtaa tgcgttaatt agctctattt gaaactctaa gcacacatcg     28500
     ctttcgcctt caattaggca gcctgtcgta tgctttgttt tacttgaaag aatagttgct     28560
     acctttctga catacctttc ttggtattcc atactcataa tttttgactc ctatttgatc     28620
     tgtttaattc tacaagaata ttttatattc ttgatttttc taatttaaac ggtctatatt     28680
     cggtcggata caaatgcaag aaaaggagta tctccatttg taacagaagc gtttagtctc     28740
     gttacgctta ctcgttaaag gcttgcgtgt acaagtgcat cgctctggaa tctctccgtc     28800
     atggcgatat gccttaacac ttattgtgta ttgtacagcc ctttaagtgg tctgtagtcc     28860
     ttgctacaga tagaccaaca tcgattgctg ttttcaagcg gacttattgt ccctaagggt     28920
     ttattcgtgt cttacttctc ctaaattcac gaaatggact ggcatgcgat gatttgccct     28980
     tcccccagca actatatgaa attttcaaag gacaggatgg ggaacataca caagattcat     29040
     ttctttgagc tatgaacccc aagtgtgcta tattcttgca caattaaatc gatcaaatgt     29100
     attactattt tactttttgc tttgcttttc tctcaaaaat aacctgcatt aactttccgc     29160
     atggtttatt cttctttgcg ataacaattc catcgctatt tcttacgctt ttgatatacc     29220
     taaacatatt tgttacagga acttctcttc ttcctgcttg atcgtacaga ttgccattat     29280
     cgagaacaat taaattcttg ccatcaaagg tactaacttt gtgcgctctg tttaatagag     29340
     tgccaatatc catttctttg gttactttca gcctgtgtgt acttttgcta aactcttttt     29400
     ctctcatggt tcttctctcc aatcttataa atttaaattt gtatctagac tttctcacga     29460
     tctaaatacc tgctaacaag tttctaaccc aagcccattc acataaacaa caaatagtaa     29520
     ggcgagcgtt attaaatttt catatagcca atgggtttct tacagaatac aaaaaaggcg     29580
     taaactaatg ttttagtcta cgcctttttc ttcaatccga agaaccactt ttaagaagga     29640
     taaccgcaca aaaccaataa tattgttaaa aatagcgtgt aagtataccc ttgcatacct     29700
     tgtataaata cacgaaacag tataatatta ttgatgttgc atcacgttat gcttcatcaa     29760
     gtgggcagcc tttctaaaac agttggtgtg ttttaaaagg tcgaaaatat caagagttac     29820
     cagctctttt tattttcagc ccatgtaact atgtaattgt tagtagttca caatttagat     29880
     gctaataaac atctgtcaaa attaagatta caacgattgt catttatcgt caatccataa     29940
     tttctcaaaa actgctatat ctaaccaaac tacatatcaa aagtcttcgg aaaacccagt     30000
     gttatcaacg gattagatga ctgggatttt tttgactttt ttaaaattac aaattgtgga     30060
     aacatgtaga acatttgttc taattttagt acttattttt tgttttgtaa atataaaatc     30120
     gtgataaaca acaataaaga tatagttctg cattcagaat attaatttgt gaatttttca     30180
     catatgtttc tcttatatcg aatttgatat ttgggaaatt tcccgtaaaa cagcgaatgc     30240
     gattgcctct attgagacaa tcgcattcgt attatttata gattaaccca tgccaccgcc     30300
     gggtccaacc attttagcaa ctaatttttc tgaatctttt ttcactatat tgtttgattg     30360
     atctttatta ctagcagtag caaacataat tcctgctact aaagctatac ttgttactac     30420
     aaatataatt ttttcatttt gcaccaccct cacacattgt accattttta gataaattca     30480
     ccaacatttt tttagggaac ttgcaataga atctattacc ttcacactcg aataattcaa     30540
     tggacttctc taataaagtt atatcattcg ttgctagccc caaatagcaa tactctattg     30600
     gctttaatga gccattctca ttcttaatat tatttaaaat aatttctgct ttcttgtaat     30660
     tgcctttaac aatttcaaaa aaagattctt cagcaggatg atatatgctt atactatcta     30720
     acccttgtct atttactaat ttaataaaag cataagtgtt taagacattt tcttttcttc     30780
     tgtttgctct ctcagactga catagttcaa gcgtttctag tgacttattt atataccaag     30840
     atgctctttc gtagctttca aaagtatatg attctgcaag atataccaat gctgaagctc     30900
     ttaaaagcga gaaacaattt ttatcatctt tgaaattcag tatttcatga caaatctccc     30960
     tagacttatc aatgttatcc tgcattaaat aagcgtagga tagcccctct ttaattcttc     31020
     cgctataggc tgttcgaaca aattcgtctg taattagttc aatattaggc tgcattactt     31080
     ccgcataatc aaaaagcgaa ttaaattttt ctaaatcata catcgtatag aaagttaata     31140
     tcccatacaa gaccttaatt tcttccgtct taataatttt gcgctttttc ctttcttcaa     31200
     gttcatctaa taatgctttt ccttgaagaa tgccacaact acgcatccaa actagctcat     31260
     atgcgtaagc ccattctcta ttcattgcca aaggagaatt ttttctctat caacgattaa     31320
     ttttaataag cccaaatcac cttttgcatt tgcatactcc atagcgattc ttaagtttat     31380
     cttgcttgtg gtaacagaac aaaaggtata tagcatttct tgtcttttat ttatatcatc     31440
     gtacaaaatg ttcagtaact taactaaagt ccaaaaacca aattgagttt tgcctgttaa     31500
     atttttagaa agtgtaccgc cagcaacacc catttccttt gcaagatcac cctgacttct     31560
     tctttggaaa tcaattgtat ctataaggct gcctagaaat ttagttagtg tttttttaga     31620
     ttccacattt tcattctgct ttaaattcat acaaattgcc ccttaattta aggattcccc     31680
     ccaccaacat tcatttagcg gaatattagc atatagtatc ttagcataat gatactataa     31740
     atcttgtcgt aaaatgtcga taaatcgaac ttctcaaata tgaaataatg catatccaat     31800
     acttaaagca acaactatca attaacaaca aaaagtcgat tcccctaatg tataggaaat     31860
     cgactttttc tacttttttt tataaagaaa aaagcccatg cggggctaga tacttttctt     31920
     catgccgcat ttacggcatt ctcttaaata gatgaaatct ttgatggaac ttttgaatgc     31980
     ggtatttccg caattatcac agcgaccgct gattttatca ggatgttctg tgtatgtgta     32040
     tatcctgctt agatcgtact tttgttcagg ttgtttattc tccattagtt tcacctacat     32100
     atcaatctga attaaaacag cttaatcata ataacatgac gtgttcacat agaggacgct     32160
     ttttaatttg tatctccact tcttaattgc tttcttaact ttctgttctc cacatacaaa     32220
     taagcctttg tctcatatgt ttcgtgctta aagtaagagt aactaccctt aaatatcgtt     32280
     atttggcgct tctcagtctg caacaatacc caatatttac tttcatccaa cacaacacct     32340
     gatacattct taccgctcgg aaaataaacc gtaattgtat cccccacaga aaagacatac     32400
     tcagtaggtt ttttataatc agctagtttc atttcttctg tatagaaatc gtttgttaaa     32460
     agtaatggct catgctttac atgtgcaata taagataaag cacccttcat gattgtatag     32520
     taattctctt tttcgctttt aacatacaaa taataagcat cctcagacaa gagagtccct     32580
     tttatcccct taccatcttt aaatacacaa cctatctttt caccaatctt aaatacaaat     32640
     gacgttttct tatccccctt actatactta ggagatcttt cttcaacagt tggaaactct     32700
     tcatgtttta tgtattttac ttcagaaaaa ttaactgtta cttgataaga accactagtc     32760
     ccctccacat caagaacaca ataatattct tcaattgttg taattttccc ctttaacaat     32820
     tcttcatgat taagtagctt aacttcaaca ttagcccctc tcataaatac ataagagtgt     32880
     ctgtaacgcc ctctactatc acgatctata ggataatttt tacccaattt tagcaccacc     32940
     aatattctaa ttttctagta aacctctaaa aatttcacat accataatga gaatataacc     33000
     ctaataatgt aagcataaaa ctttaaaagt gagagaatcc taaactagtg aatcctgtaa     33060
     ttccaagact ggctaaccaa accacgtatc gtagatatac tatgtattgg cagagtggac     33120
     aattaaaaat taaccagctg gtagcccttc caatatgccg tatagtgttt cttgttcctc     33180
     catgacattg cttgtttttg cttgttcaag aatattacct gttttaggga atagcccttg     33240
     taagtagttt aggtagctct ctcttctttt gccattttct tttaaagcaa acgcaattag     33300
     cattccaagt gtagataatc ctgtttttgc tgttttccct tttccctcaa ccgttttata     33360
     gatttttgta ctctttttta gaaccgtgtt taatgtgctg cggggaacgt taagcgcttc     33420
     gcacagttct gattgtgtaa agtatagcac aggtttgttg tttgaattca tggataggaa     33480
     ggtaataata tcagcttccc actcgtgcca atgactacgc acacgatctt tacgttgttt     33540
     cttatgtttc ttccaaagta cagaaggcgc acggaacgct gaagcctgtc ccattccata     33600
     tgtttgtagt aatcgttcta tgtaatcttt atgtgccgcc tggtattttc cagagtatgc     33660
     agacatcaca atccctctaa cttcagtatg ctctagtggt tgctctaggt tactattaaa     33720
     ctgatccatt aagtccattg tgtctttaat agcatattga ctttgaaaac acgctaaaga     33780
     aagggtgaaa atcgcattgt ttcgccctgc ttttgtttgt tttggagata catttgtaca     33840
     actaattact tgtttgaacc ataattcatc catttgcttc ggctgctcta caggagcgtt     33900
     tttagcaaaa ggactctcta ttacattatg aaactgttca ttgcctttgt tgtcgtcttg     33960
     tcgcttgctc cattcttgta actccttgaa tgtataaaca ttttcctcaa agaacattac     34020
     aatattttga actgaaggca ttctgaagaa accaaagtga ttgcatgtta aatccacgtt     34080
     tggcaaacta tcagcaaaca tttctcgtag attttgagaa atacgtttcg ctgatttaat     34140
     agctataaag ttcttgttgt ttgatacgta caccgcttta tccaacacat aatacacttg     34200
     ataacccttt gttgtttcaa gaatcatagt cggtacacca aaacctgcat taagtgccac     34260
     atcattgatt gcagtcatag ggaatgactt tgaatctata tcaataacaa aacagttaat     34320
     ttgttgtagg ttcttttccg tatgccctac aattgtacga agaccatttt gaccatatgt     34380
     accaaaatta tatacattag gtgtccagtg agaagcctgt ccaacatgat ccagtacagc     34440
     ttcttcagat gataatacaa cgccacgagt cccaaactta gcccttaaat cttctttctt     34500
     acgagtaata aaaattgatc cttttttatt cttcttacca ttgagcactt tactttcaaa     34560
     tttctcttga ttagcaatag atactaatcc agcttttgaa tttttagatt tatattttcg     34620
     taatccttta tgtagtatta attcgatagc tttttgtact gtattcatgt tgaacctcct     34680
     ttccactgat ttttgacaac aaaaaaaggt gagcagctat atcactgctc acctagataa     34740
     atagacttcc ctaaattata tataaaggca gaaaaatcca tacttaacca tgcctaaaaa     34800
     tgcacttaaa taagggtttc tatctttaca aatctactct aattaactat actaagaaga     34860
     gatattttat atctcaatag catagttaac tagaacggtt tggggagttt actcactggg     34920
     tggcagtgac gtaaatagaa tacaagatgt tggtagcaac ttgtattcac caagaagtag     34980
     aagtgtttcc agcaaatcta cttcctctgt ctgtttggga tcttccaaat ctcaattaga     35040
     cagccgttct ttttttattt gtttttttat gttttatgtg tcttttatat tctacaaatt     35100
     cttacgaatt tcttatgtat attatcaaac taaatcgtat tgtgttgaga aacttgttgt     35160
     ctataacgtt acaacaagtt tttttgtttg taaacaaata aattttaaaa aaccacttca     35220
     atttacacat gtgtaaatgt gtaaatgtgt aaatgtgtaa atttttcttt ttccatctct     35280
     ctctcttcta ttatattaaa cgtacaatct tttaatttac acatgtgtac atttacacat     35340
     gtgtaaatgt acacaacaaa aaaactataa tccctataaa cactggtctg aatcatttca     35400
     acacgaaatt tgtgtaaatg tgtaaatgtg taaatgtgta aatgtgtaaa atatacattg     35460
     atgttggatt gcttaaggta tataatggat ttataggtaa tttacacatg tgtaaatgtg     35520
     taaatgtgta aatgtgtaaa aatatatttt tttttttttt tggagggata catatggaac     35580
     acaaaagacc gctaactatt actgtagcaa acagtaaagg tggagttgga aaatctacta     35640
     ttgtaagaca cttatcttat cacttggctc tgaaaggcta taaggtatta acagctgata     35700
     tggacccaca ggcaaataca actaaaacta tgattctaac aagaaaacgt gtaaacgatg     35760
     aatactttgc attcgacaaa acattaatga gagctgtgca agatggtagt ttggaaaata     35820
     tgcaacttaa tattatagaa aacttagact tattaccttc tcatagtgat tttgaaaact     35880
     ttgaaagtct tctaacttca aagttcggtc atgctgaaac atctgatcct aactatcatg     35940
     aaatagagac taataaaatt aactatttta gaaacttact tgaaccctta aaacaaaatt     36000
     acgacttcat tattattgat agcccaccaa cagcatctta ctatacaaaa agttctgcaa     36060
     tggctagcga ttatgttctt gttgcttttc agacacaaag tgatagccta gatggtgcta     36120
     atgattacat cacacgcttt ttagcaagat tagtagaaga atataatgct caacttgatg     36180
     ttgttggaat tcttccaaat caattacata gtgcaggtaa aattgatact acagtattac     36240
     aagatgctaa agatattttt ggtgaaaaca atttatttaa aaacttaatc ccttacgcaa     36300
     aacgaatcca aagcgtacca cgtattggtt taaatgtgga tcagtattgg gataaaaaat     36360
     tattcaatga agttttcgaa ccatttactg atgaattttt agaacgaatt aataaaatgg     36420
     aggaattaag aaatgagtaa tgaacaagga aaagggatgg gatttttcgg gaacaaagga     36480
     aaacccgcct ctgaaaagaa agatgagaaa aagacgaaac ttgaccttga ctataaacct     36540
     gatctcaatc caagtactcc ttacgatcca accctacctg taaaagcaac actagtaaat     36600
     ggtgataaac gtggcacact gcgtattccc ttagaaacaa aacacgagtt tgatgccctt     36660
     cttgaaattt ctgaatacca atacacttat gaattgcttg gtgaaatgct ggatacttgg     36720
     atgaagaaat taactcctga acaacttaga ttgttccatg catctcttga aaatataaaa     36780
     cgcaaggcag ctattaagga agctaaaaag aaaaaataat tatataatgt gtaaatgtgt     36840
     acatttacac atttacacat ttacacattt tttattcgaa tcaacttcaa aaaaacgaaa     36900
     tgaccccctg atataacaac aaaacccact taactttaat ttttttgttt ttaatttgtg     36960
     taaatgtgta catttacaca tttacacatt tacacaaata tgaaaaggag atataccatg     37020
     agaaccctta ttattattac cttagttgtc ataggtttag tattttttaa cgtaatatct     37080
     ttacatacaa ttgggacatt agctgccata atcggagtta taatagcaat tgcgcttggt     37140
     gcttattttt tatatcggct tgctcttgga tttttcgcgc tatttgcaac tttcattggc     37200
     gttattttag tgatttgctt aattacatac gctgtaacta atctagttta aaaagagaag     37260
     ttaattatga atgccctaga agaaaataaa aaacaagtgg ggaacaatgg gctacaaaaa     37320
     caggccggat agtcaatcta tttagagtaa aagaaaatgg gtgctgatac ctaacagtga     37380
     acaagaagtt atatagcgac actcctcttt gaatagccgc tgttgatatt gtaagacata     37440
     aaagtagaaa cttgatttca agaaagaaat gcatattcaa attaaaaaat attacatgca     37500
     gtaagtagga caagagcaac agtattggaa agttcaaaaa tagaagcttc gaaaagaaaa     37560
     taaaaggtta ttgatttctt tagaaccata cttatatgaa agcttagagc aaattgcatt     37620
     agagttaata acagaaggtc tagactatat ttatacggag gatttgcctg ttcagcattt     37680
     tatcgaattt aaattaacat catcctattg taagccctta taatgattag cgctcaaacg     37740
     ggggtattta gaaagaaaaa tggcattacg ttttatactc aaaacaaagt aaaagaatcc     37800
     aactataaaa gaaggattct ttcaccgggt attcgttgat aaatgacttc actaaaggaa     37860
     ttgagtttga tacactcagt tcctaatttt agattataaa aaagaagatt atttgtcaaa     37920
     aaaatttgct atagaataat aaatgctttt tattgaactt aaatgaacac tctcaggaag     37980
     tatttatatt tttaatttgc ctttttctct tgaaaatttc acccttactt gctaatcata     38040
     ccataaaata tagaaaaaac tattaatttt atatgggttt agcgatccaa gagtaataga     38100
     ttttagttga aaattagact ttttaatcta tgaaacaatg ggaattattg attaggccaa     38160
     aaaattgaga taaaaaaaag aattttttca atacagattc ataacaagaa gataaaagac     38220
     agatatagaa aaaatttaaa atgaagtttt tgattgttaa atccccctaa cctcaactct     38280
     acataaatat actttttaaa aagggaattt tcttccttct catccattga tttttagaaa     38340
     ataatataga taactaaacc attgaaatac ggaaggcaac tcataaaagg ttagacttat     38400
     cataactatt acactataaa aaatatattt agcaatattt cggaaaggaa aggaattaaa     38460
     tgaacactaa gggaattata gcaaaactta cagcaggagc tttgatagca aacttactaa     38520
     tttgtccagc aaatacttta gctgaaaaaa agacatttac tgatgtacca aactgggcac     38580
     aacaatcagt taactactta atgaaaaaag cacttgatgg aaaaccagat ggaacttttt     38640
     caccatctga aaaaattgac cgtggttcag ctgcaaaatt aatggctatg gtactcggtt     38700
     tacagattaa caaacaagca aaaccgtcat ttcaggatgc aaaaaatcat tgggcatctc     38760
     catatattgc agcagtcgag aaagctggtg taatatatgg agatggtagt ggtaacttta     38820
     acccatcaaa ggacattgac cgtgcttcta tggcatctat gcttgttgaa gcttataagc     38880
     taaataatag aattatcggt gatttaccaa cgcagtttga agacttaaaa gggcattggg     38940
     gtgcaaaact agcaaatgca ttagttgcat tagggatttc aaaaggtact ggcgacggat     39000
     ggaaacccaa tggaattgta acacgtgcag aagcagtaca attcatcgcg caaacagaca     39060
     tgaaaaaagc agacacttca aaaagaatgt acatgaacag acatttcatt acataccatc     39120
     agccatccct atcatcaggg gttacctcaa atcaacatgc gccacaaatc attgttgtaa     39180
     aagaacaacg cgcagatggt tggataaaaa ttgtaacgaa tataggtgat aaatggactc     39240
     cattatatga aaaaagagaa accattcaca gtacgtttac tacatatcca gaagcgtcac     39300
     attcatctaa agtattaggt acgcattctc cgcaaacagt aacagttata gaagaaaaag     39360
     gaagttggat tcgcattcgt acaaatgctg gtttccaatg gttggataaa aaccaattaa     39420
     ctctaccaaa gaaacaaaat aacttcttag aaggaaaaac aattattatc gatccaggtc     39480
     atggtgggat agatggtgga cataaaggaa tttatatgaa tgaaagccca gttgtatacg     39540
     acacagcagt acgcgtacaa aaattgtttg cgcaaaagac tccatttact gcattattaa     39600
     cacgggatgc ttactcaaga cctggaaaaa atgcaacaga ctctctaggg aaaagagttg     39660
     aatttgcgaa aaaaaataaa ggggatatat ttgtaagtat tcatgctaat gggttcaatg     39720
     gtaacgcaca tggtacagaa actttctact acaaagcacc aacacaaaaa tcaaatccgt     39780
     atgtaaatga tagtcgtata ctagctgaaa aaattcaaaa acgtctaatc acagctcttc     39840
     aaacacgtga taggggtgta aagataggta atttatatgt tctccgtgaa aatacaatgc     39900
     catctgtttt aacagagctc ggctttgtag ataataaagc agacggaaaa aaattagatt     39960
     caccagaatg gagacaacgt gcagctgaag caatctatgc tggtattcta gattactatg     40020
     aatggaaagg tcataacatg tctgcttatt actaacccgt catataattt ggtgattttc     40080
     tccctgtcaa gtagacagta tttaaaaagc gcaactaagc aacctgagtt ctatatttat     40140
     atggactcag gttatttaat ttctcttgaa attgttgatg attataaaaa atatatattt     40200
     gcgcacggca attttaacct cattcgcttt acggaagacg gtttaatgaa aatactctgc     40260
     cttaaacggg gcacctatta aaacacctaa accatctatt ccctaaattc tttaagggat     40320
     aggtggttta atttttcttg aattcgcaca gttgtgttgg atacttttgt taccttttgt     40380
     gaatagaaag cttcgctttt taaatggcta aagaagcttt ccatgaaggc attatcatgg     40440
     caatttcctt tccgtgacat gctggtgatg atgccgtttt gtttggcata cacttgaaat     40500
     tccttcgcag tataaatact tccttgatct aagtgaagga tggcatcttt tacttttcgt     40560
     cctctcatta cttgttttac tgtcttcatc actaaggtca gattttgtga ttcattgatg     40620
     acataactta taatttcgcg attaaagtca tccataatcg ttgataaata caaagtacgc     40680
     tctcaaaata ataaataagt tacatccgta aacctctttt catttgggac tgacgcttca     40740
     aattgacgtt ctaatcgatg aggagctatg actgcttcag caccattcat atatttcttt     40800
     ttctgacgac acacttttga gagtatatga tattgtttca taatccgtaa tacttttttg     40860
     taattgacac acagccccat ttttcgaaga gtggcggtca ctcttcgata tccatatcgt     40920
     aatttatgcc taagatagac tttctttatt ttttcttcta cctcatcttt aggtcattca     40980
     gttatctgta accaacgata aaatgtgggg cgcggtaatt cctgttaaaa caattgcaca     41040
     aactcctata cttaacaaaa tatatacaaa aaccttaaaa aaatcgtcct cacacccctt     41100
     tttctccgaa aactcattta aaccacttaa aagaccgatt aaagggcata atcttattta     41160
     ataccaaatg tattaacaat ttctttaaag tcgattaaaa gcgaatttaa agcgtcattt     41220
     ttctgaaagg aaaactttta tgttgaaaat catatatgca ttgttttcca acacacccaa     41280
     ttgaaaatcc cgtaaaaaag gttgcaccag cgattttcac tccccatttc cacatatttc     41340
     tctgtaaaaa tgatgtgaaa tatagaggca tgcccccgta caaaaaatga tccggattcc     41400
     atattcatca tattttcttt gttctaactt ttgtttatga aacggatata cttggataaa     41460
     taaaaggcta tcagcaaaac tgacagccaa attcccaata cgatcatttt tcatcgcccc     41520
     atttccactc gattaaacct ctttataacg tttccgtaac aattgttgta cacgtgccgc     41580
     atacattcta aaatggggaa tgttttgtgc ggcaaccttt ccaaattcca tttgcattaa     41640
     tgtttcttct aacagtttga actcaaattc taaaaatgta tcatgctgtt tctgaatcga     41700
     atgcggaata ttatacaaag catccgcaat ttctcgtaca tatgtcacac tgtattcacc     41760
     ttgatttgaa taggaaaata catttcgaat taatacaaat gtttcttgta atacttcata     41820
     cccaatatga tgcaatacat tttgatttac cactcccctc attcctttct ctatggtctt     41880
     ttaattcctg tattgatttg aaactcataa ttttctacaa accatttctc accttctaat     41940
     agaagaaaca tattcaaaat ggaagaacgg cgagattact gctgttatgt ttatggaaat     42000
     gatagaactc aagaaaaata cattttatga aagaatatga agagaacaaa ttaaaaacga     42060
     attaaatgaa gaataagagc cagatatttc tcagaataga aaatccggct cattttatgt     42120
     tgaaattttc ttagtgtata tttttgttaa aatgtagatg ggaccccata cccatcaact     42180
     taagaattca gaattacccc aaaatgaaaa aaagaacttt ttgttacaaa ttaacacaaa     42240
     atttcgtcct ggaggtacta aaaaattttg cctgatagtg atggaatggg gccactataa     42300
     aaaaaccaca gtttacactc aaactgtggg ttttcgacgt acaatgattt atcaacttct     42360
     gtttttagtc tttaaaatct gcaacagaac caggatcccc cctcaaagta taaatcccaa     42420
     ggaggggatc cgttttttat ttacttatat acgtacagct gtaccactta ccgcaaccat     42480
     taacattcca gcacgaataa ttgcgtaatc tacgtcaatg ccaacgatag cgttcacacc     42540
     tttttgtttt gcaagttctt tcatttcgtc catcgcaata tcacgagctt cttttagctt     42600
     actttcataa gcaccagcac ggccaccgac aacatcacga actgaagcga atacatcgcg     42660
     tacaatgttt gcacccataa tagcctcacc atttacaata tcaatatact caataatttc     42720
     tttaccttga atttcagcag tcgttgttac aatcacgttt gacaacctcc tgatatttta     42780
     caacatccaa ttacatgtgt ctctctatga catatgcaat tgaataaaag caatagaatt     42840
     atttaacaca tgtatcgcga taacatatgc aagagatctg ttagaaataa gataagccgc     42900
     agtaagtatc accgcgccag gtaaatagat agcaatatcc gaaagctggc tcgtgtggaa     42960
     aagtgtaaaa attataattg aaatgataga tgcaatagca gtaccaatat aatttgaaaa     43020
     acgatttaat attatatgac gaaatatgat ttcttcaagt atcggaccta gaataccaaa     43080
     tacaagtaat gtaagtataa gaggtatctc cgcgcctgtt tcaaggagct gttcttggtt     43140
     ctctggctga ccagttgcta gaaaacgcat aacaatctgt tccacaatta ccgtaaataa     43200
     aaccaccata ggaatactta ctatttttaa aattgtcttc tctttaaaat aagtaaaact     43260
     ttcaataatt tctttcctaa agaaaatgat tcccacaata gcaggtatag tcaaactgat     43320
     ggcactaaga gcaaattctg attcaactat attgctgtta gttaaaaggg atatgcctaa     43380
     taatatgaac aagccgattt gaaatggtac aaacagtgca taaattatta gcatactaat     43440
     ttcttttgta ttcgttttta taaagttcac tttattacct ccataatgaa attacttaga     43500
     atctttgatt tttcttgttg cattaggttc tccttctaaa atataattat ataaatacca     43560
     aaccggacgg ttcggttcga aaactaatga tactataagt ttctagtttt ttaaacccct     43620
     tttataaatt attaataaaa taaaaatggt aaacaacaaa tatatttata tctcagttgc     43680
     ttatttacaa acaaatttca gtactcatta atttttgaca attagctttt tatagaatga     43740
     agtaataaga cttttaaccg caaggactgc gggagatatc ctaatatacg aagtgaaagt     43800
     gggagtagtt caaacgcttt agctaaacgt attaataaaa attatatata ataatcatat     43860
     gtctatacgt taaaattaac tatatatttt tacagctcta cgattttagg taaaattagt     43920
     tgtataatat gactgaatta aacaattggt catgtatttt tggcggaaaa ttctgtatct     43980
     ttataaaaaa gattgataat ttgtaattaa gtttgataaa attttcgttt aagaacatga     44040
     tatgaaggaa ttttcatgcc aacttctctt tttatcctat ataataaaag caaaaatatt     44100
     aagatgttcg catagttaag aaaagggtag tttttaatgt tgttgtaata attgaatatg     44160
     gatttgaaag gatgtacatc atgattttag ttagttcttg cttagctgga aaaccagtaa     44220
     gatataatgg tactgcatgt ttaaacgata caattcaaaa gttaattgat gaaaagaaag     44280
     cgatacctgt ttgcccggag ttattaggtg gttttgttac accgagagaa ccagctgaaa     44340
     tcttgggtgg agatggatat gatgttttag agggcaaagc aaaagtaatg gaacgttccg     44400
     gtaatgatgt gacggaatta tatataaatg gtgctatgaa gactttaaat ttagcacaag     44460
     aaatgcaagc tagccatgta gttttaaaag aatatagccc ttcttgtggc agtaaagaaa     44520
     tttatagtgg tgagtttgtt ggaaaaaagg taacaggagt cggcgtaacg actgctctat     44580
     tagaaagtaa gggcattaaa gttatatctg aattagaatt agatcaatta attaataaaa     44640
     tataatatta gagggcaaat tttaacaatt cgcttaccga aattatcaaa ctttattata     44700
     aaaataaata gcttgtaaaa tttcaactca cgcattttaa tcaaattttt ttcaaaatgc     44760
     gtgagatttt tttgtgatga aatcaatggt ttcgcttaaa ttttaatcaa acttaatttc     44820
     aaaccaacaa attcacttat tttacatgga taatataatt tgattaactt cttttcaaac     44880
     tgtattgttt gagattttca taagataggg attgataaga tatttctgtt ccgaactcat     44940
     ttatatttac aaaaaaatca agaaaataga gggtaaacat tacctagaat attaggatcg     45000
     ttttcattag gaggacaaag catgactaaa gttgataagg taaaagaaaa aattattgaa     45060
     acatctttat atttatttaa tactaatggg ataactcgca catccattca ggatataatg     45120
     acagccactg aactaccgaa aggatctatt tatcgtagat tcaaaaataa agaagaaatt     45180
     gttcttgctg cctacgacaa aagtggtgag attatgtgga gtcattttca taaagcaatg     45240
     gaaaataaaa aaacagcaat cgataaaatc cttgcaattt tccttgtata tcaagatgca     45300
     gctaataatc ctcctattgc tggaggctgt ccattactta atagcgccat tgaaagtact     45360
     ggagtatttc cagaattaca aaaagcagca gcaaaaggct atgatgatac agtaatgtta     45420
     atggcctctc tcataaagga aggaatagag aaacaagaac ttaaagaaga tatagacatt     45480
     atatcgctcg cttcttttct tgcctcttca atggagggag ctataatggc aagtcgagtt     45540
     tctaacgata atatacacca tcaatatttc attgaacaaa taaagcatca tctttactct     45600
     tattctaaat aagtgagaac ttgcatcacc ttcattcaat ttttataaac ttaaattcaa     45660
     taaatactcc tcataaaaag tatcttctgt ttatgagggg gagacatttt tttagcagag     45720
     gtagcttaca gaagaaatag gattgtttaa ttcgaagcac ataaacacaa agtggcccat     45780
     cacataccca cttggaccta tgttatctga aaaatggtta ggcaaaatat tcattagacg     45840
     aatagcaatc acaggtattt ttgaatttta tttcagttta tcacttactg tatttacata     45900
     atacgaaact tagggcaagt aattggaatt tctgtaccta gtttatggct aagtgaccaa     45960
     ctaaagaaat tcaagctaac tttgtatcta tataacgaaa aaaacgctat tctttttgta     46020
     gaaaaataca gaaaggatgg cgttttgtat gactctatcg attcaagatg agtttcattt     46080
     attcgctgaa gaattacagc gatatctatc cccaagcatc cttcaacagc tcgcacagga     46140
     gacgggtttc gtaaaacgta aaagtaaata tggcgcacgt gatttggccg ctttatgtat     46200
     ttggattagt caacacgtaa caagcgattc tcttactcga ttatgcagtc agctttatac     46260
     aaatacagct acactcatga gcccagaagg actgaatcaa cgctttaatc cagcagctgt     46320
     cgcatttctt cgagaagtct ttacttctct tctcaaacaa aaactctgtt caaatcaatc     46380
     actttctgca catatgatct ctactttcaa tcgtatccgt attttggatg caacagtgtt     46440
     tcaactacct gatcaattcg ctactgacta tcaaggttca ggtgggagta gtaataaggc     46500
     aggcgtgaaa atccaattag aatacgattt acttagtggt caatttctta acgtgcagct     46560
     tgggccagga aagaataatg ataaaacata tggtacgatc tgccttgaaa ccgtagaagc     46620
     aggcgatttg tgtttacgtg atcttggtta cttcgattta ggagatttac aaaccattca     46680
     tgataaagag gcttactata tctctcggtt gaagctgaat acacgcattt atactaagaa     46740
     ccctaaaccc gaatacttca acaatggtac ggtaaaaaag caaacagaat acatccagct     46800
     tgatatgaca caaatgctgt ctggtctaat ccctggtgaa acgatggaaa tccccgaggc     46860
     atacattggt caaaatcaga aacttccagc acgtgtttgc gtttgaaaaa ccaagcgata     46920
     cgtgaaaaga agaaaggcat tgtcatgaag gataaaagta aacgtttaat gggcatgaat     46980
     gtatatatca cgaacacgtc gctagaagaa gtaccgatga actacgtgca tccattatat     47040
     tcacttcgtt ggcagattga aattttgttt aaaacgtgga agtcactctt taaaattgat     47100
     gaatgtcaaa atataaaaag agaacgccta gagtgccatt tatatggaca actcatcggc     47160
     attctcctct gttcttctac gatgtttcaa atgcgtcagt ttctgcttga aaagaaaaaa     47220
     caggagctga gtgaatacaa agcgatttat atgattaaag attactttcc attactgttt     47280
     caagcgatag ccgttggcac agaaaaactt ttaaaaattt tgcatcgcct ttatcagctg     47340
     ctcaaaaaga acggtcgtaa atgtcatagg tataagaaga tgaccgtctt tgatattcta     47400
     gggattgtgt ataaaacgac agtgaagcat agataagctg cctagcgaaa aaatcacgtt     47460
     ttaataggct tctttagcat gcctactttt ctatcaatta ctagttttga accaagaatc     47520
     gtttcatatc tagtaagtta cttgtttagc ttgatggaca tgagatggga ccccttctta     47580
     tttataatta taattccttc gatttacttt ttaatggtaa aacatattgc tctactcttt     47640
     cataaagatt aagtatttgt gtaataaatt taatttttgg tactatccaa tatgaaaata     47700
     aagctgaaat actccctatt aaggcgcctg ttgcaacatc aaaaggataa tgaaccccga     47760
     cccaaatacg agagataccc acacagaatg caattacaag caataacaac ccagcctttt     47820
     tatgaacgag cttaactgaa acacaaattg aaaaaaatag aatcgtgtga tcactaggaa     47880
     atgaattatc cactacatga tcagcgagtt tattaacatc aggtaatact gcaaatggtt     47940
     gataattcaa atgcaatttc cctagtagct ttccaattat ctcagcagtc atgaaagcaa     48000
     acaccgcttg tataatcatc atcctatttt tttagaccta gttgaccaaa aagctataat     48060
     aactaagcct aaaatatata ccatatattc cgctaaaaat atcatgaatg agtttagaaa     48120
     cgaatattgt ttacctaaat cattgataac tcgaaaagca tcaatattta attgaaaaaa     48180
     agacattttc aaacctctcc ttaagtatct atatctgtat aaaacaaata tataattatc     48240
     aaaattaagt tagtgtatat taattaaaat taaatggttc attactaaat gataaaattc     48300
     agattataaa ttgttagttc tagcctattt tggaatttat aagaattcac acgtctaata     48360
     atggacatcg taccatcttc ttctaattta ccaataccaa ttgaaacacg actcttataa     48420
     tctttaatat ctgatgtaaa cttatattta tttttcaaat tatctagtat tttaaatggt     48480
     tttctaagta gaacactatg gtgtgtcgta gtttcagatc ttaaatttaa tcctacttac     48540
     ttttgctaca gcatacgcat ctcctttatt atttctagcc cataaacgtg ccccctgcac     48600
     ttattggaga gctctcagaa tatcccattt tagtatacgt atcttccaat gggttttccc     48660
     atttaaaagg gatagctgtc ttttctgttt ttactgctac ttctgttttt tccatatctt     48720
     tttcatcttg ataaatttct atttttatat ccatcatcag aaaaataata tcctggaagt     48780
     ccatcactta ccccatttta tattttttca ttcatagttt ctctcttctg cctttacagt     48840
     tgtattatta gaggctgtat ttgacagcaa agatgatgat aatacacata tacccgctaa     48900
     agtctttatc tctttttcat acaataacct cctttatttt agaacaatat tttcattgct     48960
     ccttccttaa ttttaagcaa taaaatacat agcttaaatt aaaataattt cacttgctaa     49020
     gagagttttt ttagttaatt ttcattcttg aaatcgtatt atctatgact tcaatcatga     49080
     attgaataat attcaataaa taaaatattt atcttttata atttttatat ttttatattt     49140
     ttatattttt ataaatagat ttatctttca gtaacccccg aatatcatgg gtactaaaac     49200
     aataaatgtt tctttttctg tcattatctc tattaaatta gttataaaca atatcttata     49260
     tttttaaagt tacttgtaaa gatgaatttt atgctgtact aagagaacaa atatatattt     49320
     aaacactcaa tccaccccag tataatttga cttgtataaa agctacaaaa aagattagta     49380
     tttctatttt caaaaagtga aatactaata catgttataa gcccaagaca agtaagctaa     49440
     aataatcgtt ttatgctata aaattaaaat tacaaagtag gaatatagtg attataaagc     49500
     aggaatatcg ccatataata tgcacttcat tcatattcat aaaaaaattg catgaatatg     49560
     aatgaagtgc acccttaaat agggcactat caacacttcc ccctaactaa atcatactat     49620
     tttaggaaat agtatgattt agttttcccc tttaaattca cgctctccca cccagatatt     49680
     cctacataag gaccttgagt aatcaaagta aactaaaaaa tctccttttt gtatactgat     49740
     atttagaaaa aaattactta gcagcttaga tatttttcca ttttacaaag aacaatccat     49800
     ttattactca ccatttatac ttatagtaaa ccctagaaaa actaaaaaca tcaggaagta     49860
     cccctattca ggaaacttct tataaatata tatagttact tcattttaaa taaaatcaaa     49920
     aacaataaca aaataaagct tacaaagtgg ctttttctat attattgata ctaaccatct     49980
     tgtaaatcta gataatactg tatattggtg taatcgcgtt ctgtagggat agaattaata     50040
     catataatag gggttgaacc taagtcaaga ggtattgttg aaataataaa gtcagcatta     50100
     acatcgtgat cactcttttt agcaaaaaaa acagttgaaa tttgtatttt atcaccaaac     50160
     ctttttgcca aagtagcagc tagatactct gcccaacttt cactttctcc tgtgacaagt     50220
     aatacctttt tataattact agtataacga agcctacttg cctctatata cattgtaact     50280
     tttgcaattt cttcaacaga tacatagtct gctatctcat tttttttgac aaattctgtg     50340
     tatacttcct ttactgctga gaaggtttcc gaatgttcag tttgcatata ctgtatagtt     50400
     tgtttttgcg gcctttcaaa catacatagg tattgtaaat gatatatcgt tcttttaaaa     50460
     tagtcgacta atgcaaaaat aaattcttca tcacttatta gatctacttt taatttttct     50520
     tctaatgaat tgataaagtc tttaactaac tcataaatcg ataaatttcc ttccttaaaa     50580
     tattgaacac tctcctcttt ctctttattt atatctttgt aaacatattt agaactctta     50640
     atactaattg ttaacaaaat cttatcttgt actgttaagc taacaccaaa ttcacgttct     50700
     agcttttcga atattcttcc tattttcaca taatcgggag tttctgtatt aaagtataaa     50760
     aactttctat ttaattgaac tttgtatccc tgttgctttc gttttaataa aattgctata     50820
     aaaaaagata aatgcctttt agaaaccaca tgtaatgaga ttcctaatga ttcttcaaga     50880
     gttccaaggt attgaaaaat aacttctttt ttcaattttt caaatggcca ctctgtatca     50940
     ttataagatt ttaaatacag atccaaatac attatcatga ttcgaacttc atccccctca     51000
     agtctaagag gtttcttacg aagcttcaaa ccaaattttt taagataatt ctctactctt     51060
     tttaatgcag gtagaataga tgggacttgt atatataatc tctctgctaa ggtagcaatt     51120
     gtttttgttt ctctctcaaa taaatgttgt aatatccgga aagttaaaga ttcccgaaaa     51180
     agtaagaaag taatttcatt tctatgttta ttatagggta gataaattct aactcccttt     51240
     ccctttttta tttttatatg ccagtcttca ggtaaaaaat ctttgataaa tgaaatatct     51300
     ttcataatcg ttttgttaca acatcttaaa attttagaaa tttcaatagt tgtaaaccat     51360
     ttttcttcgc ttgtaattat ttctaagatt tggatttgtc tttttatatc tttttccata     51420
     tatcgatatc ccttgctttt aagaatgtaa attactttta tacatataca attctagaca     51480
     gtataagtag aggtaaaatt aatttcttta ctcatttttg tttgcagaat gcagtcagaa     51540
     tccctggttt gtaattatta agaacaagga catttccaat aaaaatatcc aatttatatt     51600
     caaattaata atgttacaat attaattaat atcacctaat cattaatatt ttttatatcc     51660
     ttagttatat gcgtttttat tttagcaaga catttaactg ttttataaaa aattgcattt     51720
     ctgccaaata atataattat cataaataaa aatcaacatc cttatttggt tattatataa     51780
     atagtctcag cctattactt gcgatacatt tattattctt agcatcttaa attcataatg     51840
     ttaaatcgct tcccctctaa tcctttccta aaactcttaa cggcttcgag ttaccaccat     51900
     ttcatatttc aaattagcga tctttcttag tcagtttttc tattacttca cgagaaactt     51960
     tcttcattaa tatttcattg taagaaccag tgttaggtgc ggtaacagat attattgttt     52020
     gaacaatgat tttttacttt tgcttcataa tttccacttc atattaccac tataatttct     52080
     ttcaattatg gtaaataata gataccacaa cttaaatctt aaatgcaatt ctcctaaaat     52140
     gtattagttc tcaaacaagg attttttctg cttatgcaag ctgttttgga aaagattcag     52200
     cagtgtttcc aattttcatt ataatttata gagtttttca ataacctaaa aaaacttcct     52260
     ttgattaaga agtttttttg actattacaa taaaattcat ttttcagcta acattcccca     52320
     taaaaatata tataaatttt ttctaatcac tcctaaagtc attaatttca aatacatttc     52380
     attctacgat aatttcctca ttggtgttac tttccagtaa ttaagacacc gtcaaatcca     52440
     ttctactgta ctataatgaa aatattttaa ccactgttaa gatgcatatg ctagcaatag     52500
     ttagagttgg ttgtgatgta tcttcaccaa gtaaaatcgg cacagttgaa tattatgtcc     52560
     aaatacaaag agaaggtgaa ataaaaggta atgaacgtgt ctatacatta ttgacttatg     52620
     acaaagaggg aacagaaaag aaggtcacat ttactagtca aaagcctaat aatgagaagc     52680
     taaaagaaaa tgcattttta cgtctttata ttaaacaaga ggataaagag aaagcagaca     52740
     tacctgatac agaagttaaa tcctatgaag agatacagaa agacgattta ccagcaaaaa     52800
     caaaagaaca attaggtgta aaataaaagt attgagaatg acttaaaagg gttctcatat     52860
     attaagagat acccctttta agtttataaa atcagaatat tataagattt actttgttta     52920
     ttggaattat aaattttcca caataaaaaa gaatcataaa tttattaact cgaataattt     52980
     ttcgtttaaa ttgtataata ctcctaaaat aaatgacggc gtaacttatt atcacaacaa     53040
     ttaccacttc aatggaaaaa tctgtagaat gtaaggagga accctcaaat aattttgagt     53100
     aaatactaag cttatttgaa tcctgaggat ggaattcaca attggtataa ttaaaaaata     53160
     tatcgaaaaa tctaaatcac tttgtatact taggggttag cctgtagata atcactaatc     53220
     ttcttctgct catcagtcgt taatgtttcc gaacgtttaa aggtccccat tgttacaagt     53280
     aataaaccta caattaaaat cggcataatc catccaaaaa cttttttaac catttctcca     53340
     ttacctccta tttatttgat ttccaagttc catttcttct gccatctcca gcgccggtga     53400
     taacattatc tctctcgtct ttaattaagg cctgtacccc accaaaaaag gcaggggata     53460
     ctttcttctt tacgttcaat ccttttctag ataactcatt tttcacttct gaacttagct     53520
     gaatctctgt atacgctgta tttttttcaa aagtaaaacg gtattcattg ataatgtctt     53580
     gcaagctacc cttaccatgc gtatatttat ccaatattgg ggttaaaatt tgcggaatac     53640
     ggttaccacc tggtgaccca atgccgatcg tttccccatc tttctttaat acagtggggg     53700
     ccataaacgt tcgtgaacgt ttaccaggtt cataactatt aaatccctca cttccaaagt     53760
     tctgcaattg attatttaag aagaaccctg ctgtgtactt tcctgttcca aagaaattgc     53820
     ttagtgtatt agttgaagag acaaccgttc catctctatc aatgataaca aaatgcgttg     53880
     tgctttcatg ctctgcttcc gaaagcgcat caccattctc attcttcatt gttgatatat     53940
     atttgtcact caccatttta tttggatcca tattaacgta atttggatcc cctaggtttt     54000
     tctttctatc ttgataggca atccttgaaa tctcttccat tttagacata taagttgccg     54060
     tatgatctac atctttatat acttctttct tttcagctaa tttcaacatt tgtaataaag     54120
     taactcctga aaaaggtggt ggagcggtat aaacatcata tcccatgtag ttacctttta     54180
     ctggtttacg tacctctact ttatatcctt ttatatcttc taacgatatt tttgcagttt     54240
     tactgattgc cctagcgact cctccttcat aaaagccttt agccccttct ttttgaatct     54300
     tctttaaggt tctcgctaaa tctgtctgga taagtgtttc tccagtttca ataggttcac     54360
     cattcggata gaagatactt agcttatcag aataaatacg tggcttcgca aggtctaatc     54420
     gcattgttaa ggaatcatct accttgaacc ctttttccgc ataattaatg gctggttgta     54480
     ataactcacc catcggtaat gaaccataat tatcatgaat atactccatt ccagccacaa     54540
     atccgggtac tccaatatgt ggcttttggt ttcctgtaaa gtacggagtt gtttcacgat     54600
     aatcaataaa ggtttcttta tctttagata taatgagcat tccaccgccc ccacctattc     54660
     ctgaggcatg cagttctaca acgcctaaaa catatgagac cacaatcgct gcatctactg     54720
     cacttccacc gttctttaat actttcatac cttcctcaac cgcaaggggg tgagaggcac     54780
     tcactccata agttccttta tcacccatac tatcaatttt ttgcttaaca ctgtctttta     54840
     ttttattgaa agaacaggat accccgatac cccccattaa gctgactatc aaacagaaaa     54900
     gaattatctt ctttccccat ttaaaggaat tcaagttgtt gtctccactg atacttgatt     54960
     ttctttttct tgcttatctt gatgctcttg cttttccctc tttttcattt tttcaataac     55020
     atgtttatga tttaatttga tttccaattt atcatctttt ttactccata gagcaccctt     55080
     ggatgtatct tttgttaatt gacgatacac acgattttta tccaatgcac tggtaactgg     55140
     ttttggtgat ccctcttgaa tatttaaagg tacaacatca agaattgcag taccattatc     55200
     acgtaaatga tattgcacaa gtgcactatc ttttgttctt gtccatcctt ggtcaaacac     55260
     aaagttacct aaactataga agataatccc ttgcttatac acatcaaaag attgaagtac     55320
     atgcggatgg tgtcccacaa taatatctgc ccctgcatca accattgctt ttgctaaggc     55380
     ttcctgtcta ggactcggtt tattatcgta ttcttccccc cagtgcgtat ttactacgac     55440
     aagatcagca ttaccttttt taggatcctt tgccttacta atttgcttaa gtaatacatc     55500
     tgggttcata cttaacgaac ctggttgttc tttcgttgca atagctcctg ctacaaatgc     55560
     atctgtaaat ccaagagtag caaccctaac accatttaca ttttgataca caatattttt     55620
     tacatctttg aaattttcac cagcacccac atagtcaaga tcagcttctt taaaggcctt     55680
     tattgtatct ttagttccct tagcaccata atccgtcata tggttattcg ccaaatttaa     55740
     tactgtaaat ccggcttctt ttactgcctt aactgtttct tcttttgcac ttaagtgaat     55800
     attcttatct gctttttgat aattcttttt atcttctaac aaaacaggat gttcgaaatt     55860
     cccacttacg taatctgagt tttttaaata tggcgaaaca tgacgaaaaa cataatctgt     55920
     accgtaacga ttaacaatct cttttacgtg acgtcccatc ataatgtcac caaccatcgt     55980
     catcgtcaat ttttcgttct cacgatgttt tactggtgct actgcttctg tacgttgtac     56040
     ccatgtcgca gctattaata taactgcgat aagaggtaat acgattgcta cataacgagg     56100
     attttttttc ttggttttct taataaagat cagtaacttt tcttgaaatg tcaattttcg     56160
     tctcattcta cctcacctta aaataagtaa taaatattca tgattgcaaa tgttgcacca     56220
     cttaacaaaa ttgtagttcc aattgttaat ggtaaccctt gtctttgaat tgtatttgca     56280
     attaatcctg gaacaataac tccaatacca cggaattcaa aaatctcaaa tggcataaca     56340
     ggataacaat aatcaaataa aagttttaaa caaatacctg taattagcgt tgccgcaaat     56400
     tttctacggc catataaaat catgaatctt gaaacaccat acgtaacgat tacatatgtt     56460
     aaaatactga taaataaaac aaccaacata aatacgggct gattaaaaac gagtgctaaa     56520
     taaccaggta caactaaacc tgcaggtaaa atacctgttc tttctgtaaa aataaggctc     56580
     agtgtaactc ctaatactaa tgcaatatat aaatctgatc caaacattcc tgtccctcca     56640
     cttaaatcac ttttgcttgc tttttgccaa tttgttcttc cataatcata tcgattaatg     56700
     gctcagctgc accatgaata ttacccactc catatacaat ccgatttttt aaatatggac     56760
     gcatacgaga cataatttca cttgttgacc agccttctaa gttccaatac tcttgcgttg     56820
     gaatatctcc tttttcaaaa gcacttgtaa taggtgcagt cgtttctcca atcgcaataa     56880
     ctatttccgc tttaatatat ggcaaaacat ccctagcaaa ctgctcagta cgatcaacgc     56940
     ggtcagggcg gcaattcata attacaattg gagctagatt actatatcca aaatcatcca     57000
     cacgttccca aatacgtaat gttgatgagg gatcattcgc tgcaaaacca tttacgaaga     57060
     acgcaggctt agattggtca gcaaaacgtg taattctcat tgctcctgga tccggatgag     57120
     cattcaacat accacggaat gctgtttcct catcaatccc aagagcctct gctaccgcta     57180
     aagcaagcga tgcattatct gggaagacca tgtaatcaaa ttttcgtaag aattcttctg     57240
     aaattctaga attatccgca acaatcactt ttgtatttct ctcttctgca acctctttaa     57300
     agtaatccaa gtattcactt tcaatagtga ctaaatgtcc attatatgga atggtagcag     57360
     tgaaagcttc agctacttcg tcaagtgtag gtcccataac atccatatga tcttctaaaa     57420
     catttacaat cactccaaca tttgcttgaa tcattttatt ttggaagata atttgataat     57480
     cgggttgaac tgccatacat tcacaaataa gtgcttctgc ttctaaatca gcagcctctt     57540
     taactaccct gcgttgctca ccgatattag gaccttcttt acggcgctta atcggttgct     57600
     cctcgtcagt aaaccaatat atcattcgcg cagatgtacc agttgttttc cctacagtct     57660
     tatatttcgc ttcttgtaca acacctgtaa ttagtcttgt aacggtagat ttacctcgaa     57720
     ttccatttat gtttactcga attgggatag aattgagcct tttctgatgg caacgttgtt     57780
     cccatatacc ataaataatc aaaaacactg tacatatacc tattatgaag atcatctgta     57840
     ttaatccctt cctgcttttc gatttcttgc ttattaagat atttcgactt aagtagagtc     57900
     gttgatacca attaaaaatt aggtggttcc ctgcatatac aacaccgaat tcatctgagt     57960
     ataattctga aatcctatgt tcaatgcgta ttgcctcatc atgtttcaat attcttacaa     58020
     tttttatgtt tttcatatgt cttctcgcac tatcaaggct caatgtaatt aaactttctc     58080
     tccatttgaa gaagaaatat cattttaccc agatcttaac gtatagcttt cagatgtttt     58140
     cctatcgtat ccataagatc cctataagct tgaatcgatt tgctcccttc aaccataatt     58200
     gagagagttt cattcggatt tacgtaaact tctgtaggtt aatatgaaga aaaacgcaat     58260
     ttacagaact cctctgtatc tcctttagaa aacaaataaa aagttctttc ttaaaaactc     58320
     aaattctcca tttctatact agatgttgca tgaatattag gttttcctaa tataacaatt     58380
     gataataatg cagtcacaca cattccactt attatataaa attctgtttg tttctaaact     58440
     taaattcacc ccctttaaat tgaaatctat tcttagtgaa ttaatggtaa tgaagaaatg     58500
     cctttccttt ttatatttgc atatcatgct aaacacaact catttctcat taattgttag     58560
     ttgcctgaaa ttattttaag aaaaataatt tcactaaaac atccaaaaaa attccactaa     58620
     caaaagaagt tttttacaaa aaaagaaaaa tactatttag attctgattc aaagattgca     58680
     attatttgaa aggagaatac ctattcctaa tggaatctat tcttatacat ccatgccaaa     58740
     taattggtgc atacacttta cttgattttg aacaagcttg ttttataaag tgagtttcct     58800
     ttttaaggat ataaattcta ttattaaaat cctctgttaa cataactaat ctaattgttt     58860
     tttagtcgca aaaaaagtac acccattatg aatgcactct tttccaaaac tcctacttgg     58920
     atttcttttt agctgccgca atttcttccc ggactgatac aatcgtacgt ttagcatctt     58980
     gaatctctct gaccatcttc ataagattat catcccttaa ctctaacctt ttttaggtta     59040
     ttagaaatta tgataaagaa gaacctaggt ttattatcaa gagccttggt tctttttagg     59100
     gagaataatt tcaatcaaat gatttgaatt ttttctctta acaaaggaag attttattga     59160
     gttacaaaat caagtattgt gagaaaatat aggtgactga agattaacca atattatttt     59220
     caatgtattt attcagtcca taaatttttt ctcttgttaa atatagcgag tgaattgttt     59280
     ctaaattaaa ttgtgtctca tgtaatttag aacatttgtt gataaaaaga ttcacctagg     59340
     tatcgaatta attaaatggt ctgtgagaaa taatacaaat agtaggtata aaaataacgc     59400
     aaatttaaac tataaatctt aatatatgtc tatatcatta aattaaatta aattaagaca     59460
     aagtgtaaag aaaggggaat tactatgaca ataattacaa atcatgaaat agagtacaag     59520
     gattttgaag aaaatggtga gcttttaaaa ataatgggac atcctatgcg tttaaagata     59580
     attaatgagc tctataagca taaaatgcta aacggaatac aaataactaa aatcttaaat     59640
     cttccacaat caactgtatc ccaacatcta tgtaaaatga aagggaaaat tttaaaggga     59700
     aatcgaaagg gtctagaaat ctactccagt attaataatc caaaggttga aaaaattatt     59760
     gcgttattaa tccctatcga ataaaggctg tattactaca ctatattttc acgaatagct     59820
     cggtcacgta agcgtttcag tttttgctcc tcggtacacc tataaactac aatacgagta     59880
     ggcagtttgt ctttactccc tatatataca tcgtgtaatt cataaacttg gccaggttgt     59940
     agttgtttca taatgtcttc caaatgaatt tgtatatata ctggtttcaa ttgaggggtt     60000
     ttgttttaaa tacgactgtt tcgaattctt ttctatatat tttagttggt aacttaagac     60060
     tagataaata atacccctgc ttgtcttgaa tagacttaca atcttgtaga cgaaaatatc     60120
     ctaagtcacg gatatacaac tcactctttt gtatcatgtc tgttcgagtc gtaccatacg     60180
     cctgatcact tcgttttcct ggttcaattt tcacatcaga aaactctcca ctcaacaagt     60240
     catactctag ttgaattttc aaaccagctt tatgactaca ttctccagca tcaggataag     60300
     taactgcgaa tcggtctgga acttgaaagg ttgtagaatc aaagatacga atgcgctcaa     60360
     agtaggaaga aagagaatga gaaatcttag atacgcctcc aaccttagct tgtagaggtg     60420
     taataaatac agtacgaaaa aagactacag aaggcgagtt aaatcgccga ttaagttctt     60480
     ctgggcttaa taaaaatcct atttaagttt ctaattgact acatagttga ggaataaagg     60540
     tagtagtgac ttgttgattt aaccatacac acaaagataa aaaatgatgc ccgtggcact     60600
     tacgttttca tttcatcccg cctgcttcta tagctaattg attaagtata gcgggagaca     60660
     tatatcgata taactcttca gcgaataaag ataattcttg tttttgattc atattcataa     60720
     aaagcacgtt actattttct cattcacata agaaaatagt aacgtgcttt taacttcaaa     60780
     aatagtctaa aaccttaagt taatggatgt gtgactgtac ccctatctat gttgctcaac     60840
     aattgcacct ggttactgaa caaaacttca cgtctttttt aaaacaccat gactttattt     60900
     caaatacaca catacgttca gaaatcattt atgccactat attcaagtac tagtaaataa     60960
     aaacgagaca aaatctcatt caacagaatt tgtctcgttt ttataaattt caaataacca     61020
     ttcttctaga tactctttct ttttcatcga atccctttat ctaattcagg accatattaa     61080
     tgaacccaat gcataatcgt tttacaagaa atggataacc ttgattcctc cattattttc     61140
     accaaatcac gaaagtttaa attgtaccgc agataccaac caacatttag ttaacaagat     61200
     gatatctggt tgataatgtt tcaacttaag taaattctcc ttttccatac tagatcatat     61260
     tcattttata gggtaataat atcgttatgt tcaaattgaa gaattttttt gcaatagaac     61320
     cacatttctt catattttta tactcctact tctttcttaa aaaactttgc aaccgaccta     61380
     aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaacatac tacctttatt tagaaattac     61440
     tgtagctaga acacgttcga tgggaatata ccccattaca cgactatcct tactgtgatt     61500
     tcgattgtcc cccattacaa atatatgatt tttaggtact atccattttt gatccatagc     61560
     agtatacatc gcttctttaa tataggtttc tgttaattgt tttccatttc ggtatacaat     61620
     acgatcttta atttctaatg tatctcctgg ttttccaata actcttttta caataaaaaa     61680
     ttttgtttgt ggctctataa ataattcaat caagtttgta tttttgatgt catccaaaaa     61740
     tgtccgcttt ttctctgtat aactgtcaat gataacaata tcattatatt ttggtaaaga     61800
     attgaaccaa taatctaatc ttgacgtata gattaattct tgctcttgta aggttggttc     61860
     catcgattca ccttctacag tatacgttcg aaaaacaaat atattgatca ttaacgcaat     61920
     taccaaacta agcaataaag ttataccata tgtaatcaac aattttatta ttttcatatt     61980
     tgatttctcc ttgatttata cttctgaaca agcaaacaca gtcatataag ttattcagat     62040
     aacatttacc acatacacaa aatttaacga ttttatgcca aaaatactta tttaaatcga     62100
     aaatatttca tatgtctttt ttgattatat tgattcaaac atgttagaat tcatattctt     62160
     gttgtctaac gtgtaataga aattaaattt gttcatattt tatataaata aaaacgaagc     62220
     ctccaattag actccgtctt tttttagcgt accatatata tccatacttc tatttacttt     62280
     ttaaacaact ttgcaataga actaatagca ttcattgagg ttctttaact taaaataata     62340
     atattttcgg cagttctttt tcagtattat ttgttcgatc tattaccttg atactcaaat     62400
     caataccaga ttgcccatta aattctgctg catcctctaa tacgtaaacc tttttcttat     62460
     cgtcatctag atatactcga tctaaaattt tttcttttac ctcttctggt tttaagtaat     62520
     aatcatcacc gttagtgaat cctaggtgaa ttttaatatt ttttctagat aacaactcat     62580
     catgaaaaag attaccctga tctggattgt tttttaattc atcataagct atttgtaggt     62640
     tctttactac accatatttt gttttctcat ttaagaattt ttcactcctc ctctgggtac     62700
     ctgtatccgg gtcccagaat ccagcaactc taatattgga tgtaccaggt atttctcgtt     62760
     tattttggaa tttccctgaa aagttagtag tagtaaatac ataatcaatg gcataatgct     62820
     tatttgcagg gacagtaata ctatctcctc catactgagt tgttgtttct gtagattcaa     62880
     gtgtggaatt gttttcacca aatttttgtc cagcagtaag ttttactcct agttttttaa     62940
     aatatggaac tccaaattcc cctgttactt cttgtccaaa tgtaaattct ttaaaactcg     63000
     ttttcgttat agaatttact gatttaaaag ttctttgtgg tgttttgaat gtcgcagctt     63060
     cacccatatt cctattatct acatcaaacc taattacttc tttcacttgc cctggggaag     63120
     tgtttaaaac gtcaacaaaa gttgttgtta ccttccctct actatcaaga acccatttcc     63180
     atacatcatc agtactttga ctttgtacat aatgagcatg tgcagcaatc ggtttttgta     63240
     gtatatctgt tgttcctaaa ctcataaccc caaaagtaaa aactgtagct gttacaagta     63300
     gtgttttgtt tctttatttt ttctttacca tattcttgtc ctccctactt gaattaattc     63360
     ttgctttctc tgtctttacc gaccttttat actcacaata taaagtaaca atcatgcttt     63420
     ttgttcataa taagaatgaa ctgtgtaata aataagatga tcaaagaatt ggttaatttt     63480
     cttaaccaat gcttggtatt gctgtaaatc cggatttaat aatgttaaaa tattcataat     63540
     ttctatttta gccacatttg tattgtgaat aaattcagca atatttactt ttgcatcaat     63600
     acgctctctt gcaatttttt tggatgttat ttctatctct tgtaaactaa tttcttcttt     63660
     caggtacata ataaaagcag aaagtaaatg ttccccattt ttaataattt cctctttata     63720
     aggatctctc tctcgaataa tgaccttttt tttccaatca gatataaatt tttcttgacg     63780
     ctctttcaaa tatcgacaaa gaaggcattt gatttcttcc attaatacgt caactccttt     63840
     agtttaagat gttttgttat atttataata tgccattaaa aaccatataa ggttaatttg     63900
     tttatataga ttttcaaaaa aattagagaa aaaagttaac aaattgtatg gtatacttaa     63960
     ttatttataa taaaaatgaa gactatttac ataaaataac tcctgaatta tactgtttat     64020
     tgtctattaa aatatttcag aataataaac ggaaggtgat ttatgatact aaatctatct     64080
     attgaaaaag cacttgtacg aagaatcaag ctaattcgtt tcattaatca agaaaaccgt     64140
     tggtttagaa taaaagaaat atctagtcat ttacaaataa cagatgtaac tgttcgaaaa     64200
     gatatagaat tattaaaaga agaagtgatg gaatcttgga gtttaactat tgaaaaagga     64260
     aagggggttt atttagaaaa acctttgaat gaatctcttt ctctggttga atcgcgaatt     64320
     ttaagaaaat cattggtact aaaaatttgt gaagagctta tatttaaaaa aaataccata     64380
     cattcattat ctcaaaaact tcatttacaa ccctcctctc tgtacacaac tattaataaa     64440
     ttaggaaaaa aatacacaac cttggtttaa aagcacaaaa aaaccactgg aaatcatggg     64500
     tcgagaacaa gacgttcgtg tatttatgtt gaatttatat tgtagtatac ctggagaata     64560
     ttggccattt ccttatataa acaaattaaa cttgcttgat ttaattacga aattagaaaa     64620
     aaatttgaag gttaaactgt accaaaatgc aaagcatact ctatgcattt tgtttgctat     64680
     aacaatttct agattactga taggaaatac aattgaaaac ataaatgaat ttattaaaat     64740
     gaataaaaat gatgaacatt ataaaactat aactggcatt ctcaatgaat tacaacctca     64800
     ttttggtgta agattatctg aaaatgaacg ttcatttcta gcagttgcat tcttattatc     64860
     ttttcagaat tacactacag aaactcataa aaatggatta tccacataca aacaaacatt     64920
     tatgccactt gtaaaaaaat tacaaaagat ttagagttaa ggttacggtt caatctgaat     64980
     tatgatgaag aattcttaat tcatttagta gctattataa aaagaatgtt aaataagtgt     65040
     tttataaaaa attataatta taacattcaa cttgtaagat atattgaaag taagcattca     65100
     aatacatttc aaattattaa agattatatg gatactttgg tatatagtgt gaaatcaaag     65160
     ttcgatgatt atgatattgc cctattaacg atgctttttg aaacaaaacg aatgtcccaa     65220
     aataccaaag taaaaagagt atatttatat aattcatata gttttataca tcaaaattat     65280
     attactgcat tacttaaaga agcttttaaa ggagtaatag agattgtaga aaaagatacg     65340
     ctgaatttaa cttatgaggg gctgcaaaag aaaaatgtag atattatcat ttccaatgtt     65400
     aagttggaaa taaaagatat acctgttgtg caaatctcag atatgccaac ggataaagaa     65460
     ctatctaaaa taaaaaaatt actataaaat aacctgtatt tcttgttata aacttttatg     65520
     tttgtaaata acttagtaca ttttaagtta ttgaaaacaa accaataaaa aattaggatt     65580
     agtcaaagaa gacgcaaatg actattactt ttgatataaa aattaaattg acatatattt     65640
     tagaacatgt taaaaatata aataactttt atcttaatca aatgcatatt cgagcattga     65700
     acggacaaag tagtgtctat ttccctattt cagagagctg atggttggtg tgaatcagta     65760
     taaagatatg acatgaaatt catcctggag catctttcat gacgaattat tacttgtgat     65820
     gaaagacggt agtttatacc gttaacaaat agagtggtga agtttcttca caactagggt     65880
     ggtaccgcga tcatttatcg tccctacatg atgtagggac gttttttgtt gtcaaaatta     65940
     aaaacttaag tttttttata aattaataat attgttaaag gcctgacaat actattttca     66000
     tcccccaaca aataaaaagg agcaatttac atggatttaa atatatggat tacagtttta     66060
     ttagttggca cgataggagt aatttctcct ggtcctaact gggcagttat tataaaaaat     66120
     agtctgtatt caaggagctt aggtgtatca acagttgcag gtattgccac tggaagcctc     66180
     attcatattg tttattgttt aattggtata ggagtaatta tctccaaatc tatcttgcta     66240
     tttaatacat taaaatggat aggagttgca tatttactat atatcgggat taaattattg     66300
     agatcaaaaa aacaaagtcc agctgctata atcaaaaaca atgaatctac tacatggaag     66360
     gcatttcgtt caggattttt aacagacatg ctaaatccta aagccactct attttattta     66420
     gcaatattca ctcaagtaat agaaccaaat acaaatattt ttgtacaatc tgtgtatgga     66480
     ttaactgtgt ggagtgtaga gattttgtgg catatggtat tggttttctt ccttacgcat     66540
     aaatcagttc gtaattattt cttatctatt tcacattgga ttgaacgtgt gactggaact     66600
     gcattaattt tactaggaat tcgtcttgct tttttaaaga atgattaatt cgctaaatca     66660
     aagactaatt attctaccta ctaataaaaa gttaaactaa gttcatctct ttttatgatt     66720
     tgtaaaatta aatattgtat atttatataa aaaaccagtg atatcggtac gtatacaaga     66780
     tatcactggt ttttgtaatt ttcaattttt atataattgt tttttatatc tttacgatgg     66840
     ctttattatt agtaatgtat tgggaaattt aaacaataaa ataatgtctg gttgataatg     66900
     tttccactta aataagtttt ctttttccat attgatcaca caccttttaa agtagtatta     66960
     ccagtatgac caagttggaa aaacacattt caagcatttg gggatttttg caccagaacc     67020
     attttatcta agtaatctgt tcttacatcc ctaatatatt tatggattcg tccatacttc     67080
     ctggattttg aaaaacaaac taaaacggga agtgtgatga gtcaatgtac aagaatttta     67140
     gttttcaacg tatgaactac gagaagaatc tgccaaaata aattgcctta taataataaa     67200
     aaacaaagag aatcgcctag tggcgactct ctttgactga gtaagtaaat atgaatatga     67260
     aaaattgaca agtatcaaag gggataatga aatcattgaa tacttcgtct tactttaaac     67320
     aatatcattt ttagatagaa atgcatattc aaaaaaaatc ctttgataac ggtaattcag     67380
     tacaagctgg gagtttttta ttagaatagg gttttaataa aatgcatgaa actcaaaagc     67440
     ttataacatt cacgtaagta taaaaacaag gattataatt taaaatagag tatgctcaaa     67500
     acttttctgt ttatcatttt atccaagaac actccttgct caggaaacat gaagaggcat     67560
     aactgagtag gcgaggaatg tgttaacttc gaacaaggga tggacaggaa gccatattac     67620
     ttgttcgata ggtagtatca taattatttt actatattcc acatgtatgt ttgttgtcta     67680
     atagacatag aacaaaatgg aggtaaacgg aatgatgatt gatatagcat ataaatttca     67740
     tacttatcta aatcaagtaa caggaaaaag tttgacatat ggtatatgct ctgccagact     67800
     gcctactaag aagaaagagt ttgtttggtt aaaaagaaat ggatagtatt gcgattcagt     67860
     tgtctgttca cagccctgca gttgcttata cacattaaaa aacaaaccaa taaaaacatt     67920
     attgttgtgg gaaacaaaat aatgttgcca aaactagttt ttgttcaatt taccaaaaat     67980
     cgtaacgtta aggggctgaa taaataactg tataatctta tatgaattat ttatatttcc     68040
     ctttagcaaa ggcaaaatta cttttttaaa atttgtgtcc tctgttattc ttatatagga     68100
     gctgctagtt tatcttgtaa atatagacat tatactcttt atcaaattgt acgagtaaaa     68160
     aggctaccca caaatcgatt ttacagactt gagggatagc ctttttactt tctatattaa     68220
     tcaatttttt ggcaatagta tcaatatatg gagttttatc tatgcaagtt ttaattatta     68280
     ttttaatatc agtaaatgtg tctatactac ttattatcga gaggaaaaaa gaggaagata     68340
     aacagtaaca tatataataa caaattctga attgactcca tatgatttat tgtaagagga     68400
     acggaaaatc aaggattctt tttttatagt gcctgacaat cgttcgctta attacggaag     68460
     gaaattttgc tacaaatatt atcccgatgg acaagtacat aattggcatt ccttgtgttg     68520
     gtaagttgag cctttattta aaacgtggaa atcgctcttt catatttatt aatcattgca     68580
     aagagataga accaaaataa ttggaatgct acttgtatag gtaactaatt agcactctcc     68640
     tctactccac gattatgttt caaatgcgaa agttatcaaa gaacaaggga tgagcgaata     68700
     taaagtcata tatataattg aatactgctt ttttcttcta ttccaaacca tacaaaaaca     68760
     cccaggaact atcaaagctt tttcttcgtt tgtttaacct cttacagcaa aacacaccgc     68820
     aaatgaagaa agaacagtaa ctgtcgctaa ccttgtaagt atacttgcta aatagtgaaa     68880
     aattttactt attgattcat actgaccaat ctacattatc tattacatca ggaaaatatt     68940
     tttgccaaat gaatattcta atttagggta ctcagctaca ggaatgggta aaagaaataa     69000
     aagttgagaa gctaagtttt tttattaagc tgatcaattt caacaaaacg atcaagcttc     69060
     aacgtgatga atgaatttct ttaaaaggta tgtaaggatt atgactttgt tatgtttgat     69120
     atcccctgat gttaccaatt ataaatgtga ggttgttagc tattccatgt aatgttttta     69180
     tacatgttgt ctcggggaat caaatggaaa aaagtagcac taataataaa agaagtgtta     69240
     cataagatca aaagaaattg cttaagaatt atttacatga caaacagaaa aaagatatag     69300
     attatcctat ttaaatatac atattaattt cgtagggctt gcatatttaa atggaattga     69360
     attaacaata aaggatatga agacccgtca ataaccaaat aaaatatatt atcatagggt     69420
     tattttaact acacagaaaa tctcaatata tatttgaaat aaataactaa gggtgataat     69480
     tatggaaaaa gatattagcc gaaaaattga tttgttaaat atcctaattg aagaaaagcg     69540
     atggttcacg ctttttgagt tagaaaaaaa tctcaattgt tccagtaaaa ctataagaaa     69600
     agatatatca attattaatg acttattgcc aaaaactata tttatacatt caaaaaaagg     69660
     aaaaggagta aaattatctt tacctcagaa tcagtcaatt tctgaagcca tttctaatct     69720
     tctgaagaaa tcattaacgt ttttagcaat tcagcaattg ttagaagagc gttcaaatac     69780
     agtcacatct ttagcagata aactatacct tcctatttct tctactaata ttgtgctaaa     69840
     aagagtcagt aaatatatta aaaaattcgg tttatctttg gaaaaaaagc cattaagaat     69900
     tgtaggggat gaatttcaaa ttatactaat gttttctgaa cgttatttag aaagttatcc     69960
     tgatacagaa tggcctttta cagaatataa agaagaaatg ctgatagatt atataaatta     70020
     tattgaagaa aaattagaga ttgtgtttta ttctaatgat aaaagaagaa tggcctttat     70080
     tatgacaatt cttttcaaaa gaataaaaca aggacataaa gtaaagttta gtgaatggat     70140
     tataaaagaa acaatggaat ctatatatta taaaaaaata tttgagggta aaaatgtaat     70200
     aaaagtaaat aaaaatagat ccttaaatat tgaagaacaa gtattactag tcataatggt     70260
     taaattgtca aggtatgtaa gtaaagatga aaataattta aagcaagaag aattagtact     70320
     ttacaaagag ggggaaagca caacttatac atatgtaaag aatttcatca gcatccttga     70380
     acaagaatta aaaatagatc taaacaataa tgaagaattt gtctatggaa tgattgagta     70440
     ttgcagggaa gcgtttcata tattaaagtt tattccaatt ttaaaagcac ccgaaaaaga     70500
     tacgtgtaag tacataaaaa aacattatga agaaacgttt tacttagtga aacgagcata     70560
     taataaatgg ggagcagaaa tgaaattaac agatattccc gatgaggaaa tcgcaaaggt     70620
     aactatgcgc attgtagcaa tagggaaaca acataatata aacagaaaaa aagtgttgct     70680
     tattaccggt gaaggaaaaa gttgggagga atatatgaaa agccgtatta ataaacgtta     70740
     tggcgatcaa ttaaaatttg taggaggaca tgcaaaaata ttaaatggaa atactgataa     70800
     tatagataat atagatattg attttattat tactactgtt cctctgaatt ttagttggaa     70860
     atccattgtt tatgtatcac cgatacttca ggaacgtgat ttttatgaaa taggaatctt     70920
     tgcaagcaaa tagtattttg atacgcaata gctagattgt aatttaatat aacgagtaaa     70980
     gagtgatggt gtggatttgg ttattaataa aataatattt ataacggata ttaacttcta     71040
     gagggataag taaattattt aaaaatgtat tctttttata acagtattat tttcgtatat     71100
     aaggttatag taatataaat aaccgatttc cgatgatatt accaggagtg ttgtgataat     71160
     tgtaacgttt ataaccttcc tttatattct atcaactgtt taatttttat aaatataaaa     71220
     gagttctctt agtaaacgta aaaaacataa tacaacattt tctatattat gctgtaccat     71280
     taaaagagtt tttaacaata ggttgttaaa aatatgtaaa aacactttta actacaagct     71340
     taaatacttt ttaattttaa atacccttaa ttaaatcgta agtattttac ctattgttat     71400
     gtgaaaatta atattaaaaa taataaacta aggagaatat aaaaattatg aaagaagtaa     71460
     ctattcgaga atttataaaa ggagtcaacg ataagaaaaa tttaagagtg attttggaga     71520
     atgatttttt gagtatgcaa tcaaataagg tgcttaattt ggagtgtaga atagggaaga     71580
     tagtaataaa tgattgggag gttaatatca aaaactgtaa aatattaaca gtcgaaaaag     71640
     aatacattat aacagatgat tactcaaata caaaactaat tgtttatcct tcagtatgat     71700
     tatctattca aaaagctaaa aaaatgcgat gttaatataa taatataaaa aatgaattac     71760
     agaatcaggt tattcaaata tagaaaaagt tcatctatca gatgtctgaa ctgataaaat     71820
     acaactttag taggaattta ctgcaattta tatttcttat atataattgc accaaaacct     71880
     tactactccc acctgaacct cgatagtcag tggcaaaatg gttaggcagt cggaacactg     71940
     ttgcatctaa aatacggata cgattgaaag tagagattaa gtgtgcagaa agtgagtaat     72000
     ttgaacagag tttttgtttg ggaagagaaa taaaaacttt ccgaagaaat gcgactgctg     72060
     caggttgttt tgctgttcaa gacctctcag cttggattat aagaatccta attaatgaag     72120
     acatggttaa cactgtgtta gaaactcttc agccagtgag caaaggttta tatatttaat     72180
     ttcaaatcaa gttaagaaat tggttttttc cactacgaaa aaacgagttg aattctcata     72240
     aaaaactgta aaataataaa attttcattt tggggatact tcaaaatttt agcttgatgg     72300
     gcatgaggta ctaacaaaaa aatcttttta ttaaggtact ttttcattac cataaatatt     72360
     tatattagta tataattttg aaaaacactt attatattta ataacttttc ccacacccca     72420
     aaaaggggtg ttaatacaaa acactccaaa ttcagttgta gtttaacgtc acggattatt     72480
     tagaccattt agtgctgaaa aagcaacgtt atttataata atagcaagtg gtcttagttt     72540
     aattgatggt tcattaatta gtattttcta ttagctttta gttttattca ataaagtttc     72600
     atgtagcatg tgaaggaggt ttataatatg aagatatgga aaaacatact gaacataata     72660
     ttagcacttg ctgtcccaat cggtttatta tttattagta tgatgattgg tgagggagta     72720
     ctcgatctgt ttttagatat tttaaatata aattatgatg acctatcata ccttgaagag     72780
     aaagcttttg caatgtttat ccctttacta atcattgcct taacattact agttactttt     72840
     ttacatcatc gaagcctcag acctcttcgt ctttcaacag gattcttatc aaaagaaaca     72900
     tataaaaatt atggaattgg tattgggatt gtctttattt ttttgtcgtt aatacaatct     72960
     tgaatttact tatagcaggt ggatccatta cggttagcgg taatccagat tctgtaaaaa     73020
     tgatattatt gggcattccc attgtaatca ttcaaagttt ttatgaagaa attcttttcc     73080
     gtggctatgc tttaggaaca ttactctgtt ctacaaatgt gtatgtagca attttattaa     73140
     atccgatagt cttttctgtt ttacatttta attcacctga ttattctggg ttcatagtat     73200
     ttttcatagc atattttgca ggtgtattct tttctatttt aactttagcc tataataatt     73260
     tatgggtcgc tgctggagga cattttatct ggaattacac tgcggcgatt ttcggagatg     73320
     gtggtgaggg tatgttattt gatacctatt actctaacaa ggatatcacc ctttgggtat     73380
     cagctgtcct tcttatgatt ttgagtatcc tctcatttat tgtatataaa aatcaaatca     73440
     taaaaattaa tgatgaaatc aaaagaaaaa aacgttcact taagcaaatt atttccttat     73500
     catattaaca gtttaataaa aaatgatttt ggtattgtaa tctgtacctt ttataaaatt     73560
     cattaaagat ataaaaacag ccattctttc atgggtaccc atgaaagaat ggctgttttt     73620
     gatgaaaatt atacatacgt aaacttaagt tgatggatgt gtggttttaa cccgattaca     73680
     tcgctaaata aaagctctat atgtttttat attgaatata tttacttagg ctaaaaattt     73740
     caagtccttt caattctgaa ttctagatat taaatcaaga tttaaccgtt tgtttgatgc     73800
     aaattgcagc agattatgtt agaagactta taggagaaca taaaaaaata gagtgcagaa     73860
     tcttacctct acactctatt tataatcacg attaaagaat atggagattc ttcaacgcaa     73920
     tataccctac taaaattata ctatatttct accttacttg taaccaatag ggagtcctta     73980
     atcggactcc attttttacc ttttacactt ttatatttca ggatacaaag atacatgtat     74040
     ctttgtatct ttgtatcttt tttgttattt cttcacttca gtccacttat agttgaattc     74100
     tccaccgaaa tcatttgtca ctatgccttt gactgaagaa cgttgtaaat atgatcttcc     74160
     ctgctgatag aacggtgcaa ctgccccatc ttctaataag attttttcag cttgtttcat     74220
     tgcttcccaa cgagcatttt catcaccagc taaattcgtt ttcacttgat gaattagttc     74280
     atcatattgt ttatttgaat acttatcaaa gttatatgta ctatctgtcg tgaacaaatc     74340
     taaaaatgta attggatcag gaatatcagg tccccataca tcaaccccta attcgtaatc     74400
     actatttaga agtaattgaa tttgttgttt acgtggctgc ggcttcacat tgaccgttaa     74460
     tccctctaaa ttcttttcta gttccccttt taaatactcc gcatttttct tagcgaatac     74520
     attatcactt gtaagtaatt ctagtgttac ctgttctttc ccaagttctt gttttgcatt     74580
     cttccagtgt tctttcgctg ccttcacatc atcttttact aatgctccat tttcctttcg     74640
     gaagtctttt ccgtccgaaa tttttgcgaa atcggctggt ataaaaccgt ctgcaggaag     74700
     agaaccatta tttagaactg tatctacaaa ggctttctta ttcattgcct gactaatcgc     74760
     taagcgagca tttttatttt ttaacacttc attcttctga ttcatacgta aaaactgtac     74820
     agtcacttca gaacgttcct tgaagtcggg attctttcta tatttatcta caaactcacc     74880
     tgttagccct acacggtcaa gctgacctga ttcgtataga tttatttctg ttgatttatc     74940
     tttcacaata tcaaagttga tttcctctaa tttcactgtt ttagcatccc aatagttcgg     75000
     gttctttttc agttgaaaac tttgttcatg cttccaatta tctaatgtga atgctccgtt     75060
     ataaactaat tgatctgctt ctaaaccata ttgcttccct ttagattcga aatatttctc     75120
     gttaatcggt aagaacgttg cgaacgttgt caaatctata aagtaaggaa caggctgttc     75180
     taattgcact tctaacgttt tatcatctat tgcttttatc cctaactgat ctacaggtaa     75240
     ctctttacta ttaattttct ttgcattctt tatatcaaag aataaaaacg catattccgc     75300
     agctgtatca ggattcacag ctcttttcca agaaaatacg aagtcttcag ctgttacagg     75360
     tgttccgttt gaccattttg aatccctcag atggaatgtg tatatttttt tatcttcact     75420
     cacatcataa gattttgcta cagctgggat tggcttgttt ccttccccca atgtatataa     75480
     accttcaaat acgtttttca ttacgttcat ggattcaccg tcagttgcct ttgctgtatc     75540
     ttctttcttg tcgctactac aagctgttag caaaaagcta gctcctaaaa cagcagccac     75600
     aataggcgtt acttttttta acatgtttct tttcttcctc tctacgtacg gtcatagctt     75660
     tagattatct cgttgtatat cgcctagaag aagaggattt ctttgccccc taagtaataa     75720
     acctcataaa tctgtcgcca gttacaacgt agcacccaaa gataggcatg tcaattgtac     75780
     aaattataaa ttttaatata tgaatcacaa attataagga tatttactat acattctttt     75840
     gtattgatat ttttaagccc tcttctaaaa aacggctctt tattttcgtt tttaacgctt     75900
     tttacaacta ccattaatac atttgcacca aaaagaggaa aaatcataaa aacgaattaa     75960
     tagccccctt aaatggaatt cctataaaat catttcaaat tattgttttc atcctctttt     76020
     aagtcttggg ttatatttat ctacctttgc ggtatgtgaa attatatata tatatatata     76080
     tcaaaagaaa aaaggaaggg gaataccccc ctcctttact tgtacttttg tcgtcggagt     76140
     tcatcacacg ttggacaata tacaaagacc cattccattg taattgtacg tcgccctgtt     76200
     gaaagccaga caacacgcca tgcagcgccc ccacatttat tgcagcggta cacctcattg     76260
     tgatttacct caaaaccaat ttgtttctgt ttcatttaaa tctctccttt gctcttattt     76320
     gaatttaaaa gtaaccatta cattttccta ttactagtct tgtagttttt tcaaaaaaag     76380
     gttaaggaga ctaaaaaaat gaaaaaaatt taaatttgac ctgttcagtc gttccctttt     76440
     tatacaggta cggaataaaa tttgctacgt aataagtaat ttgaaaggag aaaatacata     76500
     tgaaacaatt tgttaaattt tttctatcgt ttttagttac attactagcg aatgtagcaa     76560
     gctattatat cattaatatg ttcttttaaa gagaagcctt ccgagtatat acggaaggct     76620
     tttttactaa taaaacaacg aaagtacacc cgattaagag tgtactcatt cccaaaactt     76680
     ccaccaaagc tttttctctt tcgccgctgc cacttcttcc attattcgtt ttgcttcttg     76740
     tatctcccta atcattttca taagattttc atctcttcgc tctaatcttt tttctattct     76800
     ttcctcacgt tccttgcgat cactcatatc ttcctcaatt aatgcattcc gctgatctat     76860
     gcgatcactt aatctctttt ccatttctaa tagatttgct tgctgcaccc tgtttagttc     76920
     cgctaccata gcgctatatt gttcgtggag ctgatactgc acatgatacg gcattggatt     76980
     tacttctttc atttcttctt tcttattagc gattccatac tcctttacaa tcaatttagc     77040
     agccttttct aaggtcattc catcctcttt acttagctct actaagtgct gaagaagtac     77100
     cacatcaaac tctgtatact ctcttcttcc ccgactattc ttccgtacct catacccttc     77160
     ccgttcaaga acatccgagt atttcctaag tgtgctgcca ctcaccccta gacggctgta     77220
     aacctcattt gcggtataca ctatctccat tcctgccata gcgctacccc acctcctata     77280
     aggacaattc aatacgaaca gtctaaaacc tctaagaata aatcgacgag actcgtactg     77340
     tctttgctgg gttttgtcgg aataaataga ttggaaacta cacaaaatct tacgtgaaat     77400
     tatttatgta aaacctcttc ataaaagaac gtaggttcgt gtataatagg aacaaatgtt     77460
     cttttatgat ttagggagga atcacgatgt atgactattc aatcctaccg aacagaatca     77520
     tcttatgtgt tgatttacgc agcttttacg cttcagtgag ttgcatcaaa atgggacttg     77580
     atcccatgca tacaaagttg gctgtagtcg gcgatgtaaa tagaaatggt tcaatcgttc     77640
     tagctgcaac accaccctta aaagccctgg gcgtaaagaa gatggcaagg ctctacgaga     77700
     ttcctcgaag aaaagatatt cttgttgtaa atccgattat gggaacatat ataaaatgct     77760
     ccaactacat aacaaaacta gctttacagt acgttcctat tgaggatttc caccaatata     77820
     gcatcgacga attcctgtta gatattactg acagcattca cttatttgct agcgatccat     77880
     acgaattcgc cttgaaattc aaacgtgaaa tttatgaaca tacacgcatt gaatgtacaa     77940
     tcggaattgg tccgaaccct ttgatgagta aggttgcttt agatatcgaa gcaaagaaga     78000
     acaaagaagg gatcgctcat tggaagtatg aagatgttcc aacaaaatta tggagcatac     78060
     gaccacttca taaattttgg ggcatttcgt acaaaacaga agaaaaatta aatcgaaaag     78120
     ggattcacac tatcggggat ttagcccatt accctcttac atacttaaaa caaagtttcg     78180
     gcaagattgg ggaggaattg cacttacata gcaatggcat tgacttcagc cgtatttcgg     78240
     agaaatatgt tcctgctaca acttcagtcg gaaaaagcca aattctaatg cgtgactata     78300
     caatagaaga atttccgatt gtgctactgg aacacattga agaagtctgt tatcgactta     78360
     gaagacaaaa caaacttgct caaaccgttc atttttctgt tggttatagc aagagttata     78420
     acggcgggat tagaaaaaca catactttaa gccgtcccac taacttaaca atggatattt     78480
     ataaaatttg tacatacttt ttacatcaac aatatactgg cgaaccaatc cgcagcataa     78540
     acatatcttt aacaaatttg cttcaagaag gcgaagaaca aatttctctt ttcgataatg     78600
     tcacgcaacg agaacaagaa gtaaagctta caaaagtaat ggatgaaata cgcacaaggt     78660
     ttgggaagaa cagcatttta cgggggattt cctacacgca tagcgccaca actagataca     78720
     gaaacacact aataggggga cataaatcat gaataacgct aatatgccaa aagggcgcgg     78780
     aatggtaaaa tgggcaccgt tcgccgcatt gacttcccaa tttgacggga tacgtgagat     78840
     tattaaggaa caaaacaaag taacacgtcc aattctaaca actgcagaaa aggaacgaat     78900
     cgaaaacata ctgttatgct ccttattatc cgaagaagaa atactaatta catattatga     78960
     ggacggttat ttactctcag gttatatgac tgtagttgat atcgacccat taaatagcgc     79020
     tgttatatgt acagatgctt tttataatac gatgaaactc caattttcta atataataga     79080
     tgtaaaatag aatcattaaa aggagtgtaa aaaatgcaag cggaacagac aagaaagaat     79140
     gcagcagggg caattatcca taatgatatt aataaccatc cacatctaaa tatacctatg     79200
     attattaatg agcaggatgg acagatttac gaagttttta gtgttggttt tcattctaat     79260
     gatgcaatag caatggtaac aacggacggt ttttctacaa caagggtaca tacaccgata     79320
     gtaacagtaa aaaatgatga tggcagtttt caagcatatc gcttacccct agaactcgaa     79380
     tattgggtat tttcttgttt acaagctgct tcagcaggga aaaatccctt tccgtgtaaa     79440
     gttgcttttg gaatcattga caataaattt tatgtggaat ttaaataaaa aaatacttaa     79500
     tttaattatc tcaaaagcaa ttaagaaaat taatcaaaaa attattcact acataaacat     79560
     tttttaaatt ttctaggaat caaaaaaaca atccatttgt gtagcttttt ttgattctgt     79620
     tgacaactta aagaacttga gataatataa actcatagtt tatttttaat ttgatgcata     79680
     aattaatcaa cttttgatta ttaataataa tgggacgaaa gcgcccggtt gaatttttgg     79740
     acatatgagc cgttaaaaaa gaagtaccat ttttggtact tcttttttta tatagaaaag     79800
     tattttctca aaccgtaatg cacagcaaaa tattgagaaa aattaggatc actcactgca     79860
     tcatccctat atccccaagc ataacgataa atattggtat ttccatccct accgtgtatc     79920
     cacgaattac ctataacacc cattttatat aaatgacgca ttgtctcttt taaattttta     79980
     atgtttggat aatttccgga ttttccattg taaaatttct ctatcgtatt gtaattaaat     80040
     gaagctttct ttaagtcgtt tattaattgc aatccatcta ggagcatact tttattttca     80100
     ttgatgctaa cctcattttg aagttcatca taaaaccatt ttgaatattc tttcgcacaa     80160
     tctttaaaag ctttcgggtt aaaagcaata gcatttggat ttttttctat aattaaattt     80220
     aaatacctag ttatatctct aggacgtccg aaactataat ctagcagata agaaataata     80280
     tccttctcat ttattcgatg ggaaaatatc attttatata attcatcttt acttaaagac     80340
     tcatactctt ttactgattt ttgaatttta ttcaatatca tctccattaa tggatgttcc     80400
     gcacctttat aggatttgtc tatccaatag agattcactt tactctcagt aactaactta     80460
     tttgagttag ctgaaaattt atgtatttca tcaataatat cactacgtaa caatacaatt     80520
     attttagtat tctttttacc taaatctcta aatacaagat ttaaattttt aacggtttct     80580
     atcatagcaa tcaatgtgcg gtgataaaaa gaatcttctc ctattttttc ctcaagttca     80640
     tctaagtcat cgtaaataag aacgatttct ttatcctttt taatgcattt aaataacata     80700
     tcctctaatt gacctaacaa ttcgaagtat tcctttggaa tataattcgt agaaacttgt     80760
     gcattatcct cacgtgctgc tgctataccc aattccttag gggtttttgt tttcacatca     80820
     gctttcaatg aacttttact cccaaaactt tcattgaaat ccttaatttt aaatatattt     80880
     tctgtatgta ttttctttct aaatttatgt aatttgtatt ctgctgtacc aggtattttc     80940
     tttttccact ttgcaccgtc caatattaca tcacaaaatt taattaaaaa tgtccatttg     81000
     caaaaatgcg aaatttcttc tcttttcaat tcccgattcg gtaaatctat caatttcctt     81060
     aatgtataat cattcttggt agaaatctca caataactac ctttattttc attgacctta     81120
     ttatgaacat acttagctaa gattgtttta ccgcttccct ttcgacctgc tattataaat     81180
     ttttccggtc gcataatttc ttcaaatttt ctatttttgg tataaaacaa ctgattgaaa     81240
     tctccacggg ttgcttcaga ttccccatct atatttccta tatacaattt ttttaatggc     81300
     actttcttaa ccaagtaaac acctcccgta atagtaatca ctgaagaata ttatagcata     81360
     gtaaatattg agaaaagcat atacttatta aaagtatgta catattatgt atacacatat     81420
     tacttatata cagtgtcatt accttatata tttaaaagaa attaaatata actctctact     81480
     ttataataaa actcctatta cttttaggaa aaagaatctt cattgcttct actgttaaaa     81540
     tccattctcc acgtttcttc tctattggtc tgtagtattt caatttccct tctctaatca     81600
     atttatcaac taattcacta tctttacccc tcttcaactt cattctcaac gcttcttgtg     81660
     taatccccca acgatcacac gcttctcttg gtgtcataat ttcatctagc ataaataaca     81720
     tccaaaccgc ccctttcgtt acttataagt aacatatatt gaaagtatac gtcacttata     81780
     agtaacaaac aagaacccac aacaaaaaag accctattta gggtctttct tcctagctta     81840
     atagaaaata tttcattaga gtaagtacca cttgtaacgt aatatgtagc cccgcattga     81900
     ataaccaagc cttcagacca atccttgtcc atttttcacg cacaaatgaa aacttatttc     81960
     caatcttgat tgaaacctta attttattta aattgctctt ctcacttcct ctcttcattt     82020
     ctctcattct gttataattc ttacttactt tactagattt tttctttttc atccgaatca     82080
     cctcttatat ttttttggac attatttgaa tgtcaaaata taataagcag ttcattccta     82140
     tgaaattcgc acttatcatg tctaccttgt actagaacgt tcctatgtct tgcactatga     82200
     aacgacaagt caaaaatgat agaaacaaat tctagaaaag gcgtttgaaa aataacatcc     82260
     attctatatt tgttaatttc caatgcactt gcgtttcact gaaaatatgt aaaatatgta     82320
     attaaaaggt attacgaaca ataaaataca ttgcagttca aaaatctaaa ttctcgagtg     82380
     agaattttat agtttaagag attttcacac cctatagtta gctataacaa taaattcatc     82440
     taagtataat aaattatatt tagatataaa taacacttaa tctgtaagaa taatatattc     82500
     ttctctattt acctatactt acatttttaa taaaatatta tgaactagat gttgattaaa     82560
     agtattttat atagaatact taattggtat ttttaggaat tagataaact ctataatatc     82620
     tcacttcttg aattcacata attttcaaaa acaaggactt aaagaattgt aagttgttgt     82680
     ataatggaat caaaccatat gtaagatagt ttccccgata tgaataacca gatattttat     82740
     gtgtcctgta tattggctgt aacctcaaaa agagcttgta gtgatttcta caagttcttt     82800
     ttgcattgat tactaatagc aagcattaca atgatatact aatattaagt ttttttagaa     82860
     aggataggcg gggagaaata tgaaagacgt agaatcacat ctaattgctc atttaaaaaa     82920
     aataaataca gcaccttttt tatttatcgg ttctggattt tcaaaaagat acttgaactt     82980
     agaagactgg gcaggtttaa tgaaaaaatt ttctaaccta atgccttatg aatttgagta     83040
     ttattcctct acagcaaata aagattgggc tgaagtagct gaattgatgg caaaggattt     83100
     ccatccgatt tggtggaaag aacagcaatt tgaaaataat cgtaaagaat ttaaagaccg     83160
     aatcagtagt aaacaaagtc ctttaaaggt agaagtcgca aaatatttga atagcataga     83220
     atacaaatat ggtttagatg aaaaaaatga caaggaaatt gcagcgctaa agaagattgt     83280
     aattgatggc attattacaa cgaattggga cttattatta gaacaaattt ttgaagaaca     83340
     agaaatgcaa gtatatattg gacaaaaaga actcctattt tctcatccct tagaaataaa     83400
     tgaaatatat aaaattcatg gttgtagctc tatacctgat tctttagtat taacaacttc     83460
     agattataaa gggtacaatg aaaaaaacgc atatttagca gcaaagcttc ttacagtatt     83520
     tattgagcat ccagttattt ttttaggata ttcaatatca gatgataaca tccaacaaat     83580
     attaaaagct attacccgtt gcttagatca agacaatatt cataaactta aagatcgact     83640
     tatattcgtc gaacgagctg gtcaagaaga agattctttt gaaaataatt catctttaac     83700
     aattggtaaa attacagttc caattacaag agttaaaacc aatgattatg aaaaaatata     83760
     taatgcattg gctcaaaaca aaagaaaatt cagtatgaaa atgatgcggc aaatgaagtc     83820
     tcaaatttat gaactagtta aaactaatga tccggaagaa aaaatctatg tagttgatgg     83880
     tgaatatgat gacactcaag atatagaatt tgtaattggt ctaggggtaa aaaatgtagt     83940
     tgaagaaatg cagtctaacc atgaaatttc tgctagcaag gaattaagtg agcatgggta     84000
     tggaggaata tcggatattg aactatttaa tgaactctta tcggatgaac ccaagtatga     84060
     ctatgattca atagtaaaaa tttcattacc tcaaattctc cggtcaaatc aatatgtacc     84120
     tctatttaga tatgtattgg aaagtagtgt agaagatgaa ttactagatt caaaaataaa     84180
     aaacaaacta aaaatgcgct acactgattt cttaacagaa actcaaaaga agaatataaa     84240
     aaatttatct tgggattggc aatttaaaaa tttagatgaa gttcttaaag gtttccccga     84300
     tattaaagta gcaattgaac aaattccgct gttaggacag aagaatttga attgtgatga     84360
     tttaaaagac tttcttataa aaaattctaa gtttgtaaaa gaaaaaaaca cacctgaaag     84420
     aacagggatt agaagactat ttcgtatata tgattggcta aagtacgggc aatcaaagga     84480
     tttacgaaaa cgcctaggaa aatgaagtat acggcattaa tgaggaagaa cctaggaacg     84540
     gttctttttt cattgtttgt aaagatataa ctttccgaat acatttcact ttcttaccat     84600
     caaatacaca agaagttctc gctggtatta aaaggtatag aaataggggg gaataaaaat     84660
     caataacttt acaagaaaaa atcaacagac aatacaagga ttctcatctt atttattaaa     84720
     taaagggcga aaaccctcta cgattaagcg atatacctat gatgtagaaa gctgtatcca     84780
     atggctgcag caatcaggaa gattctctga ctctgatgaa atgaattggg aatctctata     84840
     taagaaggat ttcgaagcat tttttaatta tttaatagaa gaacgccaat actccgataa     84900
     aacggtacat cgtatttata ttgctcttaa tagactgtat gagtatttag atttaccaag     84960
     cccgatcgaa agtgtaatac acatagctcc acctaatcgt gcattgcgta ctgaagattt     85020
     tatttcttca caagaagagc gacacctaaa agaagtatcc gcttctttgg agggactaac     85080
     agaaaagcaa cgttctactc gtccaatgat tttagagcga aatctttcta ttataatctt     85140
     gctcctagac tacggattat ctttacatga actggtctct ttacgcatga aacatgttca     85200
     tttcgagaac aatacactat caatacctga agatacaata atcaatcgta caatccagtt     85260
     aaaagaagaa gataaactac acttatataa ttactacaaa acgattccta aacctgtacg     85320
     tcctagatat cacagtgatg atccactctt tgtcgctttt cactttaggt tggggactta     85380
     tgtttggagt tatgacgatg atgcaccaaa atttctaacg gaaatctccg ttcaaaaaat     85440
     gattcgttta gagataaaac gtgctaatct tcgaaaggga atttcagcac aacactttcg     85500
     aaatactttt atattgcgga tgttccagca gctatgtaag gatgaacata ttatgaagca     85560
     agtcgggttt aaaactcacg aatcactgaa aagatatcgt aagtattatt atgcaaactc     85620
     taacgagaac aaaggttaaa actctgtact tgctatataa aaattatata cctacagttt     85680
     tttagataaa tgtaagatgg agctgttaag atgaagaaaa ataaggagtc atattccata     85740
     cacgtataca ctttgcgaga caagactact aaatctatta aaatcgagtc gtggcgttca     85800
     ttaagggaag aaatgcaagt attaggcata acggatagtg acattttcca aatccaaatg     85860
     attgaaataa ccccaaataa aaaagcgcca taacggttgt tatagtgctt ttttaacttc     85920
     gctctctact tataagaaca aaccgagggg agcggtatga taatatctta ttctcttgca     85980
     ttacttaatt atgaattatt tttactattt ctagttaaat tatctctaat ttgctcaaaa     86040
     cgttccttac aagaacctac aaatatatcc atacctatat atttcttatc gtcagaattt     86100
     ataactttct ccatttcatt ttcacactct ttaatagcct gttcaaggta ttttaaagct     86160
     aattctgggt tgtgttttaa atactccgaa cccgatggag ttaaaccata aggaatacac     86220
     cttactatat ctttaatttc ttgttctttc tcatatattt taccttttat tctctctacc     86280
     tgttcttctg tccacccttt gtatgcacct atataatacg ctggcgcttc aattctccct     86340
     gctttcactg cttgattcat cccttgcttt gtcatctcta attcctctgc taaatcagca     86400
     gttgaatata atttttccgt gctcatatta gcgcctcctt gtattttagg taaacaaatt     86460
     ttcgtaatcc gtttaccttc gttaagttaa atttattgta ccactacatt ttacataagt     86520
     aaacagtttt cgaatttata tttcatatcg taaactaaaa tcagaatttt taaattaaaa     86580
     tcgaatttat ttacacattt gcacatgtgt aaatgtgtaa atgtgtaaat gtgtacattt     86640
     ttaatacaga cttgtagcca aaaatacaaa agaattaaat gtgacatgtg ctactattgg     86700
     cacttttata tctctagtct tttcgtaact ccatgcatat aaacaaccat ttacaaagta     86760
     cgggaagaag aaccaatcaa aatgcacggc tgcaaagata ccattagcta tgataattgc     86820
     tgttgtacga ttaatccgct caaatagtgt tcctattcct aaaggcagaa actttctaaa     86880
     aatacattcc tcaattacag gcgctattaa tagcgggaca attaaataga agatattcaa     86940
     ctctactttt gcattcactt gttctgcatt gcctgtatca attccaaaat agccctttat     87000
     atagaaaaaa aagagactgg acacgatagc aagtccagtc gtcattaaca cccatttccc     87060
     cttttgtact actcttttta cattcaactt tcttctcccc ttactatgat tcttgtttat     87120
     tttttagcaa attcaaatgt gatctttccg ctagaatcaa gcttcagata cgcatcaaat     87180
     tctttccctg attttccttt catcccttta atcaatcctg ttttcttacc tgctagtaat     87240
     ttcttaacgt ttgtttcgct aatttttttg ttaaaaattc gcttggaagc gaaaacttgc     87300
     aaccttcctt atagcctgta caaccgtaaa acgttttgcg attcgctatg tctttgccac     87360
     atttcgggca tttccctacg gaatcctttg ttttcatttc ttgtactttg ctatctatct     87420
     gaagctcacc aattgacttc gtagcattta cgatcagctg cttggtgaat tctcctgtct     87480
     tcgcaacaaa tacctcttta gagccttgtt tcttcccgat tttacgcaaa tacccttccc     87540
     attgcgctgt catttcgggc ttcgctaata atgtgccgcc cacggcttcg caaagaattt     87600
     cacctttcgg tgtaactgtc actttattct ttttcacttc tatatattct tgttttttga     87660
     gtgtttcaat aatgccagct cgtgttgctt ccgtaccaag tccctctact tcttttagga     87720
     tacttttact ttcttcatct tctactgaag caccgcacgt tttcattaat gtaatgagtt     87780
     gcccctctgt atagggcttt ggtggtgttg tgataccttc tttcgtttgt atcttccctt     87840
     gtacaagttc gcctttttgc actataggaa ggagggattc cctgtcttcg ctttcttctt     87900
     cgctaggctg atccgctttg tatagttctt tccaacctaa cgctttttcc gcttttcctt     87960
     ttgtcataaa ttccaatcca ttcatatctg ttgtaataat cgtttcctca tattcgtaag     88020
     gcgcatggaa catgcctaac acacttttta acacttccat atacaagttg cgctgcttgt     88080
     ccgttaattg atctaccttt tgtttcgaag gaacattttt cgtcgctata acggcatagt     88140
     gctcttgtac tttttgatta tcaacgtagc gtttattcga ctctaatgat tttggttgga     88200
     agggtactcc tataatagat tgatatccct ctaaatttcg taccaaataa gcgaattcat     88260
     tttctgtaat gaaattacag tctgttcgtg gataggtcac aagttttgct tcatatagct     88320
     cttgaacaat tttcagcgta tcagcaggtg aatacttgta ctttttattt gctaaagcct     88380
     gtagggaaga aagcgaaaac aactttggcg cttcttgttt cttcggcttt acttctacgg     88440
     atttaaccgc tccttgctaa ttcccgcctt cagacagctg atgtttcttc agtagcaatg     88500
     ccacatcatt tttcgtttgg aatcgctctt tgtatcttcc tttatatgtt ccattcatcc     88560
     ctttaaattg cccttccagt tcaaagaaag gggatggctt aaagttttta atgtcctgct     88620
     gccgttggtt aatgagacat aaaacagggg tttgaacacg cccaacgctg taaacacctt     88680
     gtacgccttt ttgtcgtaat aacagcgtat ataatcggct tgcattcata ccgatagccc     88740
     aatcactaat ttgacgagcc tgcgcttcag caaacatact ctcaaactcc gatccttcct     88800
     ttaagttctg gaatcccttt ttaatttcat ccacttctaa actgttgatc cataagcgct     88860
     tcaatttttt agaagaacag cctgcttctt gaatgattaa acgtgcgatt gcttcgccct     88920
     ctctatcaat atccgttgcg attgtaatac aatccgcttc tttcattagt ttctttacaa     88980
     tgttgaactg ctttctttta tcagctgata ctttatatcc gtagcgctcc ggtaaaatcg     89040
     gcagttgtga catatcccat ttttcccact ctgctttata atcttgcggt gctttcagtt     89100
     caactaaatg cccgtatccc catgtgatat tagctccatt cggcattaag gaacaaggcg     89160
     caatggaaaa gtatccatcc ttcttctctg cttttgggaa tgcttctgtg tatgcttttg     89220
     cttgtgatgg tttctccgca ataattaatg tagtcatgtg tattacttcc tctcaattat     89280
     gtttttagtg aaagacaaaa agagcaacat atcgctatgt cgctcttcaa aaaatctcta     89340
     ttcaacaaat aaaaaagcag gaagaataaa tcctcctgct tttacaattc attatgaatg     89400
     cctactacgg taaggctaca ccaatttttt cgcacctact aaagtaaggc tactctaatt     89460
     taatcatcgt tcttttattt tatatcatta cgaaggtgaa cgagtaagaa ctccgctgaa     89520
     tatgtgccta tttcttttca tttatatcat tacggaggtg aaacagaaaa ataactccgc     89580
     tgaattgcta tatactcatt atatattatt atttaattat catcaattat tttttatctt     89640
     tccatccctc gttgttgcaa gtatgcagcc cttcttcctt gctctctttg ctcttgttgt     89700
     ttagctacac gtttacactc atcgttccag tcccattttt tctcttcaga cggggcttgc     89760
     ggatactcag gtttaaacgc aactatgctt ccatcattct tttcatatct aaaatgtatc     89820
     aatctctcta caaacgcctt tcctgcttta tcattatcta cacacagcga aagactatca     89880
     ggaacatcac caattcgctc acaagccttc atataataat taaatattac ttgtggttta     89940
     agtccctcca tactaattaa atgcgtatct tttaaattat gcttatgtaa tgtggcatag     90000
     ctcaaaaggt ctatatctga ctcataaaat ttcaagttcc gtggttcacc gtttaacaca     90060
     ttaaaaccgt agttagccgt agaatttttt tggatacttt tccacgcccc acgtttgtat     90120
     ttatccgact ttacaacgcc ttgttctgat ccacccatta ccgctcccgt ttcacggtct     90180
     ttccatagga acaatacatt attgtactta tcttgtttaa tcagtccttt gttatgcaat     90240
     gcatctacaa cttgcggatc aatttttctt tcctcaatca gatattctct tgctctatca     90300
     aatcgagata cctctttttg ttcgaaatgc tcataatcat aaggctcact cacaaatgtt     90360
     atttctgaag ctttttcata gtcctgttct ccgtccagta atcgctgcat cgccccaggg     90420
     aacgaagcat cttctacctc ctgtacgaac ttaataatat tcccgttaac ccctctactg     90480
     ttccagtaga attgattttt ctttctatca ataatgagac tgtcgtgttc tgttagacga     90540
     taataacgtt cactgtcagg ctttacaggt atatcatttt gcatacaata atctacaata     90600
     tcaagggatg ctgccttttc aatttcttct tccgtatatc ttttgatatt cttcttttgt     90660
     tgttccatga aaattcctcc attaaaaaaa gaccatgctt tttcacatga tctttttcgt     90720
     tttatttata tttatatttg attgacctta actaaataac gctttaaagg attctaaaat     90780
     ccctgaagct ccaaattgaa aacttgccat tccatatgaa tacagttcat acacaactac     90840
     gattgtacta atcattaaaa tcattttttc cgctataccg ttatagctgt aataaaaaac     90900
     atggaatcca ctttgaaaat ttctattgga taatggcagc agccacttaa tacctttttt     90960
     agagaaactg tcttccacta gatgtagaaa gtatccggca aggatgcaca ttccattcgt     91020
     aaaggacaat ggcgtcattc cgaccgcaaa taaaatagga atcaacacaa gcaccaatcc     91080
     aaatagtgag tgtgtaattc ctctatgacc aaataccgta ttcattaaat ccgatacacc     91140
     acgagttctt ctgccaatcc atgaatgttg ttcatctata tcaggcaaca aagccccaaa     91200
     actaaccgct atcacattcc caaccgtaag gtttcccgtt gatgccaaga caggcagggc     91260
     aaccgctagg cttgttgtaa gatgcgtttt atacttcatt ggttatccca ctttcttata     91320
     ttaataatca cgaccaagca tttgtttcat catataatgt cttcttgcct gctcccttgt     91380
     ttgcgatatt tgctgttgtt cttcctcatg gactgtatcc ttcccaacat atcgccttgc     91440
     aacttcaggg gtagtttttg attcttgtac cactatagcg ccatgccctt tcatcaccga     91500
     actaactgtt ttagcagatt ccatttgaaa gacttcttca gcttcagttt tatggtcatt     91560
     tacaatctct tctactggat tgaaacgaag ttctccatct tcaatcttct tttcctcaat     91620
     atatcgaata ggagcgagtc gtttttcttc aacatcttca tagccgattg ttgtataata     91680
     agcatcctta ccttctaact cttcaggact cacttcttct gccaccacat atccatatcc     91740
     ctcaaaatga taagcagctt catcctgctg caatggtttc cctgtcgatt cgcaataaat     91800
     aaccatatct tcatttattg gataaagacc ttgatactcg acatcaccat tcatgatttc     91860
     attgtgcgat ttagtaatcg aatgactaat atgattaaca gcattgaata tagaatcatt     91920
     aaaatcaaac gcaatatcac tgtttgatac atattcagat aagcactcca ctttcacatt     91980
     ttgctgccga tctgttgtta attttgcaat cggcatatca taaaattctt cttgaataag     92040
     ttcagcttca taataaggtt caaggtaatc tgcaatttga ttgaaattct ccatttcttt     92100
     ttccgttccg catctattta caacagataa taattcccct aaactcaaac gcatatcagg     92160
     atgaatttct tcgattactc gattgtcttc agacagttga atttcgtaat tctcccagtg     92220
     tttatctaaa tcaacaccta atttctcttc aatttctaaa gctgtttttt gttgaatagc     92280
     tgttactact tcgtggttat ccatcattat ttatctctcc ttattagttg aaatttaaaa     92340
     taaaaaaaga acacctatta aggtgtcctc ttatctctcc attcgttgca tgtatgccat     92400
     acgtgccatc cttcttgctt cttgctgttt tattgcggct gcatcttcat ctttttccgt     92460
     tttattagat aaaaaacggt caaccttccc ctgttgaatc tcactaattt cagtagtatt     92520
     tactgctctt agtttttcag gattagattg accttttgtt tgttcatatt catttatttc     92580
     ttgctgcaat gcttgtttaa cttcatccga taactgtctt ttttcattta aaatttgctc     92640
     atatggagac ttgtatatac cgtcacccaa atctaatcga tccatcgtta caacctccat     92700
     tcgattaaaa tctttatcca tttcttttgg aagaattaaa tggtagcgag ttttttcata     92760
     agggacatac tcacctttct cttctgccct tttagattcg gcatctattt cggcaattcg     92820
     tttactcatt attgcattcg cttcaccaaa aggaatagct ttattttttt ccaaatcagc     92880
     ttcagaccat tgaatcacaa ccatcagctt cttaatttcg ttatgctcta acgcaataca     92940
     attttcttca ttggctttat taaatgcttc aatatactct ttatcattta aagtattagc     93000
     attttccaca tcactataag acttatctct gtctgctctt tcacgtaatt cacgcacagt     93060
     tataattttt tcttcagtac ttgttaaagc accataacgc actacataca catcttcaat     93120
     ttctttttta ttttgctccc tattcttttc tctttctctt tgcaattcag atatcttctt     93180
     gtcgattgta tttataaagc tacttgctgt ttcatgaaca cgcataatgg atttatcttt     93240
     ctcttctata tcctgtccat tttttgtcca ttcagcgata taaggtactg atgcttcgct     93300
     tgtatccata ccgtaatgct tacaaacaat ataagatgtt agctccgctt caaactcttc     93360
     tgtagggaca tgttctagtg aagcaacctt tttattgtgt aacttcgcat gagctaattc     93420
     atggattgca actgacaact ctttcgtctc agtgttcctt gtattcatta caatttgagc     93480
     aaaagatgaa tctgctactt caacatatgc gccatgtata gttcctaatt ctttaatcaa     93540
     tgcaccttgt cccatatctt taattttaat attttctttt tcagctaatg cctgaatacc     93600
     taactttaac agctctttgt tttcctctgt cacttcaaaa ttaaactggc gattcgggaa     93660
     tatttttggc aagtcttcag gacttgcatt tgtttgcgaa atatcaaagg ctgttgcttt     93720
     caagtaataa tttgtttgct tctccacttt caactcacca tttttcactt gttgcttttg     93780
     ttccgctgtt aatttagtta gtggaattgg taattttgtt tttggatctc ttacaaattc     93840
     ttttacataa ggatgaaaaa ccttcattgc tttttcaccc ttattcacat ggaatcctgc     93900
     atctttaaat gttttaaaac tcgcacaagc atatgcatgt ggaaattgtg atttaattaa     93960
     ctgcatgttt ctaggagaat agttactaaa ctgcgccatg aaatttgcta actctaacat     94020
     atcctctggc gaattataat acttcgtaat atctgtaaga accttgtcca taatttcctt     94080
     tgtttcttct ttaatttgct cttttgtctt aggtgtatat ttcttttttg tgtaggtcat     94140
     tcgcaaatta accctctttc ttcatcatat tttacaaatg gtatactatc gtgttccact     94200
     gccccgttca tgaactcggc ataggctgcc gcttcttttt ctgaaacttt tacgataact     94260
     tgtttattga ataagtattt acttagatga acctcattct ttacttggtc tacatgttca     94320
     accatataaa aattattttg agacatatta cacactacct ttctattatt acaacgctaa     94380
     tttgaagtat attttttcgt aagtttgttt tcctttgccc caagttatat tccaatcgtc     94440
     taaagagcct gaatacactt ccttaaattt tagaattgga ttatccatcg aaccttctat     94500
     cacaattcca aaccctttat catatgtaga atcaccctca tgttttttcc acagttcaaa     94560
     ttctgtaatt ctatattttt tagcaaaatc aataaccgct tccagtatcc agttttcatt     94620
     ttcttcttca gttatattct tctcaaaatc cacctcaaag cactcaccat aatcatcatt     94680
     tctgattaga aaatgatttt ctcctttctt tatattatct tctataatgg ttctgttttc     94740
     ttcattacgg ctaaatcttg tgcttgatac gatggaataa tacacttttt tctccacttt     94800
     aaatcctcct ataaaataag ttcaattggt                                      94830
//

If you have problems or comments...

PBIL Back to PBIL home page