(data stored in SCRATCH zone)

EMBL: CP001598

ID   CP001598; SV 1; circular; genomic DNA; STD; PRO; 5227419 BP.
XX
AC   CP001598;
XX
PR   Project:PRJNA33543;
XX
DT   07-MAY-2009 (Rel. 100, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 7)
XX
DE   Bacillus anthracis str. A0248, complete genome.
XX
KW   .
XX
OS   Bacillus anthracis str. A0248
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus;
OC   Bacillus cereus group.
XX
RN   [1]
RP   1-5227419
RA   Dodson R.J., Munk A.C., Bruce D., Detter C., Tapia R., Sutton G., Sims D.,
RA   Brettin T.;
RT   "Genome sequence of Bacillus anthracis A0248";
RL   Unpublished.
XX
RN   [2]
RP   1-5227419
RA   Dodson R.J., Munk A.C., Bruce D., Detter C., Tapia R., Sutton G., Sims D.,
RA   Brettin T.;
RT   ;
RL   Submitted (09-APR-2009) to the INSDC.
RL   Los Alamos National Laboratory, Los Alamos, NM, USA
XX
DR   MD5; ecc7e5204c25c76f517dbcf168aa88fe.
DR   BioSample; SAMN02603932.
DR   EnsemblGenomes-Gn; BAA_0007.
DR   EnsemblGenomes-Gn; BAA_0008.
DR   EnsemblGenomes-Gn; BAA_0009.
DR   EnsemblGenomes-Gn; BAA_0011.
DR   EnsemblGenomes-Gn; BAA_0012.
DR   EnsemblGenomes-Gn; BAA_0019.
DR   EnsemblGenomes-Gn; BAA_0025.
DR   EnsemblGenomes-Gn; BAA_0031.
DR   EnsemblGenomes-Gn; BAA_0032.
DR   EnsemblGenomes-Gn; BAA_0033.
DR   EnsemblGenomes-Gn; BAA_0035.
DR   EnsemblGenomes-Gn; BAA_0036.
DR   EnsemblGenomes-Gn; BAA_0072.
DR   EnsemblGenomes-Gn; BAA_0073.
DR   EnsemblGenomes-Gn; BAA_0090.
DR   EnsemblGenomes-Gn; BAA_0092.
DR   EnsemblGenomes-Gn; BAA_0093.
DR   EnsemblGenomes-Gn; BAA_0169.
DR   EnsemblGenomes-Gn; BAA_0171.
DR   EnsemblGenomes-Gn; BAA_0172.
DR   EnsemblGenomes-Gn; BAA_0173.
DR   EnsemblGenomes-Gn; BAA_0174.
DR   EnsemblGenomes-Gn; BAA_0175.
DR   EnsemblGenomes-Gn; BAA_0176.
DR   EnsemblGenomes-Gn; BAA_0177.
DR   EnsemblGenomes-Gn; BAA_0178.
DR   EnsemblGenomes-Gn; BAA_0179.
DR   EnsemblGenomes-Gn; BAA_0180.
DR   EnsemblGenomes-Gn; BAA_0181.
DR   EnsemblGenomes-Gn; BAA_0188.
DR   EnsemblGenomes-Gn; BAA_0284.
DR   EnsemblGenomes-Gn; BAA_0285.
DR   EnsemblGenomes-Gn; BAA_0286.
DR   EnsemblGenomes-Gn; BAA_0287.
DR   EnsemblGenomes-Gn; BAA_0288.
DR   EnsemblGenomes-Gn; BAA_0289.
DR   EnsemblGenomes-Gn; BAA_0290.
DR   EnsemblGenomes-Gn; BAA_0291.
DR   EnsemblGenomes-Gn; BAA_0292.
DR   EnsemblGenomes-Gn; BAA_0293.
DR   EnsemblGenomes-Gn; BAA_0294.
DR   EnsemblGenomes-Gn; BAA_0295.
DR   EnsemblGenomes-Gn; BAA_0297.
DR   EnsemblGenomes-Gn; BAA_0298.
DR   EnsemblGenomes-Gn; BAA_0299.
DR   EnsemblGenomes-Gn; BAA_0300.
DR   EnsemblGenomes-Gn; BAA_0316.
DR   EnsemblGenomes-Gn; BAA_0318.
DR   EnsemblGenomes-Gn; BAA_0319.
DR   EnsemblGenomes-Gn; BAA_0328.
DR   EnsemblGenomes-Gn; BAA_0331.
DR   EnsemblGenomes-Gn; BAA_0332.
DR   EnsemblGenomes-Gn; BAA_0338.
DR   EnsemblGenomes-Gn; BAA_0340.
DR   EnsemblGenomes-Gn; BAA_0341.
DR   EnsemblGenomes-Gn; BAA_0601.
DR   EnsemblGenomes-Gn; BAA_0603.
DR   EnsemblGenomes-Gn; BAA_0604.
DR   EnsemblGenomes-Gn; BAA_0605.
DR   EnsemblGenomes-Gn; BAA_0606.
DR   EnsemblGenomes-Gn; BAA_0607.
DR   EnsemblGenomes-Gn; BAA_0608.
DR   EnsemblGenomes-Gn; BAA_0610.
DR   EnsemblGenomes-Gn; BAA_0611.
DR   EnsemblGenomes-Gn; BAA_0612.
DR   EnsemblGenomes-Gn; BAA_0613.
DR   EnsemblGenomes-Gn; BAA_0614.
DR   EnsemblGenomes-Gn; BAA_0615.
DR   EnsemblGenomes-Gn; BAA_0616.
DR   EnsemblGenomes-Gn; BAA_0617.
DR   EnsemblGenomes-Gn; BAA_0618.
DR   EnsemblGenomes-Gn; BAA_0619.
DR   EnsemblGenomes-Gn; BAA_0620.
DR   EnsemblGenomes-Gn; BAA_0626.
DR   EnsemblGenomes-Gn; BAA_0803.
DR   EnsemblGenomes-Gn; BAA_0805.
DR   EnsemblGenomes-Gn; BAA_0806.
DR   EnsemblGenomes-Gn; BAA_0807.
DR   EnsemblGenomes-Gn; BAA_0808.
DR   EnsemblGenomes-Gn; BAA_0809.
DR   EnsemblGenomes-Gn; BAA_0810.
DR   EnsemblGenomes-Gn; BAA_0811.
DR   EnsemblGenomes-Gn; BAA_0812.
DR   EnsemblGenomes-Gn; BAA_0813.
DR   EnsemblGenomes-Gn; BAA_0814.
DR   EnsemblGenomes-Gn; BAA_0815.
DR   EnsemblGenomes-Gn; BAA_0816.
DR   EnsemblGenomes-Gn; BAA_0817.
DR   EnsemblGenomes-Gn; BAA_0818.
DR   EnsemblGenomes-Gn; BAA_0819.
DR   EnsemblGenomes-Gn; BAA_0820.
DR   EnsemblGenomes-Gn; BAA_0821.
DR   EnsemblGenomes-Gn; BAA_0822.
DR   EnsemblGenomes-Gn; BAA_0823.
DR   EnsemblGenomes-Gn; BAA_0824.
DR   EnsemblGenomes-Gn; BAA_1104.
DR   EnsemblGenomes-Gn; BAA_1353.
DR   EnsemblGenomes-Gn; BAA_1650.
DR   EnsemblGenomes-Gn; BAA_1669.
DR   EnsemblGenomes-Gn; BAA_1670.
DR   EnsemblGenomes-Gn; BAA_3800.
DR   EnsemblGenomes-Gn; BAA_4519.
DR   EnsemblGenomes-Gn; BAA_4728.
DR   EnsemblGenomes-Gn; BAA_4729.
DR   EnsemblGenomes-Gn; BAA_5137.
DR   EnsemblGenomes-Gn; BAA_5138.
DR   EnsemblGenomes-Gn; BAA_5139.
DR   EnsemblGenomes-Gn; BAA_5140.
DR   EnsemblGenomes-Gn; BAA_5141.
DR   EnsemblGenomes-Gn; BAA_5142.
DR   EnsemblGenomes-Gn; BAA_5143.
DR   EnsemblGenomes-Gn; BAA_5144.
DR   EnsemblGenomes-Gn; BAA_5145.
DR   EnsemblGenomes-Gn; BAA_5146.
DR   EnsemblGenomes-Gn; BAA_5147.
DR   EnsemblGenomes-Gn; BAA_5148.
DR   EnsemblGenomes-Gn; BAA_5149.
DR   EnsemblGenomes-Gn; BAA_5150.
DR   EnsemblGenomes-Gn; BAA_5151.
DR   EnsemblGenomes-Gn; BAA_5152.
DR   EnsemblGenomes-Gn; BAA_5153.
DR   EnsemblGenomes-Gn; BAA_5154.
DR   EnsemblGenomes-Gn; BAA_5155.
DR   EnsemblGenomes-Gn; BAA_5156.
DR   EnsemblGenomes-Gn; BAA_5157.
DR   EnsemblGenomes-Gn; BAA_5158.
DR   EnsemblGenomes-Gn; BAA_5159.
DR   EnsemblGenomes-Gn; BAA_5160.
DR   EnsemblGenomes-Gn; BAA_5162.
DR   EnsemblGenomes-Gn; BAA_5362.
DR   EnsemblGenomes-Gn; BAA_5402.
DR   EnsemblGenomes-Gn; BAA_5747.
DR   EnsemblGenomes-Gn; BAA_5748.
DR   EnsemblGenomes-Gn; BAA_5749.
DR   EnsemblGenomes-Gn; BAA_5750.
DR   EnsemblGenomes-Gn; BAA_5773.
DR   EnsemblGenomes-Gn; EBG00001443529.
DR   EnsemblGenomes-Gn; EBG00001443530.
DR   EnsemblGenomes-Gn; EBG00001443531.
DR   EnsemblGenomes-Gn; EBG00001443532.
DR   EnsemblGenomes-Gn; EBG00001443533.
DR   EnsemblGenomes-Gn; EBG00001443534.
DR   EnsemblGenomes-Gn; EBG00001443535.
DR   EnsemblGenomes-Gn; EBG00001443536.
DR   EnsemblGenomes-Gn; EBG00001443537.
DR   EnsemblGenomes-Gn; EBG00001443538.
DR   EnsemblGenomes-Gn; EBG00001443539.
DR   EnsemblGenomes-Gn; EBG00001443540.
DR   EnsemblGenomes-Gn; EBG00001443541.
DR   EnsemblGenomes-Gn; EBG00001443542.
DR   EnsemblGenomes-Gn; EBG00001443543.
DR   EnsemblGenomes-Gn; EBG00001443544.
DR   EnsemblGenomes-Gn; EBG00001443545.
DR   EnsemblGenomes-Gn; EBG00001443546.
DR   EnsemblGenomes-Gn; EBG00001443547.
DR   EnsemblGenomes-Gn; EBG00001443548.
DR   EnsemblGenomes-Gn; EBG00001443549.
DR   EnsemblGenomes-Gn; EBG00001443550.
DR   EnsemblGenomes-Gn; EBG00001443551.
DR   EnsemblGenomes-Gn; EBG00001443552.
DR   EnsemblGenomes-Gn; EBG00001443553.
DR   EnsemblGenomes-Gn; EBG00001443554.
DR   EnsemblGenomes-Gn; EBG00001443555.
DR   EnsemblGenomes-Gn; EBG00001443556.
DR   EnsemblGenomes-Gn; EBG00001443557.
DR   EnsemblGenomes-Gn; EBG00001443558.
DR   EnsemblGenomes-Gn; EBG00001443559.
DR   EnsemblGenomes-Gn; EBG00001443560.
DR   EnsemblGenomes-Gn; EBG00001443561.
DR   EnsemblGenomes-Gn; EBG00001443562.
DR   EnsemblGenomes-Gn; EBG00001443563.
DR   EnsemblGenomes-Gn; EBG00001443564.
DR   EnsemblGenomes-Gn; EBG00001443565.
DR   EnsemblGenomes-Gn; EBG00001443566.
DR   EnsemblGenomes-Gn; EBG00001443567.
DR   EnsemblGenomes-Gn; EBG00001443568.
DR   EnsemblGenomes-Gn; EBG00001443569.
DR   EnsemblGenomes-Gn; EBG00001443570.
DR   EnsemblGenomes-Gn; EBG00001443571.
DR   EnsemblGenomes-Gn; EBG00001443572.
DR   EnsemblGenomes-Gn; EBG00001443573.
DR   EnsemblGenomes-Gn; EBG00001443574.
DR   EnsemblGenomes-Gn; EBG00001443575.
DR   EnsemblGenomes-Gn; EBG00001443576.
DR   EnsemblGenomes-Gn; EBG00001443577.
DR   EnsemblGenomes-Gn; EBG00001443578.
DR   EnsemblGenomes-Gn; EBG00001443579.
DR   EnsemblGenomes-Gn; EBG00001443580.
DR   EnsemblGenomes-Gn; EBG00001443581.
DR   EnsemblGenomes-Gn; EBG00001443582.
DR   EnsemblGenomes-Gn; EBG00001443583.
DR   EnsemblGenomes-Gn; EBG00001443584.
DR   EnsemblGenomes-Gn; EBG00001443585.
DR   EnsemblGenomes-Gn; EBG00001443586.
DR   EnsemblGenomes-Gn; EBG00001443587.
DR   EnsemblGenomes-Gn; EBG00001443588.
DR   EnsemblGenomes-Gn; EBG00001443589.
DR   EnsemblGenomes-Gn; EBG00001443590.
DR   EnsemblGenomes-Gn; EBG00001443591.
DR   EnsemblGenomes-Gn; EBG00001443592.
DR   EnsemblGenomes-Gn; EBG00001443593.
DR   EnsemblGenomes-Gn; EBG00001443594.
DR   EnsemblGenomes-Gn; EBG00001443595.
DR   EnsemblGenomes-Gn; EBG00001443596.
DR   EnsemblGenomes-Gn; EBG00001443597.
DR   EnsemblGenomes-Gn; EBG00001443598.
DR   EnsemblGenomes-Gn; EBG00001443599.
DR   EnsemblGenomes-Gn; EBG00001443600.
DR   EnsemblGenomes-Gn; EBG00001443601.
DR   EnsemblGenomes-Gn; EBG00001443602.
DR   EnsemblGenomes-Gn; EBG00001443603.
DR   EnsemblGenomes-Gn; EBG00001443604.
DR   EnsemblGenomes-Gn; EBG00001443605.
DR   EnsemblGenomes-Gn; EBG00001443606.
DR   EnsemblGenomes-Gn; EBG00001443607.
DR   EnsemblGenomes-Gn; EBG00001443608.
DR   EnsemblGenomes-Gn; EBG00001443609.
DR   EnsemblGenomes-Gn; EBG00001443610.
DR   EnsemblGenomes-Gn; EBG00001443611.
DR   EnsemblGenomes-Gn; EBG00001443612.
DR   EnsemblGenomes-Gn; EBG00001443613.
DR   EnsemblGenomes-Gn; EBG00001443614.
DR   EnsemblGenomes-Gn; EBG00001443615.
DR   EnsemblGenomes-Gn; EBG00001443616.
DR   EnsemblGenomes-Gn; EBG00001443617.
DR   EnsemblGenomes-Gn; EBG00001443618.
DR   EnsemblGenomes-Gn; EBG00001443619.
DR   EnsemblGenomes-Gn; EBG00001443620.
DR   EnsemblGenomes-Gn; EBG00001443621.
DR   EnsemblGenomes-Gn; EBG00001443622.
DR   EnsemblGenomes-Gn; EBG00001443623.
DR   EnsemblGenomes-Gn; EBG00001443624.
DR   EnsemblGenomes-Gn; EBG00001443625.
DR   EnsemblGenomes-Gn; EBG00001443626.
DR   EnsemblGenomes-Gn; EBG00001443627.
DR   EnsemblGenomes-Gn; EBG00001443628.
DR   EnsemblGenomes-Gn; EBG00001443629.
DR   EnsemblGenomes-Gn; EBG00001443630.
DR   EnsemblGenomes-Gn; EBG00001443631.
DR   EnsemblGenomes-Gn; EBG00001443632.
DR   EnsemblGenomes-Gn; EBG00001443633.
DR   EnsemblGenomes-Gn; EBG00001443634.
DR   EnsemblGenomes-Gn; EBG00001443635.
DR   EnsemblGenomes-Gn; EBG00001443636.
DR   EnsemblGenomes-Gn; EBG00001443637.
DR   EnsemblGenomes-Gn; EBG00001443638.
DR   EnsemblGenomes-Gn; EBG00001443639.
DR   EnsemblGenomes-Gn; EBG00001443640.
DR   EnsemblGenomes-Gn; EBG00001443641.
DR   EnsemblGenomes-Gn; EBG00001443642.
DR   EnsemblGenomes-Gn; EBG00001443643.
DR   EnsemblGenomes-Gn; EBG00001443644.
DR   EnsemblGenomes-Gn; EBG00001443645.
DR   EnsemblGenomes-Gn; EBG00001443646.
DR   EnsemblGenomes-Gn; EBG00001443647.
DR   EnsemblGenomes-Gn; EBG00001443648.
DR   EnsemblGenomes-Gn; EBG00001443649.
DR   EnsemblGenomes-Gn; EBG00001443650.
DR   EnsemblGenomes-Gn; EBG00001443651.
DR   EnsemblGenomes-Gn; EBG00001443652.
DR   EnsemblGenomes-Gn; EBG00001443653.
DR   EnsemblGenomes-Gn; EBG00001443654.
DR   EnsemblGenomes-Gn; EBG00001443655.
DR   EnsemblGenomes-Gn; EBG00001443656.
DR   EnsemblGenomes-Gn; EBG00001443657.
DR   EnsemblGenomes-Gn; EBG00001443658.
DR   EnsemblGenomes-Gn; EBG00001443659.
DR   EnsemblGenomes-Gn; EBG00001443660.
DR   EnsemblGenomes-Gn; EBG00001443661.
DR   EnsemblGenomes-Gn; EBG00001443662.
DR   EnsemblGenomes-Gn; EBG00001443663.
DR   EnsemblGenomes-Gn; EBG00001443664.
DR   EnsemblGenomes-Gn; EBG00001443665.
DR   EnsemblGenomes-Gn; EBG00001443666.
DR   EnsemblGenomes-Gn; EBG00001443667.
DR   EnsemblGenomes-Gn; EBG00001443668.
DR   EnsemblGenomes-Gn; EBG00001443669.
DR   EnsemblGenomes-Gn; EBG00001443670.
DR   EnsemblGenomes-Gn; EBG00001443671.
DR   EnsemblGenomes-Gn; EBG00001443672.
DR   EnsemblGenomes-Gn; EBG00001443673.
DR   EnsemblGenomes-Gn; EBG00001443674.
DR   EnsemblGenomes-Gn; EBG00001443675.
DR   EnsemblGenomes-Gn; EBG00001443676.
DR   EnsemblGenomes-Gn; EBG00001443677.
DR   EnsemblGenomes-Gn; EBG00001443678.
DR   EnsemblGenomes-Gn; EBG00001443679.
DR   EnsemblGenomes-Gn; EBG00001443680.
DR   EnsemblGenomes-Gn; EBG00001443681.
DR   EnsemblGenomes-Gn; EBG00001443682.
DR   EnsemblGenomes-Gn; EBG00001443683.
DR   EnsemblGenomes-Gn; EBG00001443684.
DR   EnsemblGenomes-Gn; EBG00001443685.
DR   EnsemblGenomes-Gn; EBG00001443686.
DR   EnsemblGenomes-Gn; EBG00001443687.
DR   EnsemblGenomes-Gn; EBG00001443688.
DR   EnsemblGenomes-Gn; EBG00001443689.
DR   EnsemblGenomes-Gn; EBG00001443690.
DR   EnsemblGenomes-Gn; EBG00001443691.
DR   EnsemblGenomes-Gn; EBG00001443692.
DR   EnsemblGenomes-Gn; EBG00001443693.
DR   EnsemblGenomes-Gn; EBG00001443694.
DR   EnsemblGenomes-Gn; EBG00001443695.
DR   EnsemblGenomes-Gn; EBG00001443696.
DR   EnsemblGenomes-Tr; BAA_0007-1.
DR   EnsemblGenomes-Tr; BAA_0008-1.
DR   EnsemblGenomes-Tr; BAA_0009-1.
DR   EnsemblGenomes-Tr; BAA_0011-1.
DR   EnsemblGenomes-Tr; BAA_0012-1.
DR   EnsemblGenomes-Tr; BAA_0019-1.
DR   EnsemblGenomes-Tr; BAA_0025-1.
DR   EnsemblGenomes-Tr; BAA_0031-1.
DR   EnsemblGenomes-Tr; BAA_0032-1.
DR   EnsemblGenomes-Tr; BAA_0033-1.
DR   EnsemblGenomes-Tr; BAA_0035-1.
DR   EnsemblGenomes-Tr; BAA_0036-1.
DR   EnsemblGenomes-Tr; BAA_0072-1.
DR   EnsemblGenomes-Tr; BAA_0073-1.
DR   EnsemblGenomes-Tr; BAA_0090-1.
DR   EnsemblGenomes-Tr; BAA_0092-1.
DR   EnsemblGenomes-Tr; BAA_0093-1.
DR   EnsemblGenomes-Tr; BAA_0169-1.
DR   EnsemblGenomes-Tr; BAA_0171-1.
DR   EnsemblGenomes-Tr; BAA_0172-1.
DR   EnsemblGenomes-Tr; BAA_0173-1.
DR   EnsemblGenomes-Tr; BAA_0174-1.
DR   EnsemblGenomes-Tr; BAA_0175-1.
DR   EnsemblGenomes-Tr; BAA_0176-1.
DR   EnsemblGenomes-Tr; BAA_0177-1.
DR   EnsemblGenomes-Tr; BAA_0178-1.
DR   EnsemblGenomes-Tr; BAA_0179-1.
DR   EnsemblGenomes-Tr; BAA_0180-1.
DR   EnsemblGenomes-Tr; BAA_0181-1.
DR   EnsemblGenomes-Tr; BAA_0188-1.
DR   EnsemblGenomes-Tr; BAA_0284-1.
DR   EnsemblGenomes-Tr; BAA_0285-1.
DR   EnsemblGenomes-Tr; BAA_0286-1.
DR   EnsemblGenomes-Tr; BAA_0287-1.
DR   EnsemblGenomes-Tr; BAA_0288-1.
DR   EnsemblGenomes-Tr; BAA_0289-1.
DR   EnsemblGenomes-Tr; BAA_0290-1.
DR   EnsemblGenomes-Tr; BAA_0291-1.
DR   EnsemblGenomes-Tr; BAA_0292-1.
DR   EnsemblGenomes-Tr; BAA_0293-1.
DR   EnsemblGenomes-Tr; BAA_0294-1.
DR   EnsemblGenomes-Tr; BAA_0295-1.
DR   EnsemblGenomes-Tr; BAA_0297-1.
DR   EnsemblGenomes-Tr; BAA_0298-1.
DR   EnsemblGenomes-Tr; BAA_0299-1.
DR   EnsemblGenomes-Tr; BAA_0300-1.
DR   EnsemblGenomes-Tr; BAA_0316-1.
DR   EnsemblGenomes-Tr; BAA_0318-1.
DR   EnsemblGenomes-Tr; BAA_0319-1.
DR   EnsemblGenomes-Tr; BAA_0328-1.
DR   EnsemblGenomes-Tr; BAA_0331-1.
DR   EnsemblGenomes-Tr; BAA_0332-1.
DR   EnsemblGenomes-Tr; BAA_0338-1.
DR   EnsemblGenomes-Tr; BAA_0340-1.
DR   EnsemblGenomes-Tr; BAA_0341-1.
DR   EnsemblGenomes-Tr; BAA_0601-1.
DR   EnsemblGenomes-Tr; BAA_0603-1.
DR   EnsemblGenomes-Tr; BAA_0604-1.
DR   EnsemblGenomes-Tr; BAA_0605-1.
DR   EnsemblGenomes-Tr; BAA_0606-1.
DR   EnsemblGenomes-Tr; BAA_0607-1.
DR   EnsemblGenomes-Tr; BAA_0608-1.
DR   EnsemblGenomes-Tr; BAA_0610-1.
DR   EnsemblGenomes-Tr; BAA_0611-1.
DR   EnsemblGenomes-Tr; BAA_0612-1.
DR   EnsemblGenomes-Tr; BAA_0613-1.
DR   EnsemblGenomes-Tr; BAA_0614-1.
DR   EnsemblGenomes-Tr; BAA_0615-1.
DR   EnsemblGenomes-Tr; BAA_0616-1.
DR   EnsemblGenomes-Tr; BAA_0617-1.
DR   EnsemblGenomes-Tr; BAA_0618-1.
DR   EnsemblGenomes-Tr; BAA_0619-1.
DR   EnsemblGenomes-Tr; BAA_0620-1.
DR   EnsemblGenomes-Tr; BAA_0626-1.
DR   EnsemblGenomes-Tr; BAA_0803-1.
DR   EnsemblGenomes-Tr; BAA_0805-1.
DR   EnsemblGenomes-Tr; BAA_0806-1.
DR   EnsemblGenomes-Tr; BAA_0807-1.
DR   EnsemblGenomes-Tr; BAA_0808-1.
DR   EnsemblGenomes-Tr; BAA_0809-1.
DR   EnsemblGenomes-Tr; BAA_0810-1.
DR   EnsemblGenomes-Tr; BAA_0811-1.
DR   EnsemblGenomes-Tr; BAA_0812-1.
DR   EnsemblGenomes-Tr; BAA_0813-1.
DR   EnsemblGenomes-Tr; BAA_0814-1.
DR   EnsemblGenomes-Tr; BAA_0815-1.
DR   EnsemblGenomes-Tr; BAA_0816-1.
DR   EnsemblGenomes-Tr; BAA_0817-1.
DR   EnsemblGenomes-Tr; BAA_0818-1.
DR   EnsemblGenomes-Tr; BAA_0819-1.
DR   EnsemblGenomes-Tr; BAA_0820-1.
DR   EnsemblGenomes-Tr; BAA_0821-1.
DR   EnsemblGenomes-Tr; BAA_0822-1.
DR   EnsemblGenomes-Tr; BAA_0823-1.
DR   EnsemblGenomes-Tr; BAA_0824-1.
DR   EnsemblGenomes-Tr; BAA_1104-1.
DR   EnsemblGenomes-Tr; BAA_1353-1.
DR   EnsemblGenomes-Tr; BAA_1650-1.
DR   EnsemblGenomes-Tr; BAA_1669-1.
DR   EnsemblGenomes-Tr; BAA_1670-1.
DR   EnsemblGenomes-Tr; BAA_3800-1.
DR   EnsemblGenomes-Tr; BAA_4519-1.
DR   EnsemblGenomes-Tr; BAA_4728-1.
DR   EnsemblGenomes-Tr; BAA_4729-1.
DR   EnsemblGenomes-Tr; BAA_5137-1.
DR   EnsemblGenomes-Tr; BAA_5138-1.
DR   EnsemblGenomes-Tr; BAA_5139-1.
DR   EnsemblGenomes-Tr; BAA_5140-1.
DR   EnsemblGenomes-Tr; BAA_5141-1.
DR   EnsemblGenomes-Tr; BAA_5142-1.
DR   EnsemblGenomes-Tr; BAA_5143-1.
DR   EnsemblGenomes-Tr; BAA_5144-1.
DR   EnsemblGenomes-Tr; BAA_5145-1.
DR   EnsemblGenomes-Tr; BAA_5146-1.
DR   EnsemblGenomes-Tr; BAA_5147-1.
DR   EnsemblGenomes-Tr; BAA_5148-1.
DR   EnsemblGenomes-Tr; BAA_5149-1.
DR   EnsemblGenomes-Tr; BAA_5150-1.
DR   EnsemblGenomes-Tr; BAA_5151-1.
DR   EnsemblGenomes-Tr; BAA_5152-1.
DR   EnsemblGenomes-Tr; BAA_5153-1.
DR   EnsemblGenomes-Tr; BAA_5154-1.
DR   EnsemblGenomes-Tr; BAA_5155-1.
DR   EnsemblGenomes-Tr; BAA_5156-1.
DR   EnsemblGenomes-Tr; BAA_5157-1.
DR   EnsemblGenomes-Tr; BAA_5158-1.
DR   EnsemblGenomes-Tr; BAA_5159-1.
DR   EnsemblGenomes-Tr; BAA_5160-1.
DR   EnsemblGenomes-Tr; BAA_5162-1.
DR   EnsemblGenomes-Tr; BAA_5362-1.
DR   EnsemblGenomes-Tr; BAA_5402-1.
DR   EnsemblGenomes-Tr; BAA_5747-1.
DR   EnsemblGenomes-Tr; BAA_5748-1.
DR   EnsemblGenomes-Tr; BAA_5749-1.
DR   EnsemblGenomes-Tr; BAA_5750-1.
DR   EnsemblGenomes-Tr; BAA_5773-1.
DR   EnsemblGenomes-Tr; EBT00001821281.
DR   EnsemblGenomes-Tr; EBT00001821282.
DR   EnsemblGenomes-Tr; EBT00001821283.
DR   EnsemblGenomes-Tr; EBT00001821284.
DR   EnsemblGenomes-Tr; EBT00001821285.
DR   EnsemblGenomes-Tr; EBT00001821286.
DR   EnsemblGenomes-Tr; EBT00001821287.
DR   EnsemblGenomes-Tr; EBT00001821288.
DR   EnsemblGenomes-Tr; EBT00001821289.
DR   EnsemblGenomes-Tr; EBT00001821290.
DR   EnsemblGenomes-Tr; EBT00001821291.
DR   EnsemblGenomes-Tr; EBT00001821292.
DR   EnsemblGenomes-Tr; EBT00001821293.
DR   EnsemblGenomes-Tr; EBT00001821294.
DR   EnsemblGenomes-Tr; EBT00001821295.
DR   EnsemblGenomes-Tr; EBT00001821296.
DR   EnsemblGenomes-Tr; EBT00001821297.
DR   EnsemblGenomes-Tr; EBT00001821298.
DR   EnsemblGenomes-Tr; EBT00001821299.
DR   EnsemblGenomes-Tr; EBT00001821300.
DR   EnsemblGenomes-Tr; EBT00001821301.
DR   EnsemblGenomes-Tr; EBT00001821302.
DR   EnsemblGenomes-Tr; EBT00001821303.
DR   EnsemblGenomes-Tr; EBT00001821304.
DR   EnsemblGenomes-Tr; EBT00001821305.
DR   EnsemblGenomes-Tr; EBT00001821306.
DR   EnsemblGenomes-Tr; EBT00001821307.
DR   EnsemblGenomes-Tr; EBT00001821308.
DR   EnsemblGenomes-Tr; EBT00001821309.
DR   EnsemblGenomes-Tr; EBT00001821310.
DR   EnsemblGenomes-Tr; EBT00001821311.
DR   EnsemblGenomes-Tr; EBT00001821312.
DR   EnsemblGenomes-Tr; EBT00001821313.
DR   EnsemblGenomes-Tr; EBT00001821314.
DR   EnsemblGenomes-Tr; EBT00001821315.
DR   EnsemblGenomes-Tr; EBT00001821316.
DR   EnsemblGenomes-Tr; EBT00001821317.
DR   EnsemblGenomes-Tr; EBT00001821318.
DR   EnsemblGenomes-Tr; EBT00001821319.
DR   EnsemblGenomes-Tr; EBT00001821320.
DR   EnsemblGenomes-Tr; EBT00001821321.
DR   EnsemblGenomes-Tr; EBT00001821322.
DR   EnsemblGenomes-Tr; EBT00001821323.
DR   EnsemblGenomes-Tr; EBT00001821324.
DR   EnsemblGenomes-Tr; EBT00001821325.
DR   EnsemblGenomes-Tr; EBT00001821326.
DR   EnsemblGenomes-Tr; EBT00001821327.
DR   EnsemblGenomes-Tr; EBT00001821328.
DR   EnsemblGenomes-Tr; EBT00001821329.
DR   EnsemblGenomes-Tr; EBT00001821330.
DR   EnsemblGenomes-Tr; EBT00001821331.
DR   EnsemblGenomes-Tr; EBT00001821332.
DR   EnsemblGenomes-Tr; EBT00001821333.
DR   EnsemblGenomes-Tr; EBT00001821334.
DR   EnsemblGenomes-Tr; EBT00001821335.
DR   EnsemblGenomes-Tr; EBT00001821336.
DR   EnsemblGenomes-Tr; EBT00001821337.
DR   EnsemblGenomes-Tr; EBT00001821338.
DR   EnsemblGenomes-Tr; EBT00001821339.
DR   EnsemblGenomes-Tr; EBT00001821340.
DR   EnsemblGenomes-Tr; EBT00001821341.
DR   EnsemblGenomes-Tr; EBT00001821342.
DR   EnsemblGenomes-Tr; EBT00001821343.
DR   EnsemblGenomes-Tr; EBT00001821344.
DR   EnsemblGenomes-Tr; EBT00001821345.
DR   EnsemblGenomes-Tr; EBT00001821346.
DR   EnsemblGenomes-Tr; EBT00001821347.
DR   EnsemblGenomes-Tr; EBT00001821348.
DR   EnsemblGenomes-Tr; EBT00001821349.
DR   EnsemblGenomes-Tr; EBT00001821350.
DR   EnsemblGenomes-Tr; EBT00001821351.
DR   EnsemblGenomes-Tr; EBT00001821352.
DR   EnsemblGenomes-Tr; EBT00001821353.
DR   EnsemblGenomes-Tr; EBT00001821354.
DR   EnsemblGenomes-Tr; EBT00001821355.
DR   EnsemblGenomes-Tr; EBT00001821356.
DR   EnsemblGenomes-Tr; EBT00001821357.
DR   EnsemblGenomes-Tr; EBT00001821358.
DR   EnsemblGenomes-Tr; EBT00001821359.
DR   EnsemblGenomes-Tr; EBT00001821360.
DR   EnsemblGenomes-Tr; EBT00001821361.
DR   EnsemblGenomes-Tr; EBT00001821362.
DR   EnsemblGenomes-Tr; EBT00001821363.
DR   EnsemblGenomes-Tr; EBT00001821364.
DR   EnsemblGenomes-Tr; EBT00001821365.
DR   EnsemblGenomes-Tr; EBT00001821366.
DR   EnsemblGenomes-Tr; EBT00001821367.
DR   EnsemblGenomes-Tr; EBT00001821368.
DR   EnsemblGenomes-Tr; EBT00001821369.
DR   EnsemblGenomes-Tr; EBT00001821370.
DR   EnsemblGenomes-Tr; EBT00001821371.
DR   EnsemblGenomes-Tr; EBT00001821372.
DR   EnsemblGenomes-Tr; EBT00001821373.
DR   EnsemblGenomes-Tr; EBT00001821374.
DR   EnsemblGenomes-Tr; EBT00001821375.
DR   EnsemblGenomes-Tr; EBT00001821376.
DR   EnsemblGenomes-Tr; EBT00001821377.
DR   EnsemblGenomes-Tr; EBT00001821378.
DR   EnsemblGenomes-Tr; EBT00001821379.
DR   EnsemblGenomes-Tr; EBT00001821380.
DR   EnsemblGenomes-Tr; EBT00001821381.
DR   EnsemblGenomes-Tr; EBT00001821382.
DR   EnsemblGenomes-Tr; EBT00001821383.
DR   EnsemblGenomes-Tr; EBT00001821384.
DR   EnsemblGenomes-Tr; EBT00001821385.
DR   EnsemblGenomes-Tr; EBT00001821386.
DR   EnsemblGenomes-Tr; EBT00001821387.
DR   EnsemblGenomes-Tr; EBT00001821388.
DR   EnsemblGenomes-Tr; EBT00001821389.
DR   EnsemblGenomes-Tr; EBT00001821390.
DR   EnsemblGenomes-Tr; EBT00001821392.
DR   EnsemblGenomes-Tr; EBT00001821394.
DR   EnsemblGenomes-Tr; EBT00001821396.
DR   EnsemblGenomes-Tr; EBT00001821398.
DR   EnsemblGenomes-Tr; EBT00001821399.
DR   EnsemblGenomes-Tr; EBT00001821401.
DR   EnsemblGenomes-Tr; EBT00001821403.
DR   EnsemblGenomes-Tr; EBT00001821405.
DR   EnsemblGenomes-Tr; EBT00001821407.
DR   EnsemblGenomes-Tr; EBT00001821410.
DR   EnsemblGenomes-Tr; EBT00001821413.
DR   EnsemblGenomes-Tr; EBT00001821414.
DR   EnsemblGenomes-Tr; EBT00001821417.
DR   EnsemblGenomes-Tr; EBT00001821419.
DR   EnsemblGenomes-Tr; EBT00001821421.
DR   EnsemblGenomes-Tr; EBT00001821422.
DR   EnsemblGenomes-Tr; EBT00001821424.
DR   EnsemblGenomes-Tr; EBT00001821426.
DR   EnsemblGenomes-Tr; EBT00001821428.
DR   EnsemblGenomes-Tr; EBT00001821429.
DR   EnsemblGenomes-Tr; EBT00001821431.
DR   EnsemblGenomes-Tr; EBT00001821433.
DR   EnsemblGenomes-Tr; EBT00001821435.
DR   EnsemblGenomes-Tr; EBT00001821437.
DR   EnsemblGenomes-Tr; EBT00001821439.
DR   EnsemblGenomes-Tr; EBT00001821442.
DR   EnsemblGenomes-Tr; EBT00001821444.
DR   EnsemblGenomes-Tr; EBT00001821446.
DR   EnsemblGenomes-Tr; EBT00001821447.
DR   EnsemblGenomes-Tr; EBT00001821449.
DR   EnsemblGenomes-Tr; EBT00001821450.
DR   EnsemblGenomes-Tr; EBT00001821451.
DR   EnsemblGenomes-Tr; EBT00001821454.
DR   EnsemblGenomes-Tr; EBT00001821456.
DR   EnsemblGenomes-Tr; EBT00001821457.
DR   EnsemblGenomes-Tr; EBT00001821459.
DR   EnsemblGenomes-Tr; EBT00001821462.
DR   EnsemblGenomes-Tr; EBT00001821464.
DR   EnsemblGenomes-Tr; EBT00001821465.
DR   EnsemblGenomes-Tr; EBT00001821467.
DR   EnsemblGenomes-Tr; EBT00001821469.
DR   EnsemblGenomes-Tr; EBT00001821471.
DR   EnsemblGenomes-Tr; EBT00001821473.
DR   EnsemblGenomes-Tr; EBT00001821475.
DR   EnsemblGenomes-Tr; EBT00001821477.
DR   EnsemblGenomes-Tr; EBT00001821479.
DR   EnsemblGenomes-Tr; EBT00001821481.
DR   EnsemblGenomes-Tr; EBT00001821482.
DR   EnsemblGenomes-Tr; EBT00001821485.
DR   EnsemblGenomes-Tr; EBT00001821487.
DR   EnsemblGenomes-Tr; EBT00001821489.
DR   EnsemblGenomes-Tr; EBT00001821490.
DR   EnsemblGenomes-Tr; EBT00001821492.
DR   EnsemblGenomes-Tr; EBT00001821493.
DR   EnsemblGenomes-Tr; EBT00001821495.
DR   EnsemblGenomes-Tr; EBT00001821498.
DR   EnsemblGenomes-Tr; EBT00001821501.
DR   EnsemblGenomes-Tr; EBT00001821503.
DR   EuropePMC; PMC4595212; 26445214.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00516; ylbH.
DR   RFAM; RF00522; PreQ1.
DR   RFAM; RF00556; L19_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF00559; L21_leader.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01410; BsrC.
DR   RFAM; RF01411; BsrF.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01749; pan.
DR   RFAM; RF01764; yjdF.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01820; RsaE.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001598.
DR   SILVA-SSU; CP001598.
XX
CC   The authors wish to acknowledge the Intelligence Technology
CC   Innovation Center for funding the sequencing and the NIH/NIAID for
CC   funding the annotation at the Pathema Bioinformatics Resource
CC   Center.
CC   The NIAID funded Bioinformatics Resource Center PathoSystems
CC   Resource Integration Center (PATRIC; http://patricbrc.vbi.vt.edu/)
CC   is responsible for annotation updates of this record.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5227419
FT                   /organism="Bacillus anthracis str. A0248"
FT                   /strain="A0248"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:592021"
FT   gene            307..1647
FT                   /gene="dnaA"
FT                   /locus_tag="BAA_0001"
FT   CDS_pept        307..1647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="BAA_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="identified by match to protein family HMM PF00308;
FT                   match to protein family HMM PF08299; match to protein
FT                   family HMM TIGR00362"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46614"
FT                   /db_xref="GOA:C3P8P5"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3P8P5"
FT                   /protein_id="ACQ46614.1"
FT                   /translation="MENISDLWNSALKELEKKVSKPSYETWLKSTTAHNLKKDVLTITA
FT                   PNEFARDWLESHYSELISETLYDLTGAKLAIRFIIPQSQAEEEIDLPPAKPNAAQDDSN
FT                   HLPQSMLNPKYTFDTFVIGSGNRFAHAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHA
FT                   IGHYVIEHNPNAKVVYLSSEKFTNEFINSIRDNKAVDFRNKYRNVDVLLIDDIQFLAGK
FT                   EQTQEEFFHTFNALHEESKQIVISSDRPPKEIPTLEDRLRSRFEWGLITDITPPDLETR
FT                   IAILRKKAKAEGLDIPNEVMLYIANQIDSNIRELEGALIRVVAYSSLINKDINADLAAE
FT                   ALKDIIPNSKPKIISIYDIQKAVGDVYQVKLEDFKAKKRTKSVAFPRQIAMYLSRELTD
FT                   SSLPKIGEEFGGRDHTTVIHAHEKISKLLKTDTQLQKQVEEINDILK"
FT   gene            1826..2965
FT                   /gene="dnaN1"
FT                   /locus_tag="BAA_0002"
FT   CDS_pept        1826..2965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN1"
FT                   /locus_tag="BAA_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00712;
FT                   match to protein family HMM PF02767; match to protein
FT                   family HMM PF02768; match to protein family HMM TIGR00663"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47466"
FT                   /protein_id="ACQ47466.1"
FT                   /translation="MRFSIQKDYLVRSVQDVMKAVSFRTTIPILTGIKVVATEEGVTLT
FT                   GSDADISIESFIPVEEDGKEIVEVKQSGSIVLQAKYFSEIVKKLPKETVEISVENHLMT
FT                   KITSGKSEFNLNGLDSAEYPLLPQIEEHHVFKIPTDLLKHMIRQTVFAVSTSETRPILT
FT                   GVNWKVYNSELTCIATDSHRLALRKAKIEGIVDEFQANVVIPGKSLNELSKILDESEEM
FT                   VDIVITEYQVLFRTKHLLFFSRLLEGNYPDTTRLIPAESKTDIFVNTKEFLQAIDRASL
FT                   LARDGRNNVVKLSTLEQAMLEISSNSPEIGKVVEEVQCEKVDGEELKISFSAKYMMDAL
FT                   KALDSTEIKISFTGAMRPFLIRTVNDESIIQLILPVRTY"
FT   gene            3093..3305
FT                   /locus_tag="BAA_0003"
FT   CDS_pept        3093..3305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0003"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM TIGR02988"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47996"
FT                   /protein_id="ACQ47996.1"
FT                   /translation="MKRIKISTEYITLGQFLKLADVIDTGGAVKWFLQEYEVYVNQELE
FT                   NRRGRKLYANDIIEIPGSGSFQVQS"
FT   gene            3318..4445
FT                   /gene="recF"
FT                   /locus_tag="BAA_0004"
FT   CDS_pept        3318..4445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="BAA_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="identified by match to protein family HMM PF02463;
FT                   match to protein family HMM TIGR00611"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48913"
FT                   /db_xref="GOA:C3P8P8"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3P8P8"
FT                   /protein_id="ACQ48913.1"
FT                   /translation="MFISEIQLKNYRNYEKLELSFEDKVNVIIGENAQGKTNLMEAIYV
FT                   LAMAKSHRTSNDRELIRWDEDFGQIKGKLQKRNSSLSLELNISKKGKKAKLNQLEQQKL
FT                   SQYIGVMNVVMFAPEDLNLVKGSPQVRRRFLDMELGQIAPVYLYELSQYQKVLTQRNHL
FT                   LKKMQGNSKNEETMLDVFTLQLIEHGTKILRKRFEFLHLLQEWAAPIHRGISRGLEELE
FT                   IVYKPSVDVSESMDLSKIKEVYYESFQSVKQREIFRGTTLIGPHRDDLQFFVNSKNVQV
FT                   FGSQGQQRTTALSLKLAEIELIYSEVKEYPILLLDDVLSELDDYRQSHLLNTIQGKVQT
FT                   FVTTTSVDGIEHETLKEAKTIHVTNGTVDCEIDRA"
FT   gene            4484..6406
FT                   /gene="gyrB"
FT                   /locus_tag="BAA_0005"
FT   CDS_pept        4484..6406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="BAA_0005"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="identified by match to protein family HMM PF00204;
FT                   match to protein family HMM PF00986; match to protein
FT                   family HMM PF01751; match to protein family HMM PF02518;
FT                   match to protein family HMM TIGR01059"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49443"
FT                   /protein_id="ACQ49443.1"
FT                   /translation="MEQKQMQENSYDESQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLV
FT                   WEIVDNSIDEALAGYCDEINVSIEEDNSIRVTDNGRGIPVGIQEKMGRPAVEVIMTVLH
FT                   AGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVHREGKIHYQKYERGIPVADLKVIG
FT                   DTDQTGTITRFKPDPEIFQETTVYEFDTLATRMRELAFLNRNIKLTIEDKREHKQKKEF
FT                   HYEGGIKSYVEHLNRSKQPIHEEPVYVEGSKDGIQVEVSLQYNEGYTNNIYSFTNNIHT
FT                   YEGGTHEVGFKTALTRVINDYGRKNSILKDADSNLTGEDVREGLTAIVSIKHPNPQFEG
FT                   QTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKIVEKGTMAARARVAAKKARELTR
FT                   RKSALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGSAKQGRDRHFQAILPLKGKIIN
FT                   VEKARLDKILSNDEVRTIITAIGTNIGGDFDIEKARYHKVIIMTDADVDGAHIRTLLLT
FT                   FFYRYMRQIIEHGYIYIAQPPLFKVQQGKKIQYAYNEKELEKILAELPAQPKPGIQRYK
FT                   GLGEMNPTQLWETTMDPEVRSLLQVSLQDAIEADETFEILMGDKVEPRRNFIQENAKYV
FT                   KNLDI"
FT   gene            6495..8966
FT                   /gene="gyrA"
FT                   /locus_tag="BAA_0006"
FT   CDS_pept        6495..8966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="BAA_0006"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="identified by match to protein family HMM PF00521;
FT                   match to protein family HMM PF03989; match to protein
FT                   family HMM TIGR01063"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50267"
FT                   /protein_id="ACQ50267.1"
FT                   /translation="MSDNQQQARIREINISHEMRTSFLDYAMSVIVSRALPDVRDGLKP
FT                   VHRRVLYAMNDLGITADKAYKKSARIVGEVIGKYHPHGDSAVYETMVRMAQDFSQRYML
FT                   VDGHGNFGSVDGDSAAAMRYTEARMSKISMELIRDISKNTIDYQDNYDGSEREPIVLPA
FT                   RFPNLLVNGTTGIAVGMATNIPPHQLGEVIDGVLALSHNPDITIAELMECIPGPDFPTA
FT                   GLILGRSGIRRAYETGRGSIILRAKVEIEEKSNGKQSIIVTELPYQVNKARLIEKIAEL
FT                   VRDKKIEGITDLRDESDRNGMRIVMEVRRDANANVLLNNLYKHTALQTSFGINMLSLVN
FT                   GEPQVLNLKQNLYHYLEHQKVVIRRRTAYELEKAEARAHILEGLRIALDHLDEVITLIR
FT                   SSKTAEIAKQGLMERFGLSEKQAQAILDMRLQRLTGLEREKIEQEYQDLMKLIAELKAI
FT                   LADEEKVLEIIREELTEVKERFNDKRRTEITIGGMESIEDEDLIPEQNIAITLTHNGYI
FT                   KRLPASTYKTQNRGGRGVQGMGTNDDDFVEHLLTTSTHDHILFFTNKGKVYRTKGYEIP
FT                   EYSRTAKGIPIINLLGVDKGEWINAIIPIREFGDDEFLFFTTKQGISKRTPLSSFANIR
FT                   TNGLIAISLREEDEVISVRLTSGDKDIIVGTSNGMLIRFNEQDVRSMGRNAAGVKAITL
FT                   GEEDQVVGMEIVEEDVNVLIVTKNGYGKRTPIDEYRLQSRGGKGLKTCNITDKNGKLVA
FT                   VKSVTGEEDIMLITAAGVIIRMPVDQISQMGRNTQGVRLIRLEDEQEVATVAKAQKDDE
FT                   EETSEEVSSEE"
FT   gene            9233..10741
FT                   /gene="rrs_1"
FT                   /locus_tag="BAA_0007"
FT   rRNA            9233..10741
FT                   /gene="rrs_1"
FT                   /locus_tag="BAA_0007"
FT                   /product="16S ribosomal RNA"
FT   gene            10891..10969
FT                   /locus_tag="BAA_0008"
FT   tRNA            10891..10969
FT                   /locus_tag="BAA_0008"
FT                   /product="tRNA-Ile"
FT   gene            10976..11053
FT                   /locus_tag="BAA_0009"
FT   tRNA            10976..11053
FT                   /locus_tag="BAA_0009"
FT                   /product="tRNA-Ala"
FT   gene            11147..14054
FT                   /gene="rrl_1"
FT                   /locus_tag="BAA_0011"
FT   rRNA            11147..14054
FT                   /gene="rrl_1"
FT                   /locus_tag="BAA_0011"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(11171..11602)
FT                   /pseudo
FT                   /locus_tag="BAA_0010"
FT                   /note="conserved hypothetical protein; this region contains
FT                   one or more premature stops and/or frameshifts"
FT   gene            14103..14218
FT                   /gene="rrf_1"
FT                   /locus_tag="BAA_0012"
FT   rRNA            14103..14218
FT                   /gene="rrf_1"
FT                   /locus_tag="BAA_0012"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(14253..15197)
FT                   /pseudo
FT                   /locus_tag="BAA_0013"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            15368..16831
FT                   /gene="guaB"
FT                   /locus_tag="BAA_0014"
FT   CDS_pept        15368..16831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaB"
FT                   /locus_tag="BAA_0014"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.205"
FT                   /note="identified by match to protein family HMM PF00478;
FT                   match to protein family HMM PF00571; match to protein
FT                   family HMM TIGR01302"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47420"
FT                   /protein_id="ACQ47420.1"
FT                   /translation="MWESKFVKEGLTFDDVLLVPAKSDVLPREVSVKTVLSESLQLNIP
FT                   LISAGMDTVTEADMAIAMARQGGLGIIHKNMSIEQQAEQVDKVKRSESGVISDPFFLTP
FT                   EHQVYDAEHLMGKYRISGVPVVNNLDERKLVGIITNRDMRFIQDYSIKISDVMTKEQLI
FT                   TAPVGTTLSEAEKILQKYKIEKLPLVDNNGVLQGLITIKDIEKVIEFPNSAKDKQGRLL
FT                   VGAAVGVTADAMTRIDALVKASVDAIVLDTAHGHSQGVIDKVKEVRAKYPSLNIIAGNV
FT                   ATAEATKALIEAGANVVKVGIGPGSICTTRVVAGVGVPQLTAVYDCATEARKHGIPVIA
FT                   DGGIKYSGDMVKALAAGAHVVMLGSMFAGVAESPGETEIYQGRQFKVYRGMGSVGAMEK
FT                   GSKDRYFQEGNKKLVPEGIEGRVPYKGPLADTVHQLVGGLRAGMGYCGAQDLEFLRENA
FT                   QFIRMSGAGLLESHPHHVQITKEAPNYSL"
FT   gene            16936..18252
FT                   /gene="dacA"
FT                   /locus_tag="BAA_0015"
FT   CDS_pept        16936..18252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dacA"
FT                   /locus_tag="BAA_0015"
FT                   /product="serine-type D-Ala-D-Ala carboxypeptidase DacA"
FT                   /EC_number="3.4.16.4"
FT                   /note="identified by match to protein family HMM PF00768;
FT                   match to protein family HMM PF07943"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49906"
FT                   /protein_id="ACQ49906.1"
FT                   /translation="MKGMFCKRFIALVTMLTLVCSMLLPYSNASAETGSALNIEAGAAI
FT                   LVEANSGKILYQKNADELLSIASMTKMMSEYLVHEAVDKGKFKWDQKIKVSEYAYKVSQ
FT                   DASLSNVALENGGSYTVKELYEAMAIFSANGATIALAEAIAGKEVDFVKMMNDKSKELG
FT                   LKNYKFVNSTGLTNKDLKGMHPEGTTADEENKMSAKDVATLAQHLIKDYPKVLDTAKIP
FT                   KKEFRPEKEKFAMSNWNWMLKGLVKEYDGVDGLKTGSTPEAGDCFTGTVERNGMRFISV
FT                   VIKTSSHTARFDETKKLYDYGFANFEMKQMYKKGSSVKGQETVRVENAKDKDVAVQTKQ
FT                   AISLPVPKGSKEVYKTELKESSKGQEAPIKKGAALGQMVITPKDTNDPGFLTGKSLQVD
FT                   LVTTSEVEEANWFTRAMRGIGSFFSGIWNSAVDTVKGWF"
FT   gene            18414..19301
FT                   /locus_tag="BAA_0016"
FT   CDS_pept        18414..19301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0016"
FT                   /product="pyridoxine biosynthesis protein"
FT                   /note="identified by match to protein family HMM PF01680;
FT                   match to protein family HMM TIGR00343"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50331"
FT                   /db_xref="GOA:C3P8Q3"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3P8Q3"
FT                   /protein_id="ACQ50331.1"
FT                   /translation="MTNVTGTERVKRGMAEMQKGGVIMDVINAEQAKIAEEAGAVAIMA
FT                   LERVPADIRAAGGVSRMADPTIVEEVMGAVSIPVMAKCRIGHLVEARVLESLGVDYIDE
FT                   SEVLTPADEVYHLNKRDYTVPFVCGCRDIGEAARRIAEGASMLRTKGEPGTGNIVEAVR
FT                   HMRQVNAEIRQVASLREDELMTYAKNTGAPYEVLLEIKRLGRLPVVNFAAGGVATPADA
FT                   ALMMQLGADGVFVGSGIFKSENPAKFARAIVEATTHYEDYELIASLSKGLGNAMKGIEI
FT                   STLLPEQRMQERGW"
FT   gene            19320..19910
FT                   /locus_tag="BAA_0017"
FT   CDS_pept        19320..19910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0017"
FT                   /product="glutamine amidotransferase, SNO family"
FT                   /note="identified by match to protein family HMM PF01174;
FT                   match to protein family HMM PF07685"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50665"
FT                   /db_xref="GOA:C3P8Q4"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3P8Q4"
FT                   /protein_id="ACQ50665.1"
FT                   /translation="MVKIGVLGLQGAVREHVKSVEASGAEAVVVKRIEQLEEIDGLILP
FT                   GGESTTMRRLIDKYDFMEPLRTFAKSGKPMFGTCAGMILLAKTLIGYDEAHIGAMDITV
FT                   ERNAFGRQKDSFEAALSIKGVGEDFVGVFIRAPYVVDVADDVEVLSTHGDRMVAVKQGP
FT                   FLAASFHPELTDDHRVTAYFVEMVKEAKMKKVV"
FT   gene            20238..21512
FT                   /gene="serS"
FT                   /locus_tag="BAA_0018"
FT   CDS_pept        20238..21512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="BAA_0018"
FT                   /product="serine--tRNA ligase"
FT                   /EC_number="6.1.1.11"
FT                   /note="identified by match to protein family HMM PF00587;
FT                   match to protein family HMM PF02403; match to protein
FT                   family HMM TIGR00414"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46636"
FT                   /db_xref="GOA:C3P9G2"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3P9G2"
FT                   /protein_id="ACQ46636.1"
FT                   /translation="MLDIKFLRTNFEEVKAKLQHRGEDLTDFGRFEELDTRRRELLVQT
FT                   EELKSKRNEVSQQISVLKREKKDAEALILEMREVGEKVKDLDNELRTVEEDLERLMLSI
FT                   PNIPHESAPVGETEDDNVVARTWGEVKEFAFEPKPHWDLATDLGILDFERAGKVTGSRF
FT                   VFYKGAGARLERALISFMLDLHTDEHGYEEVLPPYMVNRASMTGTGQLPKFEEDAFRIE
FT                   SEDYFLIPTAEVPVTNMHRDEILNKEQLPIRYAAFSSCFRSEAGSAGRDTRGLIRQHQF
FT                   NKVELVKFVKPEDSYEELEKLTNDAERVLQLLELPYRVMSMCTGDLGFTAAKKYDIEVW
FT                   IPSYGTYREISSCSNFEAFQARRANIRFRREPNGKPEHVHTLNGSGLAIGRTVAAILEN
FT                   YQQEDGTIIIPEVLRPYMGGKTVIK"
FT   gene            21669..21761
FT                   /locus_tag="BAA_0019"
FT   tRNA            21669..21761
FT                   /locus_tag="BAA_0019"
FT                   /product="tRNA-Ser"
FT   gene            21928..22320
FT                   /locus_tag="BAA_0020"
FT   CDS_pept        21928..22320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0020"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47673"
FT                   /protein_id="ACQ47673.1"
FT                   /translation="MDLIIQTFPLDGKTLYYVQCPVCKNNRILNSGANVSRIISDDTFR
FT                   KLCGCTCDVKQTATKVEAPKKVKKEAVKKEAAPKRTGKVLTAVINGKEMTVKEIAEAYD
FT                   ISTSTVRQRINAGKSESEIIAPTKKK"
FT   gene            complement(22356..23024)
FT                   /locus_tag="BAA_0021"
FT   CDS_pept        complement(22356..23024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0021"
FT                   /product="deoxynucleoside kinase family protein"
FT                   /EC_number="2.7.1.-"
FT                   /note="identified by match to protein family HMM PF01712"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48049"
FT                   /protein_id="ACQ48049.1"
FT                   /translation="MNLRQKYDIPNDAVITIAGTVGVGKSTMTTALANALGYRTSFEKV
FT                   DSNPYLDKFYADFTRWSFHLQVYFLAERFKEQKRIFEYGGGFVQDRSIYEDTGIFAKMH
FT                   HEKGTMTETDYETYKGLFDAMVMTPYFPHPDLLIYLEGSFDDIVDRIQERGRPMEQQTP
FT                   IEYWKEMHGRYENWINNFNSCPVLRLNINEYDILKDGDSIEPIIKKIGHFLKQTRKLVK
FT                   "
FT   gene            complement(23027..23662)
FT                   /locus_tag="BAA_0022"
FT   CDS_pept        complement(23027..23662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0022"
FT                   /product="deoxynucleoside kinase family protein"
FT                   /EC_number="2.7.1.-"
FT                   /note="identified by match to protein family HMM PF01712"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48618"
FT                   /protein_id="ACQ48618.1"
FT                   /translation="MTGVPFITVEGPIGVGKTSLAKEISTHMQLHLLKEIVDENPFLGK
FT                   FYEDIDEWSFQTEMFFLCNRYKQLEDINIKYLNQRKPVVADYHIFKNVIFASRTLKDSQ
FT                   YDKYMQIYRILTQDMPVPNVIVYLTASLETLQRRIAMRGREFEKNMDPNYLLQLTKDYE
FT                   TAMDAFKKDHPDIPVLKFNGDDMDFVKNPDDLNVILSALQNTLLKESK"
FT   gene            complement(23788..24327)
FT                   /locus_tag="BAA_0023"
FT   CDS_pept        complement(23788..24327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0023"
FT                   /product="isochorismatase family protein"
FT                   /note="identified by match to protein family HMM PF00857"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50027"
FT                   /protein_id="ACQ50027.1"
FT                   /translation="MKNTALLIIDMINDFQFSHGPILAKKCEMITNPILQLKKTMKSFG
FT                   YPIIYINDHYQLWRSDIDQLITHCTNEYSENIIHKIAPSSDDYIFIKPHYSAFYETPLN
FT                   SLLGYLKIENLILTGVAGNICILFTANDAHMRNYTLYVPQDCIASNHDQDNLHALKIME
FT                   TTLKANIVPSSQIKFN"
FT   gene            24435..24935
FT                   /locus_tag="BAA_0024"
FT   CDS_pept        24435..24935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0024"
FT                   /product="cytidine/deoxycytidylate deaminase zinc-binding
FT                   domain protein"
FT                   /note="identified by match to protein family HMM PF00383"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50567"
FT                   /protein_id="ACQ50567.1"
FT                   /translation="MERDQDIYFMQLAIEEAKKAEAIQEVPIGAVIVLNGEVISAAHNL
FT                   RETEQRSIAHAELLAIDEACKKLGTWRLEDATLYVTLEPCPMCAGGIVLSRVKRVVYGA
FT                   GDPKGGCAGTLMNLLTDERFNHQCEVVAGVLEEECGTLLTNFFRELRKKRKAIKKLEKS
FT                   NEN"
FT   gene            25128..25230
FT                   /gene="srpB"
FT                   /locus_tag="BAA_0025"
FT   ncRNA           25128..25230
FT                   /gene="srpB"
FT                   /locus_tag="BAA_0025"
FT                   /product="Bacterial signal recognition particle RNA"
FT                   /ncRNA_class="SRP_RNA"
FT   gene            25412..27100
FT                   /gene="dnaX"
FT                   /locus_tag="BAA_0026"
FT   CDS_pept        25412..27100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="BAA_0026"
FT                   /product="DNA polymerase III, gamma and tau subunits"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM TIGR02397"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50817"
FT                   /protein_id="ACQ50817.1"
FT                   /translation="MSYQALYRTWRPQKFEDVVGQKHVTKTLQNALLQEKVSHAYLFSG
FT                   PRGTGKTTIAKVFAKAINCEHAPVAEPCNECPSCLGITQGSISDVLEIDAASNNGVDEI
FT                   RDIRDKVKYAPSAVEYKVYIIDEVHMLSMGAFNALLKTLEEPPGHVIFILATTEPHKIP
FT                   PTIISRCQRFEFRKISVNDIVERLSTVVTNEGTQVEDEALQIVARAAEGGMRDALSLID
FT                   QAISYSDERVTTEDVLAVTGSVSQQYLGNLVECIRENDVSRALRIIDEMMGKGKDPVRF
FT                   MEDFIYYYRDMLLYQTSPQLEHMLERVMVDEQFRMLSEEMQPEVIYEIIHTLSKGQQEM
FT                   KWTNHPRIFLEVVMVQLCQQFMMQANGADRLQAIMNRMQQLEKELEQVKKNGVPVGVQQ
FT                   EVKETRAAPKPVRTGSMKIPVGRVNEVLKQAKRQDLEQLKAVWGELLGRLKAYNKVAFA
FT                   VLLENSEPVAASDDTYVLAFQYEIHCKMASENREAMDTVEQALFELLSKKLNMIAIPKS
FT                   EWGKIREDFLKREGGSSEESPEKKEDPLIEEAIKLVGQELIEIKE"
FT   gene            27123..27452
FT                   /locus_tag="BAA_0027"
FT   CDS_pept        27123..27452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0027"
FT                   /product="conserved hypothetical protein TIGR00103"
FT                   /note="identified by match to protein family HMM PF02575;
FT                   match to protein family HMM TIGR00103"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47955"
FT                   /db_xref="GOA:C3P9G9"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3P9G9"
FT                   /protein_id="ACQ47955.1"
FT                   /translation="MMRGGMGNMNNMMKQMQKMQKEMAKAQEELGEKTVEGTAGGGMIT
FT                   VIANGHKQILEVKVKEEVVDPEDIEMLQDLVLAATNDALKKADELSNSTMGKFTKGLNL
FT                   PGGMF"
FT   gene            27467..28063
FT                   /gene="recR"
FT                   /locus_tag="BAA_0028"
FT   CDS_pept        27467..28063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="BAA_0028"
FT                   /product="recombination protein RecR"
FT                   /note="identified by match to protein family HMM PF01751;
FT                   match to protein family HMM PF02132; match to protein
FT                   family HMM TIGR00615"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49434"
FT                   /db_xref="GOA:C3P9H0"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3P9H0"
FT                   /protein_id="ACQ49434.1"
FT                   /translation="MHYPEPISKLIDSFMKLPGIGPKTAVRLAFFVLDMKEDDVLGFAK
FT                   ALVNAKRDLAYCSVCGHITDRDPCYICNDSHRDQSVVCVVQEPKDVIAMEKMKEYQGVY
FT                   HVLRGAISPMGGIGPEDINIPQLLKRLHDETVQEVILATNPNIEGEATAMYISRLLKPT
FT                   GIKVTRIAHGLPVGGDLEYADEVTLSKALEGRREV"
FT   gene            28078..28299
FT                   /locus_tag="BAA_0029"
FT   CDS_pept        28078..28299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0029"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50268"
FT                   /protein_id="ACQ50268.1"
FT                   /translation="MFFQKKGKLRKEYDDNLIVLLEKVKNEWLRQKRMVEQSVEPSQDV
FT                   LCSLKIAEAKYFFLLKEAKRRPVKMEQW"
FT   gene            28514..28783
FT                   /gene="bofA"
FT                   /locus_tag="BAA_0030"
FT   CDS_pept        28514..28783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bofA"
FT                   /locus_tag="BAA_0030"
FT                   /product="sigma-k factor processing regulatory protein
FT                   BofA"
FT                   /note="identified by match to protein family HMM PF07441;
FT                   match to protein family HMM TIGR02862"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50648"
FT                   /protein_id="ACQ50648.1"
FT                   /translation="MNSTIIIVGILALVFIFLVFGVSSKPLRFIGKALFHVTLGVALLF
FT                   IVNVVGTYFDFHIPINLGTATITSLLGLPGVAALVVIKLYIMPR"
FT   gene            29027..30535
FT                   /gene="rrs_2"
FT                   /locus_tag="BAA_0031"
FT   rRNA            29027..30535
FT                   /gene="rrs_2"
FT                   /locus_tag="BAA_0031"
FT                   /product="16S ribosomal RNA"
FT   gene            30685..30763
FT                   /locus_tag="BAA_0032"
FT   tRNA            30685..30763
FT                   /locus_tag="BAA_0032"
FT                   /product="tRNA-Ile"
FT   gene            30770..30847
FT                   /locus_tag="BAA_0033"
FT   tRNA            30770..30847
FT                   /locus_tag="BAA_0033"
FT                   /product="tRNA-Ala"
FT   gene            30941..33848
FT                   /gene="rrl_2"
FT                   /locus_tag="BAA_0035"
FT   rRNA            30941..33848
FT                   /gene="rrl_2"
FT                   /locus_tag="BAA_0035"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(30965..31396)
FT                   /pseudo
FT                   /locus_tag="BAA_0034"
FT                   /note="conserved hypothetical protein; this region contains
FT                   one or more premature stops and/or frameshifts"
FT   gene            33897..34012
FT                   /gene="rrf_2"
FT                   /locus_tag="BAA_0036"
FT   rRNA            33897..34012
FT                   /gene="rrf_2"
FT                   /locus_tag="BAA_0036"
FT                   /product="5S ribosomal RNA"
FT   gene            34203..34382
FT                   /locus_tag="BAA_0037"
FT   CDS_pept        34203..34382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0037"
FT                   /product="putative csfB protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46551"
FT                   /protein_id="ACQ46551.1"
FT                   /translation="MKSQNEVCIVCETERKEGIYVYNNLICYECEKDMVNTETDDPKYI
FT                   YYLKQLRKLEVSYF"
FT   gene            34454..35875
FT                   /locus_tag="BAA_0038"
FT   CDS_pept        34454..35875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0038"
FT                   /product="Orn/Lys/Arg decarboxylase family protein"
FT                   /note="identified by match to protein family HMM PF01276;
FT                   match to protein family HMM PF03711"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47402"
FT                   /protein_id="ACQ47402.1"
FT                   /translation="MNQNRIPLYEALIEFKERRRLSFHVPGHKNGLNFPQEVVEEFKDI
FT                   LSIDVTELSGLDDLHSPFECIDEAQQLLADVYGVNKSYFLINGSTVGNLAMILSCCGEH
FT                   DIVLVQRNCHKSIINGLKLAGANPIFLDPWIDEAYNVPVGIHDEIIKEAIEKYPNAKAL
FT                   ILTHPNYYGMGMDLEASIAYAHTHKIPVLVDEAHGAHFCLGGAFPQSALAYGADMVVHS
FT                   AHKTLPAMTMGSYLHINSRLVKEEKVSTYLSMLQSSSPSYPIMASLDIARFTIARIKEK
FT                   GHDEIVEFLQEFKEELSTIPQIAILQYPLQDGLKITVQTRCRLSGYELQSVFEKVGIYT
FT                   EMADPYNVLFILPLQVNKKYMKAIEMIRVALQYYEVKDKTESIRYTYKGEISPLPYTYK
FT                   QLEEYETKVVPIEEAVGMVAAEMVIPYPPGIPLIMYGERITSGHKEQIMYLEKAGARFQ
FT                   GSRKYMKVYDIESRF"
FT   gene            35877..36503
FT                   /gene="tmk"
FT                   /locus_tag="BAA_0039"
FT   CDS_pept        35877..36503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tmk"
FT                   /locus_tag="BAA_0039"
FT                   /product="dTMP kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="identified by match to protein family HMM PF02223;
FT                   match to protein family HMM TIGR00041"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49056"
FT                   /db_xref="GOA:C3P9H5"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3P9H5"
FT                   /protein_id="ACQ49056.1"
FT                   /translation="MKGLFVTIEGPEGSGKTTLIQSLLPYFEQKEQKVMATREPGGIAI
FT                   SEDIRTILHKQEYTMMEARTEALLYAAARRQHLVEKVMPALNEDYLVLCDRFIDSSLAY
FT                   QGYARGLGMDKVFEINRFATEDCMPSLTIYLDIEPEVGLARIAKDAGREVNRLDMEDIS
FT                   FHKRVREGYLQVVERFSDRIVLVNADQPMEKLIEEVIQVIEDKLL"
FT   gene            36539..37522
FT                   /gene="holB"
FT                   /locus_tag="BAA_0040"
FT   CDS_pept        36539..37522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holB"
FT                   /locus_tag="BAA_0040"
FT                   /product="DNA polymerase III, delta prime subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM TIGR00678"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49528"
FT                   /protein_id="ACQ49528.1"
FT                   /translation="MTKTWEQLSAIQPIGVKMLMNSIAKERISHAYLLEGEKGTGKFAT
FT                   AIQMAKSFLCSQRNRVEPCHVCTNCKRIDSGNHPNLHIVKPDGLSIKKQQIHDLQEEFS
FT                   KTGLEANKKVYIIEHADRMTANAANALLKFLEEPSSDTTAILLTEQSHQILNTILSRCQ
FT                   VVTFRPLPTESLIRRLQDEGITVSLSTLAAQLTNSFDEALTLCNDEWFAQARALVIKLC
FT                   EALEKDKASIFFVQEKWGKHFGEKEQLQQGLDMLLLIYKDLLYVQLGEEDRLVFREQKE
FT                   MFESFSYAQKRIVSALFNILEAKNRINANVNAQLVFEQLVLRLQEG"
FT   gene            37528..38355
FT                   /locus_tag="BAA_0041"
FT   CDS_pept        37528..38355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0041"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04468"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49166"
FT                   /protein_id="ACQ49166.1"
FT                   /translation="MYDVVGVRFKKAGKVYYFDPNQFDISENEFVIVETVRGIEYGKVV
FT                   ITKKQVDENDVVLPLKKVIRIANENDRTIVEENKHAAKEAYQVCQQKVVEHNLDMKLVD
FT                   VEYTFDRNKIIFYFTADGRIDFRELVKDLAAIFRTRIELRQIGVRDEAKMLGGIGPCGR
FT                   MLCCSTFLGDFEPVSIKMAKDQNLSLNPAKISGLCGRLMCCLKYENDEYEAAKEQLPDL
FT                   DQRIQTPHGTGRVIGLNILERLIQVELVDKERIVEYTLDELVNKGVVSSQTTD"
FT   gene            38370..38720
FT                   /locus_tag="BAA_0042"
FT   CDS_pept        38370..38720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0042"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06156"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46357"
FT                   /db_xref="GOA:C3P9H8"
FT                   /db_xref="InterPro:IPR010377"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3P9H8"
FT                   /protein_id="ACQ46357.1"
FT                   /translation="MEKKDIFASVSSMEEQIGHLYKQLGELKQHLAELLEENQHIKMEN
FT                   ENLRHRFEEVQIKEKQKTQKRKEVKPKTDIGEGYDNLARLYQEGFHICNLHYGSVRKEG
FT                   DCLFCLSFLNKK"
FT   gene            38841..39581
FT                   /locus_tag="BAA_0043"
FT   CDS_pept        38841..39581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0043"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48357"
FT                   /protein_id="ACQ48357.1"
FT                   /translation="MNLYEDERLDYLLAQDMKIIQSPSVFNFSLDAVLLADFAWVPIQK
FT                   GNLLDLCTGNAVVPLLLSTRTKGNITGVEIQERLYDMGIRSVQYNKLEERIHLIHGDLK
FT                   DMPEKLGRHQYDVVTCNPPYFQTPVTSEKNMNEHLAIARHEIMCTLEDVVSASSQLVKQ
FT                   GGKVAFVHRPGRLLDIVTLMRKYKIEPKRVRFVYPKAGKEANTLLIEGIKDGNADLKIL
FT                   PPLFVYEENNEYTKEIRSILYGEE"
FT   gene            39568..39858
FT                   /locus_tag="BAA_0044"
FT   CDS_pept        39568..39858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0044"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01541"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47698"
FT                   /protein_id="ACQ47698.1"
FT                   /translation="MEKNKHCFYVVECSDGSYYAGYTNHIEKRIGTHNSGRGAKYTRAR
FT                   LPVVLKYVEFHEDKRTAMQAEYYFKQLNRKQKEEYMQKGERYVATKKLSTK"
FT   gene            39827..40702
FT                   /locus_tag="BAA_0045"
FT   CDS_pept        39827..40702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0045"
FT                   /product="tetrapyrrole methylase family protein"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF00590;
FT                   match to protein family HMM TIGR00096"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50209"
FT                   /protein_id="ACQ50209.1"
FT                   /translation="MWQQKSFQQNEKGVLYLVPTPIGNLEDMTFRAIRILKEADLIAAE
FT                   DTRQTKKLCNYFEIETPVMSYHEHNKEVSGKKILEKLDEGKTVALVSDAGMPCISDPGY
FT                   DIVVEAVAEQYHVIPLPGANAALTALIASGLQTKQFYFYGFLQRNKKERKMELEKLRYV
FT                   QTTMMFYEAPHRLDDTLISMQEVLGNREIVLCRELTKKFEEFIRGTVEEAIEWTKQNEV
FT                   RGEFCILVAGSTEEPAPEEQWWESISVYNHIEHYINEKGMNSKEAIKTVAKDRDLSKRD
FT                   VYQIYHVDKK"
FT   gene            complement(40723..41007)
FT                   /gene="abrB"
FT                   /locus_tag="BAA_0046"
FT   CDS_pept        complement(40723..41007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="abrB"
FT                   /locus_tag="BAA_0046"
FT                   /product="transition state transcriptional regulatory
FT                   protein AbrB"
FT                   /note="identified by match to protein family HMM PF04014;
FT                   match to protein family HMM TIGR01439"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49167"
FT                   /protein_id="ACQ49167.1"
FT                   /translation="MKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIIL
FT                   KKYKPNMTCQVTGEVSDGNLFLAEGKIILSKEGAEQILNELQDYIETAK"
FT   gene            41498..43480
FT                   /gene="metS"
FT                   /locus_tag="BAA_0047"
FT   CDS_pept        41498..43480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metS"
FT                   /locus_tag="BAA_0047"
FT                   /product="methionine--tRNA ligase"
FT                   /EC_number="6.1.1.10"
FT                   /note="identified by match to protein family HMM PF00133;
FT                   match to protein family HMM PF01588; match to protein
FT                   family HMM PF09334; match to protein family HMM TIGR00398;
FT                   match to protein family HMM TIGR00399"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46167"
FT                   /protein_id="ACQ46167.1"
FT                   /translation="MTEENKSFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKCMQGYN
FT                   VHYLTGTDEHGQKIQKKAEELNVTPQAYVDNIVAGIKELWEKMDISYDDFIRTTEDRHK
FT                   DVVEKIFKQLVDQGDIYLDEYEGWYSVQDETFYTEHQLVDPIMEGDKVVGGKSPDSGHD
FT                   VELVREESYFFRMGKYVDRLLKFYEDNPHFIQPESRKNEMINNFIKPGLEDLAVSRTSF
FT                   DWGVRVPGNPKHVIYVWVDALSNYITALGYGTENEEMYKKFWPADVHLVGKEIVRFHTI
FT                   YWPIILMALDLPLPKKVFAHGWILMKDGKMSKSKGNVVDPVILIDRYGLDALRYYLLRE
FT                   VPFGSDGVFTPEGFVERINFDLANDLGNLLNRTVAMIDKYFNGEIPAFKANVTEFDETL
FT                   VTFAKDTLKKVEEAMENMEFSVALSSIWQLVSRTNKYIDETQPWVLAKDEDDREKLASV
FT                   MAHLAEVLRQTGIMLMPFLTVAPSKMFAQLGLTDEAHTSWGSLSTIGCIPAGTKVEKGQ
FT                   PIFPRLEMDVEVAYIKEQMKASAPKVEEKKEEEPKAEEITIDDFFKVELRVAEVLSAEP
FT                   VKKADKLLKIQLDLGTEKRQVVSGIAKFYSPEDLKGKKVICVTNLKPVKLRGELSQGMI
FT                   LAGEENGVLSLASIDQNIPNGTKIK"
FT   gene            43646..44413
FT                   /locus_tag="BAA_0048"
FT   CDS_pept        43646..44413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0048"
FT                   /product="deoxyribonuclease, TatD family"
FT                   /note="identified by match to protein family HMM PF01026;
FT                   match to protein family HMM TIGR00010"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50476"
FT                   /protein_id="ACQ50476.1"
FT                   /translation="MLFDTHSHLNAEQFEEDLQEVIARMKEAGVTYTVVVGFDEATIKK
FT                   AIELAEAYDFIYAAVGWHPVDAIDMTEEHLAWLEELASHPKVVALGEMGLDYHWDKSPK
FT                   EIQKEVFRKQITLAKKVKLPIIIHNRDATQDIVDILEEENAAEVGGIMHCFSGSVEVAE
FT                   RCVDMNFLISLGGPVTFKNAKKPKEVATEIPLEKLLIETDCPYLTPHPFRGKRNEPSYV
FT                   KLVAEEIANLKGISYEEVAEITTKNAKALFGVE"
FT   gene            44628..45185
FT                   /locus_tag="BAA_0049"
FT   CDS_pept        44628..45185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0049"
FT                   /product="primase-related protein"
FT                   /note="identified by match to protein family HMM PF01751;
FT                   match to protein family HMM TIGR00334"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48014"
FT                   /protein_id="ACQ48014.1"
FT                   /translation="MKIKEIIVVEGKDDTVAIKRAVDADTIETNGSAIGDHVIEQVKLA
FT                   LQKRGVIIFTDPDYPGERIRKIISDKVPGCKHAFLPKEEALAKRKKGVGIEHASNESIR
FT                   RALENIHEEMEAYTSEISWSDLVDAGLVGGEMAKSRRERMGKLLKIGYTNAKQLHKRLQ
FT                   MFQVSKESFAEAYKQVIQEERK"
FT   gene            45182..46060
FT                   /gene="ksgA"
FT                   /locus_tag="BAA_0050"
FT   CDS_pept        45182..46060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="BAA_0050"
FT                   /product="dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF00398;
FT                   match to protein family HMM TIGR00755"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47435"
FT                   /db_xref="GOA:C3P9I6"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3P9I6"
FT                   /protein_id="ACQ47435.1"
FT                   /translation="MKDIATPNRTKDIVEKYGFSFKKSLGQNFLIDTNVLNRIVDHAEI
FT                   GSESGAIEIGPGIGALTEQLAKRAKKVVAFEIDQRLLPILDETLAPYGNVTVINKDVLK
FT                   ADVHEVFSEQFEEGQDVMVVANLPYYITTPILFKLLEEKLPVRGFVVMMQKEVGDRLAA
FT                   KPGTKEYGSLSIAIQYYTEVETVMTVPRTVFVPQPNVDSAIIRLLKRPKPVVEVTDETF
FT                   FFEVVRASFAQRRKTLMNNLSNNLNGFPKDKELLDRILTEVGIDPKRRGETLSIEEFAT
FT                   LSNALVLHKLS"
FT   gene            46171..47034
FT                   /locus_tag="BAA_0051"
FT   CDS_pept        46171..47034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0051"
FT                   /product="yabG protein"
FT                   /note="identified by match to protein family HMM PF05582;
FT                   match to protein family HMM TIGR02855"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48822"
FT                   /protein_id="ACQ48822.1"
FT                   /translation="MALHVGELVERYSHNRDILFRIIEIKGEIAILFGEEIRLVADAPL
FT                   EDLISIDQREHKKRAKREKETMERTYRLFQQDYVLMKQRHEHTSTGGYTSEVNYFQMPG
FT                   RVLHIDGDPLYLRKCLDLYNKIGVPVQGIHCKETEMHEKVVDLIDHFRPDILVITGHDA
FT                   YTKSKGVKGDLAAYRHSRHFVQAVREVRKKYPSLDQLVIFAGACQSHFEALIRAGANFA
FT                   SSPSRINIHALDPVYVVGKISFTSFMERVNVWDVVRNTITGEKGLGGIETRGILRTGLP
FT                   FQHYEE"
FT   gene            47273..47533
FT                   /locus_tag="BAA_0052"
FT   CDS_pept        47273..47533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0052"
FT                   /product="veg protein"
FT                   /note="identified by match to protein family HMM PF06257"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46943"
FT                   /protein_id="ACQ46943.1"
FT                   /translation="MSKRLDEIKSELDHHLGQRLMLKANSGRRKTVEQSGVLAETYRSV
FT                   FVVQLDQQEDALQRVSYSYADVLTETVELTFYGEPHNEVIL"
FT   gene            47625..47804
FT                   /gene="sspF"
FT                   /locus_tag="BAA_0053"
FT   CDS_pept        47625..47804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sspF"
FT                   /locus_tag="BAA_0053"
FT                   /product="small, acid-soluble spore protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50007"
FT                   /protein_id="ACQ50007.1"
FT                   /translation="MSRRRGVMSNQFKEELAKELGFYDVVQKEGWGGIRAKDAGNMVKR
FT                   AIEIAEQQLMKQNQ"
FT   gene            48001..48870
FT                   /gene="ispE"
FT                   /locus_tag="BAA_0054"
FT   CDS_pept        48001..48870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispE"
FT                   /locus_tag="BAA_0054"
FT                   /product="4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /EC_number="2.7.1.148"
FT                   /note="identified by match to protein family HMM PF00288;
FT                   match to protein family HMM PF08544; match to protein
FT                   family HMM TIGR00154"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50618"
FT                   /db_xref="GOA:C3P9J0"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3P9J0"
FT                   /protein_id="ACQ50618.1"
FT                   /translation="MKLLVKAPAKINLSLDVLGKRQDGYHEVKMIMTTIDLADRLELME
FT                   LAEDRIEILSHNRYVPDDQRNLAYQAAKLLKEKFNVKKGVSITIEKTIPVAAGLAGGSS
FT                   DAAATLRGLNKLWNLGLTIDQLAELGAEIGSDVSFCVYGGTAIATGRGEQIEHIKTPPS
FT                   CWVILAKPHIGVFTADVYGNLKLNRVTHPNVDKMVDVINAGDYKGICDTVGNVLEDVTF
FT                   AMHPEVARIKAQMKRFGADAVLMSGSGPTVFGLVHHDSRMHRIYNGLKGFCEQVYAVRL
FT                   LGERETLE"
FT   gene            48925..49773
FT                   /gene="purR"
FT                   /locus_tag="BAA_0055"
FT   CDS_pept        48925..49773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purR"
FT                   /locus_tag="BAA_0055"
FT                   /product="pur operon repressor"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM PF09182; match to protein
FT                   family HMM TIGR01743"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47921"
FT                   /protein_id="ACQ47921.1"
FT                   /translation="MKIRRSTRLVDMTYYLLQNPRQLVSLTFFAERYQSAKSSISEDLV
FT                   IIKQTFEQQGVGTLQTIPGAAGGVKYIPYISEEEADLIIGELCSLFENPDRILPGGYLY
FT                   MTDLLSNPRHINGAGRLFASVFARQPIDAVMTVATKGIPLAYAVANYLDVPVVIARKDN
FT                   KVTEGPTVSINYVSGSSKRIQTMTLAKRSLPEGSNVLIIDDFMKAGGTIQGMMSMLEEF
FT                   KANVVGIGVLVESTDIEERLINNFVSLIRLSEVDVKEKAIQVEKGNYSLAPFDEGIVEA
FT                   E"
FT   gene            49760..49879
FT                   /locus_tag="BAA_0056"
FT   CDS_pept        49760..49879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0056"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48328"
FT                   /protein_id="ACQ48328.1"
FT                   /translation="MRLSKKIKQIALSFFILFINYKIDGQTAFRALFLKSKNK"
FT   gene            49896..50270
FT                   /locus_tag="BAA_0057"
FT   CDS_pept        49896..50270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0057"
FT                   /product="putative endoribonuclease L-PSP"
FT                   /note="identified by match to protein family HMM PF01042;
FT                   match to protein family HMM TIGR00004"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46477"
FT                   /protein_id="ACQ46477.1"
FT                   /translation="MKVVQTNNAPQAIGPYSQGIIVNNMFYSSGQIPLTASGELVAGDV
FT                   TVQTEQVFQNLQAVLEEAGASFDTVVKTTVFLKDMDDFNAVNEVYGSYFSAHKPARSCV
FT                   QVAKLPKDVSVEIEVIALVK"
FT   gene            50423..50716
FT                   /gene="spoVG"
FT                   /locus_tag="BAA_0058"
FT   CDS_pept        50423..50716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVG"
FT                   /locus_tag="BAA_0058"
FT                   /product="stage V sporulation protein G"
FT                   /note="identified by match to protein family HMM PF04026"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47610"
FT                   /db_xref="GOA:C3P9J4"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="InterPro:IPR036751"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3P9J4"
FT                   /protein_id="ACQ47610.1"
FT                   /translation="MEVTDVRLRRVNTEGRMRAIASITLDHEFVVHDIRVIDGNNGLFV
FT                   AMPSKRTPDGEFRDIAHPINSGTRSKIQDAVLTEYHRLGELEEVEFEEAGAS"
FT   gene            51039..52418
FT                   /gene="glmU"
FT                   /locus_tag="BAA_0059"
FT   CDS_pept        51039..52418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmU"
FT                   /locus_tag="BAA_0059"
FT                   /product="UDP-N-acetylglucosamine
FT                   diphosphorylase/glucosamine-1-phosphate
FT                   N-acetyltransferase"
FT                   /EC_number="2.7.7.23"
FT                   /EC_number="2.3.1.157"
FT                   /note="identified by match to protein family HMM PF00132;
FT                   match to protein family HMM PF00483; match to protein
FT                   family HMM TIGR01173"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50133"
FT                   /db_xref="GOA:C3P9J5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3P9J5"
FT                   /protein_id="ACQ50133.1"
FT                   /translation="MSNRFAVILAAGKGTRMKSKLYKVLHPVCGKPMVQHVVDQVSQLG
FT                   LQKLVTVVGHGAEMVQEQLGNVSEFALQAEQLGTAHAVDQAAGVLANEEGTTLVICGDT
FT                   PLITAETMEALLQQHKEAGAMATVLTAYIEEPAGYGRIVRNENGHVEKIVEHKDANEKE
FT                   LAIKEINTGTYCFDNKALFASLSKVSNDNVQGEYYLPDVIEILKNEGHIVSAYQTEHFD
FT                   ETLGVNDRVALSQAEIIMKNRINRKNMVNGVTIIDPSNTYISADAIIGSDTVLHPGTII
FT                   EGNTVIGSDCEIGPHTVIRDSEIGDRTTIRQSTVHDSKLGTEVSVGPFAHIRPDSVIGD
FT                   EVRVGNFVEIKKTVFGNRSKASHLSYIGDAQVGEDVNLGCGSITVNYDGKNKFKTVIGN
FT                   GVFIGCNSNLVAPVTVEDGAYVAAGSTITENVPSKALSVARARQVNKEDYVDQLLNKKK
FT                   S"
FT   gene            52437..53390
FT                   /gene="prsA"
FT                   /locus_tag="BAA_0060"
FT   CDS_pept        52437..53390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prsA"
FT                   /locus_tag="BAA_0060"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR01251"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50690"
FT                   /protein_id="ACQ50690.1"
FT                   /translation="MSTQYLNSNLKVFSLNSNKELAEQIAKHIGVGLGKCSVDRFSDGE
FT                   VQINIEESIRGCDVFIIQSTSFPVNEHIMELLIMIDALKRASAKTINIVIPYYGYARQD
FT                   RKARSREPITSKLVANLLETAGATRVITLDLHAPQIQGFFDIPIDHLMGVPILSDYFET
FT                   KGLKDIVIVSPDHGGVTRARKMADRLKAPIAIIDKRRPRPNVSEVMNIIGNIEGKTAIL
FT                   IDDIIDTAGTITLAANALVENGASEVYACCTHPVLSGPAIERIQNSNIKELVVTNSIVL
FT                   PEEKKIDKVHELSVAPLIGEAIIRVYEEESVSVLFN"
FT   gene            53400..54023
FT                   /gene="spoVC"
FT                   /locus_tag="BAA_0061"
FT   CDS_pept        53400..54023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVC"
FT                   /locus_tag="BAA_0061"
FT                   /product="aminoacyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="identified by match to protein family HMM PF01195;
FT                   match to protein family HMM TIGR00447"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49000"
FT                   /protein_id="ACQ49000.1"
FT                   /translation="MRRNQDWLRLFVSKKESSGTRMKLIVGLGNPGREYELTRHNIGFM
FT                   AIDELAKRWNISLNEQKFKGLFGAGFVNGEKVILLKPLTYMNLSGESIRPLMDYYKIDV
FT                   EDFVVLYDDLDIPVGKLRLRMKGSAGGHNGVKSTISHLGTQEFQRIRMGIDRPKNGMKV
FT                   VDYVLGRFTSEEIPDVNHSIEKAADACEEWLNKPFLQIMNTFNS"
FT   gene            54094..54318
FT                   /locus_tag="BAA_0062"
FT   CDS_pept        54094..54318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0062"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50792"
FT                   /protein_id="ACQ50792.1"
FT                   /translation="MEGYYYCRHCGSNVGSVTAEKVYSDVLFQLTEQEVVEMIHFHENG
FT                   NIYIKTICELCQETLASYPEYYEYEKFLQ"
FT   gene            54424..57954
FT                   /gene="mfd"
FT                   /locus_tag="BAA_0063"
FT   CDS_pept        54424..57954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mfd"
FT                   /locus_tag="BAA_0063"
FT                   /product="transcription-repair coupling factor"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271; match to protein
FT                   family HMM PF02559; match to protein family HMM PF03461;
FT                   match to protein family HMM PF04851; match to protein
FT                   family HMM TIGR00580"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49811"
FT                   /protein_id="ACQ49811.1"
FT                   /translation="MIGLLEQFYKNEEIQSVINGLEDGLKEQLVSGMATSSRSFLMAAL
FT                   YKKTKKSQLIVTHNLYQAQKVHEDLVALLGEKDVWLYPVNELIASELGVASPELKAQRI
FT                   EVLNRLAAGEHGIIVAPVAGLRRFLPMKELWKQRQIEISLGQEIDLDTFLHTLHHIGYE
FT                   RKSMVEAPGEFSLRGGILDIYPLTEELPFRIEFFDTEVDSIRLFDVDEQRSQDKKESVR
FT                   FGPATEFLFSQEELKSGIKHLEEGLTKTMQKLSDDKLKTTVLETVSHEIEMLKNGQSIE
FT                   QMFKYLSIFYNEPASLIDYLPEDGVVILDEISRIQETASHLESEEAEWYISLLGEGTII
FT                   QDLSFSHSFEEFLHHKKRSFVYLTLFLRHIAHTHPQNIVNVTCKTMQDFHGQMQLLKTE
FT                   IDRWNEGHFTTVVLGTDDERVKKLQHILSDYDIDADIVEGTDILLPGRLQIAVGDLHAG
FT                   FEMPMQKLVVITEKELFHKKVKKSQRKQKLSNAERIKSYSELKVGDYVVHVNHGIGKFL
FT                   GIETLEINGVHKDYLNIKYQGNDKLYVPIEQIDQVQKYVGSEGKDPKVYKLGGNDWKKV
FT                   KTKVEKSVQDIADDLIKLYAEREASKGYAYTPDTAEQQEFESSFPYQETEDQLRSIEEI
FT                   KKDMERGRPMDRLLCGDVGYGKTEVAIRAAFKAIMDEKQVAILVPTTILAQQHYETIRE
FT                   RFQDYPINIGLLSRFRTRKQQNETIKGLKDGTVDIVIGTHRILSKDVTYKDLGLLIIDE
FT                   EQRFGVTHKEKIKQLKANVDVLTLTATPIPRTLHMSMLGVRDLSVIETPPENRFPVQTY
FT                   VVEYNPALMREAIERELARGGQVYFLYNRVEDIERKADEISMLVPDARVTYAHGKMNES
FT                   ELESVMLSFLEGQHDVLVSTTIIETGVDIPNVNTLIVFDADRMGLSQLYQLRGRVGRSN
FT                   RVAYAYFAYKRDKVLSEVAEKRLQAIKEFTELGSGFKIAMRDLSIRGAGNLLGAEQHGF
FT                   IDSVGFDLYSQMLKDAIEQRRGTDGVENTVNVEIDLEVDAYLPDAYISDSKQKIMMYKQ
FT                   FRGVSAIEDIEELQEEMIDRFGDYPQEVGYLLQIANIKVLAMKEQIELIKQNKFEVTIL
FT                   FSEQASQNIDGGKLFMLGNSFGRMIGLGMEGSQLKIVMKTNGLETSKWLTIAENLLKGL
FT                   PDVKKEVINA"
FT   gene            58090..58626
FT                   /gene="spoVT"
FT                   /locus_tag="BAA_0064"
FT   CDS_pept        58090..58626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVT"
FT                   /locus_tag="BAA_0064"
FT                   /product="stage V sporulation protein T"
FT                   /note="identified by match to protein family HMM PF04014;
FT                   match to protein family HMM TIGR01439; match to protein
FT                   family HMM TIGR02851"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47031"
FT                   /protein_id="ACQ47031.1"
FT                   /translation="MKATGIVRRIDDLGRVVIPKEIRRTLRIREGDPLEIFVDRDGEVI
FT                   LKKYSPISELGDFAKEYAEALYDSLGHNVLVCDRDSIIAVSGVSKKEYLNKSVGDLIEK
FT                   TMEERKSVIMTDESDVSIIDGVTEKVHSYTVGPIVANGDPIGAVIIFSKEAIISEIEHK
FT                   AVNTAASFLAKQMEQ"
FT   gene            58857..60458
FT                   /locus_tag="BAA_0065"
FT   CDS_pept        58857..60458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0065"
FT                   /product="polysaccharide synthase family protein"
FT                   /note="identified by match to protein family HMM PF01554;
FT                   match to protein family HMM PF01943; match to protein
FT                   family HMM PF03023"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45999"
FT                   /protein_id="ACQ45999.1"
FT                   /translation="MESKKYQAFWRGAIILTIASFVTKVLSAFYRIPYQNIAGDIGFYI
FT                   YQQIYPFYGFCLILATYGFPIIISKMVAERLERGKKQEAEEIICVSFWFLLGIGFIGFF
FT                   TLFFGAEVIATAMGDIHLDKLLRVISFSFILMPFLSVARGYFQGFNNMVPTAVSQVIEQ
FT                   TIRVSIIVFLSLFLIAHEFDLYTVGAGAMLGSIAGGLIGIIVLILYMRHDFRSIFFKSV
FT                   KRIKGKKKIIKILFWQGLAICVSNLVLIFIQMADSVSFYSLLIGAGEPAESAKVLKGVY
FT                   DRSIPLMQLGTVVTTSFSLSLIPIITAAKERGDLTFIREKVRLAMKITFVIGFAAAIGL
FT                   TCIIQPTNIMLFENSDGSDVLSILSLSILFSSLSITTASILQGLGQTLKPAIFVVFGGC
FT                   LKLVLNYILMPYFGAKGAAIATLVALIVISVLNSMLLMRAVSESLIDKRNMLGIVISGF
FT                   SMGFVLIMFMRVLQMSGLVMDTSHRGVATFEALLGVAIGGLAYMFLILKLRVFTKAEIG
FT                   TVMKKEKKEGSLKKSG"
FT   gene            60471..61931
FT                   /locus_tag="BAA_0066"
FT   CDS_pept        60471..61931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0066"
FT                   /product="tetrapyrrole methylase family protein/MazG family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00590;
FT                   match to protein family HMM PF03819; match to protein
FT                   family HMM TIGR00444"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47979"
FT                   /protein_id="ACQ47979.1"
FT                   /translation="MSGIITILGLGAGELDQLTMGVYRKIKEADHMFVRTKEHPVIEEL
FT                   EKEGIQYTAFDNVYEAHDTFEIVYETIANTLIEKAEGTEIIYAVPGHPLVAERTVQLLL
FT                   EKGEVANIEVRIEGGQSFLDPMFASLKIDPIEGFQLIDATSFERGQLELRQHLIFCQVY
FT                   DAFVASDVKLTLMEMLPDDYEVYIVTAAGTSFEQVKKVPLYMLDHETELNNLTSVYVPP
FT                   VQERASLYQQFDVLREIIADLRGPNGCPWDKKQTHQSLKKYLIEEAYEVLEAIDEEDDD
FT                   HLVEELGDILLQVMLHAQIGEDEGWFSIDDIIRTLSEKMVRRHPHVFGNTDVDNADEVI
FT                   ANWEEIKKQEKGFVKESVLDGVPKSLPQLLRAYEIQKKAGKVGFDWVDVQPMIEKALEE
FT                   WQEFQQEVTNMDEAKMLSEFGDLLFAFVNIARHYKIDPEEALHSTNEKFVGRFLYMEAK
FT                   VAEMNKEMQDLSLEQLDVLWEEAKQTER"
FT   gene            61946..62221
FT                   /locus_tag="BAA_0067"
FT   CDS_pept        61946..62221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0067"
FT                   /product="S4 domain protein"
FT                   /note="identified by match to protein family HMM PF01479"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49495"
FT                   /protein_id="ACQ49495.1"
FT                   /translation="MRLDKFLKVSRLIKRRTLAKEVADQGRISINGQVAKASSDVKVAD
FT                   ELTIRFGQKIVTVKINELKETTKKEDAANMYSLVREEKVKAEEGLF"
FT   gene            62280..62588
FT                   /gene="yabP"
FT                   /locus_tag="BAA_0068"
FT   CDS_pept        62280..62588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabP"
FT                   /locus_tag="BAA_0068"
FT                   /product="sporulation protein YabP"
FT                   /note="identified by match to protein family HMM PF07873;
FT                   match to protein family HMM TIGR02892"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48804"
FT                   /protein_id="ACQ48804.1"
FT                   /translation="MNNGYSPMSSNQQNVSVEHDIIMRGRRVIDITGVKQVESFDSEEF
FT                   LLETVMGFLTIRGQNLQMKNLDVEKGVVSIKGKVHEMLYIDENQGEKTKGFFSKLFK"
FT   gene            62585..63238
FT                   /gene="yabQ"
FT                   /locus_tag="BAA_0069"
FT   CDS_pept        62585..63238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabQ"
FT                   /locus_tag="BAA_0069"
FT                   /product="spore cortex biosynthesis protein YabQ"
FT                   /note="identified by match to protein family HMM PF09578;
FT                   match to protein family HMM TIGR02893"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50885"
FT                   /protein_id="ACQ50885.1"
FT                   /translation="MSLTIQLYTMLSMIGMGAWIGASLDTYQRFLKRQERKRWLVFIHD
FT                   ILFWIVQALFVFYVLLLVNEAELRIYVFLALLCGFAAYQSLLKAIYMRLLNFLIYIFVQ
FT                   TTHFFVQIIKLLMIKPVIIIAQLFIAFILFLFRILLSIGHVLWKMVIWILLFIWKVFFW
FT                   PVRFIASLIWKLLPNRVKLFIMKHVGFLQYIAKLKGHIFQLWERIKKKLGGPRK"
FT   gene            63235..63594
FT                   /gene="divIC1"
FT                   /locus_tag="BAA_0070"
FT   CDS_pept        63235..63594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="divIC1"
FT                   /locus_tag="BAA_0070"
FT                   /product="cell division protein DivIC"
FT                   /note="identified by match to protein family HMM PF04977"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50318"
FT                   /protein_id="ACQ50318.1"
FT                   /translation="MRELRQRTIEKQSPNPVKEHIIQTDENRKRLYRRLAVFLVFAFTI
FT                   IASISVTFYQQNSSIKAKEAKVKDMKKELDSLTNKEKSLKDEVQKLNDEEYVLKIARRD
FT                   YFFSGKGEIIFPVSK"
FT   gene            63682..64164
FT                   /locus_tag="BAA_0071"
FT   CDS_pept        63682..64164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0071"
FT                   /product="S1 RNA binding domain protein"
FT                   /note="identified by match to protein family HMM PF00575"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46574"
FT                   /protein_id="ACQ46574.1"
FT                   /translation="MSIEVGSKLQGKVTGITNFGAFVELPEGLTGLVHISEVADNYVKD
FT                   INDHLKVGDQVEVKVINVEKDGKIGLSIKKAKEREKTEGDRPRGEYQRGGDQQRSGRPQ
FT                   RNRSFNRDNRGGGNDRAPKETFEQKMARFLKDSEDRLTSLKRNTESKRGGRGARRG"
FT   gene            64324..64402
FT                   /locus_tag="BAA_0072"
FT   tRNA            64324..64402
FT                   /locus_tag="BAA_0072"
FT                   /product="tRNA-Met"
FT   gene            64412..64486
FT                   /locus_tag="BAA_0073"
FT   tRNA            64412..64486
FT                   /locus_tag="BAA_0073"
FT                   /product="tRNA-Glu"
FT   gene            64743..67214
FT                   /gene="spoIIE"
FT                   /locus_tag="BAA_0074"
FT   CDS_pept        64743..67214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoIIE"
FT                   /locus_tag="BAA_0074"
FT                   /product="stage II sporulation protein E"
FT                   /EC_number="3.1.3.16"
FT                   /note="identified by match to protein family HMM PF07228;
FT                   match to protein family HMM TIGR02865"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49453"
FT                   /protein_id="ACQ49453.1"
FT                   /translation="MPKAGRNTMNTSALAMNEGQLGGVKWTSKLRMKFEQVFFRWGFII
FT                   VVIGFLLGRAYILTNILPFALPFFAAVYVMKRDKMPLAFLALMGGALSVSIDNLFFTFA
FT                   SIFTFFIYNIFFSRFTRKTVGLVPFQVFISALTAHLVVVYFAQQTVTMYDLLVSTIEAG
FT                   LSFVLTMIFLQSVPLLVERKGKQQALETEEIVCLIILLASVLTGTTDWFVYDASIQHIF
FT                   TRYLVLVFAFIAGAATGSTVGVVTGLILSLANVSSLSQLSLLAFSGLLGGLLKEGKRIG
FT                   VSLGLLIGTSLITLYVDKQTNIVTTLIESGVAIAFFLLTPKLVMDRIAKFMPGTQEHSQ
FT                   DQQQYLRRMRDVTANKINQFANVFAALSNSFSVYGYVEEEDKETEADLFLSTITAKTCQ
FT                   TCFKKDQCWVVNFDKTYDYMKQIMSETEEGTLQHNRKLVREWDKHCVRGKKVTDLVAGE
FT                   LDHFYEGQKLRKQMKENRRIVAEQLLGVSKVMEDFAKEIQRERENHQVQEEQILQAFRD
FT                   FGVEIEHVDIYCLDRGSIDIEMLIPVASNEHGECEKLVAPMLSDILKENIVVKHEEKSS
FT                   YPNGHSLISFGSAKTYSLDTGLATAAKGGGFVSGDSYAMMDLSVGKYALAISDGMGNGQ
FT                   RAHMESKETVKLLQKILQSGIDEEIAIKSINSILSLRTTEEMFTTLDLAMVDLRDASAK
FT                   FLKIGSTPSFVKRANNILKIEASNLPMGIIEDVEVDVVGEQLKTGDILIMMSDGIFEGA
FT                   QHVENHELWMKRKIKELQTEDPQEIADIIMEEVIRSGDGYINDDMTIVVAKVKKNMPKW
FT                   ATIPIVGMQAQ"
FT   gene            67448..68878
FT                   /gene="tilS"
FT                   /locus_tag="BAA_0075"
FT   CDS_pept        67448..68878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tilS"
FT                   /locus_tag="BAA_0075"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /EC_number="6.-.-.-"
FT                   /note="identified by match to protein family HMM PF01171;
FT                   match to protein family HMM PF06508; match to protein
FT                   family HMM TIGR02432; match to protein family HMM
FT                   TIGR02433"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48763"
FT                   /protein_id="ACQ48763.1"
FT                   /translation="MKDTFVEKVDDFVRQHDVLKERSTIVVGVSGGPDSLALLYYLLEK
FT                   RAAKQFEIVVAHVDHMFRGDESHEDLQFVQDLCKGLGVICETIRINVSQYQKQYGMNAQ
FT                   VAARECRYAFLERIMKKYDARYVALGHHGDDQVETILMRLVRGSTPKGYAGIAVKRPFH
FT                   NGYLIRPLLGVTKEEIVNYCNELKIIPRIDPSNKKEVYTRNRLRKYVLPHLKEENPQVH
FT                   EKFQKFSMQMQEDEAYLQELAFEKMNKVITKKSDKQISLSIPTFESMSMPLQRRGIQLI
FT                   LNYLYEYKIPSSLSSIHIDKVIEFFKRTQPSGSLDFPGDLKIVRAYEECSFGFKQEIVS
FT                   PFLQDLSVPGTITLSNGDKLVTEVSEDIPSDMNETVFVAKYNDISYPIRIRSRENGDRM
FT                   SIQGMNGTKKIKAIFIEAKVPREKREEWPVVCDASGNIIWLPLLKRSAFAISKETAKKD
FT                   KYMIIHYKSKESSGRIMK"
FT   gene            68875..69417
FT                   /gene="hpt"
FT                   /locus_tag="BAA_0076"
FT   CDS_pept        68875..69417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpt"
FT                   /locus_tag="BAA_0076"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR01203"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50541"
FT                   /protein_id="ACQ50541.1"
FT                   /translation="MMNQDIEKVLISEEQIQEKVLELGAIIAEDYKNTVPLAIGVLKGA
FT                   MPFMADLLKRTDTYLEMDFMAVSSYGHSTVSTGEVKILKDLDTSVEGRDILIVEDIIDS
FT                   GLTLSYLVDLFKYRKAKSVKIVTLLDKPTGRKVDLKADYVGFTVPHEFVVGYGLDYKEQ
FT                   YRNLPYVGVLKPSVYSN"
FT   gene            69503..71404
FT                   /gene="ftsH"
FT                   /locus_tag="BAA_0077"
FT   CDS_pept        69503..71404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="BAA_0077"
FT                   /product="cell division protein FtsH"
FT                   /EC_number="3.4.24.-"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF01434; match to protein
FT                   family HMM PF06480; match to protein family HMM PF07728;
FT                   match to protein family HMM TIGR01241"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46582"
FT                   /protein_id="ACQ46582.1"
FT                   /translation="MNRIFRNTIFYLLIFLVVIGIVSYFNGSTQKTTSVSYDKFITKLE
FT                   KGEVRNVQLQPKNGVFEVKGQFNNSSQGEQFVTYAPNTEELQKKINDKAQGAEVKYQPA
FT                   EETSAWVTFFTSIIPFVIIFILFFFLLNQAQGGGSRVMNFGKSKAKLYNDEKKKVRFRD
FT                   VAGADEEKQELVEVVEFLKDPRKFAEVGARIPKGVLLVGPPGTGKTLLARAVAGEAGVP
FT                   FFSISGSDFVEMFVGVGASRVRDLFENAKKNAPCIIFIDEIDAVGRQRGAGLGGGHDER
FT                   EQTLNQLLVEMDGFGANEGIIIIAATNRPDILDPALLRPGRFDRQITVDRPDVNGREAV
FT                   LKVHARNKPLDENINLRAIATRTPGFSGADLENLLNEAALVAARQDKKKIDMSDIDEAT
FT                   DRVIAGPAKKSRVISEKERNIVAFHEAGHTVIGVVLDEADVVHKVTIVPRGQAGGYAVM
FT                   LPKEDRYFMTKPELLDKITGLLGGRVAEEIVFGEVSTGAHNDFQRATGIARRMVTEFGM
FT                   SDKLGPMQFGSSQGGQVFLGRDFHSEQNYSDAIAHEIDMEMQTIMKECYARAKQILTDN
FT                   RDKLDLIAKTLLEVETLDAEQINHLCDYGRLPERPTSSADVKVNINMKKDDEESEDK"
FT   gene            71629..72417
FT                   /gene="coaX"
FT                   /locus_tag="BAA_0078"
FT   CDS_pept        71629..72417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaX"
FT                   /locus_tag="BAA_0078"
FT                   /product="pantothenate kinase, type III"
FT                   /EC_number="2.7.1.33"
FT                   /note="identified by match to protein family HMM PF03309;
FT                   match to protein family HMM TIGR00671"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47090"
FT                   /db_xref="GOA:C3P9L2"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3P9L2"
FT                   /protein_id="ACQ47090.1"
FT                   /translation="MIFVLDVGNTNAVLGVFEEGELRQHWRMETDRHKTEDEYGMLVKQ
FT                   LLEHEGLSFEDVKGIIVSSVVPPIMFALERMCEKYFKIKPLVVGPGIKTGLNIKYENPR
FT                   EVGADRIVNAVAGIHLYGSPLIIVDFGTATTYCYINEEKHYMGGVITPGIMISAEALYS
FT                   RAAKLPRIEITKPSSVVGKNTVSAMQSGILYGYVGQVEGIVKRMKEEAKQEPKVIATGG
FT                   LAKLISEESNVIDVVDPFLTLKGLYMLYERNANLQHEKGE"
FT   gene            72424..73299
FT                   /gene="hslO"
FT                   /locus_tag="BAA_0079"
FT   CDS_pept        72424..73299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslO"
FT                   /locus_tag="BAA_0079"
FT                   /product="chaperonin, 33 kDa"
FT                   /note="identified by match to protein family HMM PF01430"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48003"
FT                   /db_xref="GOA:C3P9L3"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3P9L3"
FT                   /protein_id="ACQ48003.1"
FT                   /translation="MKDYLVKALAFDGEVRAYSVRTTNTVSEAQRRHDTWRTASAALGR
FT                   SLTAGTMMGAMLKGDQKLTIKVEGNGPIGPILVDAHANGDVRGYVTNPHVDFEGTEQGK
FT                   LRVYQAVGTEGFVTVIKDIGMREPFIGQSPIVSGELGEDFTYYFAVSEQTPSSVGVGVL
FT                   VNGDDSILAAGGFILQIMPGAQEETISFIEERLQKIPPVSTLIEQGLSPEELLYAVLGE
FT                   DKVKVLETMDVQFNCTCSRERIESVLISLGKTELEQVREEEEETEVHCHFCNERYKFSK
FT                   EDITNLIENL"
FT   gene            73404..74327
FT                   /gene="cysK1"
FT                   /locus_tag="BAA_0080"
FT   CDS_pept        73404..74327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysK1"
FT                   /locus_tag="BAA_0080"
FT                   /product="cysteine synthase A"
FT                   /EC_number="2.5.1.47"
FT                   /note="identified by match to protein family HMM PF00291;
FT                   match to protein family HMM TIGR01136; match to protein
FT                   family HMM TIGR01139"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47440"
FT                   /protein_id="ACQ47440.1"
FT                   /translation="MRVAQSVSELIGKTPIVKLNRIVESDSADIYLKLEFMNPGSSVKD
FT                   RIALAMIEDAEKKGLLKEGDTIIEPTSGNTGIGLAMVAAAKGYKAILVMPETMSVERRN
FT                   LLRAYGAELVLTPGPEGMGGAIRQATELAKEHGYFIPQQFKNQSNPEIHRLTTGPEIVE
FT                   QMGDQLDAFIAGIGTGGTITGAGEVLKEAYKDIKIYAVEPADSPVLSGGKPGPHKIQGI
FT                   GAGFVPETLDVEVYDEIIQVKTEQAFEYARRVAKEEGILVGISSGAVIYAATEVAKKLG
FT                   KGKKVLVIIPSNGERYLSTPLYQFES"
FT   gene            74548..75945
FT                   /gene="pabB"
FT                   /locus_tag="BAA_0081"
FT   CDS_pept        74548..75945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabB"
FT                   /locus_tag="BAA_0081"
FT                   /product="para-aminobenzoate synthase, component I"
FT                   /EC_number="2.6.1.85"
FT                   /note="identified by match to protein family HMM PF00425;
FT                   match to protein family HMM PF04715"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49496"
FT                   /protein_id="ACQ49496.1"
FT                   /translation="MQRRKSLALSIPYQLDFFKQYKFLSKDKPQHILLESGRGGRYNIV
FT                   GLNPVAVIRGKGEALHISESGKETIKQGNPLDLMQEYMERWKTDYNPEYPPFQGGAIGY
FT                   FSYDCIRYIEKLPSLAEDDINIPDIFFLLFDDVFVYDQKEKVLWIITHYVDKHEEAKER
FT                   LNEWKILWATEAPEVTIPFACPEKKNEAVAFTEESFMKAVECIQEYIGAGDVFQVNLST
FT                   RQERTLQTHPLEIYTSLREINPSPYMGYLELGDFQIVSGSPELLIKKQGTEVSTRPIAG
FT                   TRSRGANEQEDEELARELIENEKERAEHVMLVDLERNDLGRVCKYGTVEVDEFMVIEKY
FT                   SHVMHIVSNVRGEVEEDKDAFDLVKAVFPGGTITGAPKIRTMEIIEELEPVRRGIYTGS
FT                   IGWIGYSGDTELNIVIRTLLAKDGKAHVQAGAGIVIDSNPENEYKESLKKAIALWRAKE
FT                   RSEETVR"
FT   gene            75951..76538
FT                   /gene="pabA"
FT                   /locus_tag="BAA_0082"
FT   CDS_pept        75951..76538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabA"
FT                   /locus_tag="BAA_0082"
FT                   /product="para-aminobenzoate synthase, glutamine
FT                   amidotransferase component"
FT                   /EC_number="4.1.3.27"
FT                   /note="identified by match to protein family HMM PF00117;
FT                   match to protein family HMM TIGR00566"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48837"
FT                   /protein_id="ACQ48837.1"
FT                   /translation="MILMIDNYDSFTFNLVQFLGELGQELVVKRNDEVTISDIENMKPD
FT                   FLMISPGPCSPNEAGISMDVIRYFAGKIPIFGVCLGHQSIAQVFGGEVVRAERLMHGKT
FT                   SPMHHDGKTIFSDIPNPFTATRYHSLIVKKETLPDCLEVTSWTEEGEIMALRHTTLPIE
FT                   GVQFHPESIMTSHGKELLQNFIRKYSPSVTSC"
FT   gene            76532..77404
FT                   /gene="pabC"
FT                   /locus_tag="BAA_0083"
FT   CDS_pept        76532..77404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabC"
FT                   /locus_tag="BAA_0083"
FT                   /product="4-amino-4-deoxychorismate lyase PabC"
FT                   /note="identified by match to protein family HMM PF01063"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50933"
FT                   /protein_id="ACQ50933.1"
FT                   /translation="MLIYVNGQYVKSSEARISPYDHGYLYGLGVFETFRIYNGHPFLLD
FT                   DHYDRLIDALDTLQIKWTMTKDEVLLILKNLLIKNKLENAYVRFNVSAGIDEIGLQTEM
FT                   YEEPSVIVFIKPLAAPGEVAEKEGVVLKQVRNTPEGAARLKSHHYLNNILGKREIGNVV
FT                   NKEGIFLTETGYVAEGIVSNLFFVKGDILYTPSLETGILNGITRAFIIKVAEELGIKVK
FT                   EGFFTKDELLSADEVFVTNSIQEIVPLNRIEERDFPGKVGMVTKRFINLYEMQREKLWS
FT                   RNELRRGDV"
FT   gene            77406..78239
FT                   /gene="folP"
FT                   /locus_tag="BAA_0084"
FT   CDS_pept        77406..78239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folP"
FT                   /locus_tag="BAA_0084"
FT                   /product="dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="identified by match to protein family HMM PF00809;
FT                   match to protein family HMM TIGR01496"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49446"
FT                   /protein_id="ACQ49446.1"
FT                   /translation="MKWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEVDAA
FT                   VRHAKEMRDEGAHIIDIGGESTRPGFAKVSVEEEIKRVVPMIQAVSKEVKLPISIDTYK
FT                   AEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIAD
FT                   LYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSF
FT                   IGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGKGVK"
FT   gene            78240..78602
FT                   /gene="folB"
FT                   /locus_tag="BAA_0085"
FT   CDS_pept        78240..78602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folB"
FT                   /locus_tag="BAA_0085"
FT                   /product="dihydroneopterin aldolase"
FT                   /EC_number="4.1.2.25"
FT                   /note="identified by match to protein family HMM PF02152;
FT                   match to protein family HMM TIGR00525; match to protein
FT                   family HMM TIGR00526"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46954"
FT                   /protein_id="ACQ46954.1"
FT                   /translation="MDKIYIHDMEFYGYHGVFPEENKLGQRFKVDLTVELDLKRAGESD
FT                   DLEHSVNYGELFELCRKVVEDRTYKLVESIAENIATDILKQYESISRCTIKVIKPDPPI
FT                   PGHYRAVAVEITRERP"
FT   gene            78599..79114
FT                   /gene="folK"
FT                   /locus_tag="BAA_0086"
FT   CDS_pept        78599..79114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="BAA_0086"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   diphosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /note="identified by match to protein family HMM PF01288;
FT                   match to protein family HMM TIGR01498"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46254"
FT                   /protein_id="ACQ46254.1"
FT                   /translation="MNNIAYIALGSNIGERYTYLTEAIQFLNKNPYIKVEDVSSVYETE
FT                   PVGYTDQSCFLNLVIKISTNLSPQELLKVTQKVENDLGRKREIRWGPRTIDLDILLYNQ
FT                   ENIEAENLIVPHPRMFERAFVIVPLLEINQDIKQNISRSQVEEMKRREGVTVWKQKNGE
FT                   DAFVLFEN"
FT   gene            79066..79269
FT                   /locus_tag="BAA_0087"
FT   CDS_pept        79066..79269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0087"
FT                   /product="DNA-binding protein"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50019"
FT                   /protein_id="ACQ50019.1"
FT                   /translation="MEAEKWGRRIRAFRKLKGYTQEGFAKELGVSVSVLGEVERGNRSP
FT                   SQDFVVEVAKALKVSIDELMPK"
FT   gene            79293..80291
FT                   /locus_tag="BAA_0088"
FT   CDS_pept        79293..80291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0088"
FT                   /product="putative TIM-barrel protein, NifR3 family"
FT                   /note="identified by match to protein family HMM PF01180;
FT                   match to protein family HMM PF01207; match to protein
FT                   family HMM TIGR00737"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46747"
FT                   /protein_id="ACQ46747.1"
FT                   /translation="MLKIANIEMKNPVVLAPMAGVCNSAFRLTVKEFGAGLVCAEMVSD
FT                   KAILLNNKRTLDMLYIDEREKPLSLQIFGGEKETLVDAAKYVDQYTTADIIDINMGCPV
FT                   PKIVKCDAGAKWLLDPNKIYEMVAAVVDAVEKPVTVKMRIGWDEDHIFAIENAKAVERA
FT                   GGQVVAVHGRTRVQMYEGKADWDIIKQVKQAVNIPVIGNGDVATPQDAKRMLDEIGVDG
FT                   VMIGRAALGDPWMIYRTVKYLETGELMPEPTVREKIDVCMLHLDRLIDLKNESVAVREM
FT                   RKHAAWYLKGIRGNANVRNGINACNTREDLANVLGVFVEEVEAKQQTIHVG"
FT   gene            80451..81950
FT                   /gene="lysS"
FT                   /locus_tag="BAA_0089"
FT   CDS_pept        80451..81950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="BAA_0089"
FT                   /product="lysine--tRNA ligase"
FT                   /EC_number="6.1.1.6"
FT                   /note="identified by match to protein family HMM PF00152;
FT                   match to protein family HMM PF01336; match to protein
FT                   family HMM TIGR00499"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50756"
FT                   /protein_id="ACQ50756.1"
FT                   /translation="MDNMNHEELNDQLLVRREKLHNLREQGIDPFGKRFERTNATNDLL
FT                   SLYGEFSKEELEEKEISVSIAGRIMTKRGKGKAGFAHIQDLHGQVQIYVRKDAVGDEEY
FT                   ELFKTADLGDLVGIEGKVFKTNVGELSVKATGFTLLTKSLRPLPDKYHGLKDVEQRYRQ
FT                   RYLDLITSMESRETFVTRSKIIREMRRYLDDNGYLEVETPMMHAIAGGASARPFITHHN
FT                   ALDMELYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADY
FT                   KDIMKLTENMVAHIAKQVLGTTTIQYGDYEINLEPEWTRLHMVDAIKEHSGADFWNPMS
FT                   VEEARELAKEHNVEIKDTMEVGHIINEFFEQKVEDKLIQPTFIYGHPVEISPLAKKNDE
FT                   DPRFTDRFELFIVAREHANAFTELNDPIDQKERFEAQLKEREQGNDEAHMMDDDYIEAL
FT                   EYGMPPTGGLGIGIDRLVMLLTNAPSIRDVLLFPAMRHKQD"
FT   gene            82349..83857
FT                   /gene="rrs_3"
FT                   /locus_tag="BAA_0090"
FT   rRNA            82349..83857
FT                   /gene="rrs_3"
FT                   /locus_tag="BAA_0090"
FT                   /product="16S ribosomal RNA"
FT   gene            84036..86943
FT                   /gene="rrl_3"
FT                   /locus_tag="BAA_0092"
FT   rRNA            84036..86943
FT                   /gene="rrl_3"
FT                   /locus_tag="BAA_0092"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(84060..84491)
FT                   /pseudo
FT                   /locus_tag="BAA_0091"
FT                   /note="conserved hypothetical protein; this region contains
FT                   one or more premature stops and/or frameshifts"
FT   gene            86993..87108
FT                   /gene="rrf_3"
FT                   /locus_tag="BAA_0093"
FT   rRNA            86993..87108
FT                   /gene="rrf_3"
FT                   /locus_tag="BAA_0093"
FT                   /product="5S ribosomal RNA"
FT   gene            87315..87776
FT                   /gene="ctsR"
FT                   /locus_tag="BAA_0094"
FT   CDS_pept        87315..87776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctsR"
FT                   /locus_tag="BAA_0094"
FT                   /product="transcriptional regulator CtsR"
FT                   /note="identified by match to protein family HMM PF05848"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49599"
FT                   /protein_id="ACQ49599.1"
FT                   /translation="MRNISDIIEQYLKQVIDLSNNNVIEIKRNEIADRFECVPSQINYV
FT                   INTRFTLERGFVVESKRGGGGYIRIIKVKLHDDIDIIDQMLHMIDHSVAQGNAESMIIR
FT                   LIEEGIITNREAKLMLSVLDRSVLSMDVPSRDELRARILCAMLRTLKYK"
FT   gene            87950..88498
FT                   /locus_tag="BAA_0095"
FT   CDS_pept        87950..88498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0095"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02151"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48799"
FT                   /protein_id="ACQ48799.1"
FT                   /translation="MTCQNCNIRPATLHYTKVINEKKAEVHLCEQCAEQSGYTSFFQSS
FT                   QSNFSFHDLFAGLLHGESTMFEEGKNGFSNTSILRCPDCKMTYEQFTKVGRFGCASCYD
FT                   TFKEHLKPLLKRLHGGHTDHCGKIPERIEGNIHLKKELDELKLILKQYVQKEEFEKAAE
FT                   VRDKIRNLENQLSEYREGE"
FT   gene            88503..89567
FT                   /locus_tag="BAA_0096"
FT   CDS_pept        88503..89567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0096"
FT                   /product="phosphotransferase domain protein"
FT                   /note="identified by match to protein family HMM PF00217"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48133"
FT                   /db_xref="GOA:C3P9M6"
FT                   /db_xref="InterPro:IPR000749"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022414"
FT                   /db_xref="InterPro:IPR022415"
FT                   /db_xref="InterPro:IPR023660"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3P9M6"
FT                   /protein_id="ACQ48133.1"
FT                   /translation="MSLDKIMNEAISPWMKGDGPDSDIVLSSRIRLARNFKKYQFSTMQ
FT                   NEEETKQIQELFKKEFINKTVEPFGEFELLKMNELTPLQRRVLVEKHLISPNLAGTEYG
FT                   ACLLSESEHISVMLNEEDHIRIQCLFSGLQLSEALQSANQIDNWIEKEVEYAFDESLGY
FT                   ITSCPTNVGTGLRASVMIHLPGLVLTKRISRIIQVIQKLGLVVRGIYGEGSEALGNIFQ
FT                   VSNQMTLGKSEEDIIADLKSVIQQIIQQEKMARELIVQNSSIELEDKVYRSYGILANSR
FT                   LIQSAEAANCLSDLRLGIDLGYIQGISRNILTELMVLTQPGILQQYAGGPLGPEERDYR
FT                   RATLIRERLRIEKN"
FT   gene            89590..92025
FT                   /locus_tag="BAA_0097"
FT   CDS_pept        89590..92025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0097"
FT                   /product="negative regulator of genetic competence
FT                   ClpC/MecB"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF02151; match to protein
FT                   family HMM PF02861; match to protein family HMM PF07724;
FT                   match to protein family HMM PF07728"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47454"
FT                   /protein_id="ACQ47454.1"
FT                   /translation="MMFGRFTERAQKVLALSQEEAIRIGHNNIGTEHILLGLVREGEGI
FT                   AAKALIALGLSPEKVQKEVEALIGRGTEASQTVHYTPRAKKVIELSMDEARKLGHSYVG
FT                   TEHILLGLIREGEGVAARVLNNLGVSLNKARQQVLQLLGSNEASSGHQGGSSTNANTPT
FT                   LDSLARDLTVVARENRLDPVIGRGKEIQRVIEVLSRRTKNNPVLIGEPGVGKTAIAEGL
FT                   AQQIVNNEVPETLRDKRVMTLDMGTVVAGTKYRGEFEDRLKKVMDEIRQAGNIILFIDE
FT                   LHTLIGAGGAEGAIDASNILKPSLARGELQCIGATTLDEYRKYIEKDAALERRFQPIHV
FT                   DEPSLDESTQILKGLRDRYEAHHRVSITDDAIDAAVKLSDRYITDRFLPDKAIDLIDEA
FT                   ASKVRLRSYTTPPNLKELEVKLEEIRKEKDAAVQSQEFEKAASLRDMEQRLREKLEDTK
FT                   RQWKEQQGKENSEVTVEDIANVVSTWTRIPVSKLAQTETDKLLNLESILHDRVIGQDEA
FT                   VVAVAKAVRRARAGLKDPKRPIGSFIFLGPTGVGKTELARALAESMFGDEDAMIRIDMS
FT                   EYMEKHSTSRLVGSPPGYVGYEEGGQLTEKVRRKPYSVVLLDEVEKAHPDVFNILLQVL
FT                   EDGRLTDSKGRTVDFRNTIVIMTSNVGAEALKRNKHLGFNVQDESRDYSDMKGKVMDEL
FT                   KKAFRPEFLNRIDEIIVFHMLEKKHIQEIVTLMVNQLVNRLKEQEIELHLTEGAISAIA
FT                   DKGFDREYGARPLRRAIQKHVEDRLSEELLKGAIEKGQKVIFDVEGESFVIHSAEKVK"
FT   gene            92122..93498
FT                   /gene="radA"
FT                   /locus_tag="BAA_0098"
FT   CDS_pept        92122..93498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="BAA_0098"
FT                   /product="DNA repair protein RadA"
FT                   /note="identified by match to protein family HMM TIGR00416"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50964"
FT                   /protein_id="ACQ50964.1"
FT                   /translation="MAKKKTKFTCQECGYQSPKYMGKCPGCGQWNTLVEEMEPVVSSRR
FT                   LNYANAIQTEVTKPRRLTEVETKSEARIETKFQEFNRVLGGGIVDGSLVLIGGDPGIGK
FT                   STLLLQISSQLADSSYDVLYISGEESAKQIKLRADRLHVNGSNLFVVSETDLQRIATHI
FT                   EEMNPAFVVIDSIQTIHLPEVTSAPGSVAQVRECTAELMKLAKTKGIPIFIVGHVTKEG
FT                   AIAGPRMLEHMVDAVLYFEGDRHHTYRILRAVKNRFGSTNEMGIFEMKELGLAEVLNPS
FT                   EIFLEERPVGVAGSTVVASMEGTRPVLVEIQALISPTSFGNPRRMATGIDHNRVSLIMA
FT                   VLEKRTGLLLQNQDAYLKVAGGLKLDEPAIDLAVALSIASSFRDKSTAPTDAVIGEVGL
FT                   TGEIRRVSRIEQRVQEAAKLGFQRAIIPRKNLGGWTIPDGIEVVGVSNLGEALRLTLGG
FT                   "
FT   gene            93502..94575
FT                   /locus_tag="BAA_0099"
FT   CDS_pept        93502..94575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0099"
FT                   /product="putative DNA-binding protein"
FT                   /note="identified by match to protein family HMM PF00633;
FT                   match to protein family HMM PF02457"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48878"
FT                   /db_xref="GOA:C3P9M9"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR018906"
FT                   /db_xref="InterPro:IPR023763"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="InterPro:IPR038331"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3P9M9"
FT                   /protein_id="ACQ48878.1"
FT                   /translation="MEENKQRVKSMINILQLVAPGTPLREGIDNVLRAQTGGLIVLGYN
FT                   EQIKSIVDGGFHINCAFSPASLYELAKMDGALILNETGSKILIANAQLVPESSIDSIET
FT                   GMRHRTAERVAKQTGSLVVAISQRRNVITLYQGNLRYTLKDIGVILTKANQAIQTLEKY
FT                   KAVWNDGITNLGILEFEEVVTMSEVVHVLHSVEMVLRIKNEILSYIHELGTEGRLIRLQ
FT                   LTELLADLEAEAALLIKDYYQEKTQDHHQILKKLQELANTQLLEDSDLVKLLGYPGQTS
FT                   LEESVTPRGYRITSKISRVPPLIIENLINRFKTLQGVCRATINELDDVEGIGEVRAKKI
FT                   REGLKRIQEHLYMSRHN"
FT   gene            94736..95845
FT                   /locus_tag="BAA_0100"
FT   CDS_pept        94736..95845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0100"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01850;
FT                   match to protein family HMM PF01938"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46071"
FT                   /protein_id="ACQ46071.1"
FT                   /translation="MLKRIVQLFFLVIGGALGIYLIPKVINVLDIGAVPLLEGSYVRAI
FT                   IGAIILFLTTFWLVDYIVQLIKHIEEALVKAPVADVLFGTLGLISGLIVAYLILIPIRE
FT                   FTIPVISTVLQVFFTLLLGYLGFQVGFKKRNELLGLFTLPQRGKKKNNNSENEEPENEV
FT                   EESLAHWKILDTSVIIDGRIADICQTKFLEGTIVIPQFVLEELQHIADSSDALKRNRGR
FT                   RGLDILNRIQKEMPIPVEIYEGDFDDIQEVDSKLVKLAKITGGTVVTNDFNLNKVSELQ
FT                   GVTVLNINDLANAIKPVVLPGEELSVYVVKDGKEQNQGVAYLDDGTMIVVEDGREYVGS
FT                   QLDVLVTSVLQTSAGRMIFAKRKLLEKAL"
FT   gene            95862..96542
FT                   /gene="ispD"
FT                   /locus_tag="BAA_0101"
FT   CDS_pept        95862..96542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispD"
FT                   /locus_tag="BAA_0101"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /EC_number="2.7.7.60"
FT                   /note="identified by match to protein family HMM PF01128;
FT                   match to protein family HMM TIGR00453"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46576"
FT                   /protein_id="ACQ46576.1"
FT                   /translation="MYTLIIPAAGQGKRMGAGKNKLFLLINEVPIIVHTLRAFEKDKAC
FT                   KNIIMAINEEERPYFEELMQKYPVEKPVQFIQGGAERQDSVYNAIQHTTDVEYVLVHDG
FT                   ARPFVTNKVIQDVLTAAEKYGASICAVPVKDTVKKVEQGVVVETVERSQLKAVQTPQGF
FT                   SVSLLLEAHRSAKQSCFLGTDDASLVERIGKQVGVVEGSYYNIKVTTPEDLLIAESFLH
FT                   VQKK"
FT   gene            96657..97133
FT                   /gene="ispF"
FT                   /locus_tag="BAA_0102"
FT   CDS_pept        96657..97133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispF"
FT                   /locus_tag="BAA_0102"
FT                   /product="2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /EC_number="4.6.1.12"
FT                   /note="identified by match to protein family HMM PF02542;
FT                   match to protein family HMM TIGR00151"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47438"
FT                   /db_xref="GOA:C3P9N2"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3P9N2"
FT                   /protein_id="ACQ47438.1"
FT                   /translation="MFRIGQGFDVHEFAEGRPLIIGGITIPHEKGLIGHSDADVLLHTI
FT                   ADACLGAIAAGDIGKHFPDTDPAFKDADSAVLLQKVWEFVREQGYELGNLDCTIIAQKP
FT                   KMAPHIESMRKRISELLETSIDNINVKATTTEKLGFTGREEGIASQAVVLLQKK"
FT   gene            97205..98680
FT                   /gene="gltX"
FT                   /locus_tag="BAA_0103"
FT   CDS_pept        97205..98680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="BAA_0103"
FT                   /product="glutamate--tRNA ligase"
FT                   /EC_number="6.1.1.17"
FT                   /note="identified by match to protein family HMM PF00749;
FT                   match to protein family HMM TIGR00464"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48047"
FT                   /protein_id="ACQ48047.1"
FT                   /translation="MEGVPIMEKQVRVRYAPSPTGHLHIGNARTALFNYLFARHQDGKF
FT                   IIRIEDTDVKRNVAGGEESQLKYLKWLGMDWDEGVDVGGEFGPYRQTERLDIYKKLYED
FT                   LLERGLAYKCYMTEEELEAEREGQIARGETPRYAGNHRDLTEAQVKEFEAEGRIPSIRF
FT                   RVPADRDYTFKDIVKDEVAFHSNDFGDFVIVKKDGIPTYNFAVAVDDHLMEITHVLRGD
FT                   DHISNTPKQMMIYEAFGWDIPQFGHMTLIVNESRKKLSKRDESIIQFIEQYKELGYLPE
FT                   AIFNFIALLGWSPVGEEEIFSQEEFIKMFDAARLSKSPALFDSQKLKWMNNQYMKKQDL
FT                   DTVVELSLPHLVKAGRIGETLSEQEQAWIRDVIALYHEQMSFGAEIVELSEMFFKDHVD
FT                   YEEEGQEVLKGEQVPEVLRAFAGQVEALEAMEPAAIKAAIKAVQKETGHKGKNLFMPIR
FT                   VATTGQTHGPELPNAIALLGKEKVLNRLQKVIG"
FT   gene            99113..99778
FT                   /gene="cysE"
FT                   /locus_tag="BAA_0104"
FT   CDS_pept        99113..99778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysE"
FT                   /locus_tag="BAA_0104"
FT                   /product="serine O-acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /note="identified by match to protein family HMM PF00132;
FT                   match to protein family HMM TIGR01172"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47400"
FT                   /protein_id="ACQ47400.1"
FT                   /translation="MFKRLREDIEVVFEQDPAARSYFEVILTYSGLHAVWAHRIAHAFY
FT                   KKNFFFIARWISQVSRFFTGIEIHPGATIGRRFFIDHGMGVVIGETCEIGDNVTIYQGV
FT                   TLGGTGKEKGKRHPTIQDNVLIATGAKVLGSITVGENSKIGAGSVVLKEVPAHSTVVGI
FT                   PGRVVIQNGVKIGQELNHSDLPDPIFDKLKVMEVELDKLKKQLEVKVERKDKNDYSHL"
FT   gene            99759..101156
FT                   /gene="cysS"
FT                   /locus_tag="BAA_0105"
FT   CDS_pept        99759..101156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="BAA_0105"
FT                   /product="cysteine--tRNA ligase"
FT                   /EC_number="6.1.1.16"
FT                   /note="identified by match to protein family HMM PF01406;
FT                   match to protein family HMM PF09190; match to protein
FT                   family HMM PF09334; match to protein family HMM TIGR00435"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47992"
FT                   /db_xref="GOA:C3P9N5"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3P9N5"
FT                   /protein_id="ACQ47992.1"
FT                   /translation="MTIHIYNTLTRQKEEFTPLEENKVKMYVCGPTVYNYIHIGNARPP
FT                   MVFDTVRRYLEYKGYDVQYVSNFTDVDDKLIKAANELGEDVPTIADRFVEAYFEDVTAL
FT                   GCKHATVHPRVTENMDIIIEFIQELVNKGYAYESEGDVYFRTKEFEGYGKLSHQPIADL
FT                   RHGARIEVGEKKQDPLDFALWKAAKEGEIFWESPWGQGRPGWHIECSAMARKYLGDTID
FT                   IHAGGQDLAFPHHENEIAQSEALTGKTFARYWMHNGYININNEKMSKSLGNFILVHDII
FT                   KQYDPQLIRFFMLSVHYRHPINFSEELLQSTNNGLERIKTAYGNLKHRMESSTDLTDHN
FT                   EKWLADLEKFQTAFEEAMNDDFNTANAITELYNVANHANQYLLEEHTSTVVIEAYVKQL
FT                   ETLFDILGLELAQEELLDEEIEALIQKRIEARKNRDFALSDQIRDDLKDRNIILEDTAQ
FT                   GTRWKRG"
FT   gene            101159..101566
FT                   /locus_tag="BAA_0106"
FT   CDS_pept        101159..101566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0106"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00636"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49017"
FT                   /protein_id="ACQ49017.1"
FT                   /translation="MIDAKQLNSLALAYMGDAVYEQYIRYHLLQKGKVRPNQLHRLGTS
FT                   FVSAKAQAKVVYHLLETAFLTEEEEAVLRRGRNANSGTVPKNTDVQTYRHSTAFEALIG
FT                   YHHLLNNRERLDEIVYKAIAVLEEKEGGTSS"
FT   gene            101563..102306
FT                   /locus_tag="BAA_0107"
FT   CDS_pept        101563..102306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0107"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /note="identified by match to protein family HMM PF00588;
FT                   match to protein family HMM PF08032; match to protein
FT                   family HMM TIGR00186"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50703"
FT                   /protein_id="ACQ50703.1"
FT                   /translation="MSSEYIIGRNPVIEALRSGRDINKIWIAEGAAKGQVQIVLALAKE
FT                   NKIILQHAPKKKLDQLVEGNHQGVIAQVAAYQYAELEDLFKVAEKRNEDPFFLILDEIE
FT                   DPHNLGSIMRTADATGAHGIIIPKRRAVGLTASVAKASTGAIEYIPVARVTNLSRTIDE
FT                   LKERGLWIAGTDAKGKTDYRNLDGKMPIGLVIGSEGKGMSRIIGEKCDFLITLPMVGKV
FT                   TSLNASVAASLLMYEVYRKRNEIGK"
FT   gene            102310..102822
FT                   /locus_tag="BAA_0108"
FT   CDS_pept        102310..102822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0108"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05991"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46095"
FT                   /protein_id="ACQ46095.1"
FT                   /translation="MNDILIVDGYNIIGAWGDLKKLRDVDLQSSRDALIDKMADYQGYT
FT                   GTKVMIVFDAYTVHGIEKKMKQSRVEVIFTRKNQTADEKIEQLAIELRNINTQIYVATS
FT                   DYTEQWVIFAQGALRKSARELELEVQAMEQQVRRRTQDTKEKQPAMRKIFSKDITEKLE
FT                   KLRRGER"
FT   gene            102890..103546
FT                   /gene="sigH"
FT                   /locus_tag="BAA_0109"
FT   CDS_pept        102890..103546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sigH"
FT                   /locus_tag="BAA_0109"
FT                   /product="RNA polymerase sigma-30 factor"
FT                   /note="identified by match to protein family HMM PF04542;
FT                   match to protein family HMM PF08281; match to protein
FT                   family HMM TIGR02859; match to protein family HMM
FT                   TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47954"
FT                   /protein_id="ACQ47954.1"
FT                   /translation="MEAGFVSVGDVTFRDLEDEAIVELVRKGNTDALEYLIHKYKNFVR
FT                   AKSRSYFLVGADREDIVQEGMIGLFKAIRDYKEDKLSSFKAFAELCITRQIITAIKTAT
FT                   RQKHIPLNSYVSLDKPIYDEESDRTLLDVISEAKVTDPEEMIISQEEYTDIESKISELL
FT                   SDLERKVLSLYLDGRSYQEISEQLNRHVKSIDNALQRVKRKLERYMEMRESTTSN"
FT   gene            103857..104036
FT                   /gene="secE"
FT                   /locus_tag="BAA_0110"
FT   CDS_pept        103857..104036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="BAA_0110"
FT                   /product="preprotein translocase, SecE subunit"
FT                   /note="identified by match to protein family HMM PF00584;
FT                   match to protein family HMM TIGR00964"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50928"
FT                   /protein_id="ACQ50928.1"
FT                   /translation="MRLTNFFGDVGREMKKVSWPKKDELLRSTATVIATVVFFAIFFAV
FT                   VDMGISSLIRLILG"
FT   gene            104168..104701
FT                   /gene="nusG"
FT                   /locus_tag="BAA_0111"
FT   CDS_pept        104168..104701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="BAA_0111"
FT                   /product="transcription termination/antitermination factor
FT                   NusG"
FT                   /note="identified by match to protein family HMM PF02357;
FT                   match to protein family HMM TIGR00922"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50216"
FT                   /protein_id="ACQ50216.1"
FT                   /translation="MEKSWYVVHTYSGYENKVKANLEKRVESMGMQDKIFRVVVPEEVE
FT                   VEMKNGKEKLMKRKVFPGYVLVELIMTDDSWYVVRNTPGVTGFVGSSGSGSKPSPLLEE
FT                   EVVTIMKHMGMDNEVVDFDFELHETVRVNEGPFADYTGAIEEIDVEKKKVSVLVDMFGR
FT                   ETPVELDFHQIEKL"
FT   gene            104869..105294
FT                   /gene="rplK"
FT                   /locus_tag="BAA_0112"
FT   CDS_pept        104869..105294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="BAA_0112"
FT                   /product="50S ribosomal protein L11"
FT                   /note="identified by match to protein family HMM PF00298;
FT                   match to protein family HMM PF03946; match to protein
FT                   family HMM TIGR01632"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49474"
FT                   /db_xref="GOA:C3P9P2"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3P9P2"
FT                   /protein_id="ACQ49474.1"
FT                   /translation="MAKKVIKMVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNAR
FT                   TADQAGLIIPVEITVFEDRSFTFITKTPPAAVLLKKVAGIESGSGEPNRNKVATVKRDK
FT                   VREIAETKMPDLNAASVEAAMRMVEGTARSMGIVIED"
FT   gene            105472..106164
FT                   /gene="rplA"
FT                   /locus_tag="BAA_0113"
FT   CDS_pept        105472..106164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="BAA_0113"
FT                   /product="50S ribosomal protein L1"
FT                   /note="identified by match to protein family HMM PF00687;
FT                   match to protein family HMM TIGR01169"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48812"
FT                   /db_xref="GOA:C3P9P3"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3P9P3"
FT                   /protein_id="ACQ48812.1"
FT                   /translation="MAKRGKKYVEAAKLVDRAAAYSATEAVELVKKTNTAKFDATVEAA
FT                   FRLGVDPKKADQQIRGAVVLPHGTGKVQRVLVFAKGEKAKEAEAAGADFVGDADYIGKI
FT                   QQGWFDFDVVVATPDMMGEVGKLGRVLGPKGLMPNPKTGTVTFDVTKAVNEIKAGKVEY
FT                   RVDKAGNIHVPIGKVSFEDAKLVENFRTIADTLQKVKPAAAKGTYMKNVTVASTMGPGV
FT                   RVDVSTLA"
FT   misc_feature    106214..106357
FT                   /note="Ribosomal protein L10 leader"
FT   gene            106397..106897
FT                   /gene="rplJ"
FT                   /locus_tag="BAA_0115"
FT   CDS_pept        106397..106897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="BAA_0115"
FT                   /product="50S ribosomal protein L10"
FT                   /note="identified by match to protein family HMM PF00466"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48112"
FT                   /db_xref="GOA:C3P9P4"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3P9P4"
FT                   /protein_id="ACQ48112.1"
FT                   /translation="MSKVIETKQQVVTEIADKLRASKSTIVVDYRGLTVSEATELRKQL
FT                   REAGVEFKVYKNSLTRRAAESAEMAELNEFLTGPNAIAFSNEDVVAPAKVLNDFAKDHE
FT                   ALEIKAGVIEGKLVTLDEVKAIATLPSREGLLSMLLSVLQAPIRNLALATKAVADQKEE
FT                   QGA"
FT   gene            106965..107324
FT                   /gene="rplL"
FT                   /locus_tag="BAA_0116"
FT   CDS_pept        106965..107324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="BAA_0116"
FT                   /product="50S ribosomal protein L7/L12"
FT                   /note="identified by match to protein family HMM PF00542;
FT                   match to protein family HMM TIGR00855"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47387"
FT                   /db_xref="GOA:C3P9P5"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3P9P5"
FT                   /protein_id="ACQ47387.1"
FT                   /translation="MTKEQIIEAVKSMTVLELNDLVKAIEEEFGVTAAAPVAVAGGAGE
FT                   AAAEKTEFDVELTSAGAQKIKVIKVVREITGLGLKEAKELVDNTPKVIKEAAAKEEAEE
FT                   IKAKLEEVGAAVEVK"
FT   gene            107399..107998
FT                   /locus_tag="BAA_0117"
FT   CDS_pept        107399..107998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0117"
FT                   /product="ybxB protein"
FT                   /note="identified by match to protein family HMM PF05175;
FT                   match to protein family HMM PF08242"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48100"
FT                   /protein_id="ACQ48100.1"
FT                   /translation="MADHYFSNDPSSKSDRKRWEFTLRGSRFTFLSDRGVFSKNEVDFG
FT                   SRLLIEAFQVPDIKGDILDVGCGYGPIGLSLAKEFQDRKVHMVDVNERALELAKENAAN
FT                   NRIGNVHIFQSSVYENVDGMYAAILSNPPIRAGKDIVHEILEKAVEHLVPGGELWIVIQ
FT                   KKQGAPSALKKLEEVFSEVEVVEKKKGYYIIKSKKR"
FT   gene            108291..111824
FT                   /gene="rpoB"
FT                   /locus_tag="BAA_0118"
FT   CDS_pept        108291..111824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="BAA_0118"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="identified by match to protein family HMM PF00562;
FT                   match to protein family HMM PF04560; match to protein
FT                   family HMM PF04561; match to protein family HMM PF04563;
FT                   match to protein family HMM PF04565; match to protein
FT                   family HMM TIGR02013"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46691"
FT                   /db_xref="GOA:C3P9P7"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3P9P7"
FT                   /protein_id="ACQ46691.1"
FT                   /translation="MTGQLVQYGRHRQRRSYARISEVLELPNLIEIQTSSYQWFLDEGL
FT                   REMFQDISPIEDFTGNLSLEFIDYSLGEPKYSVDECKERDVTYAAPLRVKVRLINKETG
FT                   EVKEQDVFMGDFPLMTETGTFVINGAERVIVSQLVRSPSVYYSGKVDKNGKRGFTATVI
FT                   PNRGAWLEYETDAKDVVYVRIDRTRKLPVTVLLRALGFGSDQEITELLGDNEYLSNTLE
FT                   KDNTDSTEKALLEIYERLRPGEPPTVENAKSLLVSRFFDPKRYDLANVGRYKINKKLHI
FT                   KNRLFNQRLAETLVDPETGEILAAEGTILDRRTLDRILPYLEKNIGFKTAKPMGGVVEG
FT                   DVELQSIKIYAPESEGERVINVIGNANITRDVKHITPGDILASISYFFNLLYKVGDTDD
FT                   IDHLGNRRLRSVGELLQNQFRIGLSRMERVVRERMSIQDTNAITPQALINIRPVIAAIK
FT                   EFFGSSQLSQFMDQTNPLAELTHKRRLSALGPGGLTRERAGFEVRDVHYSHYGRMCPIE
FT                   TPEGPNIGLINSLSSFAKVNEFGFIETPYRRVDPETGLVTGHVDYLTADEEDNYVVAQA
FT                   NMKLSEEGEFLDEDIVARFRGENIVTNKERIDYMDVSPKQVVSAATACIPFLENDDSNR
FT                   ALMGANMQRQAVPLMNPESPIVGTGMEYVSAKDSGAAVICKHPGIVERVEAREVWVRRY
FT                   VEVDGQTVKGDLDRYKMQKFIRSNQGTCYNQRPIVSVGNEVVKGEILADGPSMELGELA
FT                   LGRNVLVGFMTWDGYNYEDAIIMSERLVKDDVYTSIHIEEYESEARDTKLGPEEITRDI
FT                   PNVGEDALRNLDERGIIRVGAEVKDGDLLVGKVTPKGVTELTAEERLLHAIFGEKAREV
FT                   RDTSLRVPHGGGGIILDVKVFNREDGDELPPGVNQLVRAYIVQKRKISEGDKMAGRHGN
FT                   KGVISRILPEEDMPYLPDGTPIDIMLNPLGVPSRMNIGQVLELHLGMAARYLGIHIATP
FT                   VFDGAREEDVWGTIEEAGMANDAKTILYDGRTGEPFDNRVSVGVMYMIKLAHMVDDKLH
FT                   ARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTVKSDDVIGRVK
FT                   TYEAIVKGENVPEPGVPESFKVLIKELQSLGMDVKMMSSDDTEIEMRDTEDDDDHQSAD
FT                   KLNVEVETTKE"
FT   gene            111862..115473
FT                   /gene="rpoC"
FT                   /locus_tag="BAA_0119"
FT   CDS_pept        111862..115473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="BAA_0119"
FT                   /product="DNA-directed RNA polymerase, beta' subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="identified by match to protein family HMM PF00623;
FT                   match to protein family HMM PF04983; match to protein
FT                   family HMM PF04997; match to protein family HMM PF04998;
FT                   match to protein family HMM PF05000; match to protein
FT                   family HMM TIGR02386"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50906"
FT                   /protein_id="ACQ50906.1"
FT                   /translation="MIDVNNFEYMKIGLASPDKIRSWSYGEVKKPETINYRTLKPEKDG
FT                   LFCERIFGPQKDWECHCGKYKRVRYKGVVCDRCGVEVTRAKVRRERMGHIELAAPVSHI
FT                   WYFKGIPSRMGLVLDMSPRALEEVIYFASYVVTESGDTPLDKKQLLSEKEYRAYRDRYG
FT                   STFQAAMGAEAIKKLLQDIDLDKEVDFLKEELKTAQGQRRTRAIKRLEVLEAFRNSGNE
FT                   PSWMILDVLPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPSIIV
FT                   QNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSG
FT                   RSVIVVGPNLKMYQCGLPKEMALELFKPFVMKELVEKGLAHNIKSAKRKIERVQPEVWD
FT                   VLESVIKEHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVH
FT                   VPLSSEAQAEARLLMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLEREGAIGEGMVFK
FT                   DANEALLAYQNGYVHLHTRVAVAASAVNNVTFTEEQKNMLLLTTVGKLIFNEILPESFP
FT                   YINEPTNSNLEKETPAKYFVEKGANIKEIIASREEVAPFSKKILGNIIAEVFKRFKITE
FT                   TSRMLDRMKNLGFKYSTKAGITVGVSDILVLGEKDEILHEAQAKVDNVIKQFRRGLITE
FT                   EERYDRVISIWSNAKDVIQGKLMKSLNKRNPIFMMSDSGARGNASNFTQLAGMRGLMAN
FT                   PSGRIIELPIKSSFREGLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVI
FT                   VREDDCGTDRGLLIGAIKEGNEVIESLYDRLVGRFARKTVKHPETGEVLVAENQLITED
FT                   IAHIVENSGVETVNIRSAFTCNTRHGVCKKCYGRNLATGTDVEVGEAVGIIAAQSIGEP
FT                   GTQLTMRTFHTGGVAGDDITQGLPRIQEIFEARNPKGQAVISEIDGVIAAINDVKDRQE
FT                   VVVQGEVEARTYAIPYGARLKVIPGQKISHGKELTEGSIDPKELLKVTDITAVQEYLLR
FT                   EVQKVYRMQGVEIGDKHVEVMVRQMLRKVRVSDAGETDVLPGTLLDIHQFTDANAKVLL
FT                   QGKQPATARPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKRDELLGLKENVII
FT                   GKLVPAGTGMNRYRKVDLVKTTQDDMNVENDEVYVEQ"
FT   gene            115587..115835
FT                   /locus_tag="BAA_0120"
FT   CDS_pept        115587..115835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0120"
FT                   /product="ribosomal protein L7A family"
FT                   /note="identified by match to protein family HMM PF01248"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50197"
FT                   /protein_id="ACQ50197.1"
FT                   /translation="MSYQKVSNAENVVVGHKRTLEAIKNGIVKEVVIAEDADMRLTHVI
FT                   IRTALQHNIPITKVESVRKLGKVAGIQVGASAIGIIS"
FT   gene            115950..116372
FT                   /gene="rpsL"
FT                   /locus_tag="BAA_0121"
FT   CDS_pept        115950..116372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="BAA_0121"
FT                   /product="30S ribosomal protein S12"
FT                   /note="identified by match to protein family HMM PF00164;
FT                   match to protein family HMM TIGR00981"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48379"
FT                   /db_xref="GOA:C3P9Q0"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3P9Q0"
FT                   /protein_id="ACQ48379.1"
FT                   /translation="MPTINQLVRNGRTDKVWKSKSPALNKGFNSLKKKSTDISAPQKRG
FT                   VCTRVGTMTPKKPNSALRKYARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLP
FT                   GVRYHIVRGALDTAGVDKRMQGRSKYGTKKPKAAKK"
FT   gene            116402..116872
FT                   /gene="rpsG"
FT                   /locus_tag="BAA_0122"
FT   CDS_pept        116402..116872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="BAA_0122"
FT                   /product="30S ribosomal protein S7"
FT                   /note="identified by match to protein family HMM PF00177;
FT                   match to protein family HMM TIGR01029"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47812"
FT                   /db_xref="GOA:C3P9Q1"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3P9Q1"
FT                   /protein_id="ACQ47812.1"
FT                   /translation="MPRKGPVAKRDVLPDPMYNSKLVTRLINKMMVDGKKGKSQTILYN
FT                   AFDIVSERTGKEPMEVFEQALKNIMPVLEVRARRVGGANYQVPVEVRPERRTTLGLRWL
FT                   VNYARLRGEKTMEERLANEILDAANNAGASVKKREDTHKMAEANKAFAHYRW"
FT   gene            117080..119158
FT                   /gene="fusA"
FT                   /locus_tag="BAA_0123"
FT   CDS_pept        117080..119158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="BAA_0123"
FT                   /product="translation elongation factor G"
FT                   /note="identified by match to protein family HMM PF00009;
FT                   match to protein family HMM PF00679; match to protein
FT                   family HMM PF03144; match to protein family HMM PF03764;
FT                   match to protein family HMM TIGR00231; match to protein
FT                   family HMM TIGR00484"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46917"
FT                   /db_xref="GOA:C3P9Q2"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3P9Q2"
FT                   /protein_id="ACQ46917.1"
FT                   /translation="MAREFSLENTRNIGIMAHIDAGKTTATERILYYTGRIHKIGETHE
FT                   GASQMDWMEQEQERGITITSAATTAQWKGHRVNIIDTPGHVDFTVEVERSLRVLDGAVA
FT                   VLDAQSGVEPQTETVWRQATTYGVPRIVFVNKMDKIGADFLYSVGTIHDRLQANAHPIQ
FT                   LPIGAEDEFNGIIDLVEECAYMYGNDLGTDIQRVEIPEEHKELAEEYRGKLIEAVAELD
FT                   EEMMMKYLEGEEITVEELKAGIRKATTSVEFFPVICGSAFKNKGVQILLDAVIDYLPSP
FT                   LDVPAIKGIVPDTDEEVERKSSDEEPFAALAFKIMTDPYVGKLTFFRVYSGVLNSGSYV
FT                   KNSTKGKRERVGRILQMHANSREEISTVYAGDIAAAVGLKDTTTGDTLCDEKSLVILES
FT                   MEFPEPVISVAIEPKSKADQDKMGTALSKLSEEDPTFRAHTDQETGQTIIAGMGELHLD
FT                   IIVDRMRREFKVEANVGAPQVAYRETFRAAAKVEGKFARQSGGRGQFGHVWIEFEPNEE
FT                   GKGFEFENKIVGGVVPREYIPAVGAGLEDALKNGVLAGYPVVDIKAALVDGSYHDVDSS
FT                   EMAFKIAASMALKAAVSKCNPVILEPMMKVEVVIPEEYMGDIMGDVTSRRGRVEGMEAR
FT                   GNAQVVRAMVPLSEMFGYATSLRSNTQGRGTFSMVFDHYEEVPKSVSEEIIKKNKGE"
FT   gene            119276..120463
FT                   /gene="tuf"
FT                   /locus_tag="BAA_0124"
FT   CDS_pept        119276..120463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tuf"
FT                   /locus_tag="BAA_0124"
FT                   /product="translation elongation factor Tu"
FT                   /note="identified by match to protein family HMM PF00009;
FT                   match to protein family HMM PF03143; match to protein
FT                   family HMM PF03144; match to protein family HMM TIGR00231;
FT                   match to protein family HMM TIGR00485"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46352"
FT                   /db_xref="GOA:C3P9Q3"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3P9Q3"
FT                   /protein_id="ACQ46352.1"
FT                   /translation="MAKAKFERSKPHVNIGTIGHVDHGKTTLTAAITTVLAKAGGAEAR
FT                   GYDQIDAAPEERERGITISTAHVEYETETRHYAHVDCPGHADYVKNMITGAAQMDGGIL
FT                   VVSAADGPMPQTREHILLSRQVGVPYIVVFLNKCDMVDDEELLELVEMEVRDLLSEYGF
FT                   PGDDIPVIKGSALKALQGEADWEAKIIELMAEVDAYIPTPERETDKPFLMPVEDVFSIT
FT                   GRGTVATGRVERGIVKVGDVVEIIGLAEENASTTVTGVEMFRKLLDQAQAGDNIGALLR
FT                   GVAREDIQRGQVLAKSGSVKAHAKFKAEVFVLSKEEGGRHTPFFANYRPQFYFRTTDVT
FT                   GIIQLPEGTEMVMPGDNIEMTIELIAPIAIEEGTKFSIREGGRTVGYGVVATIVE"
FT   gene            120862..121170
FT                   /gene="rpsJ"
FT                   /locus_tag="BAA_0125"
FT   CDS_pept        120862..121170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="BAA_0125"
FT                   /product="30S ribosomal protein S10"
FT                   /note="identified by match to protein family HMM PF00338;
FT                   match to protein family HMM TIGR01049"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50363"
FT                   /db_xref="GOA:C3P9Q4"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3P9Q4"
FT                   /protein_id="ACQ50363.1"
FT                   /translation="MAKEKIRIRLKAYDHRILDQSADKIVETAKRSGATVSGPIPLPTE
FT                   KTVYTILRAVHKYKDSREQFEMRTHKRLIDIVSPTPQTVDSLMRLDLPSGVDIEIKL"
FT   gene            121205..121837
FT                   /gene="rplC"
FT                   /locus_tag="BAA_0126"
FT   CDS_pept        121205..121837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="BAA_0126"
FT                   /product="50S ribosomal protein L3"
FT                   /note="identified by match to protein family HMM PF00297;
FT                   match to protein family HMM TIGR03625"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50005"
FT                   /db_xref="GOA:C3P9Q5"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3P9Q5"
FT                   /protein_id="ACQ50005.1"
FT                   /translation="MTKGILGRKIGMTQVFAENGELIPVTVIAANPNVVLQKKTTETDG
FT                   YNAIQLGFEDKREKLTNKPEQGHTAKASTTPKRFIREIRDADVDGLEVGQEVKVDVFAT
FT                   GEIVDVTGISKGKGFQGVIKRHGQSRGPMSHGSRYHRRPGSMGPVAPNRVFKGKKLAGR
FT                   MGGDQVTIQNLEIVQVDTERNLLLVKGNVPGAKKSLVVVQGAVKVSK"
FT   gene            121863..122486
FT                   /gene="rplD"
FT                   /locus_tag="BAA_0127"
FT   CDS_pept        121863..122486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="BAA_0127"
FT                   /product="50S ribosomal protein L4"
FT                   /note="identified by match to protein family HMM PF00573"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48933"
FT                   /db_xref="GOA:C3P9Q6"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3P9Q6"
FT                   /protein_id="ACQ48933.1"
FT                   /translation="MPKVTVYNQTGSQVGEIELAEAIFGIEPNEAVLFEAVMMQRASLR
FT                   QGTHKVKTRSEVRGGGRKPWRQKGTGRARQGSIRSPQWRGGGTVFGPTPRSYAYKLPKK
FT                   VRRLAIKSALATKVVENNIVVLEDLVLNAPKTKDMLAVLKGLTVEKKALIVTADANESV
FT                   ELSARNIPGVTVITADGVNVLDVLHHDKLIMTKAAVEKVEEVLA"
FT   gene            122486..122776
FT                   /gene="rplW"
FT                   /locus_tag="BAA_0128"
FT   CDS_pept        122486..122776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="BAA_0128"
FT                   /product="50S ribosomal protein L23"
FT                   /note="identified by match to protein family HMM PF00276"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48455"
FT                   /db_xref="GOA:C3P9Q7"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3P9Q7"
FT                   /protein_id="ACQ48455.1"
FT                   /translation="MRDPRDIIKRPVITERSMEMMAEKKYTFDVDVKSNKTEVKDALEA
FT                   IFGVKVEKVNIMNYKPKAKRVGRHAGFTSRRRKAIVKLTADSKEIEIFQGV"
FT   gene            122805..123635
FT                   /gene="rplB"
FT                   /locus_tag="BAA_0129"
FT   CDS_pept        122805..123635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="BAA_0129"
FT                   /product="50S ribosomal protein L2"
FT                   /note="identified by match to protein family HMM PF00181;
FT                   match to protein family HMM PF03947; match to protein
FT                   family HMM TIGR01171"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48642"
FT                   /db_xref="GOA:C3P9Q8"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3P9Q8"
FT                   /protein_id="ACQ48642.1"
FT                   /translation="MGIKKYNPTTNGRRNMTTNDFAEITTDRPEKSLLAPLSKKAGRNN
FT                   QGKITVRHQGGGHKRQYRIIDFKRNKDGIPGRVATIEYDPNRSANIALINYVDGEKRYI
FT                   LAPKNLEVGMEIMSGAEADIKIGNALPLINIPVGTVVHNIELKPGRGGQLVRSAGTSAQ
FT                   VLGKEGKYVLVRLTSGEVRLVLSACRATVGQVGNESHELIKIGKAGRSRWLGKRPTVRG
FT                   SVMNPVDHPHGGGEGRSPIGRKSPMSPWGKPTLGFKTRKKNKASDKFIVRRRKK"
FT   gene            123696..123974
FT                   /gene="rpsS"
FT                   /locus_tag="BAA_0130"
FT   CDS_pept        123696..123974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="BAA_0130"
FT                   /product="30S ribosomal protein S19"
FT                   /note="identified by match to protein family HMM PF00203;
FT                   match to protein family HMM TIGR01050"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49479"
FT                   /db_xref="GOA:C3P9Q9"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3P9Q9"
FT                   /protein_id="ACQ49479.1"
FT                   /translation="MARSLKKGPFVDDHLMSKIAKLNETEQKQVVKTWSRRSTIFPQFI
FT                   GHTIAVYDGRKHVPVYVTEDMVGHKLGEFAPTRTYKGHDADDKKTRR"
FT   gene            123992..124333
FT                   /gene="rplV"
FT                   /locus_tag="BAA_0131"
FT   CDS_pept        123992..124333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="BAA_0131"
FT                   /product="50S ribosomal protein L22"
FT                   /note="identified by match to protein family HMM PF00237;
FT                   match to protein family HMM TIGR01044"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49742"
FT                   /db_xref="GOA:C3P9R0"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3P9R0"
FT                   /protein_id="ACQ49742.1"
FT                   /translation="MQAKAVARTVRIAPRKVRLVVDLIRGKQVGEAIAILNHTPKTASP
FT                   VVEKVLKSAIANAEHNYEMDINSLVVEKVFVDEGPTLKRFRPRAMGRASQINKRTSHIT
FT                   VVVSEKKEG"
FT   gene            124337..124996
FT                   /gene="rpsC"
FT                   /locus_tag="BAA_0132"
FT   CDS_pept        124337..124996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="BAA_0132"
FT                   /product="30S ribosomal protein S3"
FT                   /note="identified by match to protein family HMM PF00189;
FT                   match to protein family HMM PF00417; match to protein
FT                   family HMM PF07650; match to protein family HMM TIGR01009"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50601"
FT                   /protein_id="ACQ50601.1"
FT                   /translation="MGQKVNPIGLRVGVIRDWESRWFAEKDYATLLHEDIKIREYINVR
FT                   LKDSAVAKVEIERAANRVNVTIHTAKPGMVIGKGGTEVEALRKALNQLTGKRVHINILE
FT                   VKRADLNAKLVGENIARQLENRVSFRRAQKQVIQRAMRAGAKGIKTQVSGRLGGADIAR
FT                   AESYSEGTVPLHTLRADIDYAAVEADTTYGKLGVKVWIYRGEVLPTKKKASEEGGK"
FT   gene            124998..125432
FT                   /gene="rplP"
FT                   /locus_tag="BAA_0133"
FT   CDS_pept        124998..125432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="BAA_0133"
FT                   /product="50S ribosomal protein L16"
FT                   /note="identified by match to protein family HMM PF00252;
FT                   match to protein family HMM TIGR01164"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47099"
FT                   /db_xref="GOA:C3P9R2"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3P9R2"
FT                   /protein_id="ACQ47099.1"
FT                   /translation="MLMPKRVKYRREHRGKMRGRAKGGTEIAFGEFGLQAQAASWITNR
FT                   QIEAARRAMTRYMKRGGKVWIKIFPSKPYTAKPLEVRMGSGKGAPEGWVAVVKPGKIMF
FT                   EIAGVSEEVAREALRLAAHKLPVKCKFVKREENGGESNEN"
FT   gene            125422..125622
FT                   /gene="rpmC"
FT                   /locus_tag="BAA_0134"
FT   CDS_pept        125422..125622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="BAA_0134"
FT                   /product="50S ribosomal protein L29"
FT                   /note="identified by match to protein family HMM PF00831;
FT                   match to protein family HMM TIGR00012"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47518"
FT                   /db_xref="GOA:C3P9R3"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3P9R3"
FT                   /protein_id="ACQ47518.1"
FT                   /translation="MKTNDIRELTTAEIETKVKALKEELFNLRFQLATGQLENPTRIRE
FT                   VRKAIARMKTVVREREIGINR"
FT   gene            125643..125906
FT                   /gene="rpsQ"
FT                   /locus_tag="BAA_0135"
FT   CDS_pept        125643..125906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="BAA_0135"
FT                   /product="30S ribosomal protein S17"
FT                   /note="identified by match to protein family HMM PF00366;
FT                   match to protein family HMM TIGR03635"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48511"
FT                   /db_xref="GOA:C3P9R4"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3P9R4"
FT                   /protein_id="ACQ48511.1"
FT                   /translation="MSERNQRKVYTGRVVSDKMDKTITVLVETYKTHSLYGKRVKYSKK
FT                   YKAHDEQNQAKLGDIVKIMETRPLSATKRFRLVEIVEEAVII"
FT   gene            125950..126318
FT                   /gene="rplN"
FT                   /locus_tag="BAA_0136"
FT   CDS_pept        125950..126318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="BAA_0136"
FT                   /product="50S ribosomal protein L14"
FT                   /note="identified by match to protein family HMM PF00238;
FT                   match to protein family HMM TIGR01067"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48932"
FT                   /db_xref="GOA:C3P9R5"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3P9R5"
FT                   /protein_id="ACQ48932.1"
FT                   /translation="MIQQESRLKVADNSGARELLTIKVLGGSGRKYANIGDIIVATVKQ
FT                   ATPGGVVKKGDVVKAVVVRTKSGARRPDGSYIKFDENAAVIIKDDKSPRGTRIFGPVAR
FT                   ELRDSNFMKIVSLAPEVL"
FT   gene            126357..126668
FT                   /gene="rplX"
FT                   /locus_tag="BAA_0137"
FT   CDS_pept        126357..126668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="BAA_0137"
FT                   /product="50S ribosomal protein L24"
FT                   /note="identified by match to protein family HMM PF00467;
FT                   match to protein family HMM TIGR01079"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49324"
FT                   /db_xref="GOA:C3P9R6"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3P9R6"
FT                   /protein_id="ACQ49324.1"
FT                   /translation="MHVKKGDKVQVITGKDKGKQGVILVAFPKQNRVIVEGVNIVKKHS
FT                   KPSQLNPQGGIITKEAPIHVSNVMILDPKTGEPTRVGFKVEDGKKVRIAKKSGELLDK"
FT   gene            126695..127234
FT                   /gene="rplE"
FT                   /locus_tag="BAA_0138"
FT   CDS_pept        126695..127234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="BAA_0138"
FT                   /product="50S ribosomal protein L5"
FT                   /note="identified by match to protein family HMM PF00281;
FT                   match to protein family HMM PF00673"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46806"
FT                   /db_xref="GOA:C3P9R7"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3P9R7"
FT                   /protein_id="ACQ46806.1"
FT                   /translation="MNRLKEKFQKEITPALVSKFNYKSVMQVPKIEKIVINTGVGDAVS
FT                   NSKTLDNAVEELTQITGQKPVVTRAKKSIAGFRLREGMPIGAKVTLRGEQMYEFFDKLV
FT                   SVSLPRVRDFRGVSKKSFDGRGNYTLGVKEQLIFPEIDYDKVSKVRGMDIVIVTTAKTD
FT                   EEARELLTQFGMPFQK"
FT   gene            127268..127453
FT                   /gene="rpsN"
FT                   /locus_tag="BAA_0139"
FT   CDS_pept        127268..127453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="BAA_0139"
FT                   /product="30S ribosomal protein S14"
FT                   /note="identified by match to protein family HMM PF00253"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50900"
FT                   /db_xref="GOA:C3P9R8"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3P9R8"
FT                   /protein_id="ACQ50900.1"
FT                   /translation="MAKKSMIAKQKRTPKFKVQEYTRCERCGRPHSVYRKFKLCRICFR
FT                   ELAYKGQIPGVKKASW"
FT   gene            127483..127881
FT                   /gene="rpsH"
FT                   /locus_tag="BAA_0140"
FT   CDS_pept        127483..127881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="BAA_0140"
FT                   /product="30S ribosomal protein S8"
FT                   /note="identified by match to protein family HMM PF00410"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48855"
FT                   /db_xref="GOA:C3P9R9"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3P9R9"
FT                   /protein_id="ACQ48855.1"
FT                   /translation="MVMTDPIADMLTRIRNANMVRHEKLEVPASKIKKEIAELLKREGF
FT                   IRDVEYIEDNKQGILRIFLKYGANNERVITGLKRISKPGLRVYAKADEVPRVLNGLGIA
FT                   LVSTSKGVMTDKDARQLQTGGEVVAYVW"
FT   gene            127914..128453
FT                   /gene="rplF"
FT                   /locus_tag="BAA_0141"
FT   CDS_pept        127914..128453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="BAA_0141"
FT                   /product="50S ribosomal protein L6"
FT                   /note="identified by match to protein family HMM PF00347;
FT                   match to protein family HMM TIGR03654"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49047"
FT                   /protein_id="ACQ49047.1"
FT                   /translation="MSRIGKKILEIPAGVTITVAEDNTVTVKGPKGELTRTFNADMLIK
FT                   IEENTLTVERPSEQKEHRALHGTTRALIGNMVEGVTEGFARGLELVGVGYRAQKQGDKL
FT                   VLSVGYSHPVEMTPEAGLEVEVPAPTKIVIKGIDKQRVGEFAANIRAVRAPEPYKGKGI
FT                   RYEGEVVRRKEGKTAK"
FT   gene            128485..128847
FT                   /gene="rplR"
FT                   /locus_tag="BAA_0142"
FT   CDS_pept        128485..128847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="BAA_0142"
FT                   /product="50S ribosomal protein L18"
FT                   /note="identified by match to protein family HMM PF00861;
FT                   match to protein family HMM TIGR00060"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49608"
FT                   /db_xref="GOA:C3P9S1"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3P9S1"
FT                   /protein_id="ACQ49608.1"
FT                   /translation="MITKADKNATRKKRHARVRAKLTGTAERPRLNVFRSNQHIYAQVI
FT                   DDVNGVTLVSASTLDKDLALNGTSNIEAATKVGESVAKRAVEKGVKEVVFDRGGYLYHG
FT                   RVKALAEAAREAGLQF"
FT   gene            128869..129369
FT                   /gene="rpsE"
FT                   /locus_tag="BAA_0143"
FT   CDS_pept        128869..129369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="BAA_0143"
FT                   /product="30S ribosomal protein S5"
FT                   /note="identified by match to protein family HMM PF00333;
FT                   match to protein family HMM PF03719; match to protein
FT                   family HMM TIGR01021"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47353"
FT                   /protein_id="ACQ47353.1"
FT                   /translation="MHRIDPSKLELEERVVTINRVAKVVKGGRRFRFAALVVVGDKNGH
FT                   VGFGTGKAQEVPDAIRKAIEDAKKNLIAVPLVGTTIPHTINGHFGAGEVFLKPAAEGTG
FT                   VIAGGPVRAVLELAGVQDILSKSLGSNTPINMIRATVNGLSELKRAEDVAKLRGKSVEE
FT                   LLG"
FT   gene            129383..129565
FT                   /gene="rpmD"
FT                   /locus_tag="BAA_0144"
FT   CDS_pept        129383..129565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="BAA_0144"
FT                   /product="50S ribosomal protein L30"
FT                   /note="identified by match to protein family HMM PF00327;
FT                   match to protein family HMM TIGR01308"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47906"
FT                   /db_xref="GOA:C3P9S3"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3P9S3"
FT                   /protein_id="ACQ47906.1"
FT                   /translation="MAKKLEITLTRSVIGRPQDQRATVEALGLKKLNSTVVKEETPAIL
FT                   GMINKVSHLVTVKEA"
FT   gene            129599..130039
FT                   /gene="rplO"
FT                   /locus_tag="BAA_0145"
FT   CDS_pept        129599..130039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="BAA_0145"
FT                   /product="50S ribosomal protein L15"
FT                   /note="identified by match to protein family HMM PF00256;
FT                   match to protein family HMM PF01305; match to protein
FT                   family HMM TIGR01071"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50107"
FT                   /db_xref="GOA:C3P9S4"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3P9S4"
FT                   /protein_id="ACQ50107.1"
FT                   /translation="MKLHELKPAEGSRKVRNRVGRGIGSGNGKTAGKGHKGQNARSGGG
FT                   VRLGFEGGQTPLFRRLPKRGFTNINRKEFAIVNLSTLNRFEDGTEVTPELLLETGVISK
FT                   LNDGVKILASGAVEKKLTVKAHKFSSSAKEAIEAAGGSVEVI"
FT   gene            130039..131340
FT                   /gene="secY1"
FT                   /locus_tag="BAA_0146"
FT   CDS_pept        130039..131340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY1"
FT                   /locus_tag="BAA_0146"
FT                   /product="preprotein translocase, SecY subunit"
FT                   /note="identified by match to protein family HMM PF00344;
FT                   match to protein family HMM TIGR00967"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50700"
FT                   /protein_id="ACQ50700.1"
FT                   /translation="MFRTISNFMRVAEIRRKILFTLAMLIVFRIGTFIPVPFTNGDVLK
FT                   AQDQLNALGILNTFGGGALKNFSIFAMGIMPYITASIIVQLLQMDVVPKFSEWAKQGEM
FT                   GRRKLTQFTRYFTIVLAFIQGFGMSIGFNGMVGGQLILNPGWSTYLYIATVLTAGTAFL
FT                   MWLGEQITAKGVGNGISILIFGGIAAAIPSVISQVYQQQFQNIGDQLFMSIVKVALILL
FT                   AVLAVIVGVIFIQQAVRKIPIQYAKRVTGGNGGYAGAQNTHLPLKVNSAGVIPVIFAVS
FT                   FLITPPTIAQFFPKHDVSQWIIANFNYSHPVGMIIYVALIVAFTYFYAFVQVNPEQMSE
FT                   NLNKQGGYVPGIRPGKNTEQYLTKILYRLTFVGSIFLAAIAILPVIFTKLGNLPPSAQI
FT                   GGTSMLIVVGVALETMKQLESQLVKRHYKGFIKQ"
FT   gene            131397..132047
FT                   /gene="adk"
FT                   /locus_tag="BAA_0147"
FT   CDS_pept        131397..132047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="BAA_0147"
FT                   /product="adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /note="identified by match to protein family HMM PF00406;
FT                   match to protein family HMM PF05191; match to protein
FT                   family HMM TIGR01351"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48854"
FT                   /db_xref="GOA:C3P9S6"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3P9S6"
FT                   /protein_id="ACQ48854.1"
FT                   /translation="MNLILMGLPGAGKGTQAEQIVAKYNIPHISTGDMFRAAMKAETEM
FT                   GLQAKSFIDKGALVPDEVTIGIVRERLSQEDCVRGFLLDGFPRTVAQASALEEIMKDLG
FT                   KKIDYVLNINVDSGLLLKRLTGRRICKECGATYHLEFNAPAKADVCDKCGGELYQRSDD
FT                   NEETVANRLDVNIKQTKPLLDFYEELGYLQSINGEQDINKVFADIDVLIGGLA"
FT   gene            132047..132793
FT                   /gene="maP1"
FT                   /locus_tag="BAA_0148"
FT   CDS_pept        132047..132793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maP1"
FT                   /locus_tag="BAA_0148"
FT                   /product="methionine aminopeptidase, type I"
FT                   /EC_number="3.4.11.18"
FT                   /note="identified by match to protein family HMM PF00557;
FT                   match to protein family HMM TIGR00500"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50028"
FT                   /protein_id="ACQ50028.1"
FT                   /translation="MIICKTPREIEIMREAGRIVALTHQELKQHITPGITTKELDQIAE
FT                   KTIQKYGATPSFKGYNGFPGSICASVNEELVHGIPGKRKLKEGDIISIDIGAKYNGYHG
FT                   DSAWTYPVGNISESVQKLLDVTEKSLYLGLEQVKPGERLSNISHAVQTHAEENGFSIVR
FT                   EYVGHGIGQDLHEDPQIPHYGPPNRGPRLKPGMVICVEPMVNQGRRYVKTLSDDWTVVT
FT                   VDGKWCAHFEHTIALTEAGYEILTTL"
FT   gene            132862..133080
FT                   /gene="infA"
FT                   /locus_tag="BAA_0149"
FT   CDS_pept        132862..133080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="BAA_0149"
FT                   /product="translation initiation factor IF-1"
FT                   /note="identified by match to protein family HMM PF00575;
FT                   match to protein family HMM PF01176; match to protein
FT                   family HMM TIGR00008"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46622"
FT                   /protein_id="ACQ46622.1"
FT                   /translation="MAKDDVIEVEGTVLETLPNAMFKVELENGHVVLAHVSGKIRMNFI
FT                   RILPGDKVTVELSPYDLNRGRITYRFK"
FT   gene            133116..133229
FT                   /gene="rpmJ"
FT                   /locus_tag="BAA_0150"
FT   CDS_pept        133116..133229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="BAA_0150"
FT                   /product="50S ribosomal protein L36"
FT                   /note="identified by match to protein family HMM PF00444;
FT                   match to protein family HMM TIGR01022"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45941"
FT                   /db_xref="GOA:C3P9S9"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3P9S9"
FT                   /protein_id="ACQ45941.1"
FT                   /translation="MKVRPSVKPICEKCKVIRRRGKVMVICENPKHKQKQG"
FT   gene            133251..133616
FT                   /gene="rpsM"
FT                   /locus_tag="BAA_0151"
FT   CDS_pept        133251..133616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="BAA_0151"
FT                   /product="30S ribosomal protein S13"
FT                   /note="identified by match to protein family HMM PF00416;
FT                   match to protein family HMM TIGR03631"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48384"
FT                   /db_xref="GOA:C3P9T0"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3P9T0"
FT                   /protein_id="ACQ48384.1"
FT                   /translation="MARIAGVDIPRDKRVVISLTYVFGIGRTTAEKILAEAGISEETRV
FT                   RDLTEDELGRIRDIIDRIKVEGDLRREVSLNIKRLMEIGSYRGLRHRRGLPVRGQNSKN
FT                   NARTRKGPRRTVANKKK"
FT   gene            133641..134030
FT                   /gene="rpsK"
FT                   /locus_tag="BAA_0152"
FT   CDS_pept        133641..134030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="BAA_0152"
FT                   /product="30S ribosomal protein S11"
FT                   /note="identified by match to protein family HMM PF00411;
FT                   match to protein family HMM TIGR03632"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49648"
FT                   /db_xref="GOA:C3P9T1"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3P9T1"
FT                   /protein_id="ACQ49648.1"
FT                   /translation="MARKTNTRKKRVKKNIEAGVAHIRSTFNNTIVTLTDTHGNALSWS
FT                   SAGALGFRGSRKSTPFAAQMAAETAAKAAMEHGLKTLEVTVKGPGAGREAAIRALQAAG
FT                   LEVTAIRDVTPVPHNGCRPPKRRRV"
FT   gene            134211..135155
FT                   /gene="rpoA"
FT                   /locus_tag="BAA_0153"
FT   CDS_pept        134211..135155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="BAA_0153"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="identified by match to protein family HMM PF01000;
FT                   match to protein family HMM PF01193; match to protein
FT                   family HMM PF03118; match to protein family HMM TIGR02027"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49042"
FT                   /protein_id="ACQ49042.1"
FT                   /translation="MIEIEKPKIETVELNEDAKYGKFVIEPLERGYGTTLGNSLRRILL
FT                   SSLPGAAVTAIQIDGVLHEFSTVEGVVEDVTTIILNLKKLALKIYSEEEKTLEIDVQGE
FT                   GIVTAADITHDSDVEILNPDLHIATLAKDAHFRVRLTAKRGRGYTPADANKSEDQPIGV
FT                   IPIDSIYTPVSRVTYQVEKTRVGQVANYDKLTLDVWTDGSIGPKEAISLGAKILTEHLN
FT                   IFVGLTDEAQNAEIMVEKEEDQKEKVLEMTIEELDLSVRSYNCLKRAGINTVQELANKT
FT                   EEDMMKVRNLGRKSLEEVKHKLEELGLGLRKDD"
FT   gene            135191..135553
FT                   /gene="rplQ"
FT                   /locus_tag="BAA_0154"
FT   CDS_pept        135191..135553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="BAA_0154"
FT                   /product="50S ribosomal protein L17"
FT                   /note="identified by match to protein family HMM PF01196;
FT                   match to protein family HMM TIGR00059"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50702"
FT                   /db_xref="GOA:C3P9T3"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3P9T3"
FT                   /protein_id="ACQ50702.1"
FT                   /translation="MAYRKLGRTSAQRKAMLRDLATDLIINERIQTTETRAKELRSVVE
FT                   KMITLGKRGDLHARRQAAAFIRNEVANAETGQDALQKLFADVAPRYAERQGGYTRIAKI
FT                   GPRRGDAAPMVIIELV"
FT   gene            135657..136499
FT                   /locus_tag="BAA_0155"
FT   CDS_pept        135657..136499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0155"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50622"
FT                   /protein_id="ACQ50622.1"
FT                   /translation="MKKEKLRTENISFQYPGAATYALKDVSFSLFEGEWVSVIGQNGSG
FT                   KSTLAKLLNGLFLPEAGTITVNDTMILSEETVWDVRKQIGMVFQNPDNQFVGTTVQDDV
FT                   VFGLENIGMPREQMVERLNQALRLVRMEDFLNDEPHSLSGGQKQRVAIAGVLALQPSIL
FT                   ILDEATSMLDPQGRREVVETVRQLVNEKGITVLSITHDLEEAAQSDRVIILNKGEILEE
FT                   GTPEQIFKSSHMLQEIGLDVPFSVKIAELLKRNEILLQNTHLTMESLVNELWRLHSKK"
FT   gene            136475..137356
FT                   /locus_tag="BAA_0156"
FT   CDS_pept        136475..137356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0156"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50642"
FT                   /protein_id="ACQ50642.1"
FT                   /translation="MEITFQKVEHRYQYKTPFERRALYDVDVSFPSGGYYAIIGHTGSG
FT                   KSTMIQHLNGLLQPTNGTVQIGEHFISAGKKEKKLKPLRKKVGVVFQFPEHQLFEETVE
FT                   KDICFGPTNFGVSEEAAKQKAREAIELVGLEPELLARSPFELSGGQMRRVAIAGVLAME
FT                   PEVLVLDEPTAGLDPKGQNELMEMFYKLHKEKGLTVILVTHNMEDAAKYAEQIVVMHKG
FT                   TVFLQGSAEEVFSHADELEKIGVDLPMSLKYKRAIEEKFGISIPKATLSLEDLTHEVVQ
FT                   VLRKGGHESCSS"
FT   gene            137344..138138
FT                   /locus_tag="BAA_0157"
FT   CDS_pept        137344..138138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0157"
FT                   /product="cobalt transport protein"
FT                   /note="identified by match to protein family HMM PF02361"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49926"
FT                   /protein_id="ACQ49926.1"
FT                   /translation="MQQLIIGRYIPGNSLIHQLDPRTKLLIVFLYVFVVFLANNAISYG
FT                   FLFLYALIALFFAKVPIRYVLSGLKPILWIFLFTFFLHIFTNKEGEVLFQLGWFSIHEK
FT                   GLEQGIYISIRFFVIILMTTLLTLTTTPIEITDGLETLLKPLKRIKVPVHEIALMMSIS
FT                   LRFIPTLMDETSKIMKAQSSRGIDFAGGPIKDRMKAIISLLVPLFISAFKRAEDLAIAM
FT                   EARGYQSGEGRTKFRQLRWKTSDTVTIISLLCLACILAWVRS"
FT   gene            138138..138896
FT                   /gene="truA1"
FT                   /locus_tag="BAA_0158"
FT   CDS_pept        138138..138896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truA1"
FT                   /locus_tag="BAA_0158"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="5.4.99.12"
FT                   /note="identified by match to protein family HMM PF01416;
FT                   match to protein family HMM TIGR00071"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50599"
FT                   /protein_id="ACQ50599.1"
FT                   /translation="MENREMDRIKCTVAYDGMHFCGYQIQPQHRTVQQEIEKALQKLHK
FT                   GELVRVQASGRTDSTVHAKGQVIHFDTPLSLEEWQWSNALNTMLPDDIVITQVEKKTEE
FT                   FHARYGVERKEYRYRVLVSKTADVFRRNYVYQYPYPLEVNSIRKAIPYFIGTHDFTSFC
FT                   SAKTDKKDKVRTIYEIELIEQDDELIFRFVGNGFLYNMVRIIVGTLLNVGQGKLDPDSI
FT                   PEILAKQNRQFAGKMAPGHGLYLWQVNYNN"
FT   misc_feature    138951..139011
FT                   /note="Ribosomal protein L13 leader"
FT   gene            139049..139486
FT                   /gene="rplM"
FT                   /locus_tag="BAA_0160"
FT   CDS_pept        139049..139486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="BAA_0160"
FT                   /product="50S ribosomal protein L13"
FT                   /note="identified by match to protein family HMM PF00572;
FT                   match to protein family HMM TIGR01066"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48474"
FT                   /db_xref="GOA:C3PAK3"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3PAK3"
FT                   /protein_id="ACQ48474.1"
FT                   /translation="MRTTFMAKANEVERKWYVVDAEGQTLGRLASEVASILRGKNKPTF
FT                   TPHVDTGDHVIIINAEKIHLTGNKLNDKIYYRHTNHPGGLKQRTALEMRTNYPVQMLEL
FT                   AIKGMLPKGRLGRQVSKKLNVYAGAEHPHQAQKPEVYELRG"
FT   gene            139508..139900
FT                   /gene="rpsI"
FT                   /locus_tag="BAA_0161"
FT   CDS_pept        139508..139900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="BAA_0161"
FT                   /product="30S ribosomal protein S9"
FT                   /note="identified by match to protein family HMM PF00380"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47700"
FT                   /db_xref="GOA:C3PAK4"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3PAK4"
FT                   /protein_id="ACQ47700.1"
FT                   /translation="MAQVQYYGTGRRKSSVARVRLVSGEGRVIINGRDFENYIPFAALR
FT                   EVVKQPLVATETLGNYDVLVNVNGGGYTGQAGAIRHGISRALLKADPEYRLTLKRAGLL
FT                   TRDARMKERKKYGLKGARRAPQFSKR"
FT   gene            140063..140491
FT                   /locus_tag="BAA_0162"
FT   CDS_pept        140063..140491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0162"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47315"
FT                   /protein_id="ACQ47315.1"
FT                   /translation="MNVIVSLQEKQKEKQLKYERKMLRELSLKTLRSNIRDAFQMQELH
FT                   RQYEDYCIELGIESYLLGARYSKFGYYGESFFDVKYRALEEEQQLTETLFQFLTSMTMR
FT                   EIKLQDEELLFESCQQFIGLWWQEGYEKGERRYRLKLH"
FT   gene            140558..141271
FT                   /gene="cwlD"
FT                   /locus_tag="BAA_0163"
FT   CDS_pept        140558..141271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cwlD"
FT                   /locus_tag="BAA_0163"
FT                   /product="N-acetylmuramoyl-L-alanine amidase CwlD"
FT                   /EC_number="3.5.1.28"
FT                   /note="identified by match to protein family HMM PF01520;
FT                   match to protein family HMM TIGR02883"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48417"
FT                   /protein_id="ACQ48417.1"
FT                   /translation="MKRIRIISFALAAVILFFLVKQEFQIIKSWRAWNLPLSGKVIVLD
FT                   AGHGGPDGGAVGGKDIVEKDITLEITKKVQDYLQEQGALVILTREGDYDLAQKDTKSYS
FT                   RRKAEDLKKRVEIINKPDVDFFASIHLNALTSSGSKGAQTFYYRSSIENERAAKFIQAE
FT                   LRTSLENTNRSAKTISHVYLLKYAKTPGALIEAGFLSNVNERYMLNSEKYQQKVAAAVY
FT                   RGILRYFTEKGNPPE"
FT   gene            141416..142480
FT                   /locus_tag="BAA_0164"
FT   CDS_pept        141416..142480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0164"
FT                   /product="mrp protein"
FT                   /note="identified by match to protein family HMM PF01883"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46425"
FT                   /protein_id="ACQ46425.1"
FT                   /translation="MVMKEQVVEALEGIVDPFLHKTLKETGAIKEVTVKPEKKHVSVKI
FT                   AIVKTGTAEQMQLQSGIVKLVKELGAATVGLRFAEFTEEELAQFAPEQEEQTESLLSPN
FT                   SKTTFLAVASGKGGVGKSTVSVNLAIALARLGKKVGIIDADIYGFSVPDMMGIEKRPVV
FT                   RGDKIIPVERLGVKVISMGFFVEDNAPVIWRGPMLGKMLNHFFTEVEWGDLDYLVLDLP
FT                   PGTGDVALDLHSMLPACKEIIVTTPHPTAAFVAARAGAMALRTEHSILGVVENMAYFES
FT                   KTTGEKEYVFGRGGGDKLATELQTEVLGRIPLQQPDWNKEDFAPSVYEDTHTTGLIYRT
FT                   IAETVIDKTAFAQK"
FT   gene            complement(142537..143154)
FT                   /gene="gerD"
FT                   /locus_tag="BAA_0165"
FT   CDS_pept        complement(142537..143154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerD"
FT                   /locus_tag="BAA_0165"
FT                   /product="spore germination protein GerD"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46753"
FT                   /protein_id="ACQ46753.1"
FT                   /translation="MKRMLLVLTSSFLFLVLVACAQEKEAKSELDYDQTKKMIVDILKT
FT                   DQGKKAIQDVLTDEKMKQALILDETVVKKTIEDAMVSDKGQQFWEKLFKDPEFSSKFAK
FT                   SMGKEQTALMKTLLKDPEYQAGVIEIMKNPEVEKMMLQTMKSKEYRQYLQQVLTETAES
FT                   PLFQAKMIDIISKGVQKAEKSGSDKKEAGGEGGSQEGKKEQQ"
FT   gene            143294..143905
FT                   /gene="kbaA"
FT                   /locus_tag="BAA_0166"
FT   CDS_pept        143294..143905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kbaA"
FT                   /locus_tag="BAA_0166"
FT                   /product="kinb signaling pathway activation protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50168"
FT                   /protein_id="ACQ50168.1"
FT                   /translation="MNSRKWVRLFFTTLFLGGISTVIIGFVLEWDKYAKFFQNFDGKEI
FT                   LAVSFWLMGVGFIFSVISQMGFFAYLTIHRFGLGMFRSSSLWNIVQLFFIAFVLFDFVY
FT                   LRSVLIANGEVSLGNNILVAGVLFMFGAIVAYIKSKETNKKAFVPALFFMVVVTILEWV
FT                   PALRINDTDWLYLMVIPLLLCNAYQLLILHRLIGKTSKSA"
FT   gene            complement(144010..144774)
FT                   /locus_tag="BAA_0167"
FT   CDS_pept        complement(144010..144774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0167"
FT                   /product="putative polysaccharide deacetylase"
FT                   /note="identified by match to protein family HMM PF01522;
FT                   match to protein family HMM TIGR02764"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49917"
FT                   /protein_id="ACQ49917.1"
FT                   /translation="MFFFFITSKRNFKHISLIVILSLFTAWLLFLKTYSHESAFSTATG
FT                   PKVIYKGDTSKKQVAFTFDISWGDKKAIPILDTLKERDIKNATFFLSAAWAERHPDVVE
FT                   RIIKDGHEIGSMGYNYTSYTSLETNEIRRDLLRAQDVFTKLGVKQIKLLRPPSGDFNKA
FT                   TLKIAESLGYTVVHWSNNSNDWKNPGVNKIVSTVSNNLKGGDIVLLHASDSALQTNKAL
FT                   PLLLQKLKSDGYEQISVSQLISNTSTKSKDVQ"
FT   gene            144945..145163
FT                   /locus_tag="BAA_0168"
FT   CDS_pept        144945..145163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0168"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50597"
FT                   /protein_id="ACQ50597.1"
FT                   /translation="MLGFMLTKEEKKEMEYILKRELEELLFDFEDERIHDVVKKAMEER
FT                   YKIIFCLFRRVANAEDCIRYVRKRTFY"
FT   gene            145413..146921
FT                   /gene="rrs_4"
FT                   /locus_tag="BAA_0169"
FT   rRNA            145413..146921
FT                   /gene="rrs_4"
FT                   /locus_tag="BAA_0169"
FT                   /product="16S ribosomal RNA"
FT   gene            147100..150007
FT                   /gene="rrl_4"
FT                   /locus_tag="BAA_0171"
FT   rRNA            147100..150007
FT                   /gene="rrl_4"
FT                   /locus_tag="BAA_0171"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(147124..147555)
FT                   /pseudo
FT                   /locus_tag="BAA_0170"
FT                   /note="conserved hypothetical protein; this region contains
FT                   one or more premature stops and/or frameshifts"
FT   gene            150094..150209
FT                   /gene="rrf_4"
FT                   /locus_tag="BAA_0172"
FT   rRNA            150094..150209
FT                   /gene="rrf_4"
FT                   /locus_tag="BAA_0172"
FT                   /product="5S ribosomal RNA"
FT   gene            150218..150294
FT                   /locus_tag="BAA_0173"
FT   tRNA            150218..150294
FT                   /locus_tag="BAA_0173"
FT                   /product="tRNA-Asn"
FT   gene            150298..150373
FT                   /locus_tag="BAA_0174"
FT   tRNA            150298..150373
FT                   /locus_tag="BAA_0174"
FT                   /product="tRNA-Thr"
FT   gene            150394..150470
FT                   /locus_tag="BAA_0175"
FT   tRNA            150394..150470
FT                   /locus_tag="BAA_0175"
FT                   /product="tRNA-Glu"
FT   gene            150474..150551
FT                   /locus_tag="BAA_0176"
FT   tRNA            150474..150551
FT                   /locus_tag="BAA_0176"
FT                   /product="tRNA-Val"
FT   gene            150568..150651
FT                   /locus_tag="BAA_0177"
FT   tRNA            150568..150651
FT                   /locus_tag="BAA_0177"
FT                   /product="tRNA-Tyr"
FT   gene            150717..150791
FT                   /locus_tag="BAA_0178"
FT   tRNA            150717..150791
FT                   /locus_tag="BAA_0178"
FT                   /product="tRNA-Gln"
FT   gene            150797..150872
FT                   /locus_tag="BAA_0179"
FT   tRNA            150797..150872
FT                   /locus_tag="BAA_0179"
FT                   /product="tRNA-Lys"
FT   gene            150878..150952
FT                   /locus_tag="BAA_0180"
FT   tRNA            150878..150952
FT                   /locus_tag="BAA_0180"
FT                   /product="tRNA-Gly"
FT   gene            150960..151035
FT                   /locus_tag="BAA_0181"
FT   tRNA            150960..151035
FT                   /locus_tag="BAA_0181"
FT                   /product="tRNA-Ala"
FT   gene            151147..151356
FT                   /pseudo
FT                   /locus_tag="BAA_0182"
FT                   /note="glycerate kinase; this gene contains a frame shift
FT                   which may be the result of a sequencing error"
FT   gene            151307..152293
FT                   /pseudo
FT                   /locus_tag="BAA_0183"
FT                   /note="glycerate kinase; this gene contains a frame shift
FT                   which may be the result of a sequencing error; identified
FT                   by match to protein family HMM PF02595; match to protein
FT                   family HMM TIGR00045"
FT   gene            152503..153396
FT                   /gene="rocF"
FT                   /locus_tag="BAA_0184"
FT   CDS_pept        152503..153396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rocF"
FT                   /locus_tag="BAA_0184"
FT                   /product="arginase"
FT                   /EC_number="3.5.3.1"
FT                   /note="identified by match to protein family HMM PF00491;
FT                   match to protein family HMM TIGR01229"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49302"
FT                   /protein_id="ACQ49302.1"
FT                   /translation="MKKEISVIGVPMDLGQMRRGVDMGPSAIRYAGVIERIEEIGYDVK
FT                   DMGDICIEREKEVDVNTSLRNLTQVATVCNELASKVDHIIEEGRFPLVLGGDHSIAIGT
FT                   LAGVAKHYKNLGVIWYDAHGDLNTEETSPSGNIHGMSLAASLGYGHPTLVDLYGAYPKV
FT                   KKENVVIIGARALDEGEKDFIRNEGIKVFTMHEIDRMGMTAVMEETIEYLSHTDGVHLS
FT                   LDLDGLDPHDAPGVGTPVIGGLSYRESHLAMEMLAEADIVTSAEFVEVNMILDERNRTA
FT                   TTAVALMGSLFGEKLK"
FT   gene            153645..154466
FT                   /locus_tag="BAA_0185"
FT   CDS_pept        153645..154466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0185"
FT                   /product="conserved hypothetical protein TIGR00159"
FT                   /note="identified by match to protein family HMM PF02457;
FT                   match to protein family HMM TIGR00159"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49558"
FT                   /protein_id="ACQ49558.1"
FT                   /translation="MPFEDTTILKYLSTALDIAVVWFIIYKLILIIRGTKAVQLLKGIT
FT                   VIIVVRMISIFLELRTLYWLTEQVLTWGFLAVIIIFQPELRRALEQLGRGSLFSRTGTH
FT                   EDDEPEMVATAIAKATEYMGKRRIGALITLSKETGMGDYVETGIPLNANVSSELLINIF
FT                   IPNTPLHDGAVIMQGSTIKAAACYLPLSESPFISKELGTRHRAAMGVSEVTDSITVVVS
FT                   EETGQISLTKNGKLHRDLKTEQLKDMLLAEFSANEKTTSSSLWNWRRKRHG"
FT   gene            154459..155949
FT                   /locus_tag="BAA_0186"
FT   CDS_pept        154459..155949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0186"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07949"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47564"
FT                   /protein_id="ACQ47564.1"
FT                   /translation="MDKLMENHWFLKGISLLLACMLFMSATLTEKNTTSGILPFANDAK
FT                   ETLTNYAINVKYDEEKYIVSGIPAEGVKVKLEGPKAAVATAKAKKQFDIPVDLRDSEKG
FT                   TYEVSLKTNGLPDDVKGTVQPSTIKVTLHEKARKYVHVDLKLSNEDQMPAGAILEKSSL
FT                   KPDTVEVVGTKEEIESISSAKAYVDLKGVNKTVTKTPEVTLYNKEGKRLNVRTSPSKIS
FT                   VTLNVATQATANNTEKTVPIAYTKKGSLPEGLAVTNISVEPREVTIAGPKDILDNIQSI
FT                   EGVEVDLSQLTESTTFDTSVLLPKGVTSAKPNQVKVSVGVQKTKQTKTRTIDGISIQKN
FT                   GLSKDVTAQLLSPQDGKISVDISGETSIVDKIIANQITAVINLQNVSPGTKDVAIQVSG
FT                   PSNISIEPKQKSAKVTIVKKENPDKEVQGNGEQPNSNNNQDNQDNQTEKPKNPEPEPNP
FT                   DPDPEKEKEPEQNKDKETSQEPTVDNQKEPEKGANHNG"
FT   gene            155942..157288
FT                   /gene="glmM"
FT                   /locus_tag="BAA_0187"
FT   CDS_pept        155942..157288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmM"
FT                   /locus_tag="BAA_0187"
FT                   /product="phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /note="identified by match to protein family HMM PF00408;
FT                   match to protein family HMM PF02878; match to protein
FT                   family HMM PF02879; match to protein family HMM PF02880;
FT                   match to protein family HMM TIGR01455"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47834"
FT                   /db_xref="GOA:C3PAL5"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3PAL5"
FT                   /protein_id="ACQ47834.1"
FT                   /translation="MGKYFGTDGVRGVANKELTPELAFKIGRFGGYVLTKDTDRPKVII
FT                   GRDTRISGHMLEGALVAGLLSTGAEVMRLGVISTPGVAYLTKALDAQAGVMISASHNPV
FT                   QDNGIKFFGSDGFKLTDEQEAEIEALLDKEVDELPRPTGTNLGQVSDYFEGGQKYLQYI
FT                   KQTVEEDFSGLHIALDCAHGATSSLAPYLFADLEADISTMGTSPNGMNINDGVGSTHPE
FT                   VLAELVKEKGADIGLAFDGDGDRLIAVDEKGNIVDGDQIMFICAKYMKETGQLKHNTVV
FT                   STVMSNLGFYKALEANGITSDKTAVGDRYVMEEMKRGGYNLGGEQSGHIILLDYITTGD
FT                   GMLSALQLVNIMKMTKKPLSELAGEMTKFPQLLVNVRVTDKKLALENEKIKEIIRVVEE
FT                   EMNGDGRILVRPSGTEPLIRVMAEAPTQEVCDAYVHRIVEVVKAEVGAE"
FT   gene            157427..157582
FT                   /locus_tag="BAA_0188"
FT   ncRNA           157427..157582
FT                   /locus_tag="BAA_0188"
FT                   /product="glmS glucosamine-6-phosphate activated ribozyme"
FT                   /ncRNA_class="ribozyme"
FT   gene            157774..159576
FT                   /gene="glmS"
FT                   /locus_tag="BAA_0189"
FT   CDS_pept        157774..159576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /locus_tag="BAA_0189"
FT                   /product="glutamine--fructose-6-phosphate transaminase
FT                   (isomerizing)"
FT                   /EC_number="2.6.1.16"
FT                   /note="identified by match to protein family HMM PF00310;
FT                   match to protein family HMM PF01380; match to protein
FT                   family HMM TIGR01135"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46009"
FT                   /protein_id="ACQ46009.1"
FT                   /translation="MCGIVGFIGEQDAKEILLKGLEKLEYRGYDSAGIAVQAENGVVVY
FT                   KEKGRIAKLREIVDENVAASVGIGHTRWATHGVPSKVNAHPHQSTSKRFTLVHNGVIEN
FT                   YELVKKEYLQDVTFVSETDTEVIVQLMEQQVSTGLSVEEAFRNTLSLLHGSYAIGLLDA
FT                   ENPNMIYVAKNKSPLLVGVGDNFNVVASDAMAMLQVTDQFIELMDKEIVIVMKESITIK
FT                   NLQGETIERAPFTAELDASDIEKGTYPHFMLKEIDEQPLVIRNIIQKYQDENGEIELDQ
FT                   DIRNAILDSDRIYIIACGTSYHAGLVGKQFIEKFAKMPVEVHVASEFSYNMPLLTERPF
FT                   FIYISQSGETADSRAVLVQTNEMGHKALTITNVPGSTLSREADYTLPLYAGPEIAVAST
FT                   KAYTAQLAVLSILAADIAKAKGEVLGFDLTHELGLVANAMIELCDQKEEMDALAKQFLA
FT                   TTRNCFFIGRSVDFYVGLEGALKLKEISYIQAEGFAGGELKHGTIALIENGTPVIALAT
FT                   QEHVNLGIRGNVKEVVARGANPCIISMKGLEMEGDSFVLPAVHEALAPLVAVIPLQLIS
FT                   YYAALHRECDVDKPRNLAKSVTVE"
FT   gene            159940..160749
FT                   /locus_tag="BAA_0190"
FT   CDS_pept        159940..160749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0190"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46817"
FT                   /protein_id="ACQ46817.1"
FT                   /translation="MSIVKNGTLQVIGASIYYEVRGSGPILLLIHGGGGDADKFHNIAD
FT                   HLAKWYTVVTYDRRGHSRSNLVNKNEDYHVHTHSEDAHRLLANLTKEPAYVFGSSSGAV
FT                   IGLDLCIRHPEQVQLLIPHEPVLLQLLSENELKQAINFLEDLKGNHQNEVMKLLSNIDD
FT                   SNSEPSKDMLTERLLGNSTYFTEYEIPGILSYTLNIDALKSLLKPASIQVRPAGGSISR
FT                   ETFPYHCAFNLAEHLGTEFAEFPGHHVGYNTVHHKEFAERLHDVIEN"
FT   gene            161156..161887
FT                   /gene="gntR"
FT                   /locus_tag="BAA_0191"
FT   CDS_pept        161156..161887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gntR"
FT                   /locus_tag="BAA_0191"
FT                   /product="gluconate operon transcriptional repressor"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07729"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49812"
FT                   /protein_id="ACQ49812.1"
FT                   /translation="MTKSMEFLYPEKWLSKASTGDRVASELRMRIIAGVIESGTILSEN
FT                   KIAADFSVSRSPVREALKLLVSENIIRLERMGAVVIGLTEKEIEEIYDVRLLIETFIFE
FT                   RLGKMDTNDLVRELNKIMEMMKIAIKYHDSDEFSYQDLLFHETIIRTIEHSYILMIWNN
FT                   LKPVMESLILLSMRTRFKEKYEDFERIIKNHELYIKAIESKDRALMIEALHQNFDDVQG
FT                   KVEDLWMSQQMLSKGVEQGHE"
FT   gene            161880..162410
FT                   /pseudo
FT                   /locus_tag="BAA_0192"
FT                   /note="gluconokinase; this gene contains a premature stop
FT                   which may be the result of a sequencing error; identified
FT                   by match to protein family HMM PF00370"
FT   gene            162414..163415
FT                   /pseudo
FT                   /locus_tag="BAA_0193"
FT                   /note="gluconokinase (Gluconate kinase); this gene contains
FT                   a premature stop which may be the result of a sequencing
FT                   error; identified by match to protein family HMM PF02782"
FT   gene            163535..164881
FT                   /gene="gntP1"
FT                   /locus_tag="BAA_0194"
FT   CDS_pept        163535..164881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gntP1"
FT                   /locus_tag="BAA_0194"
FT                   /product="gluconate permease"
FT                   /note="identified by match to protein family HMM PF02447;
FT                   match to protein family HMM PF03600; match to protein
FT                   family HMM TIGR00791"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48960"
FT                   /protein_id="ACQ48960.1"
FT                   /translation="MPLVIVAIGILALLLLIMRFKLNTFISLIIVSVGVALALGMPPEK
FT                   IFKTIEAGLGGTLGHLALVFGLGAMLGKLLSDSGGAQRIAMTLVKKFGEKNIQWAVVTA
FT                   SFIIGIALFFEVGLVLLIPIVFAISRELKVSILYLGISMAAALSVTHGFLPPHPGPTAI
FT                   AGELHANIGEVLLYGFMIAVPTVVLAGPVFTKLAKKLVPEAFTKTGNIQSLGEQKVFKL
FT                   EETPGFGISVFTALLPVLLMAVATIITLLQKTMGFKDNSLLATIEFIGNADTAMLISLL
FT                   VAIYTMGLARNIPIKSVMESCTTAISNIGMMLLIIGGGGAFKQVLIDGGVGNYVAELFK
FT                   GTSLSPILLAWIIAAILRISLGSATVAALTTVGLVIPMLGQSDVNLALVVLATGAGSLI
FT                   ASHVNDAGFWMFKEYFGLSMKETFATWTLLETIVSVAGLGFTLLLSLFV"
FT   gene            165146..166555
FT                   /gene="yqjI"
FT                   /locus_tag="BAA_0195"
FT   CDS_pept        165146..166555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqjI"
FT                   /locus_tag="BAA_0195"
FT                   /product="6-phosphogluconate dehydrogenase,
FT                   decarboxylating"
FT                   /EC_number="1.1.1.44"
FT                   /note="identified by match to protein family HMM PF00393;
FT                   match to protein family HMM PF03446; match to protein
FT                   family HMM TIGR00873"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48427"
FT                   /protein_id="ACQ48427.1"
FT                   /translation="MENLQIGVVGVGVMGKSLALNFESKGYSVALYDISKEKVDETIEE
FT                   NRGKNLVGTHIVEEFVNSLESPRKILLMVNAGEITDKAIDSLVPHLDKGDILIDGGNTY
FT                   FVDTIRRNKRLAEEGINFIGAGVSGGEEGALKGPSIMPGGQKDAYEKVKDMLENISAKV
FT                   NNEPCCSYIGPNGAGHYVKMVHNGIEYGDMQLICEAYFFLKQTLDLTAEEFHEIFAEWN
FT                   KGELNSYLIEITADIFKKKDEETGKPLVDVILDTAGQKGTGKWTSQSALDLGISLPIIT
FT                   ESVFARCISALKEERVNASKVLSGPKDKTAIGVEKAELIEAVRQALYMSKICSYAQGFT
FT                   QLKAASEEYNWNLDFGSISMLWRGGCIIRAAFLQNIKEAYETNTDLPNLLLDPYFKEIV
FT                   ESYQGGLRQIISMAVQQGIPIPAFSAAISYYDSYRTAKLPANLLQAQRDYFGAHTYKRV
FT                   DKEGTFHTKWI"
FT   gene            166898..168862
FT                   /locus_tag="BAA_0196"
FT   CDS_pept        166898..168862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0196"
FT                   /product="putative prolyl oligopeptidase family protein"
FT                   /note="identified by match to protein family HMM PF00326;
FT                   match to protein family HMM PF07676"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50057"
FT                   /protein_id="ACQ50057.1"
FT                   /translation="MKVSEKTYLSIEEIISLPTVSSTNISDDGKNVAFVKRTANWEDNT
FT                   YRNHVWIYEKDKGKSYPLTTGDIDSIHPLWSPDSKSIAYLSSGGDGDMKNQIFVKSLDD
FT                   YSKVKITDEKEGISNFKWDPTGKGFYYITQSKECEEIKKRKELYGDFQHVGKEHQNNCL
FT                   CYIEMEKVIQNDKEEREINGVYQLTGGKDFYIHGFDISDNGKKVVCMATPSLNDHMNGD
FT                   LYILDVEARELQQMNVDKLLGGSACFSPEGNKICYSASIREKEYYRNHIQESTLEIYDM
FT                   NTGEVIQPLTNFDSMVMPLQWTAKGILIRWQDKTNYFIGLLAEDGTVETLREKVDGFIM
FT                   DASITRDGNHITYNKAITNETFEIYLDDKKITNENSLFEGKLKSNREIISWRSSDGLEI
FT                   EGVLSTPVEFDANKKYPLLVVIHGGPAWASFPIFSNCFNEKYPIEQFVEKGFIVLEPNY
FT                   RGSSGYGNEFLKANYRKQGLADYDDVISGVDELVEKGMVDKDRVGVMGWSNGGYISAFC
FT                   STFSSRFKAISVGGGITNWSTHYVNTDIPYFIRMYLGNTPWNDPDIYKRTSPMTYIKSA
FT                   CTPTLIQHGEKDARIPITNAYELHQGLKDMEVDTELIIFKGMAYSSDQPGVHVAIMKQN
FT                   LMWFSHYILGESMEDFSTI"
FT   gene            168981..169547
FT                   /locus_tag="BAA_0197"
FT   CDS_pept        168981..169547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0197"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49363"
FT                   /protein_id="ACQ49363.1"
FT                   /translation="MTENKNELSVEQREELLKVLQARFEKNMNRHEGLEWAKVETKLAT
FT                   NNEKLWTLNEMEVTGGEPDVVGYDEEKDEYTFYDCSKESPKGRRSLCYDLEALESRKKH
FT                   KPENNAIDVAAAMGIELLTEQQYRELQKLGDFDMKSSSWVQTPSDIRELGGALFCDYRF
FT                   GHVFVYHNGADSYYAARGFRGSLRV"
FT   gene            complement(169619..170125)
FT                   /locus_tag="BAA_0198"
FT   CDS_pept        complement(169619..170125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0198"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04173;
FT                   match to protein family HMM PF07681"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46176"
FT                   /protein_id="ACQ46176.1"
FT                   /translation="MVINFLRTDKRAAFILLFLRLYIGYTWLAAGIGKVFGQSFDASGF
FT                   LKGAIAQASGDHPAVQSWWADFLQHFVLPNADLFSFLVQWGEILVGLGLILGGLTKTAA
FT                   FFGIIMNLAFLLSGTVSVNPNLLILTMFILVAGQNAGRIGLDGYVFPKLFRKNSHGTYK
FT                   LSKTA"
FT   gene            complement(170366..171280)
FT                   /locus_tag="BAA_0199"
FT   CDS_pept        complement(170366..171280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0199"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50344"
FT                   /protein_id="ACQ50344.1"
FT                   /translation="MDTSLKNALKKAQRKQLLKIIITSILVVIILIPIIYKVGNYFAAK
FT                   GSMRLHEQLFLYNSIAEPNVQIDSQVTSSSSMFGGNITSNRSKNINGYVVKWNTLTSPY
FT                   NWFRSNIDYNEVIPGTHWGRSNTESYNYDKQTKNKVATFYNPAIKEYYDGVKNELSAVS
FT                   KMENYVAEVAISFDQPYTLKEIQTKIPDNLNIVWLYMVSPIRDESGGPAGMPVYGFEPG
FT                   TPLEESYKGFFDSLKQYNDGYDKDIQKFLKSNENKPFDQVKILGVMLTGKTENFKALEN
FT                   QNFIRGASVGVTAQIVPYIKPEK"
FT   gene            complement(171280..171771)
FT                   /locus_tag="BAA_0200"
FT   CDS_pept        complement(171280..171771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0200"
FT                   /product="RNA polymerase sigma-70 factor, ECF subfamily"
FT                   /note="identified by match to protein family HMM PF04542;
FT                   match to protein family HMM PF04545; match to protein
FT                   family HMM PF08281; match to protein family HMM TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47299"
FT                   /protein_id="ACQ47299.1"
FT                   /translation="MGKENILTSYLINLGEEVFKLLLAKGAIKEDAEDIIQNTFYKVYT
FT                   LLDDLTENNIRPWFFRVALNEYIDLKRKKEQQNIYLTEEIYSKLQYTDRELDAVLNKDE
FT                   IFYLLKDIKLEYKEAFFLKYYYDFTYEEIALILDIRVNSVKQKLHRARKTIHSTVGGKP
FT                   "
FT   gene            complement(171912..172874)
FT                   /pseudo
FT                   /locus_tag="BAA_0201"
FT                   /note="putative lipoprotein; this gene contains a frame
FT                   shift which may be the result of a sequencing error"
FT   gene            complement(172871..173212)
FT                   /pseudo
FT                   /locus_tag="BAA_0202"
FT                   /note="group-specific protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error"
FT   gene            173625..173753
FT                   /pseudo
FT                   /locus_tag="BAA_0203"
FT                   /note="oxidoreductase, short chain dehydrogenase/reductase
FT                   family; this gene contains a premature stop which may be
FT                   the result of a sequencing error"
FT   gene            173793..174428
FT                   /pseudo
FT                   /locus_tag="BAA_0204"
FT                   /note="oxidoreductase, short-chain dehydrogenase/reductase
FT                   family; this gene contains a premature stop which may be
FT                   the result of a sequencing error; identified by match to
FT                   protein family HMM PF00106"
FT   gene            complement(174466..175134)
FT                   /locus_tag="BAA_0205"
FT   CDS_pept        complement(174466..175134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0205"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49518"
FT                   /protein_id="ACQ49518.1"
FT                   /translation="MENKSFLDEWGKVIWEATIQTFQMTSISLFISILIALPLGVTLVL
FT                   TRPGGQHENKIIYSILNTIINIIRSLPFIILLFFILPFTKFLMGTSIGVQGVIVPLVVF
FT                   TAPYIARLMETALLEVDRGVIEAYQAMGVSTIQIIWHVMVKEARPSLVLGLTIATIGLI
FT                   GATAMAGLVGAGGLGDLAYRFGHLRYEPEVMYATVFILIILVQGLQSLGNGIARRLKKD
FT                   "
FT   gene            complement(175109..176149)
FT                   /locus_tag="BAA_0206"
FT   CDS_pept        complement(175109..176149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0206"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF09383"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48054"
FT                   /protein_id="ACQ48054.1"
FT                   /translation="MIELKNVSKVFTTKKGNVEALKSTSLQVKKGEVFGIIGYSGAGKS
FT                   TLIRCVNLLEKPTTGNIIVNEQDLTTLSTKELAKARQKIGMIFQGFNLLKTVTVYENIA
FT                   LPLRLAGVPKLEIEKRVEKYLRIVDLFNRKDAYPSELSGGQKQRVAIARALSHEPEVLL
FT                   SDEATSALDPETTDSILDLLLKINEEIGITILLITHEMNVIQRICDRVAVMEHGAVVES
FT                   GTVKDIFTNPQHVTTKKFVNSAFAAKIPAEVQKELQRTGEIVTLSFIGNSSGEPALAVA
FT                   TKRFQVYPNILSGNITQLKHEAYGKLVIHMQGEQNEINHALSFLQEQGIIVEGGRTDYG
FT                   KQVLFG"
FT   gene            complement(176162..176974)
FT                   /locus_tag="BAA_0207"
FT   CDS_pept        complement(176162..176974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0207"
FT                   /product="putative ABC transporter, substrate-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF03180"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47410"
FT                   /protein_id="ACQ47410.1"
FT                   /translation="MKKVLLSIVSGAVLLLGACSAGSDKEVKALDEKKITVGVTGGPHE
FT                   QIFEKVKEVAAKDGLEIDVKVFNDYVAPNVSLDEKSLDVNSYQTKSYLDVFKAERNMKL
FT                   TEVFSTVTFPMGVYSKSLKDVKDLKDGDAIAVPNDPTNELRALKLFEKAGVLKVDPKAT
FT                   EKATAKDVIENPKNLKIVELEASQLPTQLSEVKAAAINTNFALGAKLSPAKDSIFREGK
FT                   DSPYVNWVVVRTENKDDAVVNKLKKAYQSKEVKEFIEKKFDGSVLPSW"
FT   misc_binding    complement(177060..177174)
FT                   /bound_moiety="S-adenosyl methionine"
FT                   /note="SAM riboswitch (S box leader)"
FT   gene            complement(177254..178162)
FT                   /locus_tag="BAA_0209"
FT   CDS_pept        complement(177254..178162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0209"
FT                   /product="oxidoreductase, zinc-binding dehydrogenase
FT                   family"
FT                   /note="identified by match to protein family HMM PF00107;
FT                   match to protein family HMM PF08240"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46557"
FT                   /protein_id="ACQ46557.1"
FT                   /translation="MKAIICTQYGPPNVLQLQNIEKPIPKKNEVLVKIHATSVSTGDCR
FT                   IRGFNSPLLFWIPMRLILGLRKPRNPILGVELAGEIEDIGTDVTQFKKGDQIFALTELN
FT                   LGGYAEYTCVHESGLITLKPTNVTYEEAAVIPFGGTSALHFLRKSRIKKGQQVLIYGAS
FT                   GSVGTAAIQLAKYFGATVTAVCSNSNFELVQSLGADKVIDYTKEDFTKRRERYDIIFDA
FT                   VGKHKKSLCKQVLAPNGKYVSVNGMMAKVSKEDMILLKKLTETEHLKPVIDRTYRLEEI
FT                   AEAHMYVEIGHKKGNVSITLK"
FT   gene            178308..179072
FT                   /locus_tag="BAA_0210"
FT   CDS_pept        178308..179072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0210"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46024"
FT                   /protein_id="ACQ46024.1"
FT                   /translation="MKKIIFVSSLVLAISLGVGCSNEKTAKTDEPKKESVQKEKELTAK
FT                   DVFKKTNEAFKNEEHVTMTYGVGVKAEGTEMDIVKAKMQLEPKTKNSRSEMNISGTDVV
FT                   VYTVDGKVAGEVKKPNTGEVITVPEEQLNAGGMKATQDIIDKLEVPEVVLDKMKLEKSG
FT                   DKYKLKFTLKGQETESMLTSMDETQKKMLQAQNAKIEEVDAEYIITKDFKYESAKIDMI
FT                   MSSNGKDKAHIITNAKYTSYEKFDPIQLPAAK"
FT   gene            179184..180620
FT                   /locus_tag="BAA_0211"
FT   CDS_pept        179184..180620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0211"
FT                   /product="oxidoreductase, FAD-binding"
FT                   /note="identified by match to protein family HMM PF01565"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50881"
FT                   /protein_id="ACQ50881.1"
FT                   /translation="MKKGKIAVVTVAYTVLLATSVHTYKKQLDHPIMSDVGKLLPTKIK
FT                   RVESATDEHSLIKLVQDANVSGEKISIAGMQHSQGGQTYYPHGTMLDMKGYNKILEFDP
FT                   EKKRITVQSGVTWNDIQKKVNPYGLAVQVMQSQNIFTVGGSLSVNVHGRDIRHEALIDT
FT                   VESFRLLMADGIVRNVSREENADLFPYVIGGYGLFGVILDVTLKLTNDELYETHTKMLD
FT                   YKEYTSYFKEKVKKDANVRMHLARISVAPNSFLREMYVTDYTLAQNQNMREEYSELKEE
FT                   TIIAAPKFLLGLSRYSDWGKNTFWDIQRSYFERTDGKYETRNNVMRSDSTFMEYENPNR
FT                   TEVLQEYFVPIDSFTEYIDDLRNVLNEEEFNLLNITIRYVEKNENAVLSYAKDDMFALV
FT                   LLINQGRSENEIKKTEGVIQKMIDVTLKHNGSYYLPYYSYPTKEQLKRAYPRIEEFLGK
FT                   KKEADPKERFVNLFYREYTK"
FT   gene            180617..181150
FT                   /locus_tag="BAA_0212"
FT   CDS_pept        180617..181150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0212"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50121"
FT                   /protein_id="ACQ50121.1"
FT                   /translation="MTYRRFVASQSIIMMAGSMVFPFYILLLRNVGNSFSQFGWAYGLF
FT                   ALTSALVYPLVGKLSDRVGDQKLLIIYAWTMAILMLCFPIATEVWHVYILQILMGVLGA
FT                   VQRNTEKTSLARKVVQENAGYEIGKYHVWTSIGGAVAIIATGYLVDFFTIGTIFYIASI
FT                   LYVVSGVVLSSKKI"
FT   gene            181229..182950
FT                   /locus_tag="BAA_0213"
FT   CDS_pept        181229..182950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0213"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47189"
FT                   /protein_id="ACQ47189.1"
FT                   /translation="MKFLILAILTLFLIPWTRRSGSKLRAVDKKGDEKVVKGKKSSILV
FT                   IPVLFWIGIAIYEYFWLIDDRADSILTHYSVAVAILIGLVLFSQDQIGKLEGTLKGLLM
FT                   FVLLASYGYFGYLHDIVISQTKYDSVVKIEKDISEPFTENDQPFTVPPKTAENKMKKVF
FT                   GDIPKVAYFELGELTPQMVNGEALYVAPIEVSGFFKARKAETIPGYVTMSGTNPDAEAK
FT                   LHLGYKMKYVPSMFFGNNLERVVRQAEPNLIFKGKPKLEVDDKGKPYYTMTYGEFISGR
FT                   SGFEIEGVVVVDAQTGEVKRYDKGKAPKFIDGVLNHETASTLNTYFGKYIHGFWNTKFS
FT                   QTDMKIPTEWGTKEGVTPIFGKDGTLYYFTDFTSPKEGVDSALGYSLIDARTGKLYYYN
FT                   GKEVKGIMDGSAASEVVDNSFKREKWHGTMPVIYNVYGKPSWIVPVIDDGGLVRAHTVI
FT                   YASNAKIFATGSTQKEALENYKNALSGSGDSFRPTSSSKEAQKEGVVQRVYKEKTGENT
FT                   IVYVLLENEQKVFMIPAKKFPYAMFTEVGDPIQITYLDTGEAMSSVSKFTNSNLNK"
FT   gene            183132..184328
FT                   /locus_tag="BAA_0214"
FT   CDS_pept        183132..184328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0214"
FT                   /product="drug resistance transporter, Bcr/CflA family"
FT                   /note="identified by match to protein family HMM PF07690;
FT                   match to protein family HMM TIGR00710"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48088"
FT                   /protein_id="ACQ48088.1"
FT                   /translation="MILVLGTLTAIGPLSIDMYLPSLPKLTDDLQTGASLAQLTLTACL
FT                   LGLSVGQLFVGSISDIYGRRKPLIIALIIYVASSLLCAVAPSIWTLVLLRFLQGASGSA
FT                   GIVISRAMVRDMYSGSEMTKFFSLLMLVNGAAPILAPIIGGQLLQFTTWRGVFIVLGAI
FT                   SVFMLISATFVLRETLPPEERETGGLSGTLATYGKLLKDRLFMGYALSQGLVTAAMFAY
FT                   ISGSPFVLQNIYGASPQQFSLFFAINGIGIIIASQVTGRLAGKVNEKTLFVSGIVIAAV
FT                   GGLSLLLTILLGIGLIGVLCSLFLVVSSVGVVSTTGFSLAMRNQKQAAGTASALLGLLQ
FT                   FISGALVAPLVGIGGSNTALPMGIVIALCEIGAVLCYLFMARRSEKQFELQARQNLEV"
FT   gene            184579..185079
FT                   /locus_tag="BAA_0215"
FT   CDS_pept        184579..185079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0215"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46382"
FT                   /protein_id="ACQ46382.1"
FT                   /translation="MKKALGIAVMGSMILLAGCNGSKDTKEPKEKVEQSTEQTEEMKEY
FT                   RAVHEKYDLKMNKEINNALQLFEVAKEKGGKEITTATYKEDVQKVTTSMLEDIDHIRKE
FT                   IRVPKSKEQEHEVYVGFLNESEQAMKKLQKLAKEDSSLIRDIEINFATASTYYKRFQAE
FT                   TKK"
FT   gene            complement(185096..185311)
FT                   /locus_tag="BAA_0216"
FT   CDS_pept        complement(185096..185311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0216"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46904"
FT                   /protein_id="ACQ46904.1"
FT                   /translation="MDPLLLATIGLPLTIVILVIIGFYKLFIKKKSITSFYTPFDNITG
FT                   QTISEFHEEQKVLVSEDEDGDGKKKK"
FT   misc_binding    185484..185589
FT                   /bound_moiety="S-adenosyl methionine"
FT                   /note="SAM riboswitch (S box leader)"
FT   gene            185720..186643
FT                   /locus_tag="BAA_0218"
FT   CDS_pept        185720..186643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0218"
FT                   /product="oligopeptide ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50298"
FT                   /protein_id="ACQ50298.1"
FT                   /translation="MEVYVIKKLSVMVFTLWVITTVTFLIMHIIPGDPFSSDAKIFPEE
FT                   VIQNMRAKYHLDEPLWNQYVAYLDGVVHFDFGESVQSTGQGVSEIITTGFGPSAIIGLQ
FT                   ALIISLLVGIAAGTFAALYHGKVIDYSVSLLAILGISIPSFILAPLFIQVFAIQFELLP
FT                   VASWGTFEHTVLPSFALALGPIAVITRFVRSNMIEVLQSDYIKLARAKGIPIKKIIIRH
FT                   ALRNAIVPVLTFVGPLMAGLLTGTFVIEKIFSIPGLGKYFVDSIFNRDYPVIMGTTIFY
FT                   SALLILCIFITDIIHRIVDPRIRSIT"
FT   gene            186660..187664
FT                   /locus_tag="BAA_0219"
FT   CDS_pept        186660..187664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0219"
FT                   /product="oligopeptide ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49870"
FT                   /protein_id="ACQ49870.1"
FT                   /translation="MGAYEINNQLLTNEEKKELTINKDQQKISRKKEVFRKFVSNPIAV
FT                   LGSVTLLLIIVFSLIGESLTPFTASEQVKKATNLPPSSEHWFGTDDLGRDIWARTWAGG
FT                   KISLTVGLVAAALDIGLGVLIGGFSGYVRGRNCLGTLIDEWIIRGIEVLYGIPYLLIVI
FT                   LLLIVMKPGLFTIIIALALTGWIGMARLIRAQVLSLKQREFVIAAERLGTSHMKIIYGH
FT                   LIPNLTGIIIVNLSFTIPAAIFSESFLSFIGLGVQSPAASWGTMTNDALGTLLSGEWWQ
FT                   LFFPAIMIALIMFAFNAIGDGLQDAIDPKIIKRNRKEKKHGASLIFRKRNISR"
FT   gene            187621..188631
FT                   /locus_tag="BAA_0220"
FT   CDS_pept        187621..188631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0220"
FT                   /product="oligopeptide ABC transporter, ATP-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF08352; match to protein
FT                   family HMM TIGR01727"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50428"
FT                   /protein_id="ACQ50428.1"
FT                   /translation="MAQVLSLENVTLAVEKENSKQAIVKHVSFFINEGEIVALVGESGS
FT                   GKSVTAQSIIGLNQESIQFDDGNISFESKDLTNLQESEWNQIRGKDISFIFQDPLSSLN
FT                   PTMKVGRQITEVILQHEKKSKKEAKEIAINLLNDLGIHEAEKRFEQYPHQLSGGMRQRI
FT                   CLAIAFACHPKLVIADEPTTALDVTIQKQIMGLLKERKEKQNTSILLITHDLALVREVA
FT                   DRVVVMYGGRIVEKGTIQEVIGSPKHPYTKSLLQAIPNMDDAEKVLRAIEGTTPSIETL
FT                   NSFGCPFVNRCPVAIQECIHRFPERTTYSAEHSSHCWQHVLEHDRAKSKEKVNVS"
FT   gene            188628..189401
FT                   /locus_tag="BAA_0221"
FT   CDS_pept        188628..189401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0221"
FT                   /product="oligopeptide ABC transporter, ATP-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48471"
FT                   /protein_id="ACQ48471.1"
FT                   /translation="MTTDLITVKQVTKTYGSKNKEIAALKDISLAIPKGTTLGIIGESG
FT                   SGKTTLGKLIAGIESPTSGEIDYNGQVVHKLKAAHKRDFLQKVQFIFQDSTAALNPRWK
FT                   VRDSVTEGYISFGLGDKGLKDKVAGDALERVGLDRRYINRYPHEFSGGQRQRIAIARAL
FT                   LCEPEVLILDEPISALDVSLQIQIVHLLQKIQREQGYTYLFIAHDLPMVHYLCEKVAVL
FT                   YKGELVEFGNTDEVFRNPQHSYTKTLLASTPKISG"
FT   gene            189415..191025
FT                   /locus_tag="BAA_0222"
FT   CDS_pept        189415..191025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0222"
FT                   /product="oligopeptide ABC transporter,
FT                   oligopeptide-binding protein"
FT                   /note="identified by match to protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49312"
FT                   /protein_id="ACQ49312.1"
FT                   /translation="MKKFLLFVIMTVLAITSVACGKKETQKASAGKGEGDRLVTNISSD
FT                   PYTLDAAISTDSTSGYVIGHLFSSLYTQDSDGKYQNELAEKEEVNADGTEYTIHLKKDI
FT                   KWSDGSPITANDFEFAWKRLLNPKTGSMNATEMYFIKGAEAYNTGKGEEGQVGIQVVDP
FT                   QTLKITLEHPVSSIKQKLASSLFIPLSKKSIDDNNKLKTNPKELITNGPFTLKEWKHNQ
FT                   AITVQKNKEYYDKKVTLKEIEFRIIPDSKTAYQLYKSKELDLLSGLPQEMIEKEKGNKE
FT                   YKRVAGFSSYIYSFNVEKEPFTNAKVRKAFSLAVDRKFIVEKLYKNNAQEAYAFVPEGA
FT                   KTQGGRDFRKEKGDYVKFDPEEAKKLLEEGMKEQGWSTLPAVTLKFTTDTQHKKVAEAM
FT                   QEMFKKNLGVDIKLENKEWKSYIDTYKQSDFQLAYMGWGGSLLDPITKLDLYAGDGLNN
FT                   YAKWHNKEFDALVKEAEVEQNEDKRFDLLHKAEDIMFTDSPLIPIIFPSDSYLQKESVS
FT                   GLQYYVGSKPDLRYVKIKK"
FT   gene            complement(191042..191509)
FT                   /locus_tag="BAA_0223"
FT   CDS_pept        complement(191042..191509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0223"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47643"
FT                   /protein_id="ACQ47643.1"
FT                   /translation="MRTLLSVLLALMLVPALTGCKAPAKEDTTSNKKTTEEAKNETPAD
FT                   LKLNFNEFSLDADYQDTKKDYEADYKNVAADKKMEAKIEDHKADVNLTGDEAITKLSPL
FT                   LQELKFDKGTPDQEVIDQVLNVFKLDKDYQKFELEVVFSDGTKKEYKREIK"
FT   gene            191681..192580
FT                   /locus_tag="BAA_0224"
FT   CDS_pept        191681..192580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0224"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47071"
FT                   /protein_id="ACQ47071.1"
FT                   /translation="MHEEYKEMIKKAIEYIENHLHEELTTERVASHSAVSMYHFHRIFQ
FT                   RYIGMSVTDYIRKRRLTHAAQVLVSTERAVIDIAMQYGFSSQEAFTRAFKRMFQLPPKK
FT                   YRKYFQSFYIEREGVSMQKGIPKGWILSGSHPAEYEMGLDYEVVHQGKVSAYIKAKENV
FT                   THGGFSTLMQMFRADKYVGKRLRFTAFVKSENVRDWAGLWMRVDGKETEPFAMDNMQNR
FT                   PIKNTNNWQSYSVVLDIKEGALGIAFGVLLSGEGCVWLDSIRFDEVDEKIPTTDLAENF
FT                   YETLLEEPVNLQFEEVEK"
FT   gene            192653..192790
FT                   /locus_tag="BAA_0225"
FT   CDS_pept        192653..192790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0225"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50015"
FT                   /protein_id="ACQ50015.1"
FT                   /translation="MGINYLVSYIWSGHTPSLTWKTYLMFLFIFMMSFSSMQKEGEEDY
FT                   "
FT   gene            192923..193135
FT                   /pseudo
FT                   /locus_tag="BAA_0226"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            complement(193180..194820)
FT                   /locus_tag="BAA_0227"
FT   CDS_pept        complement(193180..194820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0227"
FT                   /product="putative oligopeptide ABC transporter,
FT                   oligopeptide-binding protein"
FT                   /note="identified by match to protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50818"
FT                   /protein_id="ACQ50818.1"
FT                   /translation="MKKKVVPVVASVLGASLLLTACGGNKDNASGAKANDKAPDKQAIN
FT                   LSFASEIPTMDVAKATDGESMNVMRNVFEGLYAMGEDNKPIPGVAESVDVSADKTKYTF
FT                   HLRDSKWSNGTPVTAKDFVFAWQRAVNPDTAAEYAFLFFDIKNAKQINQKQLPVDQLGI
FT                   KAVDDKTLEVQLDRPVPYFLSLTTFSTFLPINEEYLKSQGDKYGLETNHLIYNGAFTLD
FT                   NWKHEQSFQLKKNPNYWDAKTVKLEEINFNVVKDKSTEVNLYDSGQIDRVALTAEFVDK
FT                   YKGDPNFKERAEVGIQFLRLNQKNETLKNQHARLAINGAMNKKAYVETILNNGAVPAEG
FT                   MIPAKFAKSPDGNDFRKENGNLVKDDVKTAKENWKKAKQELGTDKVTIELLTSDNALAK
FT                   KTGEYLKGELEKNLDGLTVNLKPQPRKQQLKLLLSGDYEIGIDGWGPDFADPITFLDLF
FT                   TTDSAYNFDKYSNKEYDELIHKVKTDLAGDEKARFEAMKQAEKILLQDGAVAPLYQQGR
FT                   SYLQRSFIKGLVTTDFGGEFNYKWTEVAK"
FT   gene            complement(195208..196848)
FT                   /locus_tag="BAA_0228"
FT   CDS_pept        complement(195208..196848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0228"
FT                   /product="putative oligopeptide ABC transporter,
FT                   oligopeptide-binding protein"
FT                   /note="identified by match to protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49228"
FT                   /protein_id="ACQ49228.1"
FT                   /translation="MKKKFVPGIASVVGVSILLTGCGSYKNEASGANAKDEAPSKQVLN
FT                   LSSPTEIRTMDTARATDTDSGQVMRNVFEGLYNLGEGNKPIPGVAKSHEVSGDKTKYTF
FT                   HLRDSKWSNGTPVTAKDFVFAWQRAVDPATASEYAFLFFDIKNATKINNKELPADQLGV
FT                   KAVDDHTFEVELERPVPYFISLTAFPTFLPINEEFFKAQGDKYALEDNTILYNGAFTLS
FT                   DWKHEQSFKFKKNPTYWDKDTVKLEEINFNVVKEKSTEVNLFESKQLDRIKLTSDFVDK
FT                   YKKDANFKERPNVGVQFLRMNQQNKVLQNVSARQAIDQTIDRKSFVNTLLNDGSTPTFG
FT                   LVPKNFAKGPDGKDFRTINGDLTKVDTKSAQELWKKAKQELGSEKITLELLTSDADLDK
FT                   KTGEFLKGQLEKNLDGLTVNVKPQPRKQQVSLLLKGDYEIGIDGWSPDFADPITFLELF
FT                   TTNNPYNLDHYSNKEFDKTIEKVKTTLAGDEKARWEALLASEKILFKDSVIAPLYQKGE
FT                   SYLERSYVKGIVQVDFAGQLNFKWAQIEK"
FT   misc_binding    complement(196981..197087)
FT                   /bound_moiety="S-adenosyl methionine"
FT                   /note="SAM riboswitch (S box leader)"
FT   gene            complement(197240..198073)
FT                   /locus_tag="BAA_0230"
FT   CDS_pept        complement(197240..198073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0230"
FT                   /product="oxidoreductase, aldo/keto reductase family"
FT                   /note="identified by match to protein family HMM PF00248"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49644"
FT                   /protein_id="ACQ49644.1"
FT                   /translation="MSLTSLKDYTTLHNGVKMPWFGLGVFKVEDGSQVIDSVKAAIKNG
FT                   YRSIDTAAIYQNEEGVGQAIRESGVSREELFITSKVWNSDQGYETTLQAFETTLEKLGL
FT                   EYLDLYLVHWPVKGKYTESWKALEKLYKDGRVRAIGVSNFHIHHLQDVFEIAEIKPMVN
FT                   QVEYHPRLAQEELHAFCKEHNIQLEAWSPLMQGQLLDNPTLQDIAKKYNKSTAQIILRW
FT                   DLQNEVVTIPKSIKEHRIIENANIFDFELSSDDMKAIQALNEDHRVGPDPDNFNF"
FT   gene            complement(198141..198878)
FT                   /pseudo
FT                   /locus_tag="BAA_0231"
FT                   /note="pyrroline-5-carboxylate reductase; this gene
FT                   contains a premature stop which may be the result of a
FT                   sequencing error; identified by match to protein family HMM
FT                   PF01210; match to protein family HMM PF03807"
FT   gene            199066..199716
FT                   /locus_tag="BAA_0232"
FT   CDS_pept        199066..199716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0232"
FT                   /product="nucleoside transporter, PnuC family"
FT                   /note="identified by match to protein family HMM PF04973;
FT                   match to protein family HMM TIGR01528"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48334"
FT                   /protein_id="ACQ48334.1"
FT                   /translation="MIRSPLFLLITSIICVLVGLYIQSSYIEIFASVMGIINVWLLARE
FT                   KVSNFLFGMITVAVFLYIFITQGLYAMAVLAAFQFIFNVYGWYHWIARSGEEEVKATVR
FT                   LDLKGWIFYIIFILVAWIGWGYYQVHYLESTSPYLDALNAVLGLVAQFMLSRKILENWH
FT                   LWILYNVVSISIYISTGLYVMLILAVINLFICVAGLLEWKNNYKGQKHTNNYI"
FT   gene            complement(199784..200635)
FT                   /locus_tag="BAA_0233"
FT   CDS_pept        complement(199784..200635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0233"
FT                   /product="putative transporter"
FT                   /note="identified by match to protein family HMM PF06800"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46011"
FT                   /protein_id="ACQ46011.1"
FT                   /translation="MGILLALLPAIAWGNILLVSVKMGGGAYSQTVGMTIGALFFATIM
FT                   YVFTQPALTMTILIVGFISGLFWALGQVNQLKTVEKLGVSTTVTISTGMQLVATSIFGV
FT                   IAFREWTTTTTIILGTIAILLIVVGVVFTSLDDKENAQPPGQLKKGLLTLIVSTFGYLV
FT                   YVIIIRWYNIDGWSAILPQAVGMFVGAVVLTSKHKPFNKYAIRNALSGLLWGTGNLFLL
FT                   LSLPRVGVATSFPLSQTGIVISTFGAIVFLGEKKTKRQLIFIALGSVLIIGGAVLLGMT
FT                   KA"
FT   gene            complement(200922..201611)
FT                   /gene="modB"
FT                   /locus_tag="BAA_0234"
FT   CDS_pept        complement(200922..201611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modB"
FT                   /locus_tag="BAA_0234"
FT                   /product="molybdenum ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR02141"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46564"
FT                   /protein_id="ACQ46564.1"
FT                   /translation="MSFDIILSPIFLSLRVAACATIIVTILGTIIGRALARSSWRYKVI
FT                   LETIFLLPMVLPPTVIGFFLIIIFGNNSPIGMWIESIFQQSIMFTSTAAIIASTVVAFP
FT                   LMYQSAKTGFSIANVQIEESARDLGASEYQVFLHVTLPLAFPALLSGMILSFVRALGEF
FT                   GATLMFAGNIPGKTQTIPTAIYMAIDASNMQLAWTLVVITISMSLLFLLCIQLINKRIT
FT                   NSSGSFF"
FT   gene            complement(201617..201862)
FT                   /pseudo
FT                   /gene="modA_1"
FT                   /locus_tag="BAA_0235"
FT                   /note="molybdenum ABC transporter, molybdenum-binding
FT                   protein; this gene contains a frame shift which may be the
FT                   result of a sequencing error"
FT   gene            complement(201856..202422)
FT                   /pseudo
FT                   /gene="modA_2"
FT                   /locus_tag="BAA_0236"
FT                   /note="molybdate ABC transporter, periplasmic
FT                   molybdate-binding protein; this gene contains a frame shift
FT                   which may be the result of a sequencing error; identified
FT                   by match to protein family HMM TIGR01256"
FT   gene            202584..203504
FT                   /locus_tag="BAA_0237"
FT   CDS_pept        202584..203504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0237"
FT                   /product="putative molybdopterin biosynthesis protein"
FT                   /note="identified by match to protein family HMM PF05930;
FT                   match to protein family HMM TIGR01764"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50629"
FT                   /protein_id="ACQ50629.1"
FT                   /translation="MDHHSYTTEEVAKRLKVSKLTVYDLIKKGELPSYRVGRQMRIDAA
FT                   DLEQYIKQMKTGKVQVTPVKNDSNSISNTCIISGQELTLDMLAKRIENRLPSSNILRAY
FT                   QGSLTSLVKMYQGEGSIVSLHLFDGETGTYNVPYVKRILVGQPCTMINLLSRNVGFYVQ
FT                   KGNPKNIKTWADLSQSSIRFVNREKGSGIRVLVDEQLRIQNLNKERISGYEWEESNHLG
FT                   VATQVANEKADVGVGSEKFSQIVNVDFIPIMKEQYDLVILKNKENEELIEVVKDILQSE
FT                   EFHNELKAIGGYDMTKTGQIIYEIK"
FT   gene            complement(204077..204943)
FT                   /locus_tag="BAA_0238"
FT   CDS_pept        complement(204077..204943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0238"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47086"
FT                   /protein_id="ACQ47086.1"
FT                   /translation="MELRDLQIFQSVADQGSVSSAAKELNYVQSNVTARIKQLENELKT
FT                   PLFYRHKRGMTLTAEGRKMLVYVNKILQDVDELKQVFLDSETPSGILKIGTVETVSTLP
FT                   TILSSYYKSYPNVDLSLQAGLTEELIREVLDHQLDGAFISGPIKHPLIEQYDVSTEKLM
FT                   LVTQNKTFHIEEFTTTPLLVFNQGCGYRSKLERWLKDEGLLPKRIMEFNILETLLNSVA
FT                   LGLGITLVPQSAVHHLSKAGKVHCHAIPEKYGSISTVFIRRKDSYMTNSMRSFLKTIEE
FT                   HHHINML"
FT   gene            205086..206039
FT                   /locus_tag="BAA_0239"
FT   CDS_pept        205086..206039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0239"
FT                   /product="transporter, EamA family"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46630"
FT                   /protein_id="ACQ46630.1"
FT                   /translation="MIIGALACLIASMSWGAMFPVADHALEYIDPFYFSLIRYGAVAIM
FT                   LIILLLMKEGKQAFRLEGRGKLLVFFGTMAFTVYNVLIFLGQMLMGKSGVMVASIMEAL
FT                   MPMISICILWGYKHVKPKKYMITSMLIAFIGAVFVITKGDMSFFLTLKDNMFSLACIFV
FT                   GVVGWVIYTMGGQTCSDWSTLRYSTLTCVFGTTVTGIITIIITAFGYVSVPNMGTISIV
FT                   KYDLLFMMTLPGIVALLAWNYGVKILSSINGILFINFVPITTLVIMMMQGYQITMFDIV
FT                   GTLLVIAALIRNNVCQRKEENINKRILEKEQLRQAV"
FT   gene            206061..206201
FT                   /locus_tag="BAA_0240"
FT   CDS_pept        206061..206201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0240"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46239"
FT                   /protein_id="ACQ46239.1"
FT                   /translation="MLESLLFFFAVGVACELAAINRNGRKKIKQQAEMIELLKELKERN
FT                   I"
FT   gene            206569..207174
FT                   /locus_tag="BAA_0241"
FT   CDS_pept        206569..207174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0241"
FT                   /product="putative 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferase"
FT                   /note="identified by match to protein family HMM PF01553;
FT                   match to protein family HMM TIGR00530"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48365"
FT                   /protein_id="ACQ48365.1"
FT                   /translation="MYKPITFSLKYIFKTAGKVEVQGREKLPEGGPYVVACTHTSFMDV
FT                   LMLATGMYPTEIHYMAKKELFEGKFKNWFFKNVNAFPVDRANPGPSTLKIPSRLLKEGK
FT                   VVGIFPSGTRSTEDVSLKAGAVTIAMRSNVPLIPAAYIGPSSVKELIKGKRAQLIFGDP
FT                   IQIDAEEQIDRKTAMKMMTDQLNEKFEGLKEALQSNQK"
FT   gene            207333..207461
FT                   /pseudo
FT                   /locus_tag="BAA_0242"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   premature stop which may be the result of a sequencing
FT                   error"
FT   gene            207649..208626
FT                   /locus_tag="BAA_0243"
FT   CDS_pept        207649..208626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0243"
FT                   /product="sugar-binding transcriptional regulator, LacI
FT                   family"
FT                   /note="identified by match to protein family HMM PF00356;
FT                   match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49421"
FT                   /protein_id="ACQ49421.1"
FT                   /translation="MANIKDIAKMAGVSVTTVSRVLNDHPYVSEEKRKAVIEIVEKLNY
FT                   SQNANAVHLSKGKTNIVGVILPYINHPSFDAMVGGMMEGALTHNYRVLLCQTNYNKKEE
FT                   MKSLHMLKTKQLDGLIICSRANDWEIIEPYASYGTIIACEDNDISNISSVYTNHSAAFQ
FT                   LGMNHLIEKGYKKIGYCTGRKLGPSSQKRFDVYKQQLQSIDEEVNEEWIFTECFTLEDG
FT                   VRVAHKLKGMQNLPEALIVAGDEVAIGVMTEVGKLGIQVPEDLAIIGLDNQPISQVLQL
FT                   TTIDQNLKEIGKTAFEMFYRHISDKSSKQEKVEIPYELVERSTV"
FT   gene            208775..209104
FT                   /locus_tag="BAA_0244"
FT   CDS_pept        208775..209104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0244"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49135"
FT                   /protein_id="ACQ49135.1"
FT                   /translation="MNELLLSVKKYLENDENIVAFVIGIFEKDNFTLCYQHGIFVATTR
FT                   RLLFYGKFPYYPSTFKEYSYLHIDSIDFCPYFEFTCNHETVRAKCIQKGNVEQFVRTVR
FT                   TNMNN"
FT   gene            209223..210059
FT                   /locus_tag="BAA_0245"
FT   CDS_pept        209223..210059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0245"
FT                   /product="yitT family protein"
FT                   /note="identified by match to protein family HMM PF02588"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47329"
FT                   /protein_id="ACQ47329.1"
FT                   /translation="MVNQRIKEITLITIGSLLFAIGINYFAIPNRLSEGGIIGLTVVTY
FT                   YLFDWSPGIVNFAINAILLAIGYKFFDKKTMVYTILGIVETSLFLYVTEHIEYHVNSDT
FT                   LLAALFAGLFVGIGLGCMFKAGGTSGGSAILAQLANQYLGWSVGKGVLIIDIVVIAGSV
FT                   FIIGQEKAMYTLVAVFIGAKVIDFIVEGMDTKTAVTIISNQPDLIREAITKNMTRGVTV
FT                   LEGRGGYTGKNKEVLYVVINKQELVKLKQVISRVDEDAFVVIHDVRDVLGGGFKAS"
FT   gene            210197..210553
FT                   /locus_tag="BAA_0246"
FT   CDS_pept        210197..210553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0246"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06486;
FT                   match to protein family HMM TIGR01655"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48481"
FT                   /protein_id="ACQ48481.1"
FT                   /translation="MKKKMITTIIAMLVIVVMLLPTKLGPVIDKYNPFYKTKEYYTVVN
FT                   TIGQHVGDEWYEYEFIAFDERGKEQKIKKTVKHMLKRDEMLKVYAKGRYGELIEEIEAV
FT                   NIPINAKSKLLSMR"
FT   gene            211125..211238
FT                   /locus_tag="BAA_0247"
FT   CDS_pept        211125..211238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0247"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50950"
FT                   /protein_id="ACQ50950.1"
FT                   /translation="MRKEEVVKFPIKDFCSYFTVAVVCIGLFDIITNLIVK"
FT   gene            211297..212061
FT                   /locus_tag="BAA_0248"
FT   CDS_pept        211297..212061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0248"
FT                   /product="putative deoxyribonuclease, TatD family"
FT                   /note="identified by match to protein family HMM PF01026"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50224"
FT                   /protein_id="ACQ50224.1"
FT                   /translation="MKWIDSHIHVDQYKDEEKSRLLKDVENSKEIQGLIAVSMNYQSSK
FT                   EILSLAKRYSFVHPAVGFHPEQPIHKEECEKIYKLIEDHVEDIVAIGEVGLPYYLRKED
FT                   EHIAINSYISVLQRFVELASKYDLPIVLHAVYEDADVVCDLLEKHKVSRAHFHWFKGSE
FT                   TTMERMMRNGYYISITPDVLHKEKIRKIVSYYPLEYMMVETDGPWGFQEGVMTHPGMIR
FT                   EVLKEISVIKNVAVDKVAETIYENTIQFYLKG"
FT   gene            complement(212164..213813)
FT                   /locus_tag="BAA_0249"
FT   CDS_pept        complement(212164..213813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0249"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46976"
FT                   /protein_id="ACQ46976.1"
FT                   /translation="MKKWLLLLFSLLLLIPVPISAQKNENPKVLILYSSSDDQITSDTQ
FT                   ILNTQVGHFTNNITIKSIKQLAEITDKSSYTHVIYIGEKQEELPTETKEFLENFSGPLL
FT                   VLGQNIEKLSKRFSFITLKNEDINSDTIEYPTRKLKNTLEDERSIKILDTNGTILANAL
FT                   KGKNTYPLIVQQNNSYYVATPNLFDWMSHYIGEVLFSYFGQKPTNNKVEAYLRLEDVHP
FT                   AADINQLKEIAELLKEKKMPYMITVIPVYTDPETGKTLHLKDKPELVDLLRSMQDDGAT
FT                   IIMHGYTHQFYDSETGEGFEFWDVKTDQPIRQPKHEKPKTKDDFPNIEAYNTYVKKGEE
FT                   FEEKYTTDHIEKGIQELVDAKLYPVAFEAPHYTMSQKGYEILSRYFSTYVGQLQLSDTT
FT                   WKSMHSPAYRSTPSFLNGMKLMPETVGFIEEDKPHAIAKMKANAVSVAKLSDGVIGAFY
FT                   HPYLGVKPLKEVLKDLESIPNIEWIDLQKETNEVKMKDIHITTNKDGIHVEKPTSASDV
FT                   MDYIKQYGFFLILGFLVIVFLLLLRRAKKLES"
FT   gene            214064..214597
FT                   /locus_tag="BAA_0250"
FT   CDS_pept        214064..214597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0250"
FT                   /product="invasion protein IagB domain protein"
FT                   /note="identified by match to protein family HMM PF01464"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46231"
FT                   /protein_id="ACQ46231.1"
FT                   /translation="MKKFFVGFLVVLGVYLYFQGKSEGMGKLVNETSYVDSEEAKQMKQ
FT                   IIIEEAKKVNLPEWIPLTIAEHESRLNPRSVGDNGTSFGLFQLHRGGGLAPDHLTDDEL
FT                   KDPRTNAQIAMPHLMKGYKRGVQKGLTDFALLKYIANTSGWPGNLGPEWTDNNMKYNVG
FT                   LEDVYYRNKGIIKE"
FT   gene            complement(214613..215395)
FT                   /locus_tag="BAA_0251"
FT   CDS_pept        complement(214613..215395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0251"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47552"
FT                   /protein_id="ACQ47552.1"
FT                   /translation="MDTQQLYFLNDIGKQKPESIRNRSAACPFCDRENLTDILATEGPI
FT                   IWLKNKFPTLKDTFQTVLIETDNCEDHIATYTEEHMRSLIRFSVKHWLDLQKNEEFKSV
FT                   ILYKNHGPFSGGSLHHAHMQIIGMKYVNYLDNVEQDNFQGVIVQKNKNIELNISDRPII
FT                   GFTEFNIIVKDIECIDEMANYIQQTVRYILTDFHKGCSSYNLFFYHVSGKIICKVVPRF
FT                   VVSPLYVGYKIPQVSTKLEDVKIQLAEYFTKRHDDPQK"
FT   gene            complement(215530..215652)
FT                   /locus_tag="BAA_0252"
FT   CDS_pept        complement(215530..215652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0252"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47263"
FT                   /protein_id="ACQ47263.1"
FT                   /translation="MKKAIIVIASTAIALYTIKNRKKKHNKNDLYYPYTLLKKK"
FT   gene            216022..216213
FT                   /locus_tag="BAA_0253"
FT   CDS_pept        216022..216213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0253"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49234"
FT                   /protein_id="ACQ49234.1"
FT                   /translation="MGKYNKEVSIKFRTKEVNEMKRSLAARAKFLDFIYFCRAIFHDVV
FT                   VNGIRLSFFNNCIVAIER"
FT   gene            complement(216259..216387)
FT                   /locus_tag="BAA_0254"
FT   CDS_pept        complement(216259..216387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0254"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50926"
FT                   /protein_id="ACQ50926.1"
FT                   /translation="MFPPKDFVTLFTLQIVIFRTPFNIKNHGKETFPMVFDIEKGS"
FT   gene            216338..218218
FT                   /locus_tag="BAA_0255"
FT   CDS_pept        216338..218218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0255"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46406"
FT                   /protein_id="ACQ46406.1"
FT                   /translation="MTICSVNNVTKSFGGNIIFENISLEIKNGERVGLVGRNGSGKTTI
FT                   FQLLTGMESLDAGAIHMKKGTRIGHVAQIPKFDESMTVYEVLSSAFKIEKELEREMRTL
FT                   EKDMAEEQESSVLQKLMERYGIIQEKFAFLGGYEIEANIMKVANGLQVTELFPRSFLEL
FT                   SGGEQTKVSLAYMLLQKPDLLLLDEPTNHLDLFAVEWLEQFLKEYNGTVMVISHDRYFL
FT                   DEVVTKIFDLEDGEIHVYHTNYSRFVEEKEERLLQEFQAYQEQQKKIKKMKEAIKRLRE
FT                   WANQANPPNEGLHKRARSMERALERMQKLKKPILERKQIGLQFEGQDRSGKDVVVIKEV
FT                   SKGFADHPLFNEVNLHVRFQERAAIVGRNGTGKTTLLKLLLEEIEPDAGEIRIGSSVKI
FT                   GYLSQHAYGNMKSDVLEAFREYVAVTEGEARHILAKFLFYGPAVFKKVTQLSGGEKMRL
FT                   RLAQLMYQDINFLILDEPTNHLDIESREVLEEALEQYNGTILAVSHDRYFLNKLFEKTY
FT                   WIDEHKLFEFAGNYAWARQKWEERLETQVIKQQRQGRKSIETAPVKKKEARNIEEIETE
FT                   LMHVEEDIYTLECTMEHVVDIKRLEQLYEEKTKKELLRAELYNELENIVE"
FT   gene            complement(218460..218657)
FT                   /locus_tag="BAA_0256"
FT   CDS_pept        complement(218460..218657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0256"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46542"
FT                   /protein_id="ACQ46542.1"
FT                   /translation="MDNLFQYVLHYVLLTIMIVGALLLFPFFPKFVLFLAFFIMLGVAI
FT                   IISTREDTTQKENRVQRVKL"
FT   gene            218758..218877
FT                   /locus_tag="BAA_0257"
FT   CDS_pept        218758..218877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0257"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47097"
FT                   /protein_id="ACQ47097.1"
FT                   /translation="MIDMFNSKVVSAHHARIQGLQEDNYNGILLSLPKLKIEQ"
FT   gene            219175..220842
FT                   /locus_tag="BAA_0258"
FT   CDS_pept        219175..220842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0258"
FT                   /product="putative oligopeptide ABC transporter,
FT                   oligopeptide-binding protein"
FT                   /note="identified by match to protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50342"
FT                   /protein_id="ACQ50342.1"
FT                   /translation="MLSACGGQEDTASTEPVKKQDLKDAKIESIPATDKKKSPEKANQR
FT                   KDTFITAISKPGGVFLPYFQENGWDGNVTSVIFASLVTTDKQSKPIPDLAEKWDISADQ
FT                   LTYTFHLRKNLKFSDGSPLTADDVAFTLTLLHDKAYEGGLDIAQYAVKGGKEYKEGKTT
FT                   SIEGIQVVDPQTIKITTEKVNSQALTNLGGPVLSKAYYGKDYKQNTSLDYLKALYGQPI
FT                   AAGPYKFEKYVPGQEVRFVSNEHYYAGKPKIKNFIYKITSGDTGFQLFQTGELDYSGFR
FT                   ANPENIDQLKGLEFANINLESSSDIAYIYVNNKKSYLKDKKVRQALTYGLDRKKYVDTA
FT                   LQGYGSVANVPIAPVSWAYTEEGINKYPHDVEKAKKLLDEAGWKVGSDGVREKDGQKLK
FT                   LTYYASNTGKTNDIFIPIAKESYKEIGVELNPELMDFNTMLSKVGKGDYDLAAVSTPGI
FT                   SDPSEVVSEYLSTNPKSDTGYNNPKVDELIVKGIGTTDIEKRKAIYKELYKELSDDPPV
FT                   ILLNYRKLLYAHNARIKGIDPEKYDSISSNLPVLSIEQ"
FT   gene            220951..221907
FT                   /locus_tag="BAA_0259"
FT   CDS_pept        220951..221907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0259"
FT                   /product="oligopeptide ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48680"
FT                   /protein_id="ACQ48680.1"
FT                   /translation="MKTYIIRRFLQMIPTLFGTSIIIFFLFALLPGDYIDSNPKLTPER
FT                   AQELRELYGLNKPIIERYFHWLVNALHGDFGFSLQYQEPVTSLLNKFIWNTFIVAVAAL
FT                   FFTWIIALIIGVISATKQHSWFDRLVTIGVFAAMSFPSFFIGLFLIKLLAVDLKLLPIG
FT                   GMIDIGSNSTGIAYILEVLRHMILPVFILTLLGVGSLTRYFRTGMLDVIRQDYIRTARA
FT                   KGLKERTVIYKHALKNAILPAITLLAFELPGLFSGAIIIEQIFNWPGIGSIQLEALNFR
FT                   DYTVLMAFTMFLSCLTIMANFLADIVYAFVDPRIRLK"
FT   gene            221920..222843
FT                   /locus_tag="BAA_0260"
FT   CDS_pept        221920..222843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0260"
FT                   /product="oligopeptide ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47509"
FT                   /protein_id="ACQ47509.1"
FT                   /translation="METITPIIEKKKERKKRNESSPWRQAYKKIKKNKMALCGLYVLIF
FT                   MFLFSFIGPIFSPYADGKVQVTQINKPPSLSHWLGTDQLGRDILTRLMQAGRISLTIGL
FT                   ASMLLSVILGALLGAIAGFYRGVVDHLIMRVADVLMSIPGLPLLIIMGAILSEWKLPSE
FT                   YRLYVVMIILSLVGWPGLARLVRGQILTLREQAFMQAADVLGLKDSRKIIHHLIPNVFP
FT                   LLIVVATLGVAGSILSESALSYLGLGVVPPTPPWGNMISAANSLIDFQKRPWLWIPPGF
FT                   AIFITVVSINLLGDALRDALDPKMRR"
FT   gene            222854..223834
FT                   /locus_tag="BAA_0261"
FT   CDS_pept        222854..223834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0261"
FT                   /product="oligopeptide ABC transporter, ATP-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF08352; match to protein
FT                   family HMM TIGR01727"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47968"
FT                   /protein_id="ACQ47968.1"
FT                   /translation="MSKAVVELKDLQTHFQTEEGTVKAVNHVSFSVREGETVCVVGESG
FT                   CGKSVTALSIMGLIAESGSVVGGDILYEGKSLLGMKEKELRSLRGNDIAMIFQEPMTSL
FT                   NPVFTVGEQIVETLREHELLSKNEAYKKAIELIRKVGIARADEIVHSYPHELSGGMLQR
FT                   IMIAVALSCNPKLLIADEPTTALDVTIQAQILDLLRQIKREFKTSILLITHDLGVVAEM
FT                   ADYVVVMYGGKVIEEAPVLEIFQNPKHPYTKGLLKSKPVMGKRIDKLYSIPGQVPNLVG
FT                   LDEFCYFSGRCEHCMEICKEEAPNLNVHDENHKVACWLYEERAGQ"
FT   gene            223831..224841
FT                   /pseudo
FT                   /locus_tag="BAA_0263"
FT                   /note="oligopeptide ABC transporter, ATP-binding protein;
FT                   this gene contains a frame shift which may be the result of
FT                   a sequencing error; identified by match to protein family
FT                   HMM PF00005; match to protein family HMM PF08352; match to
FT                   protein family HMM TIGR01727"
FT   gene            complement(224831..225523)
FT                   /pseudo
FT                   /locus_tag="BAA_0262"
FT                   /note="hydrolase, haloacid dehalogenase-like family; this
FT                   gene contains a frame shift which may be the result of a
FT                   sequencing error; identified by match to protein family HMM
FT                   PF08282"
FT   gene            complement(225474..225704)
FT                   /pseudo
FT                   /locus_tag="BAA_0264"
FT                   /note="hydrolase; this gene contains a frame shift which
FT                   may be the result of a sequencing error"
FT   gene            225830..226006
FT                   /locus_tag="BAA_0265"
FT   CDS_pept        225830..226006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0265"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50009"
FT                   /protein_id="ACQ50009.1"
FT                   /translation="MKDLSYFVTKVEGGMGMFRYMTVILHECYKRGFSRKCIKSRFLKV
FT                   FIKKRKKSVIKFT"
FT   gene            226296..226415
FT                   /locus_tag="BAA_0266"
FT   CDS_pept        226296..226415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0266"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49210"
FT                   /protein_id="ACQ49210.1"
FT                   /translation="MRNMNSEQVLQVTKTDLLGSLGGAVVLTSFILFLANVLV"
FT   gene            226726..227844
FT                   /gene="hppD"
FT                   /locus_tag="BAA_0267"
FT   CDS_pept        226726..227844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hppD"
FT                   /locus_tag="BAA_0267"
FT                   /product="4-hydroxyphenylpyruvate dioxygenase"
FT                   /EC_number="1.13.11.27"
FT                   /note="identified by match to protein family HMM PF00903;
FT                   match to protein family HMM TIGR01263"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48677"
FT                   /protein_id="ACQ48677.1"
FT                   /translation="MKQKSMDTLAAQMEDFFPVRDVDHLEFYVGNAKQSSYYLARAFGF
FT                   KIVAYSGLETGNREKVSYVLVQKNMRFVVSGALSSDNRIAEFVKTHGDGVKDVALLVDD
FT                   VDKAYSEAVKRGAVAIAPPVELTDENGTLKKAVIGTYGDTIHTLVERKNYKGTFMPGFQ
FT                   KAEFDIPFEESGLIAVDHVVGNVEKMEEWVSYYENVMGFKQMIHFDDDDISTEYSALMS
FT                   KVMTNGSRIKFPINEPADGKRKSQIQEYLEFYNGAGVQHLALLTNDIVKTVEALRANGV
FT                   EFLDTPDTYYDELTARVGKIDEEIDKLKELKILVDRDDEGYLLQIFTKPIVDRPTLFIE
FT                   IIQRKGSRGFGEGNFKALFESIEREQERRGNL"
FT   gene            227908..228867
FT                   /locus_tag="BAA_0268"
FT   CDS_pept        227908..228867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0268"
FT                   /product="fumarylacetoacetate hydrolase family protein"
FT                   /note="identified by match to protein family HMM PF01557"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50454"
FT                   /protein_id="ACQ50454.1"
FT                   /translation="MMKFVTFRLPSKEMRAGWLEGDKVIDMNLASDGKLPSSMFAFLEK
FT                   ADEYVEVLRNIKNPEKGIYSLEEVQLAAAIPNPSSIRDFYAFEQHVKTARGRRGLDVVP
FT                   EWYDIPVFYFTNHRAVIGPNDVVIGPKKSEKIDYELEIACVIGKEGRNISREQAEEYIF
FT                   GYCIMNDWSARDLQATEMKVGLGPAKGKDFATSLGAHLVTKEELDVYRNGDRYELEMTA
FT                   HVNGKLLSKGNFQDIYYTFAEMIERASEDVTLYPGDVIGSGTVGTGCILELGTEEWLQD
FT                   GDVVELTITGLGTLRNTVKKEKEAGDEHVLSSHGGATS"
FT   gene            228833..230005
FT                   /locus_tag="BAA_0269"
FT   CDS_pept        228833..230005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0269"
FT                   /product="putative homogentisate 1,2-dioxygenase"
FT                   /note="identified by match to protein family HMM PF04209"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49757"
FT                   /protein_id="ACQ49757.1"
FT                   /translation="MFYRHMGELPHKRHVQFRKKDGSLYREQVMGTKGFSGTQSILYHH
FT                   YMPTEVGHAALSHSCQLQYEEDVVLSHRHFRTKENKKSGDAVSGRNFILGNEDLLIGVV
FT                   TPTEKMNYFYRNGDGDEMLFVHYGTGKIETMFGTIHYRKGDYVTIPIGTIYRVIPDEGE
FT                   TKFLVVEANSQITTPRRYRNEYGQLLEHSPFCERDIRGPEKLETYDEKGEFVVMTKSRG
FT                   YMHKHVLGHHPLDVVGWDGYLYPWVFNVEDFEPITGRIHQPPPVHQTFEGHNFVICSFV
FT                   PRLYDYHPESIPAPYYHSNVNSDEVLYYVEGNFMSRKGVEEGSITLHPSGIPHGPHPGK
FT                   TEASIGKKETLELAVMIDTFRPLRIVKQAHETEDEKYMYSWIEEGSYTVK"
FT   gene            230239..231510
FT                   /locus_tag="BAA_0270"
FT   CDS_pept        230239..231510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0270"
FT                   /product="major facilitator family transporter"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46047"
FT                   /protein_id="ACQ46047.1"
FT                   /translation="MKNTWRELREMDRNVWIRFIGETLNGIAMMMLMPFFALYLKDKVD
FT                   SLLQVGVIMALSPIAASFGSIIGGRIADIYGRKPIMIFSMTSNALLMLGFLFIEGFIPY
FT                   AILSVFLGLSNSLFHPAASAMVADVTAPEKRTEAYGLLRMGHNIGAAIGPIMGASVVML
FT                   SKNLVFIIASSTMLFYALLVFVLIQETMPKSANKEEDNEKESGVVWKIVLRDKALMIYL
FT                   LAGIIISMGFSQTEGMLPLHFDNEMKDIFGTNNPYPYLMALNGLLVVLFQFQISKWATD
FT                   KPVGKTMLYGACLFGIGLFFIGWLPKWFGGLDTNATIILIMLLFVYAIYTLGEMIMSPV
FT                   QMTFVANLAPEHLRGTYMGAASLQWITGNAFGPLLGGFLLDRLLGHFLFTILAIGCVVA
FT                   GVVYISLDRLVEQRQKGTLTKQSS"
FT   gene            231893..232369
FT                   /pseudo
FT                   /locus_tag="BAA_0271"
FT                   /note="D-alanine--D-alanine ligase; this gene contains a
FT                   frame shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF01820"
FT   gene            232704..232979
FT                   /locus_tag="BAA_0272"
FT   CDS_pept        232704..232979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0272"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50061"
FT                   /protein_id="ACQ50061.1"
FT                   /translation="MTEEESNVIKRDAIVAFQSLDGAGLTRADFFLTKDGEVYINEVNT
FT                   MPGFTPFSMFPLLWQHTGLPYPELIEELIRLAMERHEEKQKIKYTI"
FT   gene            233040..234416
FT                   /gene="murF"
FT                   /locus_tag="BAA_0273"
FT   CDS_pept        233040..234416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murF"
FT                   /locus_tag="BAA_0273"
FT                   /product="UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine
FT                   ligase"
FT                   /EC_number="6.3.2.10"
FT                   /note="identified by match to protein family HMM PF01225;
FT                   match to protein family HMM PF02875; match to protein
FT                   family HMM PF08245; match to protein family HMM TIGR01143"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50773"
FT                   /protein_id="ACQ50773.1"
FT                   /translation="MINRTLKQVEQMINGTGLAEQYEGITIQGVSIDTRKIEKGNLYVP
FT                   IQGERFDGHAFVDKAVENGAVATLWVKDVANPPENLPVIFVEDTLSALQMLAKNYRDQL
FT                   DVKVIGVTGSNGKTSTKDIVTSLLATKFKVQKTEGNFNNHIGLPLTILNLEENTEVAVL
FT                   EMGMSSRGEIEFLSKLARPNAAIITNIGEAHLMDLGSREAIAEAKLEIVTGLQEGGVFV
FT                   YNGDEPLLTNRVPEMNLIAETVTFGDARANDYYPTTVTLQATGTHFKMNREENISFYLP
FT                   VLGKHNVYNTLASMAIAKYFGVTWEEMKEGLVTLQMTGMRMEIVKTDSGLTIINDAYNA
FT                   SPTAMEAAFHLMNGLDGFSKKIVVLGDMLELGDQEVQFHYEVGKLIDPAKISYVFTYGK
FT                   LGAQIAEGAKINFPNERVKAYDNKEELVKELQAVVDTKDVVLVKASRGMKLEEVITMLK
FT                   "
FT   gene            234721..236307
FT                   /locus_tag="BAA_0274"
FT   CDS_pept        234721..236307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0274"
FT                   /product="ATP-dependent RNA helicase, DEAD/DEAH box family"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50791"
FT                   /protein_id="ACQ50791.1"
FT                   /translation="MTTFRELGLSDSLLQSVESMGFEEATPIQAETIPHALQGKDIIGQ
FT                   AQTGTGKTAAFGLPLLDKVDTHKESVQGIVIAPTRELAIQVGEELYKIGKHKRVRILPI
FT                   YGGQDINRQIRALKKHPHIIVGTPGRILDHINRKTLRLQNVETVVLDEADEMLNMGFIE
FT                   DIEAILTDVPETHQTLLFSATMPDPIRRIAERFMTEPQHIKVKAKEVTMPNIQQFYLEV
FT                   QEKKKFDVLTRLLDIQSPELAIVFGRTKRRVDELSEALNLRGYAAEGIHGDLTQAKRMS
FT                   VLRKFKEGSIEVLVATDVAARGLDISGVTHVYNFDIPQDPESYVHRIGRTGRAGKKGIA
FT                   MLFVTPRESGQLKNIERTTKRKMDRMDAPTLDEALEGQQRLIAEKLQSTIENENLAYYK
FT                   RIAEEMLEENDSVTVVAAALKMMTKEPDTTPIALTSEPPVVSRGGGSKKRGGNGGGYRD
FT                   GNRNRSRDGRGGDGRNRDRNRDGRNRDGNRDRNREGSRDGNRGRRGEGQGRPGSSNGRG
FT                   ERKHHSRKPQA"
FT   gene            236404..237366
FT                   /gene="uvdE_1"
FT                   /locus_tag="BAA_0276"
FT   CDS_pept        236404..237366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvdE_1"
FT                   /locus_tag="BAA_0276"
FT                   /product="UV damage endonuclease UvdE"
FT                   /note="identified by match to protein family HMM PF03851;
FT                   match to protein family HMM TIGR00629"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50481"
FT                   /protein_id="ACQ50481.1"
FT                   /translation="MLVRLGHVAMSVHLKNASPSQTMTYAQFQKIDDREAAIRKLERIA
FT                   NSNLENCLRLLKHNKGHDISFFRLSSKLIPLANHEELLEWNYIRPLKENLKVLGDYAIR
FT                   MNMRIDFHPDHFVVLNSPEENIFKQSVKTLQMHRKLLKGMGIEHKQRCVMHVGGGYKDK
FT                   ELALERFIENWSNVPRGIQEMIMLENDDTTFTLEDTLYLGEKLDIPVVFDLHHHMMNHD
FT                   REDWHEDWARVVHTWESSLLPVKMHISSPREGKDPRAHADFIDVDTFLSFLKKIKGSVP
FT                   QIDCMIEAKMKDESLFQLMRDLSEQTDVEIIDGASFYIK"
FT   gene            complement(237359..237931)
FT                   /locus_tag="BAA_0275"
FT   CDS_pept        complement(237359..237931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0275"
FT                   /product="rhomboid family protein"
FT                   /note="identified by match to protein family HMM PF01694"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50797"
FT                   /protein_id="ACQ50797.1"
FT                   /translation="MLIPSARISLQPIAISLLLIQFIMIMLGDFFLFPMAAYHEYIANG
FT                   EWWRLITSLFVHVDLQHFLSNSICLFVLGSSIEKQLGRFSFIIIFFLSGILGNIFSYLI
FT                   MPHEYIHAGASGGIFGLLGAQLFLLYSRYRSSNPKDIAIFSIMICILLLFTFFNPSANP
FT                   ISHLTGLVIGGICTPLLIKKLDGAELI"
FT   gene            238024..238383
FT                   /gene="acpS"
FT                   /locus_tag="BAA_0277"
FT   CDS_pept        238024..238383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpS"
FT                   /locus_tag="BAA_0277"
FT                   /product="holo-(acyl-carrier-protein) synthase"
FT                   /EC_number="2.7.8.7"
FT                   /note="identified by match to protein family HMM PF01648;
FT                   match to protein family HMM TIGR00516; match to protein
FT                   family HMM TIGR00556"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49922"
FT                   /db_xref="GOA:C3PAT6"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3PAT6"
FT                   /protein_id="ACQ49922.1"
FT                   /translation="MIVGIGIDIIELNRIEKMLDGKLKFMERILTENERNVAKGLKGSR
FT                   LTEFVAGRFAAKEAYSKAVGTGIGKEVSFLDIEVRNDDRGKPILITSTEHIVHLSISHS
FT                   KEFAVAQVVLESSSS"
FT   gene            238477..239490
FT                   /locus_tag="BAA_0278"
FT   CDS_pept        238477..239490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0278"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47003"
FT                   /protein_id="ACQ47003.1"
FT                   /translation="MKRRLFLVLVGLLTVFVLAGCMEKKQDDVVRDLEAKVKGLKSYQA
FT                   EAKLSIKTGNEPQEYKVEIWHKEPSFYRVNLQNAKKDQSQIILRNEEGVFVLTPALNKS
FT                   FRFQSDWPQNSSQAYLYESLVRDILQDKKNLTFEKTDKHYIFKTKTNYQHQNMLPRQEI
FT                   TLKKSDLTPVSVKLMDNDQNVLVKVDFSKVKFDAKFDKGAFDTKQNMSRAQVDVQTTAK
FT                   EDKPFAILYPRDTPQGMTLKDEKELKTDSGKRAILTYTGSKKSFTLIQEKAKVAEASSA
FT                   ISVSGELVDLGFTIGALTKDSLTWSHNGVEYMLVSKGLEPKELLMVARSVTEKQVK"
FT   gene            239609..240778
FT                   /gene="dal1"
FT                   /locus_tag="BAA_0279"
FT   CDS_pept        239609..240778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dal1"
FT                   /locus_tag="BAA_0279"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="identified by match to protein family HMM PF00842;
FT                   match to protein family HMM PF01168; match to protein
FT                   family HMM TIGR00492"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46037"
FT                   /protein_id="ACQ46037.1"
FT                   /translation="MEEAPFYRDTWVEVDLDAIYNNVTHIKEFIPSDVEIFAVVKGNAY
FT                   GHDYVPVAKIALEAGATRLAVAFLDEALVLRRAGITAPILVLGPSPPRDINVAAENDVA
FT                   LTVFQKEWVDEAIKLWDGSSTMKYHINFDSGMGRIGIRERKELKGFLKSLEGAPFLELE
FT                   GVYTHFATADEVETSYFDKQYNTFLEQLSWLKEFGVDPKFVHTANSAATLRFQGITFNA
FT                   VRIGIAMYGLSPSVEIRPFLPFKLEPALSLHTKVAHIKQVIKGDGISYNVTYRTKTEEW
FT                   IATVAIGYADGWLRRLQGFEVLVNGKRVPIVGRVTMDQFMIHLPCEVPLGTKVTLIGRQ
FT                   GDEYISATEVAEYSGTINYEIITTISFRVPRIFIRNGKVVEVINYLNDI"
FT   gene            241088..241375
FT                   /locus_tag="BAA_0280"
FT   CDS_pept        241088..241375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0280"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49530"
FT                   /protein_id="ACQ49530.1"
FT                   /translation="MSESSVTTEIVVRLPKQMVTELDGIGKQENKNRHELICQATQLLL
FT                   RQHKTKKRYQHESMRRGYIEMGKINLGIASEAFLAEYEAAHTVERLVSGG"
FT   gene            241380..241730
FT                   /locus_tag="BAA_0281"
FT   CDS_pept        241380..241730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0281"
FT                   /product="transcriptional regulator, PemK family"
FT                   /note="identified by match to protein family HMM PF02452"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49281"
FT                   /protein_id="ACQ49281.1"
FT                   /translation="MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVA
FT                   AITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQIRTIDKQRLTDKITHLDEVMMIRVD
FT                   EALQISLGLIDF"
FT   gene            241798..243966
FT                   /locus_tag="BAA_0282"
FT   CDS_pept        241798..243966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0282"
FT                   /product="S1 RNA binding domain protein"
FT                   /note="identified by match to protein family HMM PF00575;
FT                   match to protein family HMM PF09371"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50853"
FT                   /protein_id="ACQ50853.1"
FT                   /translation="MEMVDNRQALMKMLVKELGFTEKQVRHVIQLTEEGNTVPFIARYR
FT                   KEWTGSLDEVQIRTILERWQYIMQLEDRKEEVLRLIDEKGKLTGELRQQILKATKLQEV
FT                   EDLYRPYKEKRRTKATIAKEKGLEPLAEWLLLYTKEDPNQKAMEFINAEKEVQSAEEAL
FT                   QGAQDIIAEIVSDEAAYRSWIRNVTFRKGVMSSVVKDEEKDEKNIYEMYYDYEEPLQKV
FT                   VPHRVLAMNRGEKEDILRVSVVPPVDEIVTFLYKKVIRDNDSKSAQYVKLAIEDGYKRL
FT                   IQSSIEREIRKELTETAEEQAIHIFSENLRNLLLQPPMKGKVVLAVDPAYRTGCKLAIV
FT                   DDTGKVLYIDVIYPHPPVRKYEDAKAKVLSIIDKYQVEMIAIGNGTASRESEEFIVDVL
FT                   QNVKREVFYIIVNEAGASVYSASDLAREEFPDLQVEERSAVSIGRRLQDPLAELVKIDP
FT                   KSVGVGQYQHDVSQKRLNESLTFVVETAVNQVGVNVNTASVALLQYVSGLSKTVAKNIV
FT                   AKREEEGKFTKRTDLKKIPRLGAKTYEQCIGFLRILEGANPLDRTGIHPEQYKNVELLL
FT                   KSLGLSKDDVGQPQLQKSLEEVEISKLSEETGIGEPTLVDIIDALISPERDMRDELPKP
FT                   LLKKGILKLEDLKRGMELEGTARNVVDFGAFVDVGVKQDGLVHISKLSKQYVKHPLDVV
FT                   SVGQIVKVWVDDIDTKKGRVALSMLPIE"
FT   gene            244336..244794
FT                   /locus_tag="BAA_0283"
FT   CDS_pept        244336..244794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0283"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03926"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50284"
FT                   /db_xref="GOA:C3PAU2"
FT                   /db_xref="InterPro:IPR006640"
FT                   /db_xref="InterPro:IPR023524"
FT                   /db_xref="InterPro:IPR035240"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3PAU2"
FT                   /protein_id="ACQ50284.1"
FT                   /translation="MDEQEIQRLVEEVSLQYFGMPFLHKAMFNSRLRTTGGRYLLNTHN
FT                   IELNYRYYEMYGKEELVGIVKHELCHYHLHITGRGYKHRDKDFRELLKAVDAPRFCKRM
FT                   VNAEKEKRVYVYECMECLLQYVRRRQINTKRYVCGKCKGKLNLIKKTS"
FT   gene            244908..244984
FT                   /locus_tag="BAA_0284"
FT   tRNA            244908..244984
FT                   /locus_tag="BAA_0284"
FT                   /product="tRNA-Asn"
FT   gene            244986..245078
FT                   /locus_tag="BAA_0285"
FT   tRNA            244986..245078
FT                   /locus_tag="BAA_0285"
FT                   /product="tRNA-Ser"
FT   gene            245085..245161
FT                   /locus_tag="BAA_0286"
FT   tRNA            245085..245161
FT                   /locus_tag="BAA_0286"
FT                   /product="tRNA-Glu"
FT   gene            245165..245240
FT                   /locus_tag="BAA_0287"
FT   tRNA            245165..245240
FT                   /locus_tag="BAA_0287"
FT                   /product="tRNA-Val"
FT   gene            245286..245363
FT                   /locus_tag="BAA_0288"
FT   tRNA            245286..245363
FT                   /locus_tag="BAA_0288"
FT                   /product="tRNA-Asp"
FT   gene            245451..245525
FT                   /locus_tag="BAA_0289"
FT   tRNA            245451..245525
FT                   /locus_tag="BAA_0289"
FT                   /product="tRNA-Gln"
FT   gene            245531..245606
FT                   /locus_tag="BAA_0290"
FT   tRNA            245531..245606
FT                   /locus_tag="BAA_0290"
FT                   /product="tRNA-Lys"
FT   gene            245621..245706
FT                   /locus_tag="BAA_0291"
FT   tRNA            245621..245706
FT                   /locus_tag="BAA_0291"
FT                   /product="tRNA-Leu"
FT   gene            245802..245878
FT                   /locus_tag="BAA_0292"
FT   tRNA            245802..245878
FT                   /locus_tag="BAA_0292"
FT                   /product="tRNA-Arg"
FT   gene            245883..245959
FT                   /locus_tag="BAA_0293"
FT   tRNA            245883..245959
FT                   /locus_tag="BAA_0293"
FT                   /product="tRNA-Pro"
FT   gene            245961..246034
FT                   /locus_tag="BAA_0294"
FT   tRNA            245961..246034
FT                   /locus_tag="BAA_0294"
FT                   /product="tRNA-Gly"
FT   gene            246133..247641
FT                   /gene="rrs_5"
FT                   /locus_tag="BAA_0295"
FT   rRNA            246133..247641
FT                   /gene="rrs_5"
FT                   /locus_tag="BAA_0295"
FT                   /product="16S ribosomal RNA"
FT   gene            247820..250727
FT                   /gene="rrl_5"
FT                   /locus_tag="BAA_0297"
FT   rRNA            247820..250727
FT                   /gene="rrl_5"
FT                   /locus_tag="BAA_0297"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(247844..248275)
FT                   /pseudo
FT                   /locus_tag="BAA_0296"
FT                   /note="conserved hypothetical protein; this region contains
FT                   one or more premature stops and/or frameshifts"
FT   gene            250777..250892
FT                   /gene="rrf_5"
FT                   /locus_tag="BAA_0298"
FT   rRNA            250777..250892
FT                   /gene="rrf_5"
FT                   /locus_tag="BAA_0298"
FT                   /product="5S ribosomal RNA"
FT   gene            250904..250982
FT                   /locus_tag="BAA_0299"
FT   tRNA            250904..250982
FT                   /locus_tag="BAA_0299"
FT                   /product="tRNA-Met"
FT   gene            250984..251061
FT                   /locus_tag="BAA_0300"
FT   tRNA            250984..251061
FT                   /locus_tag="BAA_0300"
FT                   /product="tRNA-Asp"
FT   gene            251235..251708
FT                   /locus_tag="BAA_0301"
FT   CDS_pept        251235..251708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0301"
FT                   /product="conserved hypothetical protein TIGR00150"
FT                   /note="identified by match to protein family HMM PF02367;
FT                   match to protein family HMM TIGR00150"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47843"
FT                   /protein_id="ACQ47843.1"
FT                   /translation="MSKYEITTKSSEETQKLSEKLGELVRAQDVIILEGDLGAGKTTFT
FT                   KGLAKGLGVKRVVNSPTFNIIKEYKGRLPLYHMDVYRLAESEEDLGFDEYFYGEGITVV
FT                   EWAHLIEAYLPNEKLQISLFHAGDDTRNIVLEPIGNRYIRLCEELLQDESTSN"
FT   gene            251689..252381
FT                   /locus_tag="BAA_0302"
FT   CDS_pept        251689..252381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0302"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00814"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49076"
FT                   /protein_id="ACQ49076.1"
FT                   /translation="MKVLAIDTSNYVMGVSLIEEGNVIGEIITNLTKNHSVRLMPAVEQ
FT                   LLKECGVKPKELTKIVVAAGPGSYTGVRIGVTAAKTLAWSLQIPIVGVSSLEVVAANGA
FT                   NFNGLISPLFDGRRGQIYTGLYTYEGEDLTSIEEDRIILIVDWLQMLKDKGKPVLFIGN
FT                   DVKLHKETIIEHLGDQAVFAPVTKNNPRPSELAFLGLQKEEQDVHSFVPSYLRLAEAET
FT                   KWLESQNK"
FT   gene            252395..252838
FT                   /gene="rimI"
FT                   /locus_tag="BAA_0303"
FT   CDS_pept        252395..252838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimI"
FT                   /locus_tag="BAA_0303"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /EC_number="2.3.1.128"
FT                   /note="identified by match to protein family HMM PF00583;
FT                   match to protein family HMM TIGR01575"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49633"
FT                   /protein_id="ACQ49633.1"
FT                   /translation="MDMIFRKMELDDIAQIVAIEEASFSTPWTADAFHRELTMNEHAHY
FT                   VVLEKDGRVIGYCGLWIIIDESHITNIAILPEYRGLKLGDALLKEVISEAKTLGVKTMT
FT                   LEVRVSNEVAKQLYRKYGFQNGGIRKRYYADNQEDGLVMWVNI"
FT   gene            252838..253854
FT                   /locus_tag="BAA_0304"
FT   CDS_pept        252838..253854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0304"
FT                   /product="putative O-sialoglycoprotein endopeptidase"
FT                   /EC_number="3.4.24.57"
FT                   /note="identified by match to protein family HMM PF00814;
FT                   match to protein family HMM TIGR00329"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50174"
FT                   /protein_id="ACQ50174.1"
FT                   /translation="MEKNTIILGIETSCDETAVAVVKNGTEIIANVVASQIESHKRFGG
FT                   VVPEIASRHHVEEITVVLEEALKEANITFDDIDAIAVTEGPGLVGALLIGVNAAKAVAF
FT                   AHDIPLVGVHHIAGHIYANRLVKEVQFPLLSLVVSGGHTELVYMKEHGSFEVIGETRDD
FT                   AAGEAYDKVARTLSMPYPGGPHIDRLAHEGKPTIDLPRAWLEPDSYDFSFSGLKSAVIN
FT                   TVHNAKQRGIEIAPEDLAASFQESVIDVLVTKASRAADAYNVKQVLLAGGVAANKGLRA
FT                   RLETEFAQKENVELIIPPLSLCTDNAAMIAAAGTIAYEQGKRATLALNANPGLDIEA"
FT   gene            complement(254336..256258)
FT                   /locus_tag="BAA_0305"
FT   CDS_pept        complement(254336..256258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0305"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50746"
FT                   /protein_id="ACQ50746.1"
FT                   /translation="MILLQVNALSKLYGAETILANIKLEVQTKDRIALVGRNGAGKSTL
FT                   LKIIAGELSHDGGEIIKPKDVSMGYLAQNTGLETSLTIWDEMLTVFTHLQQMETKLRRL
FT                   EQEMGKEENFSNEATYERLLADYDQLQLDYKDQGGYQYEADIRSILSGLGFPVETHQTT
FT                   ISTLSGGQKTRLALGKLLLTKPDLLILDEPTNHLDIETLTWLEQYLQGYPGAILIVSHD
FT                   RYFLDKLVTQVYEISNKESRRFVGNYSKYLDLKSALYEQEMKRYEKQQDEIAKLEDFVQ
FT                   KNIARASTTKRAQSRRKQLDRMELLTRPLGDSKSASFHFDIEKQSGNDVLQVKDATIGY
FT                   DKDPIIEHVTMRLTRGDSVALVGPNGIGKSTLLKSIVNKLPLLHGDVSFGSNVSVGYYD
FT                   QEQANLTSSKRVLNELWDEYPLQPEKEIRTILGNFLFTGDDVLKPVSSLSGGQKARLAL
FT                   AKLMMQKSNLLILDEPTNHLDLNSKEILENALIDYPGTLLFVSHDRYFINRVTTTVIEL
FT                   STEGAQEYLGDYDYYVEKKNEMIERAELEQEDETPVQKTVAQEKLNYLEEKERKKLERQ
FT                   RTRKIEELEQNIVQFEEEIATLEDQLCLPEIYADYEKASEITTKKQTLQEQLDACMAEW
FT                   EELHV"
FT   gene            256446..257075
FT                   /locus_tag="BAA_0306"
FT   CDS_pept        256446..257075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0306"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02629;
FT                   match to protein family HMM PF06971"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47658"
FT                   /db_xref="GOA:C3PAU8"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR009718"
FT                   /db_xref="InterPro:IPR022876"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3PAU8"
FT                   /protein_id="ACQ47658.1"
FT                   /translation="MEQQKIPQATAKRLPLYYRFIQNLSLSGKQRVSSAELSEAVKVDS
FT                   ATIRRDFSYFGALGKKGYGYNVNYLLSFFRETLDQDDITRVALIGVGNLGTAFLHYNFT
FT                   KNNNTKIEMAFDVSEEKVGTEIGGIPVYHLDELEERLSSDIQVAILTVPATVAQSVADR
FT                   LAETNVHGILNFTPARLNVSDNIRIHHIDLAVELQTLVYFLKNYPQ"
FT   gene            complement(257293..258042)
FT                   /locus_tag="BAA_0307"
FT   CDS_pept        complement(257293..258042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0307"
FT                   /product="CAAX amino terminal protease family protein"
FT                   /note="identified by match to protein family HMM PF02517"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48396"
FT                   /protein_id="ACQ48396.1"
FT                   /translation="MKKQYWWVIVTYILMQLSSIAGLPLLLKTGLYDNRGFTREEKFQL
FT                   ITGHWAIISFFIALCIVLWLLRTDIRDRHLDTKRSTVPATIGWIFIGFFLAFFSQSIAG
FT                   MIEMYVLGIKPGSENTARLMDIARTTPWFLIVISIIGPILEEIVFRKILFGTLYKKFNF
FT                   FIAAIISSLVFAAIHFDFTHLLVYTAMGLVFAFLYVKTKRIIVPIAAHVAMNTLVAIAQ
FT                   VLVSNEQIQEMIKEAEKMQGFIGGFLV"
FT   gene            258443..258727
FT                   /gene="groES"
FT                   /locus_tag="BAA_0308"
FT   CDS_pept        258443..258727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groES"
FT                   /locus_tag="BAA_0308"
FT                   /product="chaperonin, 10 kDa"
FT                   /note="identified by match to protein family HMM PF00166"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47822"
FT                   /db_xref="GOA:C3PAV0"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3PAV0"
FT                   /protein_id="ACQ47822.1"
FT                   /translation="MLKPLGDRVVIELVQAEEKTASGIVLPDTAKEKPQEGKVIAVGTG
FT                   RVLENGERVALEVAAGDLIIFSKYAGTEVKYEGTDYLILRESDILAVIG"
FT   gene            258766..260400
FT                   /gene="groL"
FT                   /locus_tag="BAA_0309"
FT   CDS_pept        258766..260400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groL"
FT                   /locus_tag="BAA_0309"
FT                   /product="chaperonin GroL"
FT                   /note="identified by match to protein family HMM PF00118;
FT                   match to protein family HMM TIGR02348"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48532"
FT                   /db_xref="GOA:C3PAV1"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3PAV1"
FT                   /protein_id="ACQ48532.1"
FT                   /translation="MAKDIKFSEEARRSMLRGVDTLANAVKVTLGPKGRNVVLEKKFGS
FT                   PLITNDGVTIAKEIELEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLK
FT                   NVTAGANPMGLRKGIEKAVVAAVEELKTISKPIEGKSSIAQVAAISAADEEVGQLIAEA
FT                   MERVGNDGVITLEESKGFTTELDVVEGMQFDRGYASPYMITDSDKMEAVLDNPYILITD
FT                   KKISNIQEILPVLEQVVQQGKPLLIIAEDVEGEALATLVVNKLRGTFNVVAVKAPGFGD
FT                   RRKAMLEDIAILTGGEVITEELGRDLKSATVESLGRAGKVVVTKENTTVVEGVGSTEQI
FT                   EARIGQIRAQLEETTSEFDREKLQERLAKLVGGVAVIKVGAATETELKERKLRIEDALN
FT                   STRAAVEEGIVAGGGTSLMNVYTKVASIVAEGDEATGINIVLRALEEPVRQIAINAGLE
FT                   GSVVVERLKGEKVGVGFNAATGEWVNMLETGIVDPAKVTRSALQNAASVAAMFLTTEAV
FT                   VADKPEPNAPAMPDMGGMGMGGMGGMM"
FT   misc_binding    260541..260643
FT                   /bound_moiety="guanine and/or adenine"
FT                   /note="Purine riboswitch"
FT   gene            260799..262346
FT                   /gene="guaA"
FT                   /locus_tag="BAA_0311"
FT   CDS_pept        260799..262346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaA"
FT                   /locus_tag="BAA_0311"
FT                   /product="GMP synthase"
FT                   /EC_number="6.3.5.2"
FT                   /note="identified by match to protein family HMM PF00117;
FT                   match to protein family HMM PF00958; match to protein
FT                   family HMM TIGR00884; match to protein family HMM
FT                   TIGR00888"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49561"
FT                   /db_xref="GOA:C3PBL1"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3PBL1"
FT                   /protein_id="ACQ49561.1"
FT                   /translation="MIILKKQHDTIIVLDFGSQYNQLIARRIREFGVYSELHPHTITAE
FT                   EIKAMNPKGIIFSGGPNSVYGEGALHCDEKIFDLGLPIFGICYGMQLMTQQFGGTVERA
FT                   NHREYGKAVLKVENESKLYANLPEEQVVWMSHGDLVTGLPEGFVVDATSESCPIAGMSN
FT                   EAKNLYGVQFHPEVRHSEHGNDLIKNFVFGVCGCSEGWNMENFIEVELEKIRETVGDKK
FT                   VLCALSGGVDSSVVAVLIHKAIGDQLTCIFVDHGLLRKGEAEGVMKTFSEGFHMNVIKV
FT                   DAKERFMNKLKGVEDPEQKRKIIGNEFIYVFDDEASKLEGMDFLAQGTLYTDIVESGTA
FT                   TAQTIKSHHNVGGLPEDMQFKLIEPLNTLFKDEVRVLGSELGIPDEIVWRQPFPGPGLG
FT                   IRVLGEITEEKLEIVRESDAILREEIIKAGLDREIWQYFTALPGMRSVGVMGDERTYDY
FT                   TVGIRAVTSIDGMTADWARIPWDVLEKISVRIVNEVKHVNRIVYDVTSKPPATIEWE"
FT   misc_binding    262501..262603
FT                   /bound_moiety="guanine and/or adenine"
FT                   /note="Purine riboswitch"
FT   gene            262731..264056
FT                   /locus_tag="BAA_0313"
FT   CDS_pept        262731..264056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0313"
FT                   /product="xanthine/uracil permease family protein"
FT                   /note="identified by match to protein family HMM PF00860"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50214"
FT                   /protein_id="ACQ50214.1"
FT                   /translation="MKRYFQFDELGTNYKTEFIAGLTTFLSMAYVLFVNPATLSLGNVK
FT                   GLPAGTGMDPGAVFVATALAAAIGSLIMGIFAKYPIALAPGMGINAFFAYTAVLTMGIP
FT                   WQTAIAGTLMSGIIFIILTASGIREKIINAIPSELKFAVAAGIGLFIAFLGFQNAGIIV
FT                   KNDAVLVGLGDLTKGTTLLAIFGVVTTIIFMIKKVNGAVFYGMILTAILGVATGLIDTP
FT                   KAVVGAIPSLEPTFGAALTHFGDIFTVQMGIVIITFFFIDFFDTAGTLVAVANQAGLMK
FT                   NNKLPRAGKALFADAIATVIGAILGTSTTTSYIESSAGVAAGGRSGFTAVVTAGFFLLA
FT                   LFFSPLLSVVTPAVTAPALIIVGILMVSSLGEIDWKKFEIAVPAFFTIISMPLTYSIAT
FT                   GIAIGFIFYPITMVVSGRRKEIHPIMYVMGVLFVLYFIYVRK"
FT   gene            264201..264902
FT                   /locus_tag="BAA_0314"
FT   CDS_pept        264201..264902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0314"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46658"
FT                   /protein_id="ACQ46658.1"
FT                   /translation="MAHETILVVDDEKEIRNLITIYLKNEGYKVLQAGDGEEGLRLLEE
FT                   NEVHLVVLDIMMPKVDGIHMCMKIREEKEMPIIMLSAKTQDMDKILGLTTGADDYVTKP
FT                   FNPLELIARIKSQLRRYMKMNGFAIQNEDELEIGEMKINISTHKVIVEGEEVKLTPREF
FT                   SILELLARNPGMVFSAEQIYEKVWNERSFQSDNTVMVHIRKVREKIEENPRKPRYIKTV
FT                   WGVGYKIEKDI"
FT   gene            264934..266391
FT                   /locus_tag="BAA_0315"
FT   CDS_pept        264934..266391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0315"
FT                   /product="sensor histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50707"
FT                   /protein_id="ACQ50707.1"
FT                   /translation="MIEKLVKGVRKSIRIQLITTFAACALLGVFFAKGAAPFFENANRQ
FT                   ATIDYRAGMEQINHEAQRAANSSVHENKLEAISNMIEMENQNLERGSRALKILVTDESG
FT                   KVLYKTKQAQEEQIDLHNTIRNAASFAINYSNGRDVFENTRKEFIAFSPITIEDKNLYM
FT                   FVSGIPDGVVMYDTQEGPFPFLIGVLVFIFSFFYITKRKMKQIEAMAEGVKEIEKGNLA
FT                   YRIEKKGEDEIASLTENINNMAEELMNNIEKERKLEKQKNELITNVSHDLRTPLTSIMG
FT                   YLRLLRDSKYENKEQHDEYTRIAFAKSEQLKNLIEDLFEYTKLTNEQVVLEKQEVCVNE
FT                   LLEQLIEELVPQAEEHGLTFVKKFPEERAYAAIDSEKMVRVFDNLLMNAIKYSKDDGEI
FT                   KVSLQRQRWEIQIVIANHSEEFTREELASLFERFYKKDQSRSRVTEGSGLGLAIAKSIV
FT                   ELQGGSIRAEYKDGIIQFIVSLPIIER"
FT   gene            266712..268220
FT                   /gene="rrs_6"
FT                   /locus_tag="BAA_0316"
FT   rRNA            266712..268220
FT                   /gene="rrs_6"
FT                   /locus_tag="BAA_0316"
FT                   /product="16S ribosomal RNA"
FT   gene            268399..271306
FT                   /gene="rrl_6"
FT                   /locus_tag="BAA_0318"
FT   rRNA            268399..271306
FT                   /gene="rrl_6"
FT                   /locus_tag="BAA_0318"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(268423..268854)
FT                   /pseudo
FT                   /locus_tag="BAA_0317"
FT                   /note="conserved hypothetical protein; this region contains
FT                   one or more premature stops and/or frameshifts"
FT   gene            271356..271471
FT                   /gene="rrf_6"
FT                   /locus_tag="BAA_0319"
FT   rRNA            271356..271471
FT                   /gene="rrf_6"
FT                   /locus_tag="BAA_0319"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(271609..272562)
FT                   /pseudo
FT                   /locus_tag="BAA_0320"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   premature stop which may be the result of a sequencing
FT                   error"
FT   gene            complement(272795..273667)
FT                   /locus_tag="BAA_0321"
FT   CDS_pept        complement(272795..273667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0321"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF08241;
FT                   match to protein family HMM PF08242"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49261"
FT                   /protein_id="ACQ49261.1"
FT                   /translation="MNNFKLGNDFDNLVSPLSDVELLNLFIQSCSQTKINGTPVPMFPP
FT                   EEIQQQFVGASYEHALYEAYLFYSHVKTYAQNLGVPLNKERKILDFGCGWGRIIRFFFK
FT                   DIRDENLLGIDVDPAMINICNETLGRGIYKTANPQPPVEFISDNSLDIIFAYSVFSHLS
FT                   EETAEHWIKEFSRILRPGGIFIATTQARYFLDYCQQFKEHPEFIQTGWHKTLSQAFPDI
FT                   NRAISDYESGNFVHSPTGAGNVRNSRFYGETVIPRTYIKNHYEKYLKLRDFFDDVNRLP
FT                   QALFVLQKD"
FT   gene            complement(273694..274416)
FT                   /locus_tag="BAA_0322"
FT   CDS_pept        complement(273694..274416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0322"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF08241"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48715"
FT                   /protein_id="ACQ48715.1"
FT                   /translation="MEGNLKHNNGYCVICEKEATFIEHNDWLRDHYLCSTCHSIPRQRA
FT                   LVHVLNTLFPKWDSYHIHESSPGGITTQLLIKNCKNYTYSQYFKNYPLGQYFQGIRCEN
FT                   LENMTFQNESFDLFITQDVFEHVMEPEKAFKEIERVLKPGGAHVFTVPWYPTLPKTLQR
FT                   ARNNKDGIEYMEEPIYHGNPIDEKGALVTFDWGQDMIEYIYTHANMYTIVYLQKDRSLG
FT                   LDAEFLHVFISKKHEHNF"
FT   gene            complement(274720..275514)
FT                   /locus_tag="BAA_0323"
FT   CDS_pept        complement(274720..275514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0323"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50456"
FT                   /protein_id="ACQ50456.1"
FT                   /translation="MKNINQKFLEYIILHKDRIPHFHKDFPLILFWSHRSGCTALANWF
FT                   FFQIGLFPEAKKYNDFIHYYEFWVYKNNPNYIQAVHSGLLEAKKHVCKLVRNPYTRAVS
FT                   SFLLLADNPYASPQWDSIRKCFYNDKHSKQGISFKQFLYYVQTLGSNSQVIDMHFSQQY
FT                   VQGEEAFIQSYIPLEDFNKQIPKTENEYGLIKSDLTKLTSSGHHRAHKMVYTGSYAELS
FT                   ITDEAFPRFPTYASFYDKETMDLVTEIYAKDFEMYPYTKGIF"
FT   gene            275946..276719
FT                   /pseudo
FT                   /locus_tag="BAA_0324"
FT                   /note="UDP-glucose 4-epimerase; this gene contains a frame
FT                   shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF01370"
FT   gene            complement(276760..277533)
FT                   /locus_tag="BAA_0325"
FT   CDS_pept        complement(276760..277533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0325"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF08241;
FT                   match to protein family HMM PF08242"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47149"
FT                   /protein_id="ACQ47149.1"
FT                   /translation="MKEFIETNKDLISQIAQNYNVNASIHPEDHIFQFLVTNPVFPSKK
FT                   EAIDYYFKDGRKSAETLLDLMTSFYPPVDTPIKLLEFASGYGCVTRHLLNLQTNLRITA
FT                   CDIHEEAITFLERTLHTSSILSHPEPEQIKLSSTYDIVFGLSFFSHMPDTTWFRWLQTL
FT                   YNAVSPGGLFIFTTHGYQSKKYFGFPDLNKQGYWFLPSSEQLDLDVHQYGQTIVSPSYV
FT                   CDKIKLLPYNPIIKKYTEGFWWEHQDLWVIQKEIK"
FT   gene            complement(277601..278035)
FT                   /pseudo
FT                   /locus_tag="BAA_0326"
FT                   /note="glycosyl transferase, group 1 family; this gene
FT                   contains a premature stop which may be the result of a
FT                   sequencing error"
FT   gene            complement(278201..279532)
FT                   /pseudo
FT                   /locus_tag="BAA_0327"
FT                   /note="glycosyl transferase, group 1 family; this gene
FT                   contains a premature stop which may be the result of a
FT                   sequencing error; identified by match to protein family HMM
FT                   PF00534"
FT   gene            280010..281518
FT                   /gene="rrs_7"
FT                   /locus_tag="BAA_0328"
FT   rRNA            280010..281518
FT                   /gene="rrs_7"
FT                   /locus_tag="BAA_0328"
FT                   /product="16S ribosomal RNA"
FT   gene            281697..284604
FT                   /gene="rrl_7"
FT                   /locus_tag="BAA_0331"
FT   rRNA            281697..284604
FT                   /gene="rrl_7"
FT                   /locus_tag="BAA_0331"
FT                   /product="23S ribosomal RNA"
FT   gene            284655..284770
FT                   /gene="rrf_7"
FT                   /locus_tag="BAA_0332"
FT   rRNA            284655..284770
FT                   /gene="rrf_7"
FT                   /locus_tag="BAA_0332"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(285221..286018)
FT                   /gene="uppP"
FT                   /locus_tag="BAA_0333"
FT   CDS_pept        complement(285221..286018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uppP"
FT                   /locus_tag="BAA_0333"
FT                   /product="undecaprenyl-diphosphatase UppP"
FT                   /EC_number="3.6.1.27"
FT                   /note="identified by match to protein family HMM PF02673;
FT                   match to protein family HMM TIGR00753"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50087"
FT                   /protein_id="ACQ50087.1"
FT                   /translation="MSDIITAFILGIVEGLAEFLPISSTGHLILVGHLLGFEGERAKTF
FT                   EIVIQLGAILAIAILYHKRLVSLCNLKPLLRKEKKFNAFHVFLGVFPAVVAGLLLHDVI
FT                   KTYLFQPYTVVIGLVAGAILMIFAEVKKQEATSYSLDDLTYRQALTIGLFQCLAVYPGF
FT                   SRAGSTISGGLLAKVNYKTASEFSFLIALPVMVGATGLDLLKSWTYLSVDDIPMFAVGF
FT                   ITSFIVAMLAVVTFLKLLEKIGLKPFAYYRILLAILFTVFVLL"
FT   gene            complement(286036..286773)
FT                   /locus_tag="BAA_0334"
FT   CDS_pept        complement(286036..286773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0334"
FT                   /product="putative bacitracin ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47780"
FT                   /protein_id="ACQ47780.1"
FT                   /translation="MVNLFYTELLKLKRSNMFLISIIGAGVAPFLVVVASYIHIKTKQP
FT                   TPTIWFHQLFTEVNLYTTLVIGFPLYGVVVAYLFTREYAEDTLKNLLTIPVSRISFIIS
FT                   KFIILFLWIMMLTLVAWSLTLILGLLGNFPGFNTTLLLGSFLKFLICGGLLFLLSSPIV
FT                   LLTLVMKSYVPPIILTVIITMTNLMLVNSKHKDLFPWTATLDIANNELQPTYPPEYSYI
FT                   IIVTTAIFGFIATLFYFKRVDIH"
FT   gene            complement(286766..287695)
FT                   /locus_tag="BAA_0335"
FT   CDS_pept        complement(286766..287695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0335"
FT                   /product="putative bacitracin ABC transporter, ATP-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49493"
FT                   /protein_id="ACQ49493.1"
FT                   /translation="MSPINTIIKTTNLTKVYGKQKSVDNLNINVQQGEIYGFIGRNGAG
FT                   KTTTIRMLLGLIKPTSGTIEIFGEDLFQNQKDILSRIGSIVEVPGFYENLTAKENLLIN
FT                   AKIIGVYKKNAIEDTLEIVGLQHETKKLVGKYSLGMKQRLGIARALLHYPELLILDEPT
FT                   NGLDPIGIKEMRKLIHSLAQERNITILISSHILAEVEQLVDRIGIIHEGRLLEEVSLDK
FT                   LRKANRKYIEFQVNNENKAAMLLENQFQIFDYEVHDEGNIRIYSHFGQQGYINRTFVLN
FT                   DIEVLKMMISEDRLEDYFTKLVGGGTIG"
FT   gene            complement(287764..288777)
FT                   /locus_tag="BAA_0336"
FT   CDS_pept        complement(287764..288777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0336"
FT                   /product="putative sensor histidine kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46053"
FT                   /protein_id="ACQ46053.1"
FT                   /translation="MKIDKILFLISLQLIIYGLLHIQMDPKVKISLFITLILITMYLFF
FT                   SRIQFIQNHKSIDTKLSRALKGNLQTRLFTSNDQSLHNIVFSINELITELEKVRIKAKR
FT                   SEESRKQLLSSISHDIRTPLTSIIGYIDALKDGVAASEIEKQEYLKILYMKSNNLKHLV
FT                   DEIFNMAKLDANEFPLKEEKLDFSEVTREVLIDFLPEISKHNIKLQVLMPESTCPIIAD
FT                   HLSLMRIIGNLMKNAIYYGKDGKTIGVELLETDAAYELLIWDKGPGIPKHDLQNVFERM
FT                   YRSEQSRNSSFGGSGLGLSISKALVEKNGGHIWVESIPWERTTFGFSIPKHNTFKK"
FT   gene            complement(288767..289480)
FT                   /locus_tag="BAA_0337"
FT   CDS_pept        complement(288767..289480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0337"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48404"
FT                   /protein_id="ACQ48404.1"
FT                   /translation="MKDIRILIADDDKEIRNLLKIYLERELYMVDTAIDGEVALQLFNQ
FT                   NNYSIVILDLMMPKVDGIEVCRKLRDKTNVPILMLTAKDHEVDKILGLSIGADDYITKP
FT                   FSIHEVVARVKALIRRFLVLGSNINVQEKTTLAFKGLTINLNTYTVHTNKEEISLTGKE
FT                   LELLKFFTSNPGQVFTKTQLFRNVWDDNYIEDDNTVMVHIRKLRKKIEIDPSNPKFIQT
FT                   VWGIGYKFVGEKLED"
FT   gene            289983..291491
FT                   /gene="rrs_8"
FT                   /locus_tag="BAA_0338"
FT   rRNA            289983..291491
FT                   /gene="rrs_8"
FT                   /locus_tag="BAA_0338"
FT                   /product="16S ribosomal RNA"
FT   gene            291670..294577
FT                   /gene="rrl_8"
FT                   /locus_tag="BAA_0340"
FT   rRNA            291670..294577
FT                   /gene="rrl_8"
FT                   /locus_tag="BAA_0340"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(291694..292125)
FT                   /pseudo
FT                   /locus_tag="BAA_0339"
FT                   /note="conserved hypothetical protein; this region contains
FT                   one or more premature stops and/or frameshifts"
FT   gene            294628..294743
FT                   /gene="rrf_8"
FT                   /locus_tag="BAA_0341"
FT   rRNA            294628..294743
FT                   /gene="rrf_8"
FT                   /locus_tag="BAA_0341"
FT                   /product="5S ribosomal RNA"
FT   misc_binding    295231..295333
FT                   /bound_moiety="guanine and/or adenine"
FT                   /note="Purine riboswitch"
FT   gene            295442..295927
FT                   /gene="purE"
FT                   /locus_tag="BAA_0343"
FT   CDS_pept        295442..295927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="BAA_0343"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="identified by match to protein family HMM PF00731;
FT                   match to protein family HMM TIGR01162"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50215"
FT                   /protein_id="ACQ50215.1"
FT                   /translation="MKSLVGVIMGSTSDWETMKYACDILDELNIPYEKKVVSAHRTPDY
FT                   MFEYAETARERGLKVIIAGAGGAAHLPGMVAAKTNLPVIGVPVQSKALNGLDSLLSIVQ
FT                   MPGGVPVATVAIGKAGSTNAGLLAAQILGSFHDDIHDALELRREAIEKDVREGSELV"
FT   gene            295924..297075
FT                   /gene="purK"
FT                   /locus_tag="BAA_0344"
FT   CDS_pept        295924..297075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="BAA_0344"
FT                   /product="phosphoribosylaminoimidazole carboxylase, ATPase
FT                   subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="identified by match to protein family HMM PF02222;
FT                   match to protein family HMM PF02655; match to protein
FT                   family HMM TIGR01161"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48995"
FT                   /protein_id="ACQ48995.1"
FT                   /translation="MTRIILPGKTIGIIGGGQLGRMMALAAKEMGYKIAVLDPTKNSPC
FT                   AQVADIEIVASYDDLKAIQHLAEISDVVTYEFENIDYRCLQWLEKHAYLPQGSQLLSKT
FT                   QNRFTEKNAIEKAGLPVATYRLVQNQEQLTEAIAELSYPSVLKTTTGGYDGKGQVVLRS
FT                   EADVDEARKLANAAECILEKWVPFEKEVSVIVIRSVSGETKVFPVAENIHVNNILHESI
FT                   VPARITEELSQKAIAYAKVLADELELVGTLAVEMFATADGEIYINELAPRPHNSGHYTQ
FT                   DACETSQFGQHIRAICNLPLGETNLLKPVVMVNILGEHIEGVLRQVNRLTGCYLHLYGK
FT                   EEAKAQRKMGHVNILNDNIEVALEKAKSLHIWDHQEQLLEGKR"
FT   gene            297072..298379
FT                   /gene="purB"
FT                   /locus_tag="BAA_0345"
FT   CDS_pept        297072..298379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purB"
FT                   /locus_tag="BAA_0345"
FT                   /product="adenylosuccinate lyase"
FT                   /EC_number="4.3.2.2"
FT                   /note="identified by match to protein family HMM PF00206;
FT                   match to protein family HMM TIGR00928"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50819"
FT                   /protein_id="ACQ50819.1"
FT                   /translation="MISRYTRPEMGAIWTEENKFKAWLEVEILACEAWAELGDIPKEDV
FT                   KKIREHASFDIDRIYEIEKETRHDVVAFTRAVSETPALGEERKWVHYGLTSTDVVDTAL
FT                   SYILKQANEIILKDLENFVSILANKAKEHKYTIMMGRTHGVHAEPTTFGLKLGLWYEEM
FT                   KRNVERFKQAANTVRVGKLSGAVGTYANIDPFVEKYVCENLGLEAAPISTQTLQRDRHA
FT                   HYMSTLALIATSIEKMAVEIRGLQKSETREVEEAFAKGQKGSSAMPHKRNPIGSENMTG
FT                   LARVIRGYMMTAYENVPLWHERDISHSSAERVILPDATIALNYMLNRFGNIVKNLTVYP
FT                   ENMKRNMTRTYGLIYSQRVMLTLIDKGMVREEAYDIVQPKAMEAWETQVQFKELVEADE
FT                   RITSKLTQEEINECFNYEHHMQHVDTIFERLGLNEA"
FT   gene            298468..299187
FT                   /gene="purC"
FT                   /locus_tag="BAA_0346"
FT   CDS_pept        298468..299187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purC"
FT                   /locus_tag="BAA_0346"
FT                   /product="phosphoribosylaminoimidazolesuccinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /note="identified by match to protein family HMM PF01259;
FT                   match to protein family HMM TIGR00081"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47504"
FT                   /db_xref="GOA:C3PBM7"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3PBM7"
FT                   /protein_id="ACQ47504.1"
FT                   /translation="MQKLELLYEGKAKRIYRTESADMVWVEYKDSATAFNGEKKETITG
FT                   KGRLNNEITTLLFRKLQEVGIKTHFVEKLSETEQLVKKVSIIPLEVVTRNVIAGSLSKR
FT                   LGMEEGTVLAEPIVEFYFKDDDLGDPLVTEDHIRVLNVASPEQVSVLRDMALQINQVLI
FT                   DHFASCRVRLVDFKLEFGVTDEGAIILADEISPDTCRLWDETSNEKFDKDVFRRDLGNL
FT                   TDAYEEILKRLGGISHV"
FT   gene            299180..299434
FT                   /gene="purS"
FT                   /locus_tag="BAA_0347"
FT   CDS_pept        299180..299434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purS"
FT                   /locus_tag="BAA_0347"
FT                   /product="phosphoribosylformylglycinamidine synthase, purS
FT                   protein"
FT                   /note="identified by match to protein family HMM PF02700;
FT                   match to protein family HMM TIGR00302"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48746"
FT                   /protein_id="ACQ48746.1"
FT                   /translation="MYKVKVYVTLRESVLDPQGTAVKGALHSLSFTEVQDVRIGKYMEL
FT                   TIDKSVSDLDAKVKEMCEKLLANVVMEDFRYEVEEVVAQ"
FT   gene            299431..300114
FT                   /gene="purQ"
FT                   /locus_tag="BAA_0348"
FT   CDS_pept        299431..300114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purQ"
FT                   /locus_tag="BAA_0348"
FT                   /product="phosphoribosylformylglycinamidine synthase I"
FT                   /EC_number="6.3.5.3"
FT                   /note="identified by match to protein family HMM PF00117;
FT                   match to protein family HMM PF07685; match to protein
FT                   family HMM TIGR01737"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46198"
FT                   /db_xref="GOA:C3PBM9"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3PBM9"
FT                   /protein_id="ACQ46198.1"
FT                   /translation="MKFAVIVFPGSNCDVDMFHAIKDELGEEVDYVWHDTENLDEYDAI
FT                   LLPGGFSYGDYLRCGAISRFANAMKAVQKAAEQGKPILGVCNGFQILVESGLLPGALMR
FT                   NENLKFMCRTVQLRVENNETMFTSQYEKDEVINIPIAHGEGNYYCDEETLKQLEENNQI
FT                   AFRYVENPNGSVSDIAGIVNEKGNVLGMMPHPERAVDELLGGAEGLKVFQSILKQWRET
FT                   YVVNA"
FT   gene            300098..302317
FT                   /gene="purL"
FT                   /locus_tag="BAA_0349"
FT   CDS_pept        300098..302317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purL"
FT                   /locus_tag="BAA_0349"
FT                   /product="phosphoribosylformylglycinamidine synthase II"
FT                   /EC_number="6.3.5.3"
FT                   /note="identified by match to protein family HMM PF00586;
FT                   match to protein family HMM PF02769; match to protein
FT                   family HMM TIGR01736"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48285"
FT                   /db_xref="GOA:C3PBN0"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3PBN0"
FT                   /protein_id="ACQ48285.1"
FT                   /translation="MSLMLEPNPTQIKEERIYAEMGLTDEEFAMVEKILGRLPNYTETG
FT                   LFSVMWSEHCSYKNSKPVLRKFPTTGERVLQGPGEGAGIVDIGDNQAVVFKMESHNHPS
FT                   AIEPYQGAATGVGGIIRDVFSMGARPVALLNSLRFGELQSPRVKYLFEEVVAGIAGYGN
FT                   CIGIPTVGGEVQFDPCYEGNPLVNAMCVGLINHEDIKKGQAHGAGNTVMYVGASTGRDG
FT                   IHGATFASEELSESSEAKRPAVQVGDPFMEKLLIEACLELIQSDALVGIQDMGAAGLTS
FT                   SSAEMASKAGMGIEMYLDDVPQRETGMTPYEMMLSESQERMLIVVKKGREQEIVDLFEK
FT                   YGLAAVTMGKVTEDKMLRLFHKGEMVAEVPADALAEEAPIYHKPSKEAAYFAEFQQMKM
FT                   ETPKVENYKETLFALLQQPTIASKEWVYDQYDYQVRTSTVVTPGSDAAVVRVRGTEKGL
FT                   AMTTDCNSRYIYLDPEVGGKIAVAEAARNIVCSGGEPLAITDCLNFGNPEKPEIFWQIE
FT                   KSVDGMSEACRTLQTPVIGGNVSMYNERSGEAVYPTPTVGMVGLVHDLKHVTTQEFKQA
FT                   GDLVYVIGETKAEFGGSELQKMLHGKIFGQSPSIDLDVELKRQKQVLAAIQAGLVQSAH
FT                   DVAEGGLAVAISESAIGANGLGATVKLDGEATAALFAESQSRFVITVKRENKEAFEKAV
FT                   EAIQVGEVTNTNEVTIHNEENEVLLTANVDEMRKAWKGAIPCLLK"
FT   gene            302302..303717
FT                   /gene="purF"
FT                   /locus_tag="BAA_0350"
FT   CDS_pept        302302..303717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purF"
FT                   /locus_tag="BAA_0350"
FT                   /product="amidophosphoribosyltransferase"
FT                   /EC_number="2.4.2.14"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM PF00310; match to protein
FT                   family HMM TIGR01134"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50234"
FT                   /protein_id="ACQ50234.1"
FT                   /translation="MLAEIKGLNEECGVFGIWGHENAAQVSYYGLHSLQHRGQEGAGIV
FT                   VNNGEKIVGHKGLGLISEVFSRGELEGLNGKSAIGHVRYATAGGSEVANVQPLLFRFSD
FT                   HSMALAHNGNLINAKMLRRELEAEGSIFQTSSDTEVLLHLIKRSTKDSLIESVKEALNK
FT                   VKGAFAYLLLTGNEMIVALDPNGFRPLSIGKMGDAYVVASETCAFDVVGATYIRDVEPG
FT                   ELLIINDEGIHVDRFTNEVDHAICSMEYIYFARPDSNIAGINVHAARKNMGKRLAAEAP
FT                   IEADVVTGVPDSSISAAIGYAEATGIPYELGLIKNRYVGRTFIQPSQELREQGVKMKLS
FT                   AVRGVVEGKRVVMIDDSIVRGTTSKRIVRMLREAGATEVHVRIASPPLKYPCFYGIDIQ
FT                   TRKELIAANHTVEEIREMIGADSLTFLSEDGLVDAIGRPYEGKYGGLCMAYFNGDYPTA
FT                   LYDYEQELLESMK"
FT   gene            303824..304864
FT                   /gene="purM"
FT                   /locus_tag="BAA_0351"
FT   CDS_pept        303824..304864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purM"
FT                   /locus_tag="BAA_0351"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /note="identified by match to protein family HMM PF00586;
FT                   match to protein family HMM PF02769; match to protein
FT                   family HMM TIGR00878"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47153"
FT                   /db_xref="GOA:C3PBN2"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3PBN2"
FT                   /protein_id="ACQ47153.1"
FT                   /translation="MANAYKQAGVDIEAGYEAVSRMKKHVQTTMRKEVLGGLGGFGGMF
FT                   DLSKFALEEPVLVSGTDGVGTKLMLAFMADKHDTIGIDAVAMCVNDIVVQGAEPLFFLD
FT                   YIACGKAEPSKIENIVKGISEGCRQAGCALIGGETAEMPGMYSTEEYDLAGFTVGIVDK
FT                   KKIVTGEKIEAGHVLIGLASSGIHSNGYSLVRKVLLEDGELSLDRIYGRLELPLGEELL
FT                   KPTKIYVKPILELLKNHEVYGMAHITGGGFIENIPRMLPEGIGAEIELGSWKIQPIFSL
FT                   LQEVGKLEEKEMFNIFNMGIGMVVAVKEEDAKDIVRLLEEQGETARIIGRTVQGAGVTF
FT                   NGGKAL"
FT   gene            304861..305448
FT                   /gene="purN"
FT                   /locus_tag="BAA_0352"
FT   CDS_pept        304861..305448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purN"
FT                   /locus_tag="BAA_0352"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /EC_number="2.1.2.2"
FT                   /note="identified by match to protein family HMM PF00551;
FT                   match to protein family HMM TIGR00639"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48252"
FT                   /protein_id="ACQ48252.1"
FT                   /translation="MSRLAVFASGSGSNFQSLVNAVEEKRLDAEISLLVCDKPEARAVG
FT                   RANYHHIPCFAFSAKAYESKEAFEKEILNKLEEYEIDYVILAGYMRLIGPTLLEAYGGR
FT                   IINIHPSLLPSFPGKDAVGQALEAGVKVTGVTIHYVDAGMDTGPIIAQEAVVVSEGDTR
FT                   ESLQKKIQQVEHKLYVNTVNQIVQSTKEPTVN"
FT   gene            305473..307008
FT                   /gene="purH"
FT                   /locus_tag="BAA_0353"
FT   CDS_pept        305473..307008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="BAA_0353"
FT                   /product="phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase"
FT                   /EC_number="2.1.2.3"
FT                   /EC_number="3.5.4.10"
FT                   /note="identified by match to protein family HMM PF01808;
FT                   match to protein family HMM PF02142; match to protein
FT                   family HMM TIGR00355"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49609"
FT                   /db_xref="GOA:C3PBN4"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3PBN4"
FT                   /protein_id="ACQ49609.1"
FT                   /translation="MKKRALVSVSDKTGVVEFVKGLLEQGIEVISTGGTKKLLEENGLQ
FT                   VIGISEVTGFPEIMDGRVKTLHPNIHGGLLAVRDNETHVAQMNELGMEPIDFVVVNLYP
FT                   FKETIAKPDVTFADAIENIDIGGPTMIRSAAKNHKFVSVIVDPVDYDVVLAELKENGEV
FT                   AEETKRKLAAKVFRHTAAYDALISNYLTEQMGEESPETLTVTFEKKQDLRYGENPHQKA
FT                   TFYKAPFAATSSVAYAEQLHGKELSYNNINDADAALSIVKEFTEPAVVAVKHMNPCGVG
FT                   VGTDIHEAYTRAYEADPVSIFGGIIAANREIDKATAEKLHEIFLEIIIAPSFSKEALEV
FT                   LQSKKNLRLLTVNIEKATSASKKLTSVQGGLLVQEEDTLSLDESTISIPTKREPSEQEW
FT                   KDLKLAWKVVKHVKSNAIVLAKDDMTIGVGAGQMNRVGSAKIAITQAGEKAQGSALASD
FT                   AFFPMPDTVEEAAKAGITAIIQPGGSIRDEDSIKVADTYGIAMVFTGVRHFKH"
FT   gene            307130..308401
FT                   /gene="purD"
FT                   /locus_tag="BAA_0354"
FT   CDS_pept        307130..308401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="BAA_0354"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="identified by match to protein family HMM PF01071;
FT                   match to protein family HMM PF02222; match to protein
FT                   family HMM PF02655; match to protein family HMM PF02843;
FT                   match to protein family HMM PF02844; match to protein
FT                   family HMM PF08442; match to protein family HMM TIGR00877"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48040"
FT                   /protein_id="ACQ48040.1"
FT                   /translation="MNVLVIGRGGREHALAWKFAQSEKVEKVYVAPGNEGMRDVATPID
FT                   IDENDFDALVLFAKENHVELTFVGPEIPLMNGIVDRFKEEGLRVFGPNKAAAVIEGSKA
FT                   FTKELMKKYNIPTAAYETFTDYEEAVQYIEKVGAPIVIKADGLAAGKGVTVAMTLEEAL
FT                   QAAKEMLQDVKFGEASKKVVIEEFLDGQEFSLMAFVNGTTVHPMVIAQDHKRAFDGDKG
FT                   PNTGGMGAYSPVPQISESAVQEAIETVLYPTAKAMIQENRSFTGILYAGLILTNDGPKV
FT                   IEFNARFGDPETEVVLPRLENDLVDVCNAVLDESELTLQWSDEAVIGVVLAAKGYPEAY
FT                   KKGDIIKGLDALQDVIVFHAGTAMKRGDFVTNGGRVLFVACKANSLQEAKDKVYKEIGK
FT                   IESDVLFYRSDIGYRAIGHEMTRS"
FT   gene            complement(308437..308601)
FT                   /locus_tag="BAA_0355"
FT   CDS_pept        complement(308437..308601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0355"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47451"
FT                   /protein_id="ACQ47451.1"
FT                   /translation="MAKKKSFPLRIDPELHAVIEKWANDEFRSVNAHIEYLLREMAKQK
FT                   GKLKKDKDA"
FT   gene            complement(308618..309463)
FT                   /locus_tag="BAA_0356"
FT   CDS_pept        complement(308618..309463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0356"
FT                   /product="SPFH domain/band 7 family protein"
FT                   /note="identified by match to protein family HMM PF01145"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46611"
FT                   /protein_id="ACQ46611.1"
FT                   /translation="MKEKQVFYVNGFLGIIGILILAAIGVFFLIQEIFIGAALTIILAA
FT                   VLATGIGIVQPNQAKVITFFGNYLGTIRQNGLFLTIPFAFRQTVSLRVENFNSKKLKVN
FT                   DVDGNPIEIAAVIVYKVVDSAKAMFGVEHYDRFVEIQSETAIRHVATKYPYDNFQDETC
FT                   ITLRGNTEEISEELKRELEARLEIAGVEVLETRLTHLAYATEIAHAMLQRQQAKAVLAA
FT                   RKEIVEGAVKMAKDSIHMLDEEGVLELDDERKANMVNNLLVAIVSDKGAQPVINTGSLY
FT                   "
FT   gene            complement(309673..310050)
FT                   /locus_tag="BAA_0357"
FT   CDS_pept        complement(309673..310050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0357"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46058"
FT                   /protein_id="ACQ46058.1"
FT                   /translation="MKQNIGTINALIRITLGLVLFGCSATKLVRKPWCTWSNILLWIGA
FT                   MKVAEGIVRFCPVVEMWKFGKYMNMGAFKMPSMNFAEKGHTKEEVNQTSNHDKPQSNGS
FT                   YDASDKEIESAIEDIILAKPL"
FT   gene            310385..311074
FT                   /locus_tag="BAA_0358"
FT   CDS_pept        310385..311074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0358"
FT                   /product="pcrB family protein"
FT                   /note="identified by match to protein family HMM PF01884;
FT                   match to protein family HMM TIGR01768"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46646"
FT                   /db_xref="GOA:C3PBN9"
FT                   /db_xref="InterPro:IPR008205"
FT                   /db_xref="InterPro:IPR038597"
FT                   /db_xref="InterPro:IPR039074"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3PBN9"
FT                   /protein_id="ACQ46646.1"
FT                   /translation="MYDISGWKHVFKLDPNKELSDEHLEMICESGTDAVIVGGSDGVTI
FT                   DNVLHMLVSIRRYAVPCVLEVSDVEAITPGFDFYYIPSVLNSRKVEWVTGVHHEALKEF
FT                   GDIMDWDEIFMEGYCVLNPEAKVAQLTDAKCDVTEDDVIAYARLADKLLRLPIFYLEYS
FT                   GTYGDVELVKNVKAELKQAKLYYGGGISNAEQAKEMAQHADTVVVGNIIYDDIKAALKT
FT                   VKAVKGE"
FT   gene            311075..313330
FT                   /gene="pcrA"
FT                   /locus_tag="BAA_0359"
FT   CDS_pept        311075..313330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcrA"
FT                   /locus_tag="BAA_0359"
FT                   /product="ATP-dependent DNA helicase PcrA"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00580;
FT                   match to protein family HMM TIGR01073"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45933"
FT                   /protein_id="ACQ45933.1"
FT                   /translation="MQAYMSMTDRLLNGLNPQQQKAVQTTNGPLLLMAGAGSGKTRVLT
FT                   HRIAYLLGEKGVAPWNVLAITFTNKAAREMRERIDTLVGPEAEDIWISTFHSMCVRILR
FT                   RDIDHIGINRNFTILDSGDQLTVVKKIMKERNIDPKKFEPRSILAGISNAKNELLSADK
FT                   YAKKITIADPYEKLTSDVYTEYQKRLLKNNSLDFDDLIMTTIQLFERVPEVLEFYQRKF
FT                   QYIHVDEYQDTNKAQYLLVKHLAARFKNLCVVGDSDQSIYRWRGADISNILSFEKDYEN
FT                   AQVILLEQNYRSSQNILNAANAVIERNTNRKPKKLWTDNEVGSKISYYRAATEKDEAYF
FT                   VAKKIRDDIQMGKRKYTDFAVLYRTNAQSRMVEEIFLKSNIPYKIVGGTKFYDRKEIKD
FT                   ILAYLRLIGNPDDEISFARIINVPKRGIGATSIDKIINYGVQNGISLTAVFDEIEHVGV
FT                   SAKVTKAVKEFAGLLHNWVNMQEYLSVTELVEEVIEKTGYRDMLKNERTLEAEGRLENL
FT                   DEFLSVTQTFESQSEDKSLVAFLTDLALVADIDRVDEDPTAGEEVILMTMHSAKGLEFP
FT                   VVFIVGLEEGIFPHTRSLMEEDEMQEERRLAYVGITRAEEELYLSNAQMRTLFGRTSMN
FT                   AASRFITEIPTELVESLNETAPKRETSFGAKGRVASSSKTTTTTRSRSAFARPAAKTTG
FT                   GEQIGWAVGDKASHQKWGVGTVISVKGEGDAKELDIAFPSPIGVKRLLAKFAPVTKQ"
FT   gene            313346..315355
FT                   /gene="ligA"
FT                   /locus_tag="BAA_0360"
FT   CDS_pept        313346..315355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ligA"
FT                   /locus_tag="BAA_0360"
FT                   /product="DNA ligase, NAD-dependent"
FT                   /EC_number="6.5.1.2"
FT                   /note="identified by match to protein family HMM PF00533;
FT                   match to protein family HMM PF00633; match to protein
FT                   family HMM PF01653; match to protein family HMM PF03119;
FT                   match to protein family HMM PF03120; match to protein
FT                   family HMM TIGR00575"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50958"
FT                   /db_xref="GOA:C3PBP1"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3PBP1"
FT                   /protein_id="ACQ50958.1"
FT                   /translation="MSKEIAKKRIEELRDLLNTFNYQYHVLDNPSVSDAEYDRNMQELI
FT                   KLEAENPEFMSEDSPSIRVGGTVLDIFEKVTHKSPMLSLGNAFNEGDLRDFDRRVRQGI
FT                   DDANVRYICELKIDGLAVSLHYEKGRFIQGATRGDGVTGEDITQNLKTIKAIPLRLNEE
FT                   VTLEARGEAYMPKRSFVKLNEEKEQNGEDVFANPRNAAAGSIRQLDPKIAAKRNLSMFV
FT                   YGLANVEEKTIPSHSESLDYLGELGFKTNPNRRTCETIEEVIAYVEEWQEKRPHLDYEI
FT                   DGIVIKVDDVALQESLGTTAKSPRWAIAYKFPAEEVVTRLTGIELSVGRTGVVTPTAEL
FT                   EPVRVAGTIVRRASLHNEDLIREKDIRIGDYVVVKKAGDIIPEVVNVIFDKRTGGEEEY
FT                   HMPTHCPACESELVRLEEEVALRCINPTCPAQIREGLIHFVSRNAMNIDGLGERVITQL
FT                   FDADYIRTFADLYSLTKEQLLQLERFGEKSATNLVQAIENSKENSLERLLFGLGIRHVG
FT                   AKAARTFAEHFETMDALVKATEEELKAINEIGEKMAQSVVAYFDNEDVLELLQQFKEYG
FT                   VNMTYKGIKIADLQNVESYFAGKTVVLTGKLEVMGRSEAKKKIEALGGKVTGSVSKSTD
FT                   LVVAGEAAGSKLAQAEKHNVEVWNEERFLQELNK"
FT   gene            315372..316565
FT                   /locus_tag="BAA_0361"
FT   CDS_pept        315372..316565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0361"
FT                   /product="putative lipoprotein"
FT                   /note="identified by match to protein family HMM PF07537"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50183"
FT                   /protein_id="ACQ50183.1"
FT                   /translation="MKKIALAVLSLGLLVSGCSAGADKDEKVVEKSGKAKEQVIVPNYS
FT                   ISDEYYKTTIPFEGGNARGLVVQGVSNRLDIDEFETGLMRIAKESFSTKDNVLKGGKSL
FT                   TTQYIQMLVKRKRTDAEQKELEDTLKKDAVKFPNIGLNPALGAGSESLEAKNKKNPIYI
FT                   SNILEHDYYVNKDKKDERSGIVVGLAMNSVHYYEEEHGYPREVTISNEKMLAEGKKMVP
FT                   EILKVMHQQDPETKNLPITFAIYRQAPKSSLVPGNFVSYGNVEKGSETVEDWKQINEKY
FT                   YLFPSEQAKTDNKREDLARVSNFKAKLSDYFQGDYTAVIGTGMYRDDELREIKLDIPVQ
FT                   FNGKAEIIGFTQYVAGLVMEYFPNYMKVQVTIKSVERPEAIIIREAKQDEPYVKILD"
FT   gene            316661..317431
FT                   /locus_tag="BAA_0362"
FT   CDS_pept        316661..317431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0362"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF01925"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49521"
FT                   /protein_id="ACQ49521.1"
FT                   /translation="MDELSFQVIILLIAFGFLAAFIDSVVGGGGLISLPALMFVGLPPA
FT                   SAIATNKLAATMGTFTSAIYFIRSGKVDFKIVGKLIPLTVIGAVAGALVVKFIPPDILR
FT                   PLVLVMLVFIAIYIIAKKDWGSVSTYKKMTKRKTLIFFFVILMIGFYDGFFGPGTGSFL
FT                   IFAFLLIGLDFIQAAASGKLLNFVSNIVSLITFLFLDVIHFEYGIIMGLSMIFGAYFGS
FT                   KFAVQKGVGYVRALFLLVTILLISKNVLEYTHIL"
FT   gene            317585..319132
FT                   /locus_tag="BAA_0363"
FT   CDS_pept        317585..319132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0363"
FT                   /product="putative delta-1-pyrroline-5-carboxylate
FT                   dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00171;
FT                   match to protein family HMM TIGR01237"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48277"
FT                   /db_xref="GOA:C3PBP4"
FT                   /db_xref="InterPro:IPR005932"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3PBP4"
FT                   /protein_id="ACQ48277.1"
FT                   /translation="MVVAYKHEPFTDFSVEANKLAFEEGLKKVESYLGQDYPLIIGGEK
FT                   ITTEDKIVSVNPANKEELVGRVSKASRELAEKAMQVADETFQTWRKSKPEMRADILFRA
FT                   AAIVRRRKHEFSAILVKEAGKPWNEADADTAEAIDFMEYYGRQMLKLKDGIPVESRPIE
FT                   YNRFSYIPLGVGVIISPWNFPFAIMAGMTTAALVSGNTVLLKPASTTPVVAAKFMEVLE
FT                   EAGLPAGVVNFVPGNGSEVGDYLVDHPRTRFISFTGSRDVGIRIYERAAKVNPGQIWLK
FT                   RVIAEMGGKDTIVVDKEADLELAAKSIVASAFGFSGQKCSACSRAVIHEDVYDHVLNRA
FT                   VELTKELTVANPAVLGTNMGPVNDQAAFDKVMSYVAIGKEEGRILAGGEGDDSKGWFIQ
FT                   PTIVADVAEDARLMKEEIFGPVVAFCKAKDFDHALAIANNTEYGLTGAVISNNRDHIEK
FT                   AREDFHVGNLYFNRGCTGAIVGYQPFGGFNMSGTDSKAGGPDYLALHMQAKTTSETL"
FT   gene            319318..319467
FT                   /locus_tag="BAA_0364"
FT   CDS_pept        319318..319467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0364"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47134"
FT                   /protein_id="ACQ47134.1"
FT                   /translation="MGKYQLDYKGQVAVAKFHEKQTPVKFDKKQQIEKLRAEYLKKKQK
FT                   QTDK"
FT   gene            complement(319699..320262)
FT                   /locus_tag="BAA_0365"
FT   CDS_pept        complement(319699..320262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0365"
FT                   /product="isochorismatase family protein"
FT                   /note="identified by match to protein family HMM PF00857"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46465"
FT                   /protein_id="ACQ46465.1"
FT                   /translation="MKTALLLVDIQNDYFPHGKMELRNPAEASAYASQLLQLFRKKNEP
FT                   IFHIQHISIKEDATFFLPNTEGVHIHESVRPLREESVILKHYPNSFRETDLLKQLQRLA
FT                   IEHVVICGMMTHMCIDATVRAAFDFGLQCTVIHDACATKDLSFKNATIPAVYIHNTILA
FT                   SLNGVYANVMSTEEFLATKKHSLQ"
FT   misc_binding    320505..320611
FT                   /bound_moiety="S-adenosyl methionine"
FT                   /note="SAM riboswitch (S box leader)"
FT   gene            320735..321754
FT                   /locus_tag="BAA_0367"
FT   CDS_pept        320735..321754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0367"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF09383"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46051"
FT                   /protein_id="ACQ46051.1"
FT                   /translation="MISFNNVSKVYESGGQSVHAVEDVTLSVEKGEIFGIIGFSGAGKS
FT                   TLLRLVNMLERPTAGTISIDDKDITSLSTKELRKLRQRIGMIFQSFNLFNSRTVFGNIA
FT                   YPLKLAKVPKNEIKERVNELLKFVGLEDKANNYPEQLSGGQKQRVGIARALATSPDILI
FT                   CDEATSALDPETTTEILNLLKKVNREYNLTILLITHEMHVVKEICHRVAVMEKGKVIEE
FT                   GKLFDVFTQPKTTTTQNFVRSVINDHLPESVLAKIQNGGQIYRLTFTGEETGQPVLSYI
FT                   AKNYNVDVNVLYGNIIELQNVLFGNLLVELQGEQREIQKALQHLRLQVQLKEVEAHAS"
FT   gene            321744..322409
FT                   /locus_tag="BAA_0368"
FT   CDS_pept        321744..322409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0368"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50382"
FT                   /protein_id="ACQ50382.1"
FT                   /translation="MRVDWSIFWPRILDATGDTLLMVIVTLIFATILGIPLGLLLYVTR
FT                   KGNFLENKWVFSILNIIINTIRPIPFIIFLVALSPLTRSVIGTTIGTAAAIFPMTLVAS
FT                   IGIARMVETNLVSVPKGVIEAAQAMGASPIRIVFEILVPEALAPLILGVTFMTVGLIEF
FT                   SAVAGLVGGGGLGDLAMTYGYQRFDTSVMFVTVVLLIILVQLAQNLGNYFAKVFLRRS"
FT   gene            322431..323285
FT                   /locus_tag="BAA_0369"
FT   CDS_pept        322431..323285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0369"
FT                   /product="putative ABC transporter, substrate-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF03180"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50683"
FT                   /protein_id="ACQ50683.1"
FT                   /translation="MKKILAFALSAIVGVSALSGCSSGDTGAGAKEKVVRVGVTGTDGD
FT                   AWEILKRKAEKEGIKIKLVEFSDYTTPNKALADGDIELNSFQHIAFLEQFKKEHKLDIT
FT                   AVGTTQIAPMGLYSEKHKKANEIPDGSEIAIPNDPTNQARALKLLDAAGLLKLKKDFGL
FT                   FGDPSGIAENPKKLKITPVIAQQTPRVLKDVAASVINNGVAGQAGLDPAKDPIFLEDPK
FT                   NENAKPYINIFAARTKDKDDPTLKKVIELYHSKEVTDAIKKETNDGSISVDLSLDELEK
FT                   IVK"
FT   gene            complement(323452..323922)
FT                   /locus_tag="BAA_0370"
FT   CDS_pept        complement(323452..323922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0370"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50280"
FT                   /protein_id="ACQ50280.1"
FT                   /translation="MLKRISTIIFWIIPLLFFIHNLEESFQMPQYLANQFSITFISSQH
FT                   FFIAISVLTLFVLVIIFLYQLNFLSSIYWIIFIQGAIFFNSVQHIILFFIYRSYNPGVI
FT                   STVFIVIFSIFFFSSQKHLIHKKQFVITLVFSLFSYPIIIWITLLLASYFHS"
FT   gene            complement(323981..324172)
FT                   /locus_tag="BAA_0371"
FT   CDS_pept        complement(323981..324172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0371"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49461"
FT                   /protein_id="ACQ49461.1"
FT                   /translation="MHEELLRKIIRTKIKVGMHILEELPAPIQQSAKQMLNILQEELSS
FT                   YPNEQGHHKNNLKNIIIE"
FT   gene            complement(324165..324818)
FT                   /pseudo
FT                   /locus_tag="BAA_0372"
FT                   /note="anion-transporting ATPase family protein; this gene
FT                   contains a frame shift which may be the result of a
FT                   sequencing error"
FT   gene            complement(324836..325345)
FT                   /pseudo
FT                   /locus_tag="BAA_0373"
FT                   /note="arsenite-activated ATPase ArsA; this gene contains a
FT                   frame shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF02374"
FT   gene            complement(325422..325904)
FT                   /locus_tag="BAA_0374"
FT   CDS_pept        complement(325422..325904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0374"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="identified by match to protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45934"
FT                   /protein_id="ACQ45934.1"
FT                   /translation="MLQYEHFLDLLLDNAKKLFYPEEWVSLDLTLSKTEVFCLLWMERN
FT                   TDITMTKIADLLDIPMSTTTGVVNRLVKKGYIERYRDENDRRIVLIRLTENGVTLVQEV
FT                   KQNAAHYFNLVTEALSEEEKAFLLQIFQKIMNHIATSQQKTEEKVSTPKMKNIPIE"
FT   gene            326136..326252
FT                   /pseudo
FT                   /locus_tag="BAA_0375"
FT                   /note="conserved hypothetical protein; this region contains
FT                   one or more premature stops and/or frameshifts"
FT   gene            326515..326805
FT                   /gene="gatC"
FT                   /locus_tag="BAA_0376"
FT   CDS_pept        326515..326805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatC"
FT                   /locus_tag="BAA_0376"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, C subunit"
FT                   /EC_number="6.3.5.-"
FT                   /note="identified by match to protein family HMM PF02686;
FT                   match to protein family HMM TIGR00135"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47046"
FT                   /db_xref="GOA:C3PBQ3"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3PBQ3"
FT                   /protein_id="ACQ47046.1"
FT                   /translation="MSRISVENVKHVAHLARLAITDQEAEKFQKQLDAIVTFAEQLNEL
FT                   DTTDVKPTTHVLTMKNVMREDVPEKGLPVEEVLKNAPDHKDNQIRVPAVLE"
FT   gene            326821..328278
FT                   /gene="gatA"
FT                   /locus_tag="BAA_0377"
FT   CDS_pept        326821..328278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatA"
FT                   /locus_tag="BAA_0377"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, A subunit"
FT                   /EC_number="6.3.5.-"
FT                   /note="identified by match to protein family HMM PF01425;
FT                   match to protein family HMM TIGR00132"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50459"
FT                   /db_xref="GOA:C3PBQ4"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3PBQ4"
FT                   /protein_id="ACQ50459.1"
FT                   /translation="MSLFDHSVSELHKKLNNKEISVTDLVEESYKRIADVEDNVKAFLT
FT                   LDEENARAKAKELDAKIGAEDNGLLFGMPIGVKDNIVTNGLRTTCASKILANFDPIYDA
FT                   TVVQKLKAADTITIGKLNMDEFAMGSSNENSGFYATKNPWNLDYVPGGSSGGSAAAVAA
FT                   GEVLFSLGSDTGGSIRQPAAYCGVVGLKPTYGRVSRYGLVAFASSLDQIGPITRTVEDN
FT                   AYLLQAISGLDRMDATSANVEVGNYLAGLTGDVKGLRIAVPKEYLGEGVGEEARESVLA
FT                   ALKVLEGMGATWEEVSLPHSKYALATYYLLSSSEASANLSRFDGVRYGVRSDNVNNLMD
FT                   LYKNTRSEGFGDEVKRRIMLGTFALSSGYYDAYYKKAQQVRTLIKNDFENVFANYDVII
FT                   GPTTPTPAFKVGEKVDDPMTMYANDILTIPVNLAGVPAISVPCGFGANNMPLGLQIIGK
FT                   HFDEATIYRVAHAFEQATDHHTKKASL"
FT   gene            328293..329720
FT                   /gene="gatB"
FT                   /locus_tag="BAA_0378"
FT   CDS_pept        328293..329720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatB"
FT                   /locus_tag="BAA_0378"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, B subunit"
FT                   /EC_number="6.3.5.-"
FT                   /note="identified by match to protein family HMM PF01162;
FT                   match to protein family HMM PF02637; match to protein
FT                   family HMM PF02934; match to protein family HMM TIGR00133"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45986"
FT                   /db_xref="GOA:C3PBQ5"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3PBQ5"
FT                   /protein_id="ACQ45986.1"
FT                   /translation="MNLETIIGLEVHVELKTNSKIFSASPTEFGAEPNTQTSVIDLGYP
FT                   GVLPTLNKEAVNFAMKAAMALNCEIATETKFDRKNYFYPDNPKAYQISQFDKPIGENGW
FT                   IEIEVDGKKKRIGITRLHLEEDAGKSTHTADGSLVDYNRQGMPLIEIVSEPDMRTPEEA
FT                   YAYLEKLKSIIQYTGVSDCKMEEGSLRCDANISLRPVGQEKFGTKAELKNLNSFTYVQK
FT                   GLEHEQVRQEKELLSGGIIQQETRRYDEATKKTILMRVKEGSDDYRYFPEPDLVELYID
FT                   DAWKEEVRASIPELPDARKARYVAEIGLPAYDAHVLTLTKEMSDFFEAAIADGADAKLT
FT                   SNWLMGEVLAYLNKQQKELKDVALTPAGLSKMVQLIEKGTISSKIAKKVFNELIEKGGD
FT                   PEEIVKAKGLVQISDEGTLRKVVTEILDNNEQSIEDFKNGKDRAIGFLVGQIMKATKGQ
FT                   ANPPLVNKILLEEINKR"
FT   gene            330191..331096
FT                   /locus_tag="BAA_0379"
FT   CDS_pept        330191..331096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0379"
FT                   /product="conserved hypothetical protein TIGR00147"
FT                   /note="identified by match to protein family HMM PF00781;
FT                   match to protein family HMM TIGR00147"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49128"
FT                   /protein_id="ACQ49128.1"
FT                   /translation="MMKRARIIYNPTSGRELFKKSLPEVLQKLEQAGYEASCHATTGPG
FT                   DATVAARQAADRKFDVVIAAGGDGTLNEVVNGLVGHEHRPKFGIIPVGTTNDFARAIGV
FT                   PRSIEEAADIICEGKTVPLDLGRANDTYFINIAGGGRITELTYEVPSKLKTVLGQLAYY
FT                   LKGIEMLPSLHPTYVEIEYDGKLLQEEITMFLITNTRSVGGFEKVAPYASINDGLFDLL
FT                   VLKKGSIADLIKAATQAQRGEHINNPKVLYTQANRIKVHSPDKLMINLDGEYGGDAPME
FT                   FENIYHCLELFVPEHQEDAL"
FT   gene            331236..331979
FT                   /locus_tag="BAA_0380"
FT   CDS_pept        331236..331979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0380"
FT                   /product="haloacid dehalogenase/epoxide hydrolase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01549"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49861"
FT                   /protein_id="ACQ49861.1"
FT                   /translation="MEKVKAILFDKDGTLMDFHSIWIKVAEELVAECINLYELPKSMQP
FT                   TLLKEIGVEGVFVNPRSAIAAGTSLDVAKGLCKYITSSKEEEMHEWVSEKLFSLMYEHR
FT                   SYMKMTADLPRILQSLKDRGFILGVVTADDFAPTELFLKQYQLESFFDYVVASDTFPAQ
FT                   KPDKRIVESFCDKFHLDACEVAVVGDTPTDLHLAKNGDCYAIGVLSGTGDRQTLEPLAD
FT                   LVVQSVEDFISHSGEFIWERGKSNV"
FT   gene            332062..333498
FT                   /gene="gabT"
FT                   /locus_tag="BAA_0381"
FT   CDS_pept        332062..333498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabT"
FT                   /locus_tag="BAA_0381"
FT                   /product="4-aminobutyrate transaminase"
FT                   /EC_number="2.6.1.19"
FT                   /note="identified by match to protein family HMM PF00202;
FT                   match to protein family HMM TIGR00700"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48400"
FT                   /protein_id="ACQ48400.1"
FT                   /translation="MEKNVGIHFAIKRENNVKKRMGYVMNTKKFAKVNEQIPGPKAASL
FT                   LERRQNIVPKGVSNGIPTFVQSANGALVTDVDGNQYIDFAGAIGTINVGHCHPAVKEAL
FT                   HKQVDQYIHTGFNVMMYEPYIELAEKLAALAPGSFDKQVLFLNSGAEAVENAVKIARKY
FT                   TKRPGIIAFSKGFHGRTLMTMTMTSKVKPYKFGFGPFAPEVYKAPFPYEYRCPEGLTEE
FT                   QYDDFMIEEFKNFFISEVAPETIAAVVMEPVQGEGGFIVPSKKFAQEVRNICSEHGILF
FT                   VADEIQTGFSRTGKYFAIDHYDVVPDLITVSKSLGAGVPISGVIGRKEIMNESAPGELG
FT                   GTYAGSPLGCAAALAVLDVIEKENLNDRAIELGKVVMNRFEEMKNKYNCIGDVRGLGAM
FT                   CAFELVQDRKTKTPDKTLTANLCTEANKRGLLLLSAGTYGNVIRVLMPLVITDEQLEEG
FT                   LTIIEESLQICYEKANTARV"
FT   gene            333611..334978
FT                   /locus_tag="BAA_0382"
FT   CDS_pept        333611..334978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0382"
FT                   /product="sensory box sigma-54 dependent DNA-binding
FT                   response regulator"
FT                   /note="identified by match to protein family HMM PF00158;
FT                   match to protein family HMM PF07728; match to protein
FT                   family HMM PF08448; match to protein family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48802"
FT                   /protein_id="ACQ48802.1"
FT                   /translation="MVAEKERVLMDLQDVFEYAFDEIFVTDDKGIVVRVNSTCERHYQI
FT                   AAKELVGKHVKELQKDGIFYPSATLEVIEKKRPIELVQTTKSGEYLHVRTRPVFDDEGN
FT                   LRRVISYSRDLTELYQLRQKVEEMDNQLKTYKKELRETYEHEGLIFKSIAMQKIIETIK
FT                   KVSVVDSTVLVLGETGVGKSRLVRHLHEMSNRKNESFYEINCAALPTNLIESELFGYSG
FT                   GSFTGANREGKKGLLESAHKGTLFLDEIGEMPLEIQAKLLQVLQEKTFRPIGGRELKKV
FT                   DVRIVAATNRDLSMMVKQGTFRKDLYYRLNVIPILIPPLRERTEDILPLIYHYLQHFNE
FT                   KYGRNVKLAPSTLQMFVGYPWEGNNREIENVIERIVITADDIVTIEDLPIAMQESTVEQ
FT                   SGQSLYKMLEEVERNIILKAYKTYGSSYKVAEFLKISQSAATRKIKKLIEEEENIG"
FT   gene            334971..336422
FT                   /gene="gabD"
FT                   /locus_tag="BAA_0383"
FT   CDS_pept        334971..336422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabD"
FT                   /locus_tag="BAA_0383"
FT                   /product="succinate-semialdehyde dehydrogenase (NADP+)"
FT                   /EC_number="1.2.1.16"
FT                   /note="identified by match to protein family HMM PF00171;
FT                   match to protein family HMM TIGR01780"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47223"
FT                   /protein_id="ACQ47223.1"
FT                   /translation="MDKKATFVNVEKKAMYINGEWITLQEQIEVNNPATKEIFATVPKG
FT                   GVTEAKQAVDAAHEAFKSWSKLTAADRAAKLKKWFTLIDENKEEIAAIMTKEQGKPFAE
FT                   ALGEVNYANSFVEWYAEEGKRVYGEMIPASHPNKRILVMKQPVGVMAAITPWNFPAAMI
FT                   TRKVAPALAAGCTAVVKPASQTPLTALKLAELAHEADIPKGVINIVTGSAKAIADTWME
FT                   DGRVRKVSFTGSTEIGKELMASAAQTMKKVSLELGGHAPFIVMNDADLDKAVEAVIGSK
FT                   FRNAGQTCICTNRVFVQEEVYEAFVEKFEKAVGQLKVGDGFGDGTTVGPLIDENAVSKV
FT                   QEHIEDAIQKGGTVLYGGQKVAELDGHFMQPTVIGLANDTMLCMNEETFGPVAPVAKFK
FT                   TVEEVIERANHTPYGLAAYIFTKDISQAFQISEALEYGIIGLNDGLPSVAQAPFGGFKE
FT                   SGIGREGGHFGIEEYLEIKYISLGL"
FT   gene            336470..336793
FT                   /locus_tag="BAA_0384"
FT   CDS_pept        336470..336793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0384"
FT                   /product="multidrug resistance protein, Smr family"
FT                   /note="identified by match to protein family HMM PF00893"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49476"
FT                   /protein_id="ACQ49476.1"
FT                   /translation="MVYWLLLLVTIIFEVAGTIAMKLSNGLTKLVPSVLIFVFYGICFS
FT                   VFAIVVKKIHLSIAYAIWSGVGTLLITIISVYFFKEHISLFQACCILFIVLGVIGLKVS
FT                   SAS"
FT   gene            complement(336833..338062)
FT                   /gene="ampS"
FT                   /locus_tag="BAA_0385"
FT   CDS_pept        complement(336833..338062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampS"
FT                   /locus_tag="BAA_0385"
FT                   /product="aminopeptidase AmpS"
FT                   /EC_number="3.4.11.-"
FT                   /note="identified by match to protein family HMM PF02073"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50311"
FT                   /protein_id="ACQ50311.1"
FT                   /translation="MSFEQTLEKYAALAVNVGVNIQPGQTLSISAPLEAVQFVRLVTEK
FT                   AYKSGAKHVYVDWNDETLTRLKFDLAPEEAFAEFPSWKANAREELAKEGAAFMSIYAEN
FT                   PDLLKGVDSTRIATAHKVAGEAMKVYRDYVQADKVSWCVISVPTKEWAAKVFPDAAPEE
FT                   QEAKLWDAIFKATRADLENPVEAWKEHDKTLHTKVDYLNEKHYKALHYTGPGTDLTIEL
FT                   PEKHVWAGAGSLNEKNVPFMANIPTEEVFTMPLKTGVNGQVSSTKPLAFAGNIIDNFTL
FT                   TFENGRIVDYKAEVGEEALKHLVETDKGSHFLGEVALVPHDSPISNTNILFYNTLFDEN
FT                   ASCHLAIGSAYAFNLVGGKTMSKEELAENGANTSITHNDFMIGSAKLDIDGITADGRHE
FT                   PIFRKGNWAF"
FT   gene            complement(338179..339261)
FT                   /locus_tag="BAA_0386"
FT   CDS_pept        complement(338179..339261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0386"
FT                   /product="polysaccharide deacetylase-like protein"
FT                   /note="identified by match to protein family HMM PF01522"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50783"
FT                   /protein_id="ACQ50783.1"
FT                   /translation="MRKYAAIALCTSAILAGCNTSNVSQEPNKERKVQETKKQAETVQE
FT                   QGKISYNPITHESTNTTIHMTDIKDTLTEVQYKIWRTADGKETAKSLSSKEKEKQFSLP
FT                   FDTKEFEGKRGEFQIEAIGIKEDGKTIPLTKSAITFEQKVPVLMYHAIDDYHGQGIKDL
FT                   FVSPANFEAQMKYLKDNGYTLLTFERWGDINKVNKPIFVTFDDGMKNNMNAFHVLQKLK
FT                   DDTFKPVATEYMIVNNVDAEGSLSTSDIKEMVDSGIFSMQSHTATHADLPKITNYEEEL
FT                   KESKEKLEKITGKPVIAVAYPFGHVDDKVVAETKKYYQFATTTKPGKFITKGEPDELLK
FT                   MKRVRIHHTTTVEQFASSIK"
FT   gene            complement(339413..340516)
FT                   /locus_tag="BAA_0387"
FT   CDS_pept        complement(339413..340516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0387"
FT                   /product="polysaccharide deacetylase"
FT                   /note="identified by match to protein family HMM PF01522"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48805"
FT                   /protein_id="ACQ48805.1"
FT                   /translation="MKKYTYIALLSSAILVGCNTSSASDKQIQETTAKQAVEQKKAKAV
FT                   ELPLTQGVITWDPYEYNAQNTTLYTKDLRDSFKEVRYNIWRTADGPESKQTFTSQEKDR
FT                   DFALPLHLKTFHLKRGEFQIETVGIKEDNTETNLVTSKITFQQHVPVLMYHAIEKFPGP
FT                   SDGDYGLYVPPEQFEKHMQYLKDNGYTMLTFERWNDINRVNKPIFITMDDGRKNNMNAL
FT                   HILQKLKDDTFQPAATEFLTANEIDKPNRLSTDDIKQMMDSGIFSIQSHTANHTMMAHS
FT                   NNYDEELRGSKEKIEALTGKKVIALAYPVGSYNDPAVEETKKYYEFAVTTDHGNHITKG
FT                   MPNEQYLIKRHFVGPNTSMEKFISLIK"
FT   gene            complement(340756..341952)
FT                   /locus_tag="BAA_0388"
FT   CDS_pept        complement(340756..341952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0388"
FT                   /product="nucleoside transporter, NupC family"
FT                   /note="identified by match to protein family HMM PF01773;
FT                   match to protein family HMM PF07662; match to protein
FT                   family HMM PF07670"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49976"
FT                   /protein_id="ACQ49976.1"
FT                   /translation="MQYVMSIIGILVVLGLCFALSNNKSKINFRAIAIMIGFQILIGWF
FT                   MFGTKIGQQIIIFISKVFNKLIKLGTTGVDFLFNGIQRDFVFFLNVLLIIVFFSALLSI
FT                   FSYLGVLPFIVRVVGGAISKVTGLPRVESFHAVNSVFFGSSEALIVIKNDLQHFNKNRM
FT                   FIICCSAMSSVSASVTASYVMMLDAKYVLAALPLNLFSSLIVCSLLTPVDTKKEDEVVQ
FT                   KFDRTVFGDSFIGAMINGALDGLKVAGIVAALMIAFIGVMEVVNYVISAASGAMGHAVT
FT                   LQQIFGYVLAPFAFLMGIPAQDIIPAGGIMGTKIVLNEFVAILDLKGVAATLSPRTVGI
FT                   VTVFLISFASISQIGAIVGTIRALSEKQGSIVSKFGWKMLFASTLASILSATIAGLFI"
FT   misc_binding    complement(342154..342256)
FT                   /bound_moiety="guanine and/or adenine"
FT                   /note="Purine riboswitch"
FT   gene            342378..343754
FT                   /locus_tag="BAA_0390"
FT   CDS_pept        342378..343754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0390"
FT                   /product="RNA methyltransferase, TrmA family"
FT                   /note="identified by match to protein family HMM PF01938;
FT                   match to protein family HMM PF02475; match to protein
FT                   family HMM PF05958; match to protein family HMM TIGR00479"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47985"
FT                   /protein_id="ACQ47985.1"
FT                   /translation="MSTKMTPPVEKNEFIDVVFEDLTHDGAGVAKVKGYPIFVKNGLPG
FT                   EEAQIKIVKVKKNFAFGRLMKLHTESPYRKDAECPVYNQCGGCQLQHLTYEGQLQAKEK
FT                   QVRDVMQRIGGLGDVPVHPVLGMKNPWVYRNKAQVPIGEREGGLVAGFYRQGTHDIINM
FT                   ESCLIQAEENDTLIQEVKRICEKHGISAYNEERNKGTLRHVMARYGQVTGEIMLVFITR
FT                   TAELPNKKAIIEEIAAKFPEVKSIVQNVNPKRTNVIFGDKTTVLYGSEYIYDFIGDIKF
FT                   AISARSFYQVNPEQTKVLYDKTLEYAKLDGNETVIDAYCGIGSISLFLAQKAKKVYGVE
FT                   IVPEAIEDAKRNAALNNMTNAEFGVGEAEVVIPKWYKEGVIADTMVVDPPRKGCDEALL
FT                   NTIIDMKPKRVVYVSCNPATLARDLKVLEEGGYKTQEVQLVDMFPHTTHVECVAWLKLV
FT                   "
FT   gene            343851..344840
FT                   /locus_tag="BAA_0391"
FT   CDS_pept        343851..344840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0391"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01207"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48556"
FT                   /protein_id="ACQ48556.1"
FT                   /translation="MIDNFWRDLPRPFFVLAPMEDVTDVVFRHVVSEAGRPDVFFTEFT
FT                   NSDSYCHPEGMKSVRGRLIFTEDEQPMVAHIWGDNPEYFRQMSIGMAELGFKGIDINMG
FT                   CPVPNVASRGKGSGLILRPDVAAELIQAAKAGGLPVSVKTRLGFKELSEWEDWLTHIFK
FT                   QDIANLSIHLRTREEMSQVDAHWELIPEIKKLRDRIAPNTLLTINGDIPDRKTGLELAE
FT                   KYGIDGVMIGRGIFKNPFAFEKEPREHSSKEHLDLLRLQLDLQDQYAEVLPRSITGLHR
FT                   FFKIYVKGFPGAAELRNQLMSTKSTDEVRALLNKFEESVNVVEGSETV"
FT   gene            345101..345670
FT                   /locus_tag="BAA_0392"
FT   CDS_pept        345101..345670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0392"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46578"
FT                   /protein_id="ACQ46578.1"
FT                   /translation="MGKVEVKKKKKLSVMKFLIYMLIAIVVINWIYKTPEEKKADLEEK
FT                   VASYEEFESHCITYEDWNVDKGGNKNLNTLYNDPQECLEKELFIWRNDGTELTRGVAKL
FT                   VFHNTDYYFTEEELKDDIQTEAENKYKLLEEIQRECKSTLLGGFSYDYYTDGYDYIIED
FT                   TSGEKSKMNEKIFNSLFEITKTYKNN"
FT   gene            345943..346461
FT                   /locus_tag="BAA_0393"
FT   CDS_pept        345943..346461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0393"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07308"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48806"
FT                   /protein_id="ACQ48806.1"
FT                   /translation="MAMSNNDILKRVRYALDIRDIDMVEIFKLGGIEVTKEDVVDMLTK
FT                   IKRAPQYEPENPDVEEDEYVKTCDMMMLEAFFNGFITLKRGKQDPKPGQPAPVQSKESA
FT                   NNLLLKKMKIALSLTSEDVLDILDSVGVKVTKGELGALLRKKGHKNYKECGDRYARNFI
FT                   KGLAVKYRG"
FT   gene            346556..347263
FT                   /locus_tag="BAA_0394"
FT   CDS_pept        346556..347263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0394"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01863"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46965"
FT                   /protein_id="ACQ46965.1"
FT                   /translation="MIHTYLGETINFHITYKKKKSVRLFVDSYGNVEVQAPKGTPVEYL
FT                   IQLLEEKWDWIQTTRKEMAERARGPQEKDYDQGEGFLYLGNTYPIQISQDASIEQDNAI
FT                   FEGDKLHIYVKELKDEKIQQALKRFYYKQCKSLVGKSIKAHQSNFKTKPRSIRITDSSR
FT                   TWGTCDSNLQLTFNWKLAMAPQRVIDYVVVHEMCHMVHLNHDRSFWRLVGKIMPDYKEM
FT                   ENWLALSSWKMTV"
FT   gene            complement(347463..348158)
FT                   /locus_tag="BAA_0395"
FT   CDS_pept        complement(347463..348158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0395"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50423"
FT                   /protein_id="ACQ50423.1"
FT                   /translation="MTVLYEGRLKQNNERFHVTLLSLEYIEQILLLQNVVVEALEDKSR
FT                   LQPLSQEEFQYILEGNGMMIGAFIENELIAFRALLVPPIDDEHLGLDIGLPESELHRVI
FT                   YQEISNVHPNCRGNGMQKILATVIMDELQKEDSKYDYVCCTVAPFNIPSLKDKFAQGMK
FT                   IAALKEKYGGSMRYVFVKELREDNERDWTDIKSIPMNNAGGQQALLSEGYRGYKMEKVD
FT                   EDFVVKFGR"
FT   gene            complement(348173..349282)
FT                   /locus_tag="BAA_0396"
FT   CDS_pept        complement(348173..349282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0396"
FT                   /product="mandelate racemase/muconate lactonizing enzyme
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF01188;
FT                   match to protein family HMM PF02746"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50038"
FT                   /protein_id="ACQ50038.1"
FT                   /translation="MKITAIHLYAIRLPLRDPFVISYGSYSDMPSIIVKMETDEGIIGY
FT                   GEGVADDHVTGESWESTFHILKHTLAPALIGQNPMNIEKIHDMMDNTIYGVPTAKAAID
FT                   IACFDIMGKKLNQPVYQLIGGRYHEEFPITHVLSIADPEEMAEEAASMIQKGYQSFKMK
FT                   VGTNVKEDVKRIEAVRERVGNDIAIRVDVNQGWKNSANTLMALRSLGHLNIDWIEQPVI
FT                   ADDIDAMAHIRSKTDLPLMIDEGLKGSREMRQIINLDAADKVNIKLMKCGGIYPAVKLA
FT                   HQAEMAGIECQVGSMVESSVASSAGFHVAFSKKIITSVELTGPLKFTKDIGNLHYDVPF
FT                   IRLNEKPGLGIEINEDTLRELTVFQDIVR"
FT   gene            349375..350646
FT                   /locus_tag="BAA_0398"
FT   CDS_pept        349375..350646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0398"
FT                   /product="transcriptional regulator domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46085"
FT                   /protein_id="ACQ46085.1"
FT                   /translation="MMIKIAVVGSKEFMETLLPIAHKLEEIEIDPYVYLHPAESSELLK
FT                   RLKPCDFIFFSGALPYYMAKEIREQLRIPSTYLQQDETTVASSILSVMYHQGIQPHKIS
FT                   IDLVDRSFIINVFHDIGIKESPQVFDYENMLWSKDEINRVIDFHVAKYQSGKAHLALTS
FT                   IHAVYDELQKIGIPSERMIDLKQSIIHGLKDAKIKAELARSHSATVGACIISSLELRDG
FT                   LLEQLDVISKELRGSFKTIDEMTFILYTTRGDIESIIKTNIINNLFASIEGMIAIGFGY
FT                   GKTVKEAEQNAKIAQGFAKNNPIDHCFYILTSDKELFGPFPKEQRVQSLKNDNPELMKI
FT                   AKETKLSPANLSKIIQFSQSHPSLKFTAADLSEYLQVTRRSTERLLKKLVDYGYVHICG
FT                   EEMPYQQGRPRAIYELNLPLSLSF"
FT   gene            complement(350635..352056)
FT                   /gene="nhaC1"
FT                   /locus_tag="BAA_0397"
FT   CDS_pept        complement(350635..352056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaC1"
FT                   /locus_tag="BAA_0397"
FT                   /product="Na+/H+ antiporter NhaC"
FT                   /note="identified by match to protein family HMM PF03553;
FT                   match to protein family HMM PF03600; match to protein
FT                   family HMM TIGR00931"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50753"
FT                   /protein_id="ACQ50753.1"
FT                   /translation="MKKEIPFGVAMIPIIITVAVMMVTIVVLKQSPHVPLIIGTTVASI
FT                   VAWRYGYKWNDIEEAMYKGIHLALPAIVIIILVGLTIGAWIGGGIVATMIYYGLNLLTP
FT                   SLFLVSITIICSIVALAIGSSWSTMGTIGVAGMGIGLSMGIPAPMVAGAIISGSYFGDK
FT                   MSPLSDTTNLAAGLTNTDLFTHIRHMLFTTIPGLIITLIVYAFLGRSFGANNIDAKSIE
FT                   QTLQVLQQNFVISPFLLIIPVVVMVLVAKKVPAIPAILVGIILGFLSQVFIQGGSVSAS
FT                   VGALQAGFVIDTGNKLVDELFNRGGLDSMMNTVSMTIVAMTFGGVLEHTGILRSIVNQI
FT                   LKLAKSAKGLIASTIASCFATNLTCSEQYISIVVPSRMYANAYTEKGLHSKNLSRALED
FT                   GGTLTSVFVPWNTCGVFILATLGVGAFEYAPYAILNFIVPIISIIYGITGLTITKLSDI
FT                   EKAELLKKQNAQLEA"
FT   gene            352336..353451
FT                   /gene="amhX"
FT                   /locus_tag="BAA_0399"
FT   CDS_pept        352336..353451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amhX"
FT                   /locus_tag="BAA_0399"
FT                   /product="amidohydrolase amhX"
FT                   /EC_number="3.5.1.-"
FT                   /note="identified by match to protein family HMM PF01546;
FT                   match to protein family HMM PF07687; match to protein
FT                   family HMM TIGR01891"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46797"
FT                   /protein_id="ACQ46797.1"
FT                   /translation="MKTLELQERLTEIFQHLHENPEVSWKEYETTAYITNFLKEEGISY
FT                   KTFDDCPGVIAEIGNGNPVVAIRADMDALWQEVNGEFKANHSCGHDAHMTIVMGLILQL
FT                   KNMRWKSGTVRFIFQPAEEKGNGALKMVEKGAVDDADFLFGVHLRPIEELSLKQAASSI
FT                   RHGAAGFLEGTIHGEDAHGARPHQGINAIDVISMINIGLKNIWLRPQSSYSVKMTRCQA
FT                   GGDNLNIIPGNGHFSLDVRAENNTLLEELKKRIEHVIESAASMGSKTSYEWIDLAPGAE
FT                   VSEEAERFMRKGILEVYGEDKCTGPLYTTGSDDFHYYTVKRPYLKAVMLGLGADLQPGL
FT                   HHPYMKFDHSCIMDGVEILKQTVLKVLEDRG"
FT   gene            353603..354211
FT                   /locus_tag="BAA_0400"
FT   CDS_pept        353603..354211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0400"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49298"
FT                   /protein_id="ACQ49298.1"
FT                   /translation="MNEQYYDAVLNIKTVGEQKGFNKSMHYHRYEPTPYSGLDELLNQY
FT                   EIKRSDRVVDFGCGKGRLNFYMHHKCGASAVGIEMNEEFYKEALDNLDRYARKVRDSKD
FT                   KIRFECCLAQEYEINPCDNRFYFFNPFSVQVFMNVVNNILLSVEETGREVDIILYYPSE
FT                   DYIFFLENQTTFELKREVRLPGAYEKNGNERFLVYTLGL"
FT   gene            complement(354256..355782)
FT                   /gene="ahpF"
FT                   /locus_tag="BAA_0401"
FT   CDS_pept        complement(354256..355782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahpF"
FT                   /locus_tag="BAA_0401"
FT                   /product="alkyl hydroperoxide reductase, F subunit"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF01134; match to protein
FT                   family HMM PF07992; match to protein family HMM TIGR03140"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48761"
FT                   /protein_id="ACQ48761.1"
FT                   /translation="MILDADIKTQLSQYLQLMENDILLKVSAGNDDVSKDMLALVDELA
FT                   TMSSKITVEKVELERTPSFSVNRPGEDTGVVFAGIPLGHEFTSLVLALLQVSGRAPKVE
FT                   QKLIDQIKNIQGEYHFESYISLSCHNCPDVVQALNVMSVLNSGITHTMIDGAAFKEEVE
FT                   SKDIMAVPTVFLNGESFGSGRMTLEEILAKMGNGPDASELSDKDPYDVLVVGGGPAGAS
FT                   AAIYAARKGIRTGIVAERFGGQVMDTMGIENFISVKRTEGPKLVASLEEHVKEYDIDVM
FT                   NLQRAKRLEKKELIEVELENGAILKSKSVIVSTGARWRNVGVPGEAEFKNKGVAYCPHC
FT                   DGPLFTGKDVAVIGGGNSGIEAAIDLAGIVKHVTVLEFMPELKADAVLQERLNSLPNVT
FT                   VLKNVQTKEITGTDKVNGISYIDRETEEVHHVELQGVFVQIGLVPNTDWLGETVERVRG
FT                   EIVTDKHGATNVPGVFAAGDCTNNPYKQIIISMGSGANAALGAFDYLIRN"
FT   gene            complement(355797..356360)
FT                   /gene="ahpC"
FT                   /locus_tag="BAA_0402"
FT   CDS_pept        complement(355797..356360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahpC"
FT                   /locus_tag="BAA_0402"
FT                   /product="peroxiredoxin"
FT                   /EC_number="1.11.1.15"
FT                   /note="identified by match to protein family HMM PF00578;
FT                   match to protein family HMM PF08534; match to protein
FT                   family HMM TIGR03137"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48211"
FT                   /protein_id="ACQ48211.1"
FT                   /translation="MLLIGTEVKPFKANAYHNGEFIQVTDESLKGKWSVVCFYPADFTF
FT                   VCPTELEDLQNQYATLKELGVEVYSVSTDTHFTHKAWHDSSETIGKIEYIMIGDPTRTI
FT                   TTNFNVLMEEEGLAARGTFIIDPDGVIQSMEINADGIGRDASILVNKIKAAQYVRNNPG
FT                   EVCPAKWQEGSATLKPSLDLVGKI"
FT   gene            356951..358180
FT                   /locus_tag="BAA_0403"
FT   CDS_pept        356951..358180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0403"
FT                   /product="putative 5-methylthioribose kinase"
FT                   /note="identified by match to protein family HMM TIGR01767"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47652"
FT                   /protein_id="ACQ47652.1"
FT                   /translation="MSKFTKYFLMEANDVIVYVKEKLCKFEHAKGLQCKEIGDGNLNYV
FT                   FRVWDEQKNISVIVKQAGDTARISDEFKLSTNRIRIESDVLQLEEELAPGLVPKVYLFD
FT                   SVMNCCVMEDLSDHTILRTALINHEIFPRLADDLTTFLVNTLLLTSDVVMNHKEKKELV
FT                   KNYINPELCEITEDLVYAEPFTNHNKRNELFPLNEGWIREHIYSDKELRIEVAKLKFSF
FT                   MTNAQALIHGDLHTGSVFVKNDSTKVIDPEFAFYGPMGYDIGNVMANLMFAWVNADATM
FT                   SAGAKKDTYMDWLQSTMVEVIDLFKKKFLDAWNIHVTEIMAKEEGFNEIYLQSVLEDTA
FT                   AVTGLELIRRIVGLAKVKDITCIENEEARARAERICLQVAKKFILRANQYKTGTSFVET
FT                   LKEQSMHYAK"
FT   gene            358190..359236
FT                   /gene="mtnA_1"
FT                   /locus_tag="BAA_0404"
FT   CDS_pept        358190..359236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtnA_1"
FT                   /locus_tag="BAA_0404"
FT                   /product="S-methyl-5-thioribose-1-phosphate isomerase"
FT                   /EC_number="5.3.1.23"
FT                   /note="identified by match to protein family HMM PF01008;
FT                   match to protein family HMM TIGR00512; match to protein
FT                   family HMM TIGR00524"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46268"
FT                   /protein_id="ACQ46268.1"
FT                   /translation="MMEEQLIPIQWKDDALVLLDQTLLPNEVVYESFNTAEGVWDAIQV
FT                   MKVRGAPAIGVSAAYGVYLGVKEFVESTEAEFIDEVKRVCAYLATSRPTAVNLFWALER
FT                   MESVATDHTHLSITQLKDRLLEEAKEIHREDEEINRQIGEHALTLFHDGMGVLTHCNAG
FT                   ALATTKYGTATAPMYLAKEKGWDLKIYSDETRPRLQGSTLTALELQRAGIDVTVITDNM
FT                   AAMVMSQGKIDAVIVGCDRVAANGDVANKIGTLGVSILAKYYNIPFYVAAPTPTIDLKT
FT                   PTGKEIPIEERDASEVINRFGQYSAPKESKVYNPAFDVTPHENVTAIITEKGIVKAPFT
FT                   ENLKKLFQ"
FT   gene            359291..359932
FT                   /locus_tag="BAA_0405"
FT   CDS_pept        359291..359932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0405"
FT                   /product="aldolase, class II"
FT                   /note="identified by match to protein family HMM PF00596"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48923"
FT                   /protein_id="ACQ48923.1"
FT                   /translation="MLLQKEREEIVAYGKKMISSGLTKGTGGNISIFNREQGLVAISPS
FT                   GLDCYETKPEDVVILNLDGEVVEGERKPSSELDMHLIYYRNREDINALVHTHSPYAKTI
FT                   ASLGWELPAVSYLIAFAGPNVRCAPYETFGTKQLAEAAFEGMIDRRAVLLANHGLIAGA
FT                   NHIKMAFTVAEEIEFCAQIYYQTKSIGEPKLLPEDEMENLAKKFEGYGQQ"
FT   gene            complement(359973..360980)
FT                   /locus_tag="BAA_0406"
FT   CDS_pept        complement(359973..360980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0406"
FT                   /product="iron compound ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF01032"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47924"
FT                   /protein_id="ACQ47924.1"
FT                   /translation="MIPSILRKQRLIILALLILTITTIVIGMGLGSASLSYDRLLPILM
FT                   GQGTFKEEFVLYSLRLPRIIITLLAGMALALSGAILQGITRNDLAEPGILGINSGAGVA
FT                   VAIFFLYFPIDVGSFLYLLPVVGFIGAFLTAVLIYVFSYSKSSGLQPVRLTLTGIGFAF
FT                   ALSGMMIVLISSADRMKVDFISKWIAGNIWGDDWIFIFAMLPWLIVLIPFVFYKANRLN
FT                   ILALNEPVAIGVGIEIEKERRYLLVAAVALAAAAVSVTGGISFIGLMAPHIAKSLVGPR
FT                   HQIFMPIALLIGGWLLLLADTIGRNIVEPNGIPAGIVVALIGAPYFMYLLLKKA"
FT   gene            complement(360977..362017)
FT                   /locus_tag="BAA_0407"
FT   CDS_pept        complement(360977..362017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0407"
FT                   /product="iron compound ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF01032"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47820"
FT                   /protein_id="ACQ47820.1"
FT                   /translation="MKRKDVKRMTKEHDNTRSIAFTYKLILSIIAFFLIFMVAMVLGAA
FT                   DTSIKDVWLALTSSAKGDKISIIREIRLPREVAAIFVGAGLAVSGAIMQGLTRNPLAEP
FT                   GLLGLSGGANAALALTLAFNPSISYLYLTLACFIGAAVGAIMVFGIGMVKKGGLSPLRI
FT                   VLAGAAVSAFLLAISEGVGIYFKISQDVSLWTAGGVIGTTWSQLKVIIPVISISIFIAI
FT                   LLAKKLTVLSFSEEVAIGLGQKIIVIKTILFIIIILLAGASVALVGNMAFIGLMVPHMV
FT                   RPIVGPDYRFVIPMSAIAGASFMLLADTIGRTINAPYETPVAAIVAIVGLPFFLFIVRK
FT                   GGKTFS"
FT   gene            complement(362066..362983)
FT                   /locus_tag="BAA_0408"
FT   CDS_pept        complement(362066..362983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0408"
FT                   /product="iron compound ABC transporter, iron
FT                   compound-binding protein"
FT                   /note="identified by match to protein family HMM PF01497"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46788"
FT                   /protein_id="ACQ46788.1"
FT                   /translation="MKKLFISLTVLFVLVMSACSNGSTDKKNDAKGSKSETITYQSENG
FT                   KVEVPANPKRVVVLSSFAGNVMSLGVNLVGVDSWSKQNPRFDSKLKDVAEVSDENVEKI
FT                   AELNPDLIIGLSNIKNVDKLKKIAPTVTYTYGKVDYLTQHLEIGKLLNKEKEAKTWVDD
FT                   FKKRAQDAGKEIKAKIGEDATVSVVENFNKQLYVYGENWGRGTEILYQEMKLKMPEKVK
FT                   EKALKEGYYALSTEVLPEFAGDYLIVSKNKDTDNSFQETESYKNIPAVKNNRVYEANMM
FT                   EFYFNDPLTLDFQLDFFKKSFLGK"
FT   gene            363316..364365
FT                   /locus_tag="BAA_0409"
FT   CDS_pept        363316..364365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0409"
FT                   /product="pyridine nucleotide-disulfide oxidoreductase
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF01134; match to protein
FT                   family HMM PF03486; match to protein family HMM PF07992"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46092"
FT                   /protein_id="ACQ46092.1"
FT                   /translation="MNREELFDVTVIGGGPAGLYSAFYSGLREMKTKIIEFQPQLGGKI
FT                   HVYPEKMIWDIGGLLPVTGEKLIEQLVQQGLTFQPEVVLNTKIESIIRNKDGIFTLKTS
FT                   TGEEHFSKTVIVATGSGILNPQKLSIEGAERFEVSNLNYTVKSLKRFKNKTVIISGGGN
FT                   SAIDWANELEPIAKKVYLTYRKEELSGHEAQVKQLMNSSAECFFNTSITTLIAGDNHEA
FT                   IEYVELTNHETGEVSQLAIDEVIINHGYERDITLLENSELDVAIIDNYYIAGNANSESS
FT                   VDGLYAAGDILKHEGKLHLIAGAFQDAGNAVNKAKQFIQPDASEYGMVSSHNEVFKKRN
FT                   RELIKQMMK"
FT   gene            complement(364562..364930)
FT                   /locus_tag="BAA_0410"
FT   CDS_pept        complement(364562..364930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0410"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48323"
FT                   /protein_id="ACQ48323.1"
FT                   /translation="MATRHIITMLEKTLQVETENTISHLTTSLSDRILSQSAAIQENNC
FT                   YHTIGEWYKNHFLFQQDDFLWAKYVFYDAYCEEIKKQGHLTKRVRQILESLARMHGKQY
FT                   IASILNMPFPKKRAKGTA"
FT   gene            365112..365351
FT                   /locus_tag="BAA_0411"
FT   CDS_pept        365112..365351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0411"
FT                   /product="DNA binding domain, excisionase family"
FT                   /note="identified by match to protein family HMM TIGR01764"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47799"
FT                   /protein_id="ACQ47799.1"
FT                   /translation="MNALYITVEEAAEYLNLPKSYIEELIQQKKIRALFDGEQYLLNKE
FT                   QFNTHLEQMEKYKQLVEEILNEPIPEDMDVKDED"
FT   gene            365587..366108
FT                   /locus_tag="BAA_0412"
FT   CDS_pept        365587..366108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0412"
FT                   /product="putative spore coat protein B"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46914"
FT                   /protein_id="ACQ46914.1"
FT                   /translation="MSLFHCDFLKDLIGSFVRVNRGGPESQRGTIISVCPDYFVLQNEK
FT                   GELYYYQLSHLKSITKSAKECGSSDCEWEDCACAEDFEALLESFKYRWVKINRGGPEKV
FT                   EGILQDVSCDFVTLIVKEEIILIAIKHIKSVNYNALACGESDESDDSSSKESSNNSGRA
FT                   RAQRQSSRGR"
FT   gene            366129..366578
FT                   /locus_tag="BAA_0413"
FT   CDS_pept        366129..366578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0413"
FT                   /product="spore coat protein B"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46372"
FT                   /protein_id="ACQ46372.1"
FT                   /translation="MENVLCCDQIKCLVGETVKVNLRGPESRVGELVSLGKDYLTLQLP
FT                   HGELVYYQLKHVKSLVKKVKESKCGDCYSSCFCSDEDTFLDILKDLKYKWVKINRGGPE
FT                   CMDGLLSEVHHGCITLVNCDEVIYVINSHIKSVSQVVKCKKNEDE"
FT   gene            366741..367409
FT                   /locus_tag="BAA_0414"
FT   CDS_pept        366741..367409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0414"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49898"
FT                   /protein_id="ACQ49898.1"
FT                   /translation="MNELNKSIGENIYVKLIGEKRFKGVLIDVGNDIVVLYNGQDYVYI
FT                   SLYHVQYYKILRTYDEEISKPDVDSVIKRESPSISLRKVLSTSKGIFTEIYVAGNAPIH
FT                   GYVTSIMNDYIVFYSPVYKTVYISLKHLKWLIPYKENQVPYALNKNELPVNPLNITLAR
FT                   TFEEQLIKMSGKIMVFDLGEESNKIGKMAKIDEGHIEILKARDAKMYVNIQHVKSVHCP
FT                   "
FT   gene            367646..368911
FT                   /locus_tag="BAA_0415"
FT   CDS_pept        367646..368911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0415"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48117"
FT                   /protein_id="ACQ48117.1"
FT                   /translation="MEQFPNSLSITLLGSAGGAAKAVLAILNQAIVNEKDPIYEVIKSV
FT                   TFHLVDIKQKDRTYYDELFPNLKDQLFLSEIDLQDVVTFKKHLKESSTSVVIDVSGADT
FT                   IRVLSCCNELGICYINSALENEAVDQDDSLIGFQLTERYTRFEKEKEKFTNTKAIIGSG
FT                   MNPGVVQWMVVELMKERPNEKPRACYIVEHDTSFLNDTALIKPHTLYASWAVERFLDEA
FT                   IWSYPMYMSHHRPLYFYEDVYASEYKVKLGEKEFYGCLMPHEEVLILGKNFNMEVGFLY
FT                   RINEYTTNIIRQNLNKVEDLWNWNRKVFNPAEEEIAGEDLVGVLLVYENSEAYMYNVMN
FT                   SSQVFHKYKTNATYFQVGCGIYAGLCSLLFDEFKQGAYYVEELLLNTESKYGEYLNLYM
FT                   KDFVVGENDFTDGLLHDRVRWI"
FT   gene            369033..369149
FT                   /pseudo
FT                   /locus_tag="BAA_0416"
FT                   /note="histidine kinase; this gene contains a frame shift
FT                   which may be the result of a sequencing error"
FT   gene            369193..369309
FT                   /pseudo
FT                   /locus_tag="BAA_0417"
FT                   /note="sporulation kinase; this region contains one or more
FT                   premature stops and/or frameshifts"
FT   gene            369371..369565
FT                   /pseudo
FT                   /locus_tag="BAA_0418"
FT                   /note="sensor histidine kinase domain protein; this region
FT                   contains one or more premature stops and/or frameshifts"
FT   gene            369789..370169
FT                   /locus_tag="BAA_0419"
FT   CDS_pept        369789..370169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0419"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50862"
FT                   /protein_id="ACQ50862.1"
FT                   /translation="MELTLNSTVCLHTIQFRKEQKNYIVKDTITGEKYEMPPLWIDALA
FT                   MMRDGFLLGEIEEKLKEEYPAEEINMLAFTRQLLELELVEMVDGEEIACTKKKEKDYLA
FT                   WVRPRVEQFFLSLNKKYRSKGQ"
FT   gene            complement(370198..370830)
FT                   /locus_tag="BAA_0420"
FT   CDS_pept        complement(370198..370830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0420"
FT                   /product="putative cyclase"
FT                   /note="identified by match to protein family HMM PF04199"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50860"
FT                   /protein_id="ACQ50860.1"
FT                   /translation="MKVIDLSQTFENNMSQFPGTPKINLEAITSVEETGYQVTDFHSVV
FT                   HVGTHCDAPAHFISGATTIDQLPLDQFVGEAVLIDVTHVQERKLRKEVLHNADIKEGDI
FT                   VIFHSNLSTKWNTEAYEQEAFYLSEELAEELVQLKVKSVGLDFISPDEVTTETSPIHHI
FT                   LLGNNIYLIENLTNLDAIKTKRFFFSAAPLKIKDSDGAFARAFAVIF"
FT   misc_binding    complement(370917..371029)
FT                   /bound_moiety="S-adenosyl methionine"
FT                   /note="SAM riboswitch (S box leader)"
FT   gene            371179..372288
FT                   /locus_tag="BAA_0422"
FT   CDS_pept        371179..372288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0422"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50320"
FT                   /protein_id="ACQ50320.1"
FT                   /translation="MTGNVLNYFAGGNTARGFHNLYEENLKGLNRLFILKGGPGTGKSS
FT                   LIKAIGRDWVEKGYDIEFLHCSSDNKSVDGVIIPKLKVGIVDGTSPHVIEPKMPGVVEE
FT                   YINLGGAWDSDKLREQKVEIERFVSEASKAFQAAYARFNEALIIHDEWEKIYIDNIDFN
FT                   KANELTDQLIQKLFADKGGKQSLVKHRFLGAATPKGAVDFVPNLTEGLLHRYFIKGRPG
FT                   SGKSTMLKKLAKAAEEKGFEVEVYHCGFDPNSLDMVIVRELGFAIFDSTAPHEYFPSRE
FT                   GDEIIDMYALIVTPGTDEKYAEEIRHVSIQYKTKMNEAMSFLAKAKSVRDKLERIYIAA
FT                   MDFSKVDAYKEEIQKEFERIAISVTEKNK"
FT   gene            372411..373193
FT                   /locus_tag="BAA_0423"
FT   CDS_pept        372411..373193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0423"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46552"
FT                   /protein_id="ACQ46552.1"
FT                   /translation="MREKIKLELERIEKEKDVKILFAVESGSRAWGFPSKDSDYDVRFV
FT                   YMHPVEWYLSIHDKRDVIEYPISDDLDISGWDIKKALQLFAKSNPALLEWIRSPIFYSK
FT                   NSNFPEQLQQMSEKNFDPKATIYHYLHMASKNYREFLQGENVKLKKYFYVLRPILACKW
FT                   LEEKTTLPPVEFDRLITELLLERSVLDEIEQLLIKKKAGTELDVGLKIEVLNQFLEEQI
FT                   HYYQQYVKGIEKGSGIDIESLNTLFRDMLFEVYKKEHE"
FT   gene            complement(373208..374509)
FT                   /locus_tag="BAA_0424"
FT   CDS_pept        complement(373208..374509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0424"
FT                   /product="putative benzoate transport protein"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46044"
FT                   /protein_id="ACQ46044.1"
FT                   /translation="MQPSAPPHLESTKTIFSNSITKLVVFICWLAILADGYDLGIYGAV
FT                   LPKLLEDNSWALSPAHAGTIASYALFGMFIGAILVGTITDLIGRKWTLICCLALFSITM
FT                   GLAALAPSPELFGLWRFIGGIGLGGVIPTASALTVEYSPKKRQSFIYALMFTGYPLGIV
FT                   LGAILSMFMLEDFGWRIMFGIGMIPLLLIPFIIRYLPESIQFLLSRNRQEEVDKILNRF
FT                   QIEFYAKDETHQAPSNIRKKNGFLTLFSKEYIKATLLFWITYIMGMFLIYGLNTWLPQM
FT                   MRQAGYPLGSSLSFLLMLNITAAIGALFAGAIADRIGAKIVISISYLMAAICIGLLTIK
FT                   PSVSIIYLLIGLAGIGSVGITQILNAYVTQYFPSHIRATSLGWGLGLGRVGAIAGPILV
FT                   GIIMTMQYDLAWNFYLFSFAGLLAAISVFFIPTK"
FT   gene            complement(374653..376179)
FT                   /locus_tag="BAA_0425"
FT   CDS_pept        complement(374653..376179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0425"
FT                   /product="putative Rieske 2Fe-2S iron-sulfur protein"
FT                   /note="identified by match to protein family HMM PF00355;
FT                   match to protein family HMM PF01266"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49800"
FT                   /protein_id="ACQ49800.1"
FT                   /translation="MTSDTFPQFPSSYWIESTQIPTFPPLSENIKTKVAIIGAGITGIT
FT                   TAYLLAKEGIDVVLIDSGLILNGTTGHTTAKITAQHDLIYDELINHFGMEKAGLYYEAN
FT                   NHALQFINKTVQTYKIDCNFLNEDSYLYTTTDNGLRTLSKEYEAYQKLNIPCDFVQSLS
FT                   IPIPVQSALVMKNQAQFHPLLYLKTLLEKFVEMGGKVYEQTTAIDVEKGDYPQVITKGG
FT                   HRITCEYVVSCSHFPFYDATSFFFTRMYAERSYALAIKAKTDYPGGMYLSIDDPKRSLR
FT                   YTTNNGEKLILIGGESHKTGQGINTMLHYEALYSFAEATFGVDEVPYRWSAQDLITLDK
FT                   VPYIGHINESNPNIFVATGYRKWGMTTGTAAAHLLKDSILKVHSPYKELYTPSRFHANP
FT                   DIKTFLSQNIDVAKHLIEGKIETALRKPEDLEVGEGSVVHVNGKRAGAYKDKEGKLHIV
FT                   DTTCTHLGCEVEWNNGDCTWDCPCHGSRFSIEGDVIEGPADQPLKRVDNE"
FT   gene            376762..377847
FT                   /locus_tag="BAA_0426"
FT   CDS_pept        376762..377847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0426"
FT                   /product="stearoyl-CoA 9-desaturase"
FT                   /note="identified by match to protein family HMM PF00487"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49593"
FT                   /protein_id="ACQ49593.1"
FT                   /translation="MKELHTFGWYAARVSPHLPKKAFKPVPTRLFGGLAYLLVALAGLI
FT                   SIGVFELNVWANLGIAIVLGLCFASLGFLGHEILHGTVVRKAWLRDFLGAIAFMPLSTG
FT                   PKLWRKWHNATHHVHTQHEENDPDAWPTLEKLKKSKFLSWVYRMPLHVRSFFSFLSLTI
FT                   QFTLHSTRMFFHFIKEFKSSNQKSVWLQLLLPWTVWISLLFIMGPGKWLFAYVIPLLIA
FT                   NFIVMAYIATNHRLNPIVPVNDPLANCLSVTVPRWVDVLHFNFSYHTEHHLFPAMSSKY
FT                   YPLVKEKIKEMWPERYHEMPMTKALAALWNTPRVYYQGSELVDPHREHFYGSLGNGLDP
FT                   HNISYREEHIEEEESIKKVNQ"
FT   gene            complement(377900..378592)
FT                   /locus_tag="BAA_0427"
FT   CDS_pept        complement(377900..378592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0427"
FT                   /product="putative amino acid ABC transporter, permease
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR01726"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49409"
FT                   /protein_id="ACQ49409.1"
FT                   /translation="MFEIFMSTYPTLLKATIVTLQLTLTSLVLGSLIGLLFAFFRISNN
FT                   KVLNSIAHVYIAIIRGTPLIVQIAILYFGITSVVVFTPFWAGAIALAIHNGAYITEIFR
FT                   GSIQSVDRGQMEAARSLGMPYPLAMRRIVLPQAFRQSLPPLGNQFIIGLKDSSLVAYVG
FT                   MAELWGSGLSIAAGNFQQLDTYIIVGLYYLVLVLLFTYLVNLLEKRLQRKETNSVQVSA
FT                   KKKKEVSL"
FT   gene            complement(378687..379481)
FT                   /locus_tag="BAA_0428"
FT   CDS_pept        complement(378687..379481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0428"
FT                   /product="putative amino acid ABC transporter, amino
FT                   acid-binding protein"
FT                   /note="identified by match to protein family HMM PF00497"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48722"
FT                   /protein_id="ACQ48722.1"
FT                   /translation="MKRKLLTIVASITLCTSFILGACSKESATTSSNGKKEFRYAMSGL
FT                   YKPFNYKENDGKLVGFDVEIGEALAKKMNMKPTPITNPWETLIQGLKAKKYDVILGSMA
FT                   ITEERLKAVNFSNPYYRSGAQIFVAKKNTSISSPEDLKGKKIGVVKASTFKDLVAKHTD
FT                   QITEYDSDITALMDLEPGRIDAVITDQMVGLRMIKEGKSNIKEAGKPLNLDEMGIAIRK
FT                   DDKEMVEKVNKALDEIIKDGTYEKISKKWFGRNILGEEENTK"
FT   gene            complement(379603..380325)
FT                   /locus_tag="BAA_0429"
FT   CDS_pept        complement(379603..380325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0429"
FT                   /product="amino acid ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50529"
FT                   /protein_id="ACQ50529.1"
FT                   /translation="MIQVRNLVKSFGSLDVLKGIDLEVNEKEVVVLIGASGSGKSTLLR
FT                   CLNFLEMYDEGEIHLQGERIDPKHSNLNKVRENVGMVFQHFNLFPHMTSLENIIEAPIH
FT                   VKKLETANAKEIGNQLLQKVGLQDKADVTPHLLSGGQKQRIAIARALAMNPKIMLFDEP
FT                   TSALDPELVGEVLQVMKELAEEGMTMVIVTHEMNFARDVADRVIFMDDGKIVEDAPPAQ
FT                   FFSTPSHERAKQFLRNVL"
FT   gene            complement(380495..382219)
FT                   /locus_tag="BAA_0430"
FT   CDS_pept        complement(380495..382219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0430"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="identified by match to protein family HMM PF00015;
FT                   match to protein family HMM PF00672"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49773"
FT                   /protein_id="ACQ49773.1"
FT                   /translation="MLKILYLLNVINRLILLIAVPIISILIISVVNYMNLQQMHKQLQT
FT                   VYVDRLQPIKWLGSIESSLYQEFSYVKELIITEDENRRTTILNKLNDTNKETEKLQAQY
FT                   ENTYITGEEKKLLSQYKEKLENYKKHRAQMLDFIKENKLNQAYSFYLTTVEHNLSATVG
FT                   ALKNLSDYNEKLAEGLYNDSEHSYKQVISITIILFITCLVLCILISLFTAKSIINPINS
FT                   LRSIMNTAGKGDLTIAVPKQYHHEFGHMFNSFDQMISNLQQIIKNVIQTSVQVKSSTNH
FT                   IVETATVSSSTMDNIANTMKQLSHHINDQSANIKDSSTAMDEIANGVQSIAESSTTISN
FT                   LAISTSDKANVGTEIIENSISQMTTIHTVMDEIYKVVDQLVIRTQDIDKALQTITYISE
FT                   QTNLLSLNAAIESARAGEHGKGFAVVSEEVRKLAEQSKQAATDITKLNLLVQNDTKDVV
FT                   NVMGKGQQEIQEGIHAVQNAKLAFHNIVNHINEVTDQIQDITASAEEMSASSEEINSAL
FT                   INISSISQNIVSETNHTSQSSQAQSVSIQDITNMSLQMQKLVDELEKSATQFKIKNL"
FT   gene            382427..383719
FT                   /locus_tag="BAA_0431"
FT   CDS_pept        382427..383719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0431"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="identified by match to protein family HMM PF00015;
FT                   match to protein family HMM PF00672"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45969"
FT                   /protein_id="ACQ45969.1"
FT                   /translation="MEKERKAFSFGLRTQLMLFTTVLALITYSTSIFFIYVIYDYFQSY
FT                   VSQTAYNIIVMLLGVVWSGILAYGAAVFLIKPLRKLEEAARKAAEGDIREDVPLPKTDD
FT                   EIKSLSVAFNMMLGNLRGMVKNIDTTFSYTYNQVQQIRKQTGEATKQAQGVSETLAEIS
FT                   SGAEQSAASIQAIVSAVDTTTSIASEVEEKAKQSDELSSEMVQALGHSTRVFTSLIQGI
FT                   QTLAKENEDSMQNVQKLEERMKQVEHIVSVVSEIASQTNLLALNASIEAARAGEHGRGF
FT                   AVVAEEVRKLADESDHSARNISQLLRNMQEEVQQVAMKMTEQVKIAKEEARRGEATELI
FT                   LKEMSSSVMEVADATKQISSYMNEQVSHIHQTGAQTKAVAAIAEETSAGSQEVACVTVQ
FT                   QSKNMVVIDQLLKDLEKQAADLKQTIERFSM"
FT   gene            383956..385620
FT                   /locus_tag="BAA_0432"
FT   CDS_pept        383956..385620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0432"
FT                   /product="glycosyl hydrolase family protein"
FT                   /note="identified by match to protein family HMM PF00128"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46420"
FT                   /protein_id="ACQ46420.1"
FT                   /translation="MNKTWWKEAVAYQIYPRSFMDSNGDGIGDLQGIIAKLDYLKDLGI
FT                   DVIWICPMYKSPNDDNGYDISDYQDIMDEFGTMEDFDALLDEVHKRDMKLIIDLVINHT
FT                   SDEHPWFIESRSSKDNPKRDWYIWHDGKDGAEPNNWESIFNGSAWEYDEVTGQYYLHLF
FT                   SRKQPDLNWENKEVREVLYDTVNWWLDKGIDGFRVDAISHIKKEDGFKDMPNPKGLKYV
FT                   PSFDKHMNVDGIQPLLEELKENTFSKYDIMTVGEANGVKIEDAELWVGEEQGKFNMVFQ
FT                   FEHLSLWDAEKKKDLDVVGLKKVLTKWQKGLENKGWNALYIENHDKPRIVSTWGDDKQY
FT                   WRESATALGAMYFFMHGTPFIYQGQEIGMTNVQFPNIEDYDDVAIKNLYREKIAEGVSH
FT                   QDMMEIIWASCRDNSRTPMHWDDEINAGFTTGTPWFGMNQNYKEINVAKQKNEENSIFN
FT                   FYKKMIALKKEHDVLNYGTYDLLLEDDPQIYAYTRTLNDEKIVVISNISKEEAVYNEDL
FT                   FALERKRLLLNNYEVAEHEQLTTITLKPYETRVYRIS"
FT   gene            385793..387430
FT                   /locus_tag="BAA_0433"
FT   CDS_pept        385793..387430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0433"
FT                   /product="PTS system, IIBC component"
FT                   /note="identified by match to protein family HMM PF00367;
FT                   match to protein family HMM PF02378; match to protein
FT                   family HMM TIGR00826; match to protein family HMM
FT                   TIGR02003"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48243"
FT                   /protein_id="ACQ48243.1"
FT                   /translation="MKITSFDFWQKFGKALLVVVAVMPAVGLMISIGKLIGMSAGDINA
FT                   VHTIARVMEDIGWAIITNLHILFAVAIGGSWAKDRAGGAFAALLAFVLTNRITGAIFGV
FT                   NAEMLADSKAKVSSVLAGDLIVKDYFTSVLGAPALNMGVFVGIITGFLGATLYNKYYNY
FT                   NKLPQALAFFNGKRFVPFVVIVWSTVTAIVLSLLWPFIQSGLNEFGRWIAASKDSAPVV
FT                   APFVYGTLERLLLPFGLHHMLTIPMNYTELGGTYTMLTGSKIGQVVAGQDPLWLAWITD
FT                   LNNLLANGDTKAYNDLLNNVVPARFKAGQVIGSTAALMGIAFAMFRNVDKEKRAKYKPM
FT                   FLSAALAVFLTGVTEPIEFMFMFIAPVLYVVYAITTGLAFALADLINLRVHAFGFIELI
FT                   TRTPMMVNAGLTRDLINFVIVSLVFFGLNFTLFNFLIKKFNLPTPGRAGNYIDNEDEAS
FT                   EGTGNVQEGSLATKVIDLLGGKENIADVDACMTRLRVTVKDLDVVAPEAQWKQNGALGL
FT                   IVKDKGVQAVYGPKADVLKSDIQDMLGA"
FT   gene            387435..388226
FT                   /locus_tag="BAA_0434"
FT   CDS_pept        387435..388226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0434"
FT                   /product="endonuclease/exonuclease/phosphatase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF03372"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47516"
FT                   /protein_id="ACQ47516.1"
FT                   /translation="MKLLTLNCHSWQEENQIEKIKYLAKVIQEEEYDVVALQEVSQSIG
FT                   AKNVCGNKKEDNFGLLLLEELKALHVKDYNITWDFSHIGYDVYEEGLAIITKHNVVKED
FT                   TFFISENKDTTYWKTRKIVSATIAYNGKNITFYSCHLGWWNDEEELFKGQVNRLMERVD
FT                   SNELSFLMGDFNNNARLQGEGYEYMMQEGLYDTYELAIEKDEGTTVQGEIAGWDENKHN
FT                   LRIDLILCNRSEKIRSSKVVFNGTNRKIISDHFGVEVQVDI"
FT   gene            388245..388400
FT                   /locus_tag="BAA_0435"
FT   CDS_pept        388245..388400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0435"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50255"
FT                   /protein_id="ACQ50255.1"
FT                   /translation="MMKSCEDFFEEYKYFQEKILVFFMTFPIYLLLLNVKPIWSFCIHT
FT                   LTYFVI"
FT   gene            388532..391357
FT                   /locus_tag="BAA_0436"
FT   CDS_pept        388532..391357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0436"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF01061;
FT                   match to protein family HMM TIGR03061; match to protein
FT                   family HMM TIGR03062"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49178"
FT                   /protein_id="ACQ49178.1"
FT                   /translation="MKQIWRIYKTDLRNVAKHWAAIVIVVGLMILPSLYAWFNIKASWD
FT                   PYGNTKEVPIAVSNQDAGSNLRGKDINIGNEIVDSLKKNKNLGWKFVDEKQAIYGVERG
FT                   DYYASITIPKDFSEKIATVLDENPQKPELDYYVNEKVNAIAPKITAKGASGITEEISKN
FT                   FVKTANGEIFKIFNDLGIDLETNLPSIEKVKDLVFKLEAQFPEMNTLMDKALDDATRAE
FT                   DLVKVAQKELPVVESVINDGQEALTNLDKFFANNDQTLQNAPGTIRNHLTAAKNVMDKA
FT                   NAFTDFLMHPGIDFSGMKGLPEFPARPDLSKLNDEGYKNIARNINQTVNNVLNSARAGT
FT                   TYGKSVVNGLQNGQFDPEKAKQDLNAVSENLQGRTDSIAYLINVFTELQKSATTDFGQS
FT                   FFQGRVDRLTKLKSGMENANNGIKDIVNVIGTGQEVKKDVTDVANQKLDAANGLIDQAE
FT                   KDYNETFVADYKKAVSTVDQAKADANEAYDSVKNEYDKFKNGVEDAKANISNKGVTDLE
FT                   WAKVSLNDLNGQLQATNNLIGDAIPVLESTNKVLADVNSGKNLNGGIAKLNKIQNSVQK
FT                   GIDATNKATTLINNGQKPTKEVVESINEATQNASAQLGDFLATYDSEIVPNFNTAIERT
FT                   KRMSKNTSQILKEADKKLPDVKKLLEDSSKGLVDGRKKLADIKAEMPATEKKIKELADK
FT                   IRDFESEEDLKDIIRLLKNDVEKQSDYFANPVNLKENKLFAMPNYGSAMSPFYTVLALW
FT                   VGALLMVSLLTVEVHEEGANYKSHEIYFGRLLTFLTMGLSQAFIVSMGDIFLLGTYVVD
FT                   KFWFVLFSLFIGGVFVCIVYSLVSIFGNVGKSMAIILLVLQVAGSGGTFPIQMTPAFFQ
FT                   AIYPFLPFTYAISAIRETVGGMLWDIVTRDLLVLSAFVVVMIVAALLLKTPINKSSEKF
FT                   VENAKGSKIIH"
FT   gene            complement(391398..393587)
FT                   /gene="topB1"
FT                   /locus_tag="BAA_0437"
FT   CDS_pept        complement(391398..393587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="topB1"
FT                   /locus_tag="BAA_0437"
FT                   /product="DNA topoisomerase III"
FT                   /EC_number="5.99.1.2"
FT                   /note="identified by match to protein family HMM PF01131;
FT                   match to protein family HMM PF01751; match to protein
FT                   family HMM TIGR01056"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49575"
FT                   /protein_id="ACQ49575.1"
FT                   /translation="MAKSVVIAEKPSVARDIARVLKCDKKGNGYLEGSKYIVTWALGHL
FT                   VTLADPESYDVKYKKWNLEDLPMLPERLKLTVIKQTGKQFNAVKSQLLRKDVNEIIVAT
FT                   DAGREGELVARWIIDKVRINKPIKRLWISSVTDKAIKDGFANLKPGKAYDNLYASAVAR
FT                   SEADWYIGLNATRALTTRFNAQLNCGRVQTPTVAMIANREDEIKNFKAQTYYGIEAQTT
FT                   NQLKLTWQDANGNSRSFNKEKIDGIVKGLDKHNATVLEIDKKQKKSFSPGLYDLTELQR
FT                   DANKKFGYSAKETLNIMQKLYEQHKVLTYPRTDSRYISSDIVGTLPERLKACGVGEYRP
FT                   LAHKVLQKPIKANKSFVDDSKVSDHHAIIPTEGYVNFSAFTDKERKIYDLVVKRFLAVL
FT                   FPAFEYEQLTLRTKVGNETFIARGKTILHAGWKEVYENRFEDDDVTDDVKEQLLPRIEK
FT                   GDTLTVKLIMQTSGQTKAPARFNEATLLSAMENPTKYMDTQNKQLADTLKSTGGLGTVA
FT                   TRADIIDKLFNSFLIEKRGKDIHITSKGRQLLDLVPEELKSPTLTGEWEQKLEAIAKGK
FT                   LKKEVFISEMKNYTKEIVSEIKSSDKKYKHDNISTKSCPDCGKPMLEVNGKKGKMLVCQ
FT                   DRECGHRKNVSRTTNARCPQCKKKLELRGEGAGQIFACKCGYREKLSTFQERRKKESGN
FT                   KADKRDVQKYMKQQKKEEEPLNNPFAEALKKLKFD"
FT   misc_binding    393814..393923
FT                   /bound_moiety="thiamin/thiamin pyrophosphate"
FT                   /note="TPP riboswitch (THI element)"
FT   gene            393996..394802
FT                   /gene="thiM"
FT                   /locus_tag="BAA_0439"
FT   CDS_pept        393996..394802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiM"
FT                   /locus_tag="BAA_0439"
FT                   /product="hydroxyethylthiazole kinase"
FT                   /EC_number="2.7.1.50"
FT                   /note="identified by match to protein family HMM PF02110;
FT                   match to protein family HMM TIGR00694"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50279"
FT                   /db_xref="GOA:C3PBW0"
FT                   /db_xref="InterPro:IPR000417"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3PBW0"
FT                   /protein_id="ACQ50279.1"
FT                   /translation="MNTKEISKVVDLVRESNPLVHNITNVVVTNFTANGLLALGASPVM
FT                   AYAKEEVAEMASIAGALVLNMGTLRPDEVEAMLLAGKSANRNDVPVLFDPVGAGATSYR
FT                   TEVARHIPAEIELAIIRGNAAEIANVINEKWEIKGVDAGAGNGNVVSIAKQAADELNTV
FT                   AVITGKEDVVTDGERTIVIRNGHSILTKITGTGCLLTSVIGAFVAVEKDYVKAAVAALT
FT                   FYGVAAELAAAKTVEKGPGSFQIEFLNQLANTTSGDIEKYGKIEVI"
FT   gene            394819..395478
FT                   /gene="thiE"
FT                   /locus_tag="BAA_0440"
FT   CDS_pept        394819..395478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiE"
FT                   /locus_tag="BAA_0440"
FT                   /product="thiamine-phosphate diphosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /note="identified by match to protein family HMM PF02581;
FT                   match to protein family HMM TIGR00693"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50807"
FT                   /db_xref="GOA:C3PBW1"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3PBW1"
FT                   /protein_id="ACQ50807.1"
FT                   /translation="MSRISKAEMSKLLSVYFIMGSNNCTKDPLQVLREALEGFITIFQF
FT                   REKGEGALTGEERICFAKELQAICKEYGVPFIVNDDVELALELDADGVHVGQDDEGITS
FT                   VREKMGDKIVGVSTHTIEEARWVIENGADYLGVGPIFPTSTKKDTKAVQGTKGLAHFRE
FT                   QGITIPIVGIGGISIENTASVIEAGADGVSVISAISLAESAYESTKKLVEEVSRSL"
FT   gene            complement(395594..396907)
FT                   /locus_tag="BAA_0441"
FT   CDS_pept        complement(395594..396907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0441"
FT                   /product="anaerobic C4-dicarboxylate membrane transporter"
FT                   /note="identified by match to protein family HMM PF03605;
FT                   match to protein family HMM TIGR00770"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47147"
FT                   /protein_id="ACQ47147.1"
FT                   /translation="MFWLQFLTLLLCIFIGARLGGVGLGVMGGVGMAILVFVFHLQPTA
FT                   PPIDVMLMILAVITAAGALQAAGGMDYLVHLAEKALRKNPKRITFFAPIVTYLFTLCAG
FT                   TGHVAYSVLPVIAEVSRESGIRPERPMSIAVIASQQAITASPISAATVALLAMLADYKI
FT                   TLLDILKVSIPSTFIACMIAAFVASKMGKELNEDPEYLKRLKEGMIPKIEEKKEFVGVK
FT                   GAKLSVILFLVGTFLVVLLGSFEALRPGWIVDGKLARLSMPNTIEMVMLTIAALIIIFC
FT                   KPNVESIVSGNVFKAGATAVVAIFGIAWMGDTFFNGNLNMIQGSIQHLVTSAPWLFAIA
FT                   LFILSILLYSQAATVRALMPLGLSLGIPPALLIAMFPAVNGYFFIPNYGTIVAAINFDR
FT                   TGTTGIGKYVLNHSFMIPGLIATFTSIGIGMLLISIMF"
FT   gene            397418..399157
FT                   /locus_tag="BAA_0442"
FT   CDS_pept        397418..399157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0442"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="identified by match to protein family HMM PF00015;
FT                   match to protein family HMM PF00672"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50225"
FT                   /protein_id="ACQ50225.1"
FT                   /translation="MKKYWHKLSFLQKNVLLTVLVILTLVGTMGALSFNMFQNSMMSIF
FT                   ERHSFETGDTVLHKLDEEIVRDVTKDPVAQREKREKLTEKLDEATEELNSVGQTYIVGA
FT                   KKNEKGELLIVDLSTDLANVVEVRPGEYYKQLDLWMEAYDKVMSTKKANMTVVYEDLLG
FT                   TWVTILEPIKDGEGNIVAIVAADVDASIVPSTKEKFIIQGLMFICISVLIATVIQFLIV
FT                   RNALAPLRDLREGLRRVGEGDLNIKLEERSDDIGIINSYFNNTIEKFKGIIDKVKQTAE
FT                   QVSSSSQELSVSTKENSMAVQEIVSSMVELRAGAQLQETSVPQYLGIVYEVEDKMEEIT
FT                   NAAKQMEKVSEGIEHHSVKGNGVTKQAINQMNIIQNAVQDLSSIIYSLEVRSKEISDIV
FT                   TVITSISNQTNSLALHATIEASRAEETGEGFAVVADEVRKLAEQMEASAKDIANLIRET
FT                   QAGTEEAVVSIRKASKEVESGMKLVEMNGAFFEEISKSAQSVTNQVRVVSSNSSDILQN
FT                   SQNIVRVVNELSLIANTYTNSSSNVEESMKEQEMSVQDIAELASSLSWLSQELQELIGE
FT                   FKS"
FT   misc_binding    399219..399320
FT                   /bound_moiety="thiamin/thiamin pyrophosphate"
FT                   /note="TPP riboswitch (THI element)"
FT   gene            399421..399741
FT                   /locus_tag="BAA_0444"
FT   CDS_pept        399421..399741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0444"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01910"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46015"
FT                   /protein_id="ACQ46015.1"
FT                   /translation="MSQQVTMSFSVVPQAKTKDVYSVVDKAIEVVQQSGVRYEVGAMET
FT                   TLEGELDVLLDVVKRAQQACVDAGAEEVITSIKIHYRPSTGVTIDEKVWKYRDEYAKPE
FT                   AI"
FT   gene            399710..400486
FT                   /locus_tag="BAA_0445"
FT   CDS_pept        399710..400486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0445"
FT                   /product="putative ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46563"
FT                   /protein_id="ACQ46563.1"
FT                   /translation="MMNMQNQKQSKIITTIWLILLIAIWEGSVSLFKIEPWILPKPSAI
FT                   VQELIGMKDLLLPNTMQTLQEVIIGLFFAILIGTSIAILMDVIPLFRILINPLLVISQT
FT                   IPIVVLAPLFIIWFGYGMLPKVMVVILVCFFPIALSILEGFQTVDKNMLKLLQTMKATK
FT                   WQVYQKVKFPAVLPYFFSGLKIAVTYSVMGAIIGEWLGASEGLGVMLTRATKSFLTARV
FT                   FGVAAIIVMVTLCLYFIVEFMARITAPWIYRKDGRK"
FT   gene            400483..401481
FT                   /locus_tag="BAA_0446"
FT   CDS_pept        400483..401481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0446"
FT                   /product="putative ABC transporter, substrate-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF09084"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49108"
FT                   /protein_id="ACQ49108.1"
FT                   /translation="MKKGLKVMLAALLAVGVAGCNPAKKEESASKDQKVKVVLDWFPNT
FT                   NHTGLYVAQAKDYYKKQGLDVEIIQPGDNVTAEQMIASGKADFAISAQENVTLARVEGI
FT                   PVVSVGAIIQHNTSAFASLKKDNMTSPKDFEGKRYGGWGGPAEEATLKTIMDKHQADFN
FT                   KVEKIILGQTDFFKSIGRDADFEWIYYGWDGIEAKRQGKELNTIMVKDLDPALDFYSPV
FT                   MITSEKHTKQDKDFVKKFMSATTEGYNFAIKEPKEAADILIKAVPDVNKDLVQESQKWL
FT                   STKYQDDAKAWGVQKEEVWTNYMNFLYDNKVIKKKIDVKDAFTNEFLPSEK"
FT   gene            401478..402227
FT                   /locus_tag="BAA_0447"
FT   CDS_pept        401478..402227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0447"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47442"
FT                   /protein_id="ACQ47442.1"
FT                   /translation="MRGLQIKDIVKSFDGNNVLANISASIREGEFVSFVGPSGCGKSTL
FT                   LNMIANVENPTSGSVTYNDKHIQEQDVVSYMPQQDLLLPWRSALQNIVLPLEIEGKPKK
FT                   QRLTEGMEALKQFELDEYADHYPDELSGGMRQRISFLRTYLCEKPIMLLDEPFGKLDAF
FT                   TKMEVHSWLLNSWHQEKQTIVMVTHDLDEAILLSDRVFILSQRPASIVGEVQVKLPRPR
FT                   TMDMLTSIELKKDKEEILRVLAPYMKK"
FT   gene            402519..404063
FT                   /locus_tag="BAA_0448"
FT   CDS_pept        402519..404063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0448"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50827"
FT                   /protein_id="ACQ50827.1"
FT                   /translation="MSILTVENLSHSYGEKTILYNACFRLLKGEHVGVVGGNGIGKSTL
FT                   LRILTGELIHDDGNIEWFPHVKIGFLQQHMDLQEGMTIEGYLQSAFADLYAIECEMLKI
FT                   AEEMNGAGEVEKLLVKYGELQTILESSNFYHIHAEVEEVAIGLGLFEIGLKKDVSKLSG
FT                   GQRTKLLLGKLLLEKADVLLLDEPTNYLDTAHIEWLQSYLRLYEKAYVIISHDELFLNS
FT                   ITNVIFHLEGGKVKRYVGNYEKFVQSYQVQKKQLQSAYVKQQKEISQLETFIQKNKIRK
FT                   AKQAKSREKVLEKMQRIEKIHPVPRSRFDFNVYEEPVSRILQAEKLRIGYSDPLCPELN
FT                   LQVKKGEKIAIIGHNGIGKTTMLKTLLGQIKPLSGSISVGERVNPAYFAQEEFASETTP
FT                   LEKVWAERPDMTKKEVRQALAKCGLKEEHVLKPIRLLSGGEQTKVRLCELIVTRSNVLI
FT                   LDEPTNHLDIETKKSLQEALQQYKGTVLLVSHEPSFYEAWITKVWNIEEWNAEQYE"
FT   gene            complement(404524..406548)
FT                   /locus_tag="BAA_0449"
FT   CDS_pept        complement(404524..406548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0449"
FT                   /product="chitinase B"
FT                   /note="identified by match to protein family HMM PF00041;
FT                   match to protein family HMM PF00553; match to protein
FT                   family HMM PF00704"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50287"
FT                   /protein_id="ACQ50287.1"
FT                   /translation="MKSKKFTLLLLSLLLFLPLFLTNFITPNVVLADSQKQDQKIVGYF
FT                   PSWGIYGRNYQVADIDASKLTHLNYAFADICWNGKHGNPSTHPDNPNKQTWNCKESGVP
FT                   LQNKEVPNGTLVLGEPWADVTKSYPGSGTTWEDCDKYARCGNFGELKRLKAKYPHLKTI
FT                   ISVGGWTWSNRFSDMAADEKTRKVFADSTVDFLREYGFDGVDLDWEYPGVETIPGGSYR
FT                   PEDKQNFTLLLQDVRNALTKAGAEDGKQYLLTIASGASQRYADHTELKKISQILDWINI
FT                   MTYDFHGGWEATSNHNAALYKDPNDPAADTKFYVDGAIDIYTNEGVPADKLVLGVPFYG
FT                   RGWKSCGKENNGQYQPCKPGSDGKLASKGTWDDYSTGDTGVYDYGDLAANYVNKNGFVR
FT                   GWNDVAKVPYLYNATTGTFISYDDNESMKYKTDYIKTKGLSGAMFWELSGDCRTSPKYS
FT                   CSGPKLLDTLVKELLGGPITQKDIEPPTNVKNIAVTNKNSNSVQLNWTASTDNVGVTEY
FT                   EITAGEEKWSTTTNSIAIKNLKPNTEYTFSILAKDAAGNKSQPTSILVKTDDANTTPPG
FT                   GNSNATFSVTSNWGSGYNFSIVIKNSGTTPIKNWKLEFDYNGNLTQVWDSKISSKINNH
FT                   YVITNAGWNGEIPPGGSITIGGAGTGTPAELVNASISEN"
FT   gene            406920..407291
FT                   /locus_tag="BAA_0450"
FT   CDS_pept        406920..407291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0450"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF09350"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46592"
FT                   /protein_id="ACQ46592.1"
FT                   /translation="MDVFLNIAEEKIRQAIRNGDLDNIPGKGKPLQLEDLSMVPPELRM
FT                   SYKILKNAGMIPPEMELQKDILKIEDLIACCYDEEERKKLQQELTAKTLRFQQVMEKRK
FT                   IKDSSAFRMYQDKVFHKLR"
FT   gene            407302..407616
FT                   /locus_tag="BAA_0451"
FT   CDS_pept        407302..407616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0451"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46070"
FT                   /protein_id="ACQ46070.1"
FT                   /translation="MKKFETIEELATYIEEQQLVLLFIKTENCGVCDVMLRNVNYVLEN
FT                   YDYVEKIEILLQDMQEVAGRYAVFTGPTILLFHNGKEILRESRFISLENLERTIQLFEE
FT                   "
FT   gene            407630..407881
FT                   /locus_tag="BAA_0452"
FT   CDS_pept        407630..407881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0452"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47447"
FT                   /protein_id="ACQ47447.1"
FT                   /translation="MEFIIFILLFVVIGIIVTAVRSNKKKVNLMKQNNIHNSSNSSSPL
FT                   FFFAGSDNDSSHGGSHDCGGSFGGDSGGSCDGGGGGGD"
FT   gene            408164..408745
FT                   /locus_tag="BAA_0453"
FT   CDS_pept        408164..408745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0453"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440;
FT                   match to protein family HMM PF08360"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46295"
FT                   /protein_id="ACQ46295.1"
FT                   /translation="MRRSAEEIKKEIAYKAEILFSQKGYAATSMEEICEITERSKGSIY
FT                   YHFKSKEELFLFVVKQHTYDWLEKWNEKEKLYSTSTEKLYALAEYHVEDIQQPISNAIE
FT                   EFSMSQVVSKEILDEMLALTRESYVMFETLIEAGIQSGEFREDNTRDLMYIVNGLLSGL
FT                   GVLYYELDYKELKRIYKKAIDVLLKGMAAE"
FT   gene            408812..410044
FT                   /locus_tag="BAA_0454"
FT   CDS_pept        408812..410044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0454"
FT                   /product="major facilitator family transporter"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48453"
FT                   /protein_id="ACQ48453.1"
FT                   /translation="MNALFKNRAFMLVMASDILQQFAIWIRNMALLYFIMERTNNDPVS
FT                   VSLLSVMEYAPIFIFSFIGGALADRWNPKRTMVAGDVLSVLSIIGIVLLLKLDYWQAIF
FT                   FATLISAIVGQFSQPSSSRIFKRYVKEEQVANAIAFNQTLQSLFMIFGPVVGSLVYTQL
FT                   GLFTSLYSLIILFLLSAIALSFLPKWVEQEQVARDSLKNDIKEGWKYVLHTKNLRMITI
FT                   TFTIMGLAVGLTNPLEVFLVIERLGMEKEAVQYLAAADGIGMLIGGIVAAVFASKVNPK
FT                   KMFVFGMSILAMSFLVEGLSTSFWITSFMRFGTGICLACVNIVVGTLMIQLVPENMVGR
FT                   VNGTILPLFMGAMLIGTALAGGLKEMTSLVIVFCIAMALILLAIGPVLRMQIKKEDVTT
FT                   KEELTNSLASK"
FT   gene            410158..410352
FT                   /locus_tag="BAA_0455"
FT   CDS_pept        410158..410352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0455"
FT                   /product="DNA-binding protein"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47674"
FT                   /protein_id="ACQ47674.1"
FT                   /translation="MKNQIYELRTENNISQGALADKCKVSRQTINAIENNKYDPSLALA
FT                   FRLAEVLGTTVDKLFLYKQ"
FT   gene            410365..410757
FT                   /locus_tag="BAA_0456"
FT   CDS_pept        410365..410757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0456"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49775"
FT                   /protein_id="ACQ49775.1"
FT                   /translation="MGKEKISLFVTILVAIGTLLYALYYWLTELQVNWYALFICSIALH
FT                   YLFKSSASHSVEGETEENQDLEKHVLKTSANVTYYVLVVFIFGLFFASVGFNRWIDFHN
FT                   IPLLFALCAAIVVKPAVEFLIVRRYR"
FT   gene            complement(410784..412067)
FT                   /locus_tag="BAA_0457"
FT   CDS_pept        complement(410784..412067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0457"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49682"
FT                   /protein_id="ACQ49682.1"
FT                   /translation="MKKMSRQEKSWILYDWANSVYSLVITTALFPIYFKAAAKEAGLSG
FT                   ATSTAYWGYANSFATLLISILAPILGTVADYKGFKKRFFTFFFGLGIVFTSMLAVVPTS
FT                   QWYLLLGCYMLALVGFAGANIFYDAFLVDVTSEDRMDRISTRGFALGYIGSTIPFIGCI
FT                   ALIILAQKGTIPLSVGIASQISFAITALWWGLFTIPMLKNVEQTHYIERHPKPIAMSFK
FT                   RLADTFKNIKEYKTVFMFLIAYFFYIDGVDTIITMSTAYGTDLGISATNLLIILFVTQI
FT                   VACPFALLYGKLSTTFTGKKMLYVGIIIYIIICIYAYFLKTTLDFWILAMLVATSQGGI
FT                   QALSRSYFAKLVPKESANEFFGFYNIFGKFAAIMGPVLVGVTTQLTGKTNAGVLSIIVL
FT                   FIIGGFLLTRVPENNTSVTPPNPKTKTL"
FT   gene            complement(412176..413489)
FT                   /locus_tag="BAA_0458"
FT   CDS_pept        complement(412176..413489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0458"
FT                   /product="type I phosphodiesterase/nucleotide
FT                   pyrophosphatase family protein"
FT                   /note="identified by match to protein family HMM PF01663"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47084"
FT                   /protein_id="ACQ47084.1"
FT                   /translation="MDKALTNRVIILSFDCLSALDFPILQKLPHFQSLIKKGTVVEKVE
FT                   PIYPSVTYPSHSTIVTGNYPNKHGVVSNTLLQPGRESPDWHWYRKSIKGTTLYDEAHKA
FT                   NLTTAALLWPVTGRANIDYNLPEIFPNRPWQNQVLVSLFSGSPLYQLDLNRRFGHIRNG
FT                   LSQPELDDFVLASAVHTIQTKKPNVMFVHFTDLDTQRHYHGFESKETIAAIHRHDERLG
FT                   QIIQALKDSDLYEESTIIALGDHSALSENKAIQLNVLFHQKGLISVNSKGNLVDWKVYC
FT                   QSCDGSAYVYVKDKNDTDTIREVQLLLEELLQHKQNGIEFILHDEDAKECGADGNCLFM
FT                   LEAREGYYFTENYTGDFIKEITEKDVTPSKKYTFGTHGYSPTKPNYETIFIAAGKGIKS
FT                   GVTIPYMRLIDESPTIARLLGLHLGETDGSIVEDLLQL"
FT   gene            413643..413936
FT                   /locus_tag="BAA_0459"
FT   CDS_pept        413643..413936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0459"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46513"
FT                   /protein_id="ACQ46513.1"
FT                   /translation="MDWLDGFGIFYIIGGITIILVFAISYLLKKRFPDKQFDIIFALSL
FT                   ILLCLASFPVTMMVIGGWEGMGYGFIGFFVLLGTLIGMIAHQLVKISRKSYV"
FT   gene            414284..415810
FT                   /pseudo
FT                   /gene="proS1"
FT                   /locus_tag="BAA_0460"
FT                   /note="proline--tRNA ligase; this gene contains a frame
FT                   shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF00587; match to
FT                   protein family HMM PF03129; match to protein family HMM
FT                   PF09180; match to protein family HMM TIGR00408"
FT   gene            complement(415815..416588)
FT                   /locus_tag="BAA_0461"
FT   CDS_pept        complement(415815..416588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0461"
FT                   /product="LPXTG-motif cell wall anchor domain protein"
FT                   /note="identified by match to protein family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49810"
FT                   /protein_id="ACQ49810.1"
FT                   /translation="MTKIFILASTLSLSFFSGLNIGNAATENFSPITNAIVQNNDYFVE
FT                   GNSKDNNKPPGNGGSQDDSGSDGNGSDGSGSGDNGSGDNGSGGNGSGGNGSGENGSGGN
FT                   GSGSSGSGDNGSGGNGSGGNGSGSSGSGENGSGGNGSGSSGSGENGSGGNGSGSSGSGE
FT                   NGSGGNGSGGNGSGGNSSGGSGSGGSGSQGGNRVKGDSSSQGGNGSQGGNVKDNAKKQG
FT                   DKLPNTATHYPASILMGLSTFLIGMLLFIRRKNAK"
FT   gene            416791..417669
FT                   /locus_tag="BAA_0462"
FT   CDS_pept        416791..417669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0462"
FT                   /product="ROK family protein"
FT                   /note="identified by match to protein family HMM PF00480"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47636"
FT                   /protein_id="ACQ47636.1"
FT                   /translation="MKEYIAFDIGGTQIKYGIVSETGIVLKHKTVPTEIHLGGEQIIQK
FT                   LILLSKKLMSEHTISGIGISTAGIVDVNRGVVTGGADHIPGYSTIPIINRLQEVLKVPV
FT                   SIENDVNCAALGEKWNGIGREKENFIMLTLGTGIGGAIFIDRELYRGHSYSAGEWGNML
FT                   IEGKTFEEVASISGLIHLVRNYKGKGNWNGKTIFELYDKGDREVTQAVEVFFKHLAIGI
FT                   SNLAYIFNPETIIIGGGITDRGNQFLKEVKEEVGRYLNKEIYSDCEIELAQNGNRAGMI
FT                   GAIYHFLHHHK"
FT   gene            417798..418394
FT                   /locus_tag="BAA_0463"
FT   CDS_pept        417798..418394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0463"
FT                   /product="putative tellurium resistance protein"
FT                   /note="identified by match to protein family HMM PF02342"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48731"
FT                   /protein_id="ACQ48731.1"
FT                   /translation="MPIILEKGQKIDLTKGQPKVAKLQVGLGWDPIGQSGGFLSSLFGS
FT                   KPNVDCDASVVMLEGDRFLNKNDLVYFGNKLSTCGSIIHSGDNLTGEGAGDDETIFVEL
FT                   HKVPSRINRLVFVVNIYDCVNRRQDFGMIRNAYIRIQNPQTGEELARYNLSDNYAGKTT
FT                   LIAGEMYRHGSEWKFSAVGEGTQDKNLSEIVSRYQ"
FT   gene            418418..419002
FT                   /locus_tag="BAA_0464"
FT   CDS_pept        418418..419002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0464"
FT                   /product="tellurium resistance protein"
FT                   /note="identified by match to protein family HMM PF02342"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48029"
FT                   /protein_id="ACQ48029.1"
FT                   /translation="MASISLKKGQKVDLTKTNPGLSKVLVGLGWDTNRYDGQNDFDLDV
FT                   SIFLVGANGKVSGAEDFVFYNNPKGANGAVEHLGDNRTGEGEGDDESIKVDLKNVPAHI
FT                   ERICFTITIYDGEGRSQNFGQVSNSFVRILDEEKNAELIRYDLGEDFSIETAVVVGELY
FT                   RHAGEWKFNAIGSGFQGGLASLCNNFGLDVE"
FT   gene            419083..419667
FT                   /locus_tag="BAA_0465"
FT   CDS_pept        419083..419667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0465"
FT                   /product="tellurium resistance protein"
FT                   /note="identified by match to protein family HMM PF02342"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48302"
FT                   /protein_id="ACQ48302.1"
FT                   /translation="MVIQLQKGQKIDLGKTSPGLTKAVIGLGWDIKSYDGGSDFDLDAS
FT                   AFLLDANGKCTKETDFIFYNNLQSPCGSVLHTGDNRTGEGEGEGDDEQLVVDLKKVPAD
FT                   VHRIAITVTIYDAEGRSQNFGQVGNAFVRLANEETNEEVLRFDLGEDFSIETAVVFCEL
FT                   YRHNGQWKFNAVGSGFQGGLGALVRAYGLDA"
FT   gene            419741..420532
FT                   /locus_tag="BAA_0466"
FT   CDS_pept        419741..420532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0466"
FT                   /product="putative tellurium resistance protein"
FT                   /note="identified by match to protein family HMM PF03741"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49710"
FT                   /protein_id="ACQ49710.1"
FT                   /translation="MSILQGILDTYAQFFDLDMWIKVLQDPVSWGLIGTLVVLEGLLSA
FT                   DNALVLAVMVKHLPEEKRKKALFYGLIGAYVFRFIAIGIGMFLIKLAWVKVLGALYLAW
FT                   LSVKYFIDKRKGNAEEEEAHGMNQNSILFRMFGVFWGTVAMVELMDIAFSVDSVLAAFG
FT                   VSNEVWILLLGGMLGILMMRGIAGVFLKLLERIPELETTAYILILIIAAKMLLSVIHIE
FT                   VSHTLFFIILVVAFGATFILHYVKNSGQAKEEVAATKNNHK"
FT   gene            420642..422273
FT                   /locus_tag="BAA_0467"
FT   CDS_pept        420642..422273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0467"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46760"
FT                   /protein_id="ACQ46760.1"
FT                   /translation="MFSRFTLQPYALKDESDLKHFETLLEKRPQYELTENEMKFSYIAC
FT                   RILGVPNDVDEYFNELFDYSEAKGIEVLHEQNLNKVIDSEKLRHIQEVFGLHQEAPNGL
FT                   TVNRLVAHLSGKQLLPKVDNPDLQHYIHTTFISVLKLYEKQHNQSLKTEGFRRFLIDMI
FT                   KLSENYVAKWFSTINYKKQMPRIIWYGDAQESRIYFLYFLIMLGCDVLYYHPEGKDGFE
FT                   NIDEEARTFVVSHSSRISLEPFPDRRRERVATVAYQASKEIEQVLHHDNSLLYKPWQFR
FT                   SYTPVARTLKTTYDELFLITKEKAFVRPTFFVENKHIYIPSLFAKISGVSKNDKEYFQR
FT                   LKAVTSFDNSLLINTFPFTKEQKANFQYHYRDALDRGGKLHPDLIMNSHWWPHKRLPEG
FT                   LQHGIAEAIIHTCESEMCKPIAKETKQDVALYVFAQLSQIPPNILEQLEKFDYSQDVPK
FT                   IVIFNNEKSGELTRSDAVLLLFLNQIGVDVFHFNPTGRNDIEPYIEAGAFDSHWLEEVN
FT                   FDFEFHGSSAYKNLSQTIKGLFRPFL"
FT   gene            422292..423374
FT                   /locus_tag="BAA_0468"
FT   CDS_pept        422292..423374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0468"
FT                   /product="putative tellurite resistance protein"
FT                   /note="identified by match to protein family HMM PF05816"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49631"
FT                   /protein_id="ACQ49631.1"
FT                   /translation="MNNPVVLDSKTELNEQTAQDVRLQLRQDADVQRIYNAVDIKDQLE
FT                   LIELGKEPSMEISRFADQILHTMSLSKIEDSGELLKQLGKIMDRFDSKDFAEEKSGFFS
FT                   RMFKKADKMIEQIFSKYQTMGREIDKVYVEITKYQDEMKKSIGTLDGLYEQNLKYYLDL
FT                   EKYVVAGEMLLERLNTELVPMYEERVRNNDQLAGIELESLKNSVEILEQRIDDLEKARM
FT                   VALLTAPQIRMIQRGNNKLIGKINTAFITTIPIFKNGIIQAVNAKRQKLVADSMAELDR
FT                   RTNELLKKNAQNIATQSVEVARLSGSSSIKMETLEETWNIISRGMQETQQIEEQNKRER
FT                   EESRKRMATLTENIKKELQG"
FT   gene            complement(423410..426076)
FT                   /locus_tag="BAA_0469"
FT   CDS_pept        complement(423410..426076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0469"
FT                   /product="cation-transporting ATPase, E1-E2 family"
FT                   /note="identified by match to protein family HMM PF00122;
FT                   match to protein family HMM PF00689; match to protein
FT                   family HMM PF00690; match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01494"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49019"
FT                   /protein_id="ACQ49019.1"
FT                   /translation="MSNWYSKTKDQTLIDLETNEQHGLTEEIVNERLTQYGANELATKQ
FT                   KRSLWQRIFAQINDVLVYVLIIAALISAFVGEWADASIIALVVVLNAVIGVVQESKAEQ
FT                   ALEALKKMATPKAIVKRDGELKEIPSEHVVPGDIVMLDAGRYIPCDLRLIETANLKVEE
FT                   SALTGESVPVDKDAIYHPSMQSDEQVPLGDQKNMAFMSTLVTYGRGVGVAVETGMNSQI
FT                   GKIATLLHEADDDMTPLQKSLAQVGKYLGFVAVAICIVMFLIGFLQGRDTLEMFMTAIS
FT                   LAVAAIPEGLPAIVSIVLAIGVQRMIKQNVIIRKLPAVEALGSVTIICSDKTGTLTQNK
FT                   MTVTHFYSDNTYDQLERLNVNNDTQRLLLENMVLCNDASYNNESQTGDPTEIALLVAGS
FT                   TFNMQKDHLEKIHERVNELPFDSDRKMMSTVHTYDESYYSMTKGAIDKLLPLCTHIFKN
FT                   GKIEGLTEDDKNQILEAAEVMSQEALRVLSFAFKQYNSSDVDIDHLEENLIFIGLVGMI
FT                   DPPRTEVKDSISECKKAGIRTVMITGDHKDTAFAIAKELGIAEEISEIMIGTELDNISD
FT                   TELANKINHLHVFARVSPEHKVKIVKALRAKGNIVSMTGDGVNDAPSLKQADVGVAMGI
FT                   TGTDVAKGAADVVLTDDNFSSIVKAVEEGRNIYRNIKKSILFLLSCNFGEIIALFLAIL
FT                   LGWATPLRPIHILWVNLITDTLPALSLGVDPEDPDVMKEKPRHAKESLFSGSVPFLIFN
FT                   GFVIGLLTLIAFIAGAKFYTGDTNLFPLFPERIDEDALLHAQTMAFVVLSFSQLVHSFN
FT                   LRSRTKSIFSIGIFTNKYLVFSLLIGVLMQVCIISIPPLANIFGVHALTMRDWGFVLLL
FT                   SIIPLVVNEFIKLVKRN"
FT   gene            complement(426268..426492)
FT                   /locus_tag="BAA_0470"
FT   CDS_pept        complement(426268..426492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0470"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06569"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50711"
FT                   /db_xref="InterPro:IPR009507"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3PCM9"
FT                   /protein_id="ACQ50711.1"
FT                   /translation="MDLSVKSEENVEYMVEAIKEKLRMVNAGAMRAASFNEEMYEDLRD
FT                   IYEHVMKRETFSISEMQAITEELGTLIKK"
FT   gene            426667..427131
FT                   /locus_tag="BAA_0471"
FT   CDS_pept        426667..427131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0471"
FT                   /product="low molecular weight phosphotyrosine protein
FT                   phosphatase family protein"
FT                   /note="identified by match to protein family HMM PF01451"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50169"
FT                   /protein_id="ACQ50169.1"
FT                   /translation="MVQVLFVCLGNICRSPMAEAIFRDLVVKEGLEEKIVIDSAGTGDW
FT                   HVGHPPHKGTQKILKENAVTFEGIKARQVEKEDLTKFDYIIAMDNKNIADLKSLGKTGG
FT                   YIGRLSDFVPDGGWTDVPDPYYTGNFQEVYDLVTEGCAKLLAFIRNEQGI"
FT   gene            427185..427667
FT                   /pseudo
FT                   /locus_tag="BAA_0472"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            427706..428575
FT                   /gene="yihY"
FT                   /locus_tag="BAA_0473"
FT   CDS_pept        427706..428575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yihY"
FT                   /locus_tag="BAA_0473"
FT                   /product="YihY family protein"
FT                   /note="identified by match to protein family HMM PF03631;
FT                   match to protein family HMM TIGR00765"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50741"
FT                   /protein_id="ACQ50741.1"
FT                   /translation="MRKILEKVRRNRTYSFGKDLYDRTMRDDVAGLAAQLAYFFLLAIF
FT                   PGLVFLITLLGFIDLQTESVLNLLEPYVPEDAMSLIEVNVDKVVNEQNGGLLSFGLLSM
FT                   LWFASNGVNAVMNAFNRAYDVTETRSFIKTRALSIVFTLAIIFMIVFALIVPVFGQVIG
FT                   AAVFKAIGLSDSFSYVWSITRLVASFFVLFALFSFLYTFAPDRKLKRREVISGATFATV
FT                   GWIVVSYSFAYYVDKFANYANTYGGLGGIIILMLWFYLTGWVILLGGEINGLLHHYRTG
FT                   DNNSRNEK"
FT   gene            complement(428760..430685)
FT                   /locus_tag="BAA_0474"
FT   CDS_pept        complement(428760..430685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0474"
FT                   /product="heavy metal-transporting ATPase"
FT                   /note="identified by match to protein family HMM PF00122;
FT                   match to protein family HMM PF00702; match to protein
FT                   family HMM TIGR01494; match to protein family HMM
FT                   TIGR01512; match to protein family HMM TIGR01525"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47219"
FT                   /protein_id="ACQ47219.1"
FT                   /translation="MNSEVKTLQVQKSISHPSLWDTLKKHYELIFAITSGIFILAGWLF
FT                   TKNDVMNVGITCYILAYIVGGYAKAKEGIEDTIEEKELNVEMLMLIAAIGAAMIGYWAE
FT                   GAILIFIFALSGAMESYTLSKSQKEISALLDLQPEEALRISNGTEERVPVGRLQINDII
FT                   LIKPGERVPADGTIHSGETNIDEAAITGEPIPNEKKHGDEVFAGTVNLRGAIEVKITKP
FT                   SDQTLFQKIIRLVQSAQSEKSPSQLFIEKFEGTYVKGVLLVVTLMMFVPHFLLDWSWNE
FT                   TFYRAMILLVVASPCALVAAITPATLSAISNGARNGILFKGGIHLERLASVKAIAFDKT
FT                   GTLTEGKPTVTDVYVRENMTEKEVLSITAAIESHSTHPLAESIVKYAQHTYDITLKKPE
FT                   NVEDVTGFGLKGIFESKAYKIGKADFIGEETKTFHNGVSASLEKEGKTVVYISDEEGIL
FT                   GLIALKDTLRQETIAAIRELQSIGVEAIMITGDNEETAKAIASESNIKEYYASCLPETK
FT                   VETIKKLKEKYGTVAMVGDGINDAPALATASIGVAMGEGTDVALETADVVLMKNELSRL
FT                   SQAIRLSKRMNRIVKQNVIFSLAVIAMLICSNFLQFLALPFGVIGHEGSTILVILNGLR
FT                   LLKGNN"
FT   gene            430956..431906
FT                   /locus_tag="BAA_0475"
FT   CDS_pept        430956..431906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0475"
FT                   /product="transporter, EamA family"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46673"
FT                   /protein_id="ACQ46673.1"
FT                   /translation="MKTEKFFTHPIGVFIAAIVATFLWGSAFPFIKLSYAELGIQPKEV
FT                   GEQILFAGYRFFLSGVMLLFFFKLLGKDMNFKKGTGKQLVQIGLFQTFLQYICFYIGMS
FT                   YSSGIEGAIISGTSSFFQIILAHFLYKDDALNMRKIIGVSIGFCGVVLVNVPSDGSLSF
FT                   HFGIGSLLLLSAAMLYSYGNILAKEGSKTLDVGYMTAYQMIFGSIGLLCIGALQVGIMP
FT                   FTFSVHAILMLIYLSFLSAAGFCIWNTIMKYNKVGKVSMYMFFIPVFGVLLSSMILGEA
FT                   IHSFVLFGLACVAAGIIVVNRTPAKQKIEQEKQVA"
FT   gene            432029..432709
FT                   /locus_tag="BAA_0476"
FT   CDS_pept        432029..432709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0476"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07947"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47825"
FT                   /protein_id="ACQ47825.1"
FT                   /translation="MNLLYMVLIGQIILFLIGAIYAIGQTKKTTNNIPLPLAVRLILSF
FT                   SLTASAIWIWLQDPSVEYSTWVALGMTLSTVGDLFMAGLIPIGHRLIGGMITFALAHCF
FT                   YVKAFLQTGISWNGFWIGLLVYGLFLIIGWFFFIRNEKQDKLFTIGALIYGLWVGGMAC
FT                   FAFALYYENTGIWWIPAFGGLLFVISDFIIGVTDIGGRKLKYEPLWIWFTYVAAQMCIV
FT                   YVGL"
FT   gene            432942..433295
FT                   /pseudo
FT                   /gene="lepB_1"
FT                   /locus_tag="BAA_0477"
FT                   /note="signal peptidase I; this gene contains a frame shift
FT                   which may be the result of a sequencing error; identified
FT                   by match to protein family HMM PF00717; match to protein
FT                   family HMM TIGR02227"
FT   gene            433292..433474
FT                   /pseudo
FT                   /gene="sipS1"
FT                   /locus_tag="BAA_0478"
FT                   /note="signal peptidase I S; this gene contains a frame
FT                   shift which may be the result of a sequencing error"
FT   gene            complement(433518..436280)
FT                   /locus_tag="BAA_0479"
FT   CDS_pept        complement(433518..436280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0479"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50605"
FT                   /protein_id="ACQ50605.1"
FT                   /translation="MTIENQFIQKVYYKTFLTEETSTPVSDVLGEAYINESTNEFSNIS
FT                   NIRFAQGELYYQNKDFEAAIFKWEKVNNELALWATKNIADAYFELGFLPKAEEMYQSIQ
FT                   TEDTTLTMEVSLQLLSLYIEQDRLGLAFKTISEAVAFQPDYPNITSIARSFYEKQEDWN
FT                   NAIELAVQEGIRTKSLHWFDTLINYVNQGFTKQIKPEYFYESLKALYAIDQVQFKELVI
FT                   TLWNSYQNEKLHLPWIETINHLFLHIETDNNDDWHEIVERYQDTYFELITGEHFMHEMQ
FT                   GLVPDLLTNWFSLTRAKDALFVSAAVLAWNEVSPTTLESLLVKSAGALLSNSTAETNVN
FT                   METVSHLFETIAVWAEKNDVDLSHQFTLLVHELCDLNVTQLLIAGTSDHDKLSFVNSIL
FT                   GENILTETITTPILFKDDSQTEITEFTALDVHNIPNFDEFHQIMATSDQSELENKCIEI
FT                   KLPSRFLRKNKFAFLVTPSVQGQVDKNSSYFEYLQAADSLIYVLNSASPLHGKELDTLL
FT                   YLREQVPNLQIHFVLHTNSADKNEKLMSKIKVHFPNAQFFPYSPSQESSQQLGDVTESI
FT                   LSNLATRDIEQERIEKLIWFTQKTIAYLVNERVELENTLVKSVRWNKHISVKLNGFINN
FT                   LTALEKDKIRSITESYLLTKEEITRDIHSQIPELLQSCSDLVQEDSDFKLVHEELNTAM
FT                   NERIQKHVQQVLLPKFTGFIQEWIETAHNEFIQAQSYLDEMSETFNKLYKEERMKLPCD
FT                   FKLLDDWHRDVVRMTNRITVSNINILLRFTPTQFFLKSAGKLFGNMQKNQSMLANKYKQ
FT                   YIETEDYTEIAQTISKQFFLQFEVFEGALERDIMMFFKDPLSILKQNVEAAQLEIQEDE
FT                   QTLATLRSNPETYHDPLAFFKLQLLQHKFILSTHKNNEDIYEFNESPTI"
FT   gene            436755..437345
FT                   /locus_tag="BAA_0480"
FT   CDS_pept        436755..437345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0480"
FT                   /product="dedA family protein"
FT                   /note="identified by match to protein family HMM PF09335"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46127"
FT                   /protein_id="ACQ46127.1"
FT                   /translation="MEQHIGELIAHYGYFGIIIALAGGIVGLPIPDEFLLTFVGYNVSK
FT                   GVMSGTAAFLSGMAGAMLGITLSYILGLKLGLPVLKKYGPKIRIKEHHIEKTHILFEKY
FT                   GPFLLMIGYFIPGVRHLTAYFAGMSNLTIWRFCLYAYGGALIWISVFIGLGWKLGEKWR
FT                   FVEYSLHHYGIWILSISVVVTCVVWFYIKKNRE"
FT   gene            complement(437354..437782)
FT                   /locus_tag="BAA_0481"
FT   CDS_pept        complement(437354..437782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0481"
FT                   /product="transporter, EamA family"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46902"
FT                   /protein_id="ACQ46902.1"
FT                   /translation="MSSWLLFALLSAIAAALVSIFGKIGLDGIDANVATTVRSIIMALF
FT                   MVGVIIIQGKFQNIGDVLLNKKALLFITLSGVAGASSWLFYFLALKTGKVSQVAPVDKL
FT                   SVVFSIILAMIILGEKLNFMTGIGVVFITAGVLFIAFS"
FT   gene            complement(437889..438035)
FT                   /locus_tag="BAA_0482"
FT   CDS_pept        complement(437889..438035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0482"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47494"
FT                   /protein_id="ACQ47494.1"
FT                   /translation="MKREERKNMIEFIEKKKGIERDELLFMTDDEVEHIYNVTYFLYEE
FT                   IAE"
FT   gene            complement(438189..438605)
FT                   /locus_tag="BAA_0483"
FT   CDS_pept        complement(438189..438605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0483"
FT                   /product="general stress protein 26"
FT                   /note="identified by match to protein family HMM PF01243"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48300"
FT                   /protein_id="ACQ48300.1"
FT                   /translation="MHLKEKITTIIQGQRTGVLSTVRNDKPHSAFMMFFHEDFVLYVAT
FT                   DRQSKKITDIENNPNVHVLLGREGKKLDEDYIEVEGLASIEEDSTLKNKFWNNSLKRWL
FT                   LRPEDPNYVLIKINPDTIYYIDGAGTTEPEFLRL"
FT   gene            438785..439840
FT                   /gene="cax"
FT                   /locus_tag="BAA_0484"
FT   CDS_pept        438785..439840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cax"
FT                   /locus_tag="BAA_0484"
FT                   /product="calcium/proton exchanger"
FT                   /note="identified by match to protein family HMM PF01699;
FT                   match to protein family HMM TIGR00378; match to protein
FT                   family HMM TIGR00846"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49266"
FT                   /protein_id="ACQ49266.1"
FT                   /translation="MFNKIFLIVALIGVPLSVLGKTLHWPQTIMFAVYCITIIALAGFM
FT                   GRATESLAIVSGPRIGGLLNATFGNAVELIISIFALQAGLIEVVLASLTGSVLGNLLLV
FT                   GGLSFFIGGLKYKRQSFNVYDARHNSALLIFAVVVAFVIPEIFSMKMDAGKTYQLSIGV
FT                   SIIMIIMYLAALLFKLVTHRGVYQHKSDEVAHEEEPEWSKGKALLILAIATIAVAYVSE
FT                   ALVHTFETVAKSFGWSELFIGVIIVAIVGNAAEHASAIIMAYKNKVNIAVEIAVGSTLQ
FT                   IAMFVAPVLVLLSMFFAQRMPLVFTIPELVSMITAVFLTIAISNDGDTNWFEGGTLLAA
FT                   YVIMGIGFYLL"
FT   gene            439922..440719
FT                   /locus_tag="BAA_0485"
FT   CDS_pept        439922..440719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0485"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47456"
FT                   /protein_id="ACQ47456.1"
FT                   /translation="MKRVYSICLSTMVSFILLFPNMSFAKTTVETKMPSSVLNISKDNT
FT                   FPNDAQDLPRLQPSKFAQELLKTANIKIENPDLIRMFNETTISNAPLAVGYRAKIYLGQ
FT                   WALHYESIDTSINWEYKQVNRNVYDNRGGDRLYPLRYKQETQKTVEGDLTADMKDATDV
FT                   KKMMLLKALEKVQLPLSFKTTIGYGTGHERVYNISPSQLGYLYAYTPAVNEKGKVTFGE
FT                   VYLVLKGNQKRLVVKNITSQGIGAAIPIHDHLYFKFISSSHSQ"
FT   gene            complement(440754..441881)
FT                   /locus_tag="BAA_0486"
FT   CDS_pept        complement(440754..441881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0486"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04055;
FT                   match to protein family HMM PF08756"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49589"
FT                   /protein_id="ACQ49589.1"
FT                   /translation="MTISQKMKPITPSYDPWEAYMDLEEYGKLLLTNVEFTTTTLCNMR
FT                   CEHCAVGYTLQPKDPNPLPMDLLLKRLDEIPHLRSLSITGGEPMLSKKSVDNYVTPLLK
FT                   YAHERGVPTQINSNLTIDLARYEQIIPYLDVLHISHNWGTIDDFVEGGFAMMERKPTYE
FT                   QRAKLFERMITNSKALSDAGVLVSAETMLNKRTLPHIEHIHRQIVDEMGCKRHEVHPMY
FT                   PSDFASNLEILTKAEIRDAIEHLLEIRDENVWMLFGTLPFYACSDDERDIATFRKLQES
FT                   KNVTVRNDPDGRSRLNVNIFDGNIIVTDFGDVPLLGNIQTNTLQEAYEKWSASKTAKSL
FT                   SCHCPTVKCLGPNVLVKNSYYPTEDFLSKTANITL"
FT   gene            442095..442277
FT                   /locus_tag="BAA_0487"
FT   CDS_pept        442095..442277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0487"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47324"
FT                   /protein_id="ACQ47324.1"
FT                   /translation="MGKAIQDKDTQLVYLKERLNMFIEVIDTIEPEEVELEDVDRLLAM
FT                   LDELELKCEQFKKDE"
FT   gene            442484..444004
FT                   /gene="fumA"
FT                   /locus_tag="BAA_0488"
FT   CDS_pept        442484..444004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fumA"
FT                   /locus_tag="BAA_0488"
FT                   /product="fumarate hydratase, class I"
FT                   /EC_number="4.2.1.2"
FT                   /note="identified by match to protein family HMM PF05681;
FT                   match to protein family HMM PF05683; match to protein
FT                   family HMM TIGR00722; match to protein family HMM
FT                   TIGR00723"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47749"
FT                   /protein_id="ACQ47749.1"
FT                   /translation="MEKLQESMYQLIVETSTNLPKDVRRAIQQAKERENAGTRSAMALG
FT                   TITNNIKMADDNISPICQDTGMPTFKIYTPVGVNQLKLKEAIYHALERATKDGKLRPNS
FT                   VDSLFGDNSGNNLGPGTPVIKFEQWEKDYIDARLILKGGGCENKNIQYSLPCELEGLGR
FT                   AGRDLEGIRKCLLHAVYQAQGQGCSAGVIGVGIGGDRTSGYELAKNQLFRTLDDVNPIP
FT                   ELQQLEEYVLENANKLGIGTMGFGGETTLLGCKIGVYNRLPASFYVSVAYNCWAYRRLG
FT                   VTIHPETGEIMDWLYQEGDDTLQQEAQEKTEQREIVLQAPITEEQIRKLRVGDVVTING
FT                   MMYTGRDAIHKHLMDNDCPVDLNGQVIYHCGPVVVKDENDNWQIKAAGPTTSIREEPYQ
FT                   GDIMKKFGIRAVIGKGGMGAKTLAALEEHGGVYLNAIGGAAQYYAECIKEVKDVDFLQF
FT                   GIPEAMWHLRIEGFKAVVTMDSHGNSLHADVDKTSLEKLASFKEPVFK"
FT   gene            444131..444913
FT                   /gene="pdaA"
FT                   /locus_tag="BAA_0489"
FT   CDS_pept        444131..444913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdaA"
FT                   /locus_tag="BAA_0489"
FT                   /product="delta-lactam-biosynthetic de-N-acetylase"
FT                   /EC_number="3.5.-.-"
FT                   /note="identified by match to protein family HMM PF01522;
FT                   match to protein family HMM TIGR02884"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48388"
FT                   /protein_id="ACQ48388.1"
FT                   /translation="MKHKWLYIGLIFSIMMALVPVSALAYTNTPHNWGIPRPKNETVPD
FT                   AGKLYTDLLQKNGGFYLGDTKKKDIYLTFDNGYENGYTGKILDVLKEKKVPATFFVTGH
FT                   YIKTQKDLLLRMKDEGHIIGNHSWSHPDFTAVNDEKLREELTSVTEEIKKVTGQKEVKY
FT                   VRPPRGVFSERTLALTKEMGYYNVFWSLAFLDWKVDEQRGWQYAHNNVMTMIHPGSILL
FT                   LHAISKDNAEALAKIIDDLREKGYHFKSLDDLVKSNQP"
FT   gene            444973..445161
FT                   /pseudo
FT                   /locus_tag="BAA_0490"
FT                   /note="conserved domain protein; this gene contains a
FT                   premature stop which may be the result of a sequencing
FT                   error"
FT   gene            445195..445836
FT                   /pseudo
FT                   /locus_tag="BAA_0491"
FT                   /note="endonuclease III domain protein; this gene contains
FT                   a premature stop which may be the result of a sequencing
FT                   error; identified by match to protein family HMM PF00730"
FT   gene            445847..447226
FT                   /locus_tag="BAA_0492"
FT   CDS_pept        445847..447226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0492"
FT                   /product="RNA methyltransferase, TrmA family"
FT                   /note="identified by match to protein family HMM PF01938;
FT                   match to protein family HMM PF05958; match to protein
FT                   family HMM TIGR00479"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49842"
FT                   /protein_id="ACQ49842.1"
FT                   /translation="MIQKQHESKLEVGQTFPVTIKRLGINGEGVGYFKRQVVFIPGALP
FT                   GEEVVAETTKIQRGFAEAKVKKVRKASPHRVKAPCPVYEECGGCQLQHLDYKEQLNQKR
FT                   DIVVQAFEKYMKNSMEEKIRPTLGMENPWHYRNKSQLQVGRKDEKVITGLYKQNSHQLI
FT                   DIAHCMIQHKATNEATKVVRRILEKLNVSIYNEKKQKGLVRTIVTRTAVQTGEVQVTLI
FT                   TTKEELPNKEQFIAEVQKQMPAVKSIMQNVNWRKTSVIFGDKTFKLAGKEVIQETLGDL
FT                   SFELSARAFFQLNPEQTVVLYNEAKKAAALTGNEKIVDAYCGVGTIGLWLANDAAEVRG
FT                   MDVIPEAIADARKNAKRHGFTNTKYEAGKAEQWLPKWVKEGWRPDVIVVDPPRTGCDDK
FT                   LLETILKVKPKQVVYVSCNPSSLARDVQALMKSYEVEYVQPVDMFPHTAHVENVVKLTL
FT                   K"
FT   gene            complement(447287..448411)
FT                   /locus_tag="BAA_0493"
FT   CDS_pept        complement(447287..448411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0493"
FT                   /product="prophage LambdaBa04, site-specific recombinase,
FT                   phage integrase family"
FT                   /note="identified by match to protein family HMM PF00589"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50403"
FT                   /protein_id="ACQ50403.1"
FT                   /translation="MKGYFRKRGEKWSFTIDIGKDPITGKRKQKTASGFKTKKEAERAC
FT                   NELIHQFNTGSLVDDKNFTLSEYLQEWLENTAKQRVRETTFTNYKRAINSRIIPVLGSH
FT                   KLKDLKPLHGQRFVKSLIDEGLSPAYIEYIFIVLKGSLEDAVRWELLFKNPFQHVEIPR
FT                   PRKVVNSTWSIEETKKFLNRTKFENVIYYHLFLLALNTGMRRGEILGLKWKNFDLNEGK
FT                   ISVTETLIYDENGFRFTEPKTHGSKRLISIDQNLCKEFKSYKAKQNEFKLLFGQSYEDN
FT                   DLVFAKETGQPILPRTMTTTFNQFIKKADVPQIRFHDLRHTHATILLKLGINPKIVSER
FT                   LGHSSIKTTLDTYSHVTIDMQESAVLKLSEALKS"
FT   gene            complement(449127..449330)
FT                   /locus_tag="BAA_0494"
FT   CDS_pept        complement(449127..449330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0494"
FT                   /product="prophage LambdaBa04, DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48701"
FT                   /protein_id="ACQ48701.1"
FT                   /translation="MVIIASFFNVSVDALIGFTNEFDEEPLTELLSNVQTTYAALNEQQ
FT                   RERFCKQVSVLINMLEDNQDIF"
FT   gene            450006..451181
FT                   /locus_tag="BAA_0495"
FT   CDS_pept        450006..451181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0495"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49262"
FT                   /protein_id="ACQ49262.1"
FT                   /translation="MWKVLNVLEGELYVAGIKKNKLADYWGVKPATVTKVFKGANDISF
FT                   GYLSKTLILLKKSLISQAKIVNDYVTNTDPKPENLREAMEDLAIRGKFELLKAIIDQEI
FT                   HSDVAENREFAEVYEIIFRRYHDGLNASAYFKLLRQKNKNVKTIEMEVLTEILLCQAQY
FT                   QSGNYKTLYERLKSVSEKINEITNKFIKECLLLRYKEAIAVTSLQGGEVVESRSICRDI
FT                   LDELEWDDFFSLPKLNAYLKIGESLIFEPDNYDSAKFYLEKTLELLGNPSCKGLEKKWK
FT                   LVQQTLSFLKIHQQRDLNTLEFVHPSEKAYSMILEGDVLGAKKILLDLKEKNGEWTDIQ
FT                   TAYYALTCEGEERESLLKKSLLMCQKSGNIHYSQLPKNILGFNLKKWYNYL"
FT   gene            451199..451345
FT                   /locus_tag="BAA_0496"
FT   CDS_pept        451199..451345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0496"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47632"
FT                   /protein_id="ACQ47632.1"
FT                   /translation="MKKILALLPILLVAGLFTFSADNQQTKDKQEASEPVVQRMMTDPG
FT                   GGW"
FT   gene            451513..451647
FT                   /locus_tag="BAA_0497"
FT   CDS_pept        451513..451647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0497"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48203"
FT                   /protein_id="ACQ48203.1"
FT                   /translation="MKKEQLARELMVKWVLENKETNSEEVLKEITSHTYTEEKLKEAN"
FT   gene            complement(451675..452016)
FT                   /locus_tag="BAA_0498"
FT   CDS_pept        complement(451675..452016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0498"
FT                   /product="prophage LambdaBa04, DNA-binding protein"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48253"
FT                   /protein_id="ACQ48253.1"
FT                   /translation="MTFGEKLKQLRGKRTQGDVANLLNISRATYSHLENNRIEPSMTVL
FT                   NSIADLFCVSTDYLLGRSSDPRLTEEQDKTADEMARRFMELVADLPKEEQENAWKQAAM
FT                   YVNFTKNQK"
FT   gene            452191..452412
FT                   /locus_tag="BAA_0499"
FT   CDS_pept        452191..452412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0499"
FT                   /product="prophage LambdaBa04, DNA-binding protein"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48780"
FT                   /protein_id="ACQ48780.1"
FT                   /translation="MNNILKNERKKMKFTQKQLAEKLGISTIYVRKIESGYIPRPDIMV
FT                   KYQEVFDISVKELFPDYFSAFNDKKFII"
FT   gene            452430..453161
FT                   /locus_tag="BAA_0500"
FT   CDS_pept        452430..453161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0500"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF09669;
FT                   match to protein family HMM TIGR02681"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49114"
FT                   /protein_id="ACQ49114.1"
FT                   /translation="MNQLQDLRHPVSEFVFTERNQVVTDSLTMAQMFGKEHKNVIRDIE
FT                   VQLEKLIEANETEWGQLNFEPTQYQHYQNKQWYPKFNLTEDAFAIVAMSYITPEAMKMK
FT                   IKFLQEFKRMKEHIQKVQQQPKSVEDAIIYSMTELKQIKSRQDHTEEEMNKMKLLVDNE
FT                   LWLTEQHKGSVQRKVKQRVFELKKEGYDNASYQGIYGALKRHFGVAKYDKIPRKYYQNA
FT                   MRFIAGWYPPERPNTLDDYVS"
FT   gene            453206..453556
FT                   /locus_tag="BAA_0501"
FT   CDS_pept        453206..453556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0501"
FT                   /product="putative prophage LambdaBa04, DNA binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49967"
FT                   /protein_id="ACQ49967.1"
FT                   /translation="MKNSTVQIALAVTKFSAQKGWSDEEFWEAIELLRFNKEDARQTAI
FT                   EKLDTIPVTYDNTNDYPIMLKVDHVAEVLGISQRKAYDIMDQKGFPLVKIGRKKVVPRD
FT                   AFFNWLERGVSA"
FT   gene            453553..453720
FT                   /locus_tag="BAA_0502"
FT   CDS_pept        453553..453720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0502"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50845"
FT                   /protein_id="ACQ50845.1"
FT                   /translation="MMEDTTSLVAFAMFIAFSILLLYITYEPIKRWAWSNVEQNKKTHG
FT                   SGSFKKKQLS"
FT   gene            453750..453935
FT                   /locus_tag="BAA_0503"
FT   CDS_pept        453750..453935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0503"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50398"
FT                   /protein_id="ACQ50398.1"
FT                   /translation="MDLIKYQVLLPNKFWDLAESKDELKKMIEQYFKNSYPHYKIKEII
FT                   RSGESHIAICERKWLI"
FT   gene            453932..454804
FT                   /locus_tag="BAA_0504"
FT   CDS_pept        453932..454804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0504"
FT                   /product="putative prophage LambdaBa04, DnaD replication
FT                   protein"
FT                   /note="identified by match to protein family HMM PF04271;
FT                   match to protein family HMM TIGR01446"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46867"
FT                   /protein_id="ACQ46867.1"
FT                   /translation="MNNVVLQIGQMNFRGNVIDHGWFKTLTLDNGKPNMVAISILGEVV
FT                   YWYKPTEVRDEHSNNVRYKQKFKADTLQKSYQQFADSFGFTKRQVKDACDYLKDRRLVH
FT                   IEFRTIFVNGTRCNNVMFIEPIPEEIQKISILYWENGTPPTLERKRVLQQNEPPSYDKK
FT                   EEPPTFKRKTNTENTTKNTTENVSSSSIFSFYENNFGILNSFIAENISQWVNDTSEELV
FT                   QAAMERALKQQKKWNYAEGILKQWVNNNVKTLKDVDALETEYQRNKGVKKRVGINRKSD
FT                   DSDSEYIGL"
FT   gene            454773..455576
FT                   /locus_tag="BAA_0505"
FT   CDS_pept        454773..455576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0505"
FT                   /product="putative prophage LambdaBa02, DNA replication
FT                   protein DnaC"
FT                   /note="identified by match to protein family HMM PF01695"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47715"
FT                   /protein_id="ACQ47715.1"
FT                   /translation="MTRIVNTSACSEETEGYTCEHCNKYIAAITVEVPQLRIKNKILPT
FT                   CECVVEREEAKIREAQNFAKKREIEKLFSISNLGERFSKSTFESFLDRNGSETAYKVAV
FT                   KYVKTFKEWNGESLMLWGEPGNGKTHLAAAIVNELSKKGYIVVFQSVPELLQRIRSTFN
FT                   SENKENETQIMRALLECDLLILDDIGAEKTTEWVEEKLFNIIDGRYRKELPTLYTSNLE
FT                   PKELKNQVGKRSYDRMVETSLTVKNEAASYRREIAKQRLQRFIEA"
FT   gene            455592..455786
FT                   /locus_tag="BAA_0506"
FT   CDS_pept        455592..455786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0506"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47739"
FT                   /protein_id="ACQ47739.1"
FT                   /translation="MCVLCHDTGIIRKETYPGVIETNGCNCEVAKRQQAENDKRWQAWL
FT                   IKFESMKQELERSKQQKAS"
FT   gene            455811..455984
FT                   /locus_tag="BAA_0507"
FT   CDS_pept        455811..455984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0507"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48429"
FT                   /protein_id="ACQ48429.1"
FT                   /translation="MKPTKVEIDVTDNKIYVVKNGEVTPLNPPATGFGEQIITWQGGKV
FT                   DRVSTTITEKIK"
FT   gene            456265..456681
FT                   /locus_tag="BAA_0508"
FT   CDS_pept        456265..456681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0508"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48381"
FT                   /protein_id="ACQ48381.1"
FT                   /translation="MFNRWLTDEEYQQAESNGISRRVLYMRMYRYGWELQEALTTPPRT
FT                   YWHMGEGKHNKWLKLAEKNGVNSSTFYSRVNNGWDPKDAASIPTRKQMDRKELVKIAES
FT                   NGISVSTFRSRLSYGWDPMKAATTPAKSKNKNIS"
FT   gene            456697..457161
FT                   /locus_tag="BAA_0509"
FT   CDS_pept        456697..457161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0509"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03819"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46400"
FT                   /protein_id="ACQ46400.1"
FT                   /translation="MNIMENGVLEATKLISEARKEATVLQIASILSIGELNDYQEATLR
FT                   TWNNKTDFGGRVSNAALGLTGEAGEVADIVKKAIYHGHGFQPSHCPGEEDGNTYKLALE
FT                   LGDILYYLSIMAHELGYTLQDIAEMNIAKLAKRYPDGFSREASQARVDVK"
FT   gene            457199..457378
FT                   /locus_tag="BAA_0510"
FT   CDS_pept        457199..457378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0510"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46956"
FT                   /protein_id="ACQ46956.1"
FT                   /translation="MNMYVVTLSHYTDEAYFEIECVCPTKELAKEQVDKLQREKDPTHS
FT                   EWKYSWDIVKVISE"
FT   gene            457427..457711
FT                   /locus_tag="BAA_0511"
FT   CDS_pept        457427..457711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0511"
FT                   /product="prophage LambdaBa04, transactivating regulatory
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50285"
FT                   /protein_id="ACQ50285.1"
FT                   /translation="MNIKVDELKENEDGIKGGKITITNEAHTITIHSQHVDDAYYLAGN
FT                   LEDCANKIEVKQNCEKCCHCDGKGVGLDWGAMKFWECDVCDGTGELDSK"
FT   gene            457911..458510
FT                   /locus_tag="BAA_0512"
FT   CDS_pept        457911..458510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0512"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49921"
FT                   /protein_id="ACQ49921.1"
FT                   /translation="MEYIEKATKEIRENWFGDHVAEIQGEEGLQVIYWGKPGTGSYRAK
FT                   FVLSGYNVFVSGDIGEAVYNLTCPATLENIKGCNLGYFTGKLTAFCEERWNFDQDKAKE
FT                   ELNEFWEEYEMNETKDGKEIYDDIVSAIDESSSMESYHFWVGNVYHNSSLESDTMECIW
FT                   DFGKRLPRRLIGYWLGLQMAIEQLEKNKPAAEAVTL"
FT   gene            458942..459079
FT                   /locus_tag="BAA_0513"
FT   CDS_pept        458942..459079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0513"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48890"
FT                   /protein_id="ACQ48890.1"
FT                   /translation="MRERENWDVLCEECDKVIIIGVKTESGDHYCEACYDKLAYGNKDK
FT                   "
FT   gene            459123..459527
FT                   /locus_tag="BAA_0514"
FT   CDS_pept        459123..459527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0514"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48540"
FT                   /protein_id="ACQ48540.1"
FT                   /translation="MKTYEELVEKCKELVEKGWTPESVRECFEAYSEFGIDAIQSAMNE
FT                   ALLNNGCSDNVLDYRPNLENLKALGLEEDYVFQALAYMGNASQFMSWANTVLALVDDVP
FT                   EQLKQDIKKVHSGIYEMQEKLREYKKEDDE"
FT   gene            459527..459973
FT                   /locus_tag="BAA_0515"
FT   CDS_pept        459527..459973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0515"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49099"
FT                   /protein_id="ACQ49099.1"
FT                   /translation="MEEILVQGNITEDLKRLGVKANRTYGDETTSYQVYEVSEEDFRKL
FT                   SDDAENMDTDDSHWKNGGWRWDTGSNQPIPTDKAEVNNQELVCWVETINDDEETYRNDW
FT                   YVDLLEYLDVGVGCTAFRNVCAVTKDLAKYNNMSMAELFKKYQG"
FT   gene            460014..460196
FT                   /locus_tag="BAA_0516"
FT   CDS_pept        460014..460196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0516"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48122"
FT                   /protein_id="ACQ48122.1"
FT                   /translation="MGTLVVNCGEYEFTRFESAVRTLEQEYGYEGEAWEMVVASGDLEI
FT                   LSDFLNSDGLNAEIE"
FT   gene            460228..460602
FT                   /locus_tag="BAA_0517"
FT   CDS_pept        460228..460602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0517"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47356"
FT                   /protein_id="ACQ47356.1"
FT                   /translation="MTVVSRSHRALKRKYRPIRKEFKKDILEATKNNRAFAMMIIETYT
FT                   ASQHRTHIMKVWELLGIHHREAYKDYCDKLMGKHLTGRDEIMRSIYFADKVLYDKYHRK
FT                   LPECYAMGDALGIAYKVLKQ"
FT   gene            460708..461064
FT                   /locus_tag="BAA_0518"
FT   CDS_pept        460708..461064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0518"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48241"
FT                   /protein_id="ACQ48241.1"
FT                   /translation="MSKVIEGQEVYVSTSGGWVGKSEPNLRKYIVVRANKTSFYANPEG
FT                   VEDKSPYRFNQKDLSHNTGWGYHYQAYRTEKEYWDMIERGKEKAQLRKELKDTVDKMSL
FT                   IELRKLKEVLFVTK"
FT   gene            461285..461407
FT                   /locus_tag="BAA_0519"
FT   CDS_pept        461285..461407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0519"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47811"
FT                   /protein_id="ACQ47811.1"
FT                   /translation="MKPLKKRKVRKAIARRAKAVEKHQVDKAWRNIFVRNGYLK"
FT   gene            461523..461693
FT                   /locus_tag="BAA_0520"
FT   CDS_pept        461523..461693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0520"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47050"
FT                   /protein_id="ACQ47050.1"
FT                   /translation="MKVLKDQLREWKKQSNQMKKKPKKKRKEKLSTRDIEGLMGIHGPR
FT                   YERRRGALRQK"
FT   gene            461721..462203
FT                   /locus_tag="BAA_0521"
FT   CDS_pept        461721..462203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0521"
FT                   /product="phage transcriptional regulator, ArpU family"
FT                   /note="identified by match to protein family HMM TIGR01637"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46684"
FT                   /protein_id="ACQ46684.1"
FT                   /translation="MTKQLSFLPKIDRTATQEELEGVLESVRIHRQFGMMRKEMKVTPS
FT                   YEIREHGPTHTVGKPLEDVAIANIQQSKREEWLERMSVRIDQFLNRLGNGRAGSIQRDI
FT                   IYKRYLEEEDVCDYMVYNEIGMSERTYRRWKSKAFYKLAFALGLEVYETEETGGNE"
FT   gene            462524..462745
FT                   /pseudo
FT                   /locus_tag="BAA_0522"
FT                   /note="prophage LambdaBa04, site-specific recombinase,
FT                   phage integrase family; this gene contains a premature stop
FT                   which may be the result of a sequencing error"
FT   gene            463334..463636
FT                   /locus_tag="BAA_0523"
FT   CDS_pept        463334..463636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0523"
FT                   /product="prophage LambdaBa04, Gp54"
FT                   /note="identified by match to protein family HMM PF01844"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46217"
FT                   /protein_id="ACQ46217.1"
FT                   /translation="MAKEYAKKFYKSTVWKKCRDSYFKFRHGLCERCTDPGKIVHHKNY
FT                   ITPENINDPEITLSFNNLELLCQDCHNREHHEKNSPVVEGVMFDENGDLIRREDI"
FT   gene            463633..463800
FT                   /locus_tag="BAA_0524"
FT   CDS_pept        463633..463800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0524"
FT                   /product="putative prophage LambdaBa04, DNA binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50776"
FT                   /protein_id="ACQ50776.1"
FT                   /translation="MNTFFHNTIGVNDAAILLKVSPGHIKNMCAEGKIIAKKIGKTWVI
FT                   DRSKLKGVRK"
FT   gene            463797..463943
FT                   /locus_tag="BAA_0525"
FT   CDS_pept        463797..463943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0525"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50059"
FT                   /protein_id="ACQ50059.1"
FT                   /translation="MSEENKFGCRNWVSPEANLAYEEKVPSKDVLEVKREVLKMKQSPP
FT                   IKK"
FT   gene            464044..464415
FT                   /locus_tag="BAA_0526"
FT   CDS_pept        464044..464415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0526"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48836"
FT                   /protein_id="ACQ48836.1"
FT                   /translation="MASKKELTKEERVNKEIRRLKRIYKELPKDTLMVVEGLIVEAADL
FT                   RVRLEDIRKDLDENGYDEMFSQSENQEPYERERPAARRYIAMNKSYQTIMKQLGDYIPK
FT                   KPIENKEKDDGFDDFVTNR"
FT   gene            464412..466100
FT                   /locus_tag="BAA_0527"
FT   CDS_pept        464412..466100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0527"
FT                   /product="putative prophage LambdaBa04, terminase, large
FT                   subunit"
FT                   /note="identified by match to protein family HMM PF03354"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48449"
FT                   /protein_id="ACQ48449.1"
FT                   /translation="MRVQYPLSYNPIIEYYNKIESGEEIVGYKVKRIYKKLVDDIYDQD
FT                   SIYEYNPKRANHAMEFIENFCKHSKGKWAGKPIDLELWQKAFIGSLFGFIHKIDGTRKY
FT                   REALLIVARKNGKSTLSSGICLYLQIADGEGGAEVYAVATKEKQAKIVWSEAKRMVKKS
FT                   PVLSKRIKALVKELNADFNDSTFQPVGSDSDTLDGLNVHGASLDEIHAWKDKNLYDVIV
FT                   DGTSAREQPLILMITTAGTVRESVYDMKYEEAERLLLSLDDEKEYTDPTFLPIIYELDS
FT                   RKEWTDPKCWKKANPGLGTIKKIDNLQTKVNKAQANPLLVKNLLTKDFNVRETSSEAWL
FT                   TFEQLNNKQTFDVMELKPNYGIGGTDLSETTDLTAAKVIFMLPNDINVYVLQMYWLPEE
FT                   LLEQRSKEDKIPYDLWHEAGYLRTTPGNSIHPKFVTEWFLEIRDEYGIYLPWIGYDRWS
FT                   AKYWVEEMQGYFGKEAMVPVAQGKQTLSMPMKLLGADLEAKRIIYNNNPIDKWCLSNTA
FT                   IDIDKNLNIQPDKTNNQRRRIDGTAALLDAYVVLQEKKNDYLNMI"
FT   gene            466371..467336
FT                   /pseudo
FT                   /locus_tag="BAA_0528"
FT                   /note="prophage LambdaBa04, portal protein, truncation;
FT                   this gene contains a frame shift which may be the result of
FT                   a sequencing error"
FT   gene            467293..467874
FT                   /locus_tag="BAA_0529"
FT   CDS_pept        467293..467874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0529"
FT                   /product="putative prophage LambdaBa04, prohead protease"
FT                   /note="identified by match to protein family HMM PF04586;
FT                   match to protein family HMM TIGR01543"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50448"
FT                   /protein_id="ACQ50448.1"
FT                   /translation="MDKTETREIVTQKIEIREDDNGNRTLIGYAVKWEKKSVVMGYYRK
FT                   FREQFKNGAFTETLQNDDQRFLWSHDTSKVLGRTKNNTLRLNEDAVGLRFELDLPDTTL
FT                   GNDTYKSIKRGDVDGVSFGFSMISEEIQEPDDDLMLRTVTKAKLLEVSAVAFPAYPDSE
FT                   VSARGYDPYKHFTEEKKRSEKRRRLYLQTL"
FT   gene            467893..469083
FT                   /locus_tag="BAA_0530"
FT   CDS_pept        467893..469083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0530"
FT                   /product="putative prophage LambdaBa04, major capsid
FT                   protein"
FT                   /note="identified by match to protein family HMM PF05065;
FT                   match to protein family HMM TIGR01554"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49720"
FT                   /protein_id="ACQ49720.1"
FT                   /translation="MNKEQLLKRKSEIGELLSDETRSIDNLDTIETELRDINEQLAAIE
FT                   KREQLLNEARSINEGNAAGANKIETFNANLNLSNEKREIGTNTVEYRNAFMNYVLRGEA
FT                   IPAELRANAVTKTSDIGSVIPQTVLDKIIEKIEAVGMILPLITRTAIKGGVTVPTSAVK
FT                   PVATWVAESSGSDKQKKTTGSITFNYHKLRCAVAVSLEVETMSLAVFETTLINNIVEAM
FT                   TKAIEQAIVSGDGSGKPKGILAETPFEGQALDVAKINYKTLTDAEAALPLEYEASAIWT
FT                   MTKKTFMEFSAMTDADGQPIARTNYGISGKPERILLGRPVVLCNYVDSFATATEGTAFA
FT                   FLFNYKDYILNTNYQMGVKKYEDNETDDQVTKAIMIVDGKVVDKNSLVVLKKAPSA"
FT   gene            469099..469356
FT                   /locus_tag="BAA_0531"
FT   CDS_pept        469099..469356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0531"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47117"
FT                   /protein_id="ACQ47117.1"
FT                   /translation="MNHFVLNTFIDKETKVGYSKGDMYESNDSERIAFLIEKGFLKGNK
FT                   EIPTFPKHTGGGWYELSNGEKVQGKEEAMSAEQSLKDKES"
FT   gene            469353..469625
FT                   /locus_tag="BAA_0532"
FT   CDS_pept        469353..469625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0532"
FT                   /product="putative prophage LambdaBa04, DNA packaging
FT                   protein"
FT                   /note="identified by match to protein family HMM TIGR01560"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47108"
FT                   /protein_id="ACQ47108.1"
FT                   /translation="MILKDVKKTLRISHDALDDEINDSIEAARHDLMLSGVSSVKANND
FT                   DDPLIKRAIKVYCKAEFVTEAKEAERFQASYNMLKNHLTLAGDYK"
FT   gene            469622..469921
FT                   /locus_tag="BAA_0533"
FT   CDS_pept        469622..469921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0533"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM TIGR01563"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46319"
FT                   /protein_id="ACQ46319.1"
FT                   /translation="MNDILFFPVVTTTKDDLGQIEVSEDFTRQVFCEKKSISQNEFFQA
FT                   GQNGFKPKCVLIVYSLDYQEEQKVNYNNKTYSIYRTYERDDERIELYCEVKAGG"
FT   gene            469914..470270
FT                   /locus_tag="BAA_0534"
FT   CDS_pept        469914..470270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0534"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48159"
FT                   /protein_id="ACQ48159.1"
FT                   /translation="MASIDSLANDIARELQRYGKEVEEKLEVEKEEVANNLVSDLKENS
FT                   PKNTGKYAKGWRKKKEGNGFIVHNALKPQLTHLLEKGHAQVNGGRVPAKVHIAPAEEKA
FT                   ENEFLERVERAIQQ"
FT   gene            470402..470596
FT                   /locus_tag="BAA_0535"
FT   CDS_pept        470402..470596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0535"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49356"
FT                   /protein_id="ACQ49356.1"
FT                   /translation="MIADSKVHFKISDVNIELYTAKKDLVAEAKLEKVLDDNEIPYESS
FT                   EIYIDSEKLFQKIYETRLI"
FT   gene            470597..471166
FT                   /locus_tag="BAA_0536"
FT   CDS_pept        470597..471166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0536"
FT                   /product="putative prophage LambdaBa04, major tail protein"
FT                   /note="identified by match to protein family HMM TIGR01603"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49371"
FT                   /protein_id="ACQ49371.1"
FT                   /translation="MENKVVFGLKKVHYSVITEDSSGKITYGTPAKLPGAVKMKLDPKG
FT                   EQSDFWADDSNYYTDSSNQGYEGTLNIANITEAFRTDVLGEILDEDDQVLTEVSNAKIK
FT                   RIALMFEFDGDVKATRHLLYNVSVSRPGFGSSTKSDKTEPNTTELKFVASQHPETLNVK
FT                   TSTKVTTPAGIYDAWYTKVYEKVVGA"
FT   gene            471171..471533
FT                   /locus_tag="BAA_0537"
FT   CDS_pept        471171..471533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0537"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48647"
FT                   /protein_id="ACQ48647.1"
FT                   /translation="MKKTIIIDEKAVLLKSTAGTAIRYKSQFRRDMFADILSLGVLSSY
FT                   ISTDGDQSNIDLSQVDLSKLDFEVIYNLVWAFAKTANKEVPDPLTWLDTFGEFPIAEII
FT                   TEIQDLIKSTVQSKKK"
FT   gene            471644..471757
FT                   /locus_tag="BAA_0538"
FT   CDS_pept        471644..471757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0538"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49944"
FT                   /protein_id="ACQ49944.1"
FT                   /translation="MTIGDCLDYIDEYVELRNPKKEKENTRTATQDDFNNF"
FT   gene            471775..475710
FT                   /locus_tag="BAA_0539"
FT   CDS_pept        471775..475710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0539"
FT                   /product="putative prophage LambdaBa04, tape measure
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46339"
FT                   /protein_id="ACQ46339.1"
FT                   /translation="MVGRIKGITIEIGGETTGLQSALKDVNKRSSELSKELKDIERLLK
FT                   FNPGNVEALAQKQQLLTQQIENTTKKLDSLKSAQQQVQAQFESGAISEEQYRAFRREIE
FT                   FTEGQLNGFKNSLAGLKAEQEKAASSTRQLETLFSATGKSVDDFADALGNRLVNAIKNG
FT                   TASSRQLEQAIEIVGREALGAEADIGKLQQALRSVDDGNSIQNIRNDLNQLSQEAEEAS
FT                   ESVKGLGVELENVLGGIVAGGGIQEVIGQALDMSELKTKIDITFDVPESSKRSVEDAIR
FT                   TVVAYGGDAEEALEGVRRQWSLNKDASDAANTEIIKGAANIASSYSQIDFTELIQETNE
FT                   IGSELNISNKEALGLVNSLLKIGFPPEQLDIIAEYGAQLRRVGYTAQEVQSIMASAAKE
FT                   KSWNIDNLLDGLKEGRIRSVEMARGLSNSMKDAVRDAVDDTEKMSDAQISAMQKGFAKQ
FT                   ESALANSFSNQEKALSKSHSRRQNELAKSLDAEYNAVSKSYENQQKNLEKKLSAEYDAA
FT                   SKNYDRQQKALEKSLDAEVKAFEKSSEQKIKLIDKEYMERMKLIDEEKYNRLKAVDDQI
FT                   NSLDAKTAAEDKYFKDRENAEKRADLKVKISKAKNEEERQAAIKALRDLEEKMRLDKIR
FT                   EERKSQIDRLKEEKDSIKEASDAKKEALKSEFDSRKERVKEQINNEKEALKERQQEQKE
FT                   AFQQNKQENLKAISESNKAQLDSLREVNQANLSALKENHNERKQALSERLSDEMDAVRE
FT                   SHRAELESFKEMNAEKLELAKNPPDSAAVQEIFAQLEGWGKAIAKGGEEGKQAFVDMVK
FT                   WLDQIEDADLKEAIGVELFGTMWEDQGQKIINTILQTEQKQADLKQGIDDLQQSVSKTD
FT                   ASPMVKLKEAMNDLKQALEPILLIIADVVSAFAGFISAHPVLAAAITAITVAIGILVGI
FT                   CAALAPVIFLATSGAITFAGVMAALTSPIALVVAAIAGLIAIWVLFGDKIMAIYNEYFK
FT                   PTIDQIVSIIVSTLKPVFEQGFAIIKDVVQDAFIIIQRVWNEILSPVFSVITSIIKTVL
FT                   LPAFKFVFSAIGSVVSDAFSGIKDMWNNVLKPILNGIIDFISGIFSGNWEKAWGGIVKI
FT                   FSGVFEGIKSAAKAPINAVVSMLNGLIEGINSIEMPDWVPFVGGSKPSIPRIPMLATGG
FT                   HVLGDGSFIAGEAGPELFTKRGNRVSVTPLSSTEKSLGITGTMSRLIGDMSYSMASSMK
FT                   ELSGLKSVMSNVYGSMASSSQAMSRNASQRTAEGNSSSNANKSDSYNFADMFRGSTFVV
FT                   REEADVQKLAVELGKYIKASGRRVGQL"
FT   gene            475707..476516
FT                   /locus_tag="BAA_0540"
FT   CDS_pept        475707..476516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0540"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM TIGR01633"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48439"
FT                   /protein_id="ACQ48439.1"
FT                   /translation="MSLTLDGKPLKQLGLALLPGYQHPAAPPVRDYTVSIPGRPGAYYF
FT                   GSDIDPMEFNLPLIIKPQENRYELAAAIRKMVDTFIDPYGKPKEVKLIYDYEPDKYYLA
FT                   RYSGSMSIERYFRMGKFELPMIAYDPYAYSIIDSTNGIKWGDPIPWMSDIPISAGDNSY
FT                   TINSPQNISLNNYGTLVVRPVINISGSAENLTLTLKGERFSLGTFTNSTFLLDAKHYTA
FT                   IKNGQNYLFQLKGDLEKLELIPGANVIKISGVNLNINITFEYRAKYI"
FT   gene            476531..480109
FT                   /locus_tag="BAA_0541"
FT   CDS_pept        476531..480109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0541"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49251"
FT                   /protein_id="ACQ49251.1"
FT                   /translation="MADAPKLTGEETIKQSYYKINMAIDNSNDALKTAKDSLTSPVSNA
FT                   RIDPKAVTKDKLGDDVDYQTTALGGAIIGDNVMWEKVAIFGPKSNMTEEFTDNNELEFG
FT                   KKLLKLTVTSTSNYKQLLNPGTSEHANAGVEIPVYAKRYKKISGALNYKINKATGETLI
FT                   RAGITVRYTDGTIQKSTMFKLKADGKEYADVFEQDIDNTKTISSMYLYISGGDVNDVIK
FT                   ISYVSFWMGKTNDNIFDKSLLLSKIGDVDSSVTIIKENNRINWFTDAKNIIQNKPMIKQ
FT                   GNELESSGSFLQKGIKNLNVNNIMGTPFWFEFECNSDSATPYFRFELPELMKKLHEIRQ
FT                   SGLKLSKVNATVELYFPYNLKHNVTYRLLSKKITGEWHFFPLKTITKNTGAQTITIQLN
FT                   EDIDSVIDTLGDYLTVYVTFQSALNTQKVYLGWMDIWMDDDKQVLFSENFDGRAILPGT
FT                   VVEQSLEKSLQEKINGTTVSNNPKKQLRVAMTGSSITWGKGLLDDGFVREIDYYLRDYL
FT                   SNTYLHSDPSLLFKGANSIITNEKFYKRTARKMTGTESSVSFSLVGDELSIVHGLERSN
FT                   KGAAIIELYVDGQLYDTFSNYNTEPYGNTVVNAIGDGTTVKFDLGRAFTYNHVVKVNGI
FT                   TLVGKINDAESGATFPNGHDYMIIRKYGQNPDTQETEVHHFLYLKNAPAARANIEVTMS
FT                   YGENIIYTKSTIGEITESIEGALESRYGDDEISFDPANPAALSSGLDFRETDERSVKTW
FT                   NFAEYKEREFMFKIKGYDPRANKTVSPYFILNFITNRMHYIMNAGIGGWTAEKLYNDNG
FT                   LRNYHYLMRFDPDILFVESGTNDDWDSANQFVATKTITDVTEAALRRYPTLWLKSSKYV
FT                   AVDNYTIETAALTIEEVTRNSVKINGTNTDLSSVKKGDYLIIGDYHFDEREVVTRIIDT
FT                   WDIATRTATFKKPLKPQEILNIRKLSDLTGRTVMVKRIDGFISWLDKVVDGVRQYNEDV
FT                   QIGLVSTGLCAFTTRLLLGYPDKIKELALQKECTFANAFDFIKRFQYNQTRVGSAFLNS
FT                   ANNTTSSGSNEYNLVNASGVDINVAQKLRGIRNYSIKVDGIERYGDGCYIDNAYGYYFK
FT                   PATTSSNLTIDNWNNKVTTKIAADYVTTKLVFTKDIPPNGAKIEVSFSTEKWSSDDCHM
FT                   GSLGGIHMYKNSLIDAMQIMICKSIG"
FT   gene            480175..480336
FT                   /locus_tag="BAA_0542"
FT   CDS_pept        480175..480336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0542"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48709"
FT                   /protein_id="ACQ48709.1"
FT                   /translation="MHLFEVDRECTYKSVDYKVISVLDNDLLLVVPKEDLANEKFPLQT
FT                   YVIPEQIE"
FT   gene            480405..482039
FT                   /locus_tag="BAA_0543"
FT   CDS_pept        480405..482039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0543"
FT                   /product="phage minor structural protein"
FT                   /note="identified by match to protein family HMM TIGR01665"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50348"
FT                   /protein_id="ACQ50348.1"
FT                   /translation="MKHIKLYDKQLQLKAYLENAFKIKYSPPLNELWTAGFSLPFTDPK
FT                   REEIETFDYVEIFDNGKRIGLFRIMDSEEEREVSQKIITYDCEHVLSTLMDSVLFGYHE
FT                   RINLTTRENIEYLLSKQRIKHWKLGQCDFVKYFQYSWENEDTILGPIYSIAKPFDEKFQ
FT                   WTWDDTSYPWTLNLVKYSDEITGELRYRKNMKGIKRKVEAKDVMTRIYPLGYGEGVNQL
FT                   NIKSVNNGLPYIDAPDFVRELQDGFDYIWVDRRFEDPKTLYASAKAMLLKACMPKVTYE
FT                   IDAIDYELIDPYKIEKYETGKLVRLYDEDFNISVDLRVMDRSKDDVTGNPLDVKLVLEN
FT                   KVTDIGTIQADIEKRQKVNEVYSQGTTNIDSQPFQDNCDPDHPAIIRFQIPNDVKNVNQ
FT                   LILTFETLRFRAYERAIKGGGAVVASTSAGGANVSSTSSGGGTVGSTSSGGSSVQASSS
FT                   GGGTVKASSSGGDHVHKMFHGGGIVPAEPSTIGLYTAFSDPGRNTSASFYAKGTGSSFY
FT                   TYGSSGNHTHDISIPNHTHSININHKI"
FT   gene            482057..482536
FT                   /locus_tag="BAA_0544"
FT   CDS_pept        482057..482536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0544"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49868"
FT                   /protein_id="ACQ49868.1"
FT                   /translation="MQTIEIHTQGGLKHKVQTEVYNAEALNTKLNDNDLITVLIGDFII
FT                   QRIDVKRIIPLNMIDAEGAKRVEVHTNAGKVIEITTNDYDPIYLNEQLNNNNTITVVIG
FT                   DYIFSRIDVKQVVPVKEEPKEPEQPPVTEPEKPTEPVTPPGEGTEDDSITTTEQL"
FT   gene            482631..482870
FT                   /locus_tag="BAA_0545"
FT   CDS_pept        482631..482870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0545"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49872"
FT                   /protein_id="ACQ49872.1"
FT                   /translation="MAELKHDDMKELLVGLTRVETKLDTLGNVKEVAIEAQQSAKSAHL
FT                   RVDRLDKLVFWLGTTVIGAVIVGAITALFKFAGK"
FT   gene            482943..483086
FT                   /locus_tag="BAA_0546"
FT   CDS_pept        482943..483086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0546"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46459"
FT                   /protein_id="ACQ46459.1"
FT                   /translation="MLGFLFTKFGVPEAKSFLDELAPYLLSVGIALGIWSDHDVNSEGD
FT                   DK"
FT   gene            483086..483883
FT                   /locus_tag="BAA_0547"
FT   CDS_pept        483086..483883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0547"
FT                   /product="putative prophage LambdaBa04, glycosyl hydrolase,
FT                   family 25"
FT                   /note="identified by match to protein family HMM PF01183"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48195"
FT                   /protein_id="ACQ48195.1"
FT                   /translation="MGHIIDISKWNGDINWSIAKQHIDFIIARVQDGSNYVDPLYKGYV
FT                   QAMKQHGIPFGNYAFCRFVSIADAKKEAQDFWNRGDKSATVWVADVEVKTMNDMRAGTQ
FT                   AFIDELYRLGAKKVGLYVGHHMYTPFGMANVKSDFVWIPRYGGNKPAYPCDIWQYTETG
FT                   NVPGIGKCDLNSLIGNKSLSWFTESATQESVQAPTQNIIQSGAFSPYETPDVTGALTSL
FT                   KMTAKFILKPDGLTYFISDPTSDAQLNAMKEYLDRKGWWYEVK"
FT   gene            complement(483937..484272)
FT                   /locus_tag="BAA_0548"
FT   CDS_pept        complement(483937..484272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0548"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48296"
FT                   /protein_id="ACQ48296.1"
FT                   /translation="MSLDTVAALQRMQQLKQSEAASGEKLILKREDSKSEKTVLILCII
FT                   LALPTIGISLLFLVLYGLIKERNRKTYLVKNVATGERFHVDKEDFKQYEKEFKAKEKEV
FT                   KKISDLQ"
FT   gene            484652..485389
FT                   /gene="truA2"
FT                   /locus_tag="BAA_0549"
FT   CDS_pept        484652..485389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truA2"
FT                   /locus_tag="BAA_0549"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="5.4.99.12"
FT                   /note="identified by match to protein family HMM PF01416;
FT                   match to protein family HMM TIGR00071"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46453"
FT                   /protein_id="ACQ46453.1"
FT                   /translation="MNNYKLTIQYDGARFKGWQRLGNNDNTIQGKIESVISEMVGKETE
FT                   IIGCSRTDAGVHALNQVANFQSDEKLVEHKVKKYLNQYLPNDISITNVEEVHDRFHARY
FT                   NSKAKTYLYKIWNEEHTNPFMRKYSMHVNKKLNVKSMKEAAKHLVGSHDFTAFSNAKSK
FT                   KKSMVREVYSLEVMEEAGFVQIRVSGNGFLHNMVRKIVGALIEVGLGQLAAEAIPQILE
FT                   AKQRNQINCLAEASGLYLENVEF"
FT   gene            complement(485440..485643)
FT                   /locus_tag="BAA_0550"
FT   CDS_pept        complement(485440..485643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0550"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47179"
FT                   /protein_id="ACQ47179.1"
FT                   /translation="MSNDNKLNLLQYLYFFPAILCMMLFINTDTSSFPYAKLLATISGS
FT                   FAAIMLAAFWNLKIRMKREKSS"
FT   gene            complement(485727..487130)
FT                   /gene="rocR1"
FT                   /locus_tag="BAA_0551"
FT   CDS_pept        complement(485727..487130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rocR1"
FT                   /locus_tag="BAA_0551"
FT                   /product="arginine utilization regulatory protein RocR"
FT                   /note="identified by match to protein family HMM PF00158;
FT                   match to protein family HMM PF02954; match to protein
FT                   family HMM PF07728"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47156"
FT                   /protein_id="ACQ47156.1"
FT                   /translation="MRTEEINLKQIIEMNMLYETLLNELDIGIHIINEESKTIIYNRKM
FT                   MEIESMERSDVLYKSPLEVFAFEENKNSTLIEALKLGKTNKNIKQTYFNNKGQEITTIN
FT                   DTFPIIENGKIKGAIEISKEMNHLKQTIKMDSFRKQNTKFTFDHIIGDSEAIQSTIAEG
FT                   KRVIRTSSSILLVGETGTGKELFAQSIHNESQRSTKPFISQNCAAIPDTLMESLLFGTN
FT                   RGAFTGAIDKAGLFEEANGGTLLLDEINSLSPALQAKLLRAIQEKTIRRIGGTQEKEID
FT                   VRIIATINEDPLEAITHNRLREDLYYRLSVVTLCLPPLRERKEDIPALVQHFIEKYNIQ
FT                   FGLSVTDVDIHVREFLYAYDWPGNVRELEHIIEGSMNLVEDENIITAFHLPTRFREQIK
FT                   KEFNTQPFLTNNATDAPKTLKHTIAEMEKNYITQILKEYHGNISQAAKFLGLSRQNLQY
FT                   RIKKLHLHI"
FT   gene            487404..487658
FT                   /locus_tag="BAA_0552"
FT   CDS_pept        487404..487658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0552"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00364"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49788"
FT                   /protein_id="ACQ49788.1"
FT                   /translation="MKTVIEGVYSPCYGKVEKLFVKESSYVYEWEKLALIETIDKQKVE
FT                   IKVGISGYIESLEVVEGQAIADQKLLITMRDDLLITGSD"
FT   gene            487763..489184
FT                   /locus_tag="BAA_0553"
FT   CDS_pept        487763..489184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0553"
FT                   /product="amino acid permease family protein"
FT                   /note="identified by match to protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50490"
FT                   /protein_id="ACQ50490.1"
FT                   /translation="MMNQNQGLKRELKSRHIFMIALGGVIGTGLFLGSGYTIHEAGPGG
FT                   AIVAYLVGGFVMYLTMLCLGELAVAMPDAGSYQTYATKHISPAAGYVVGWMSWLNWSAT
FT                   IGIELIAVSILMKRWFPDVPSWIWCVVFAVLLFAINALSSRSFAEVEFWFASIKVITII
FT                   AFIILGGAAMFGFLDMKGNEPAPMFSSFTDYGGLFPNGLSAILITMIAVNFSFQGTELV
FT                   GIAAGESENPEKTIPKAINNTVWRILVFFVLSIFILAGLFPWQQAGVIESPFVVVFDKI
FT                   GIPYAADIINFVIITAVLSVANSGLYATSRMLWSMSNQGMISPIFGKLSKNGVPIYALI
FT                   VSTIVGCLSLLSGIYAEDTVYLWLLSIAGFGAILVWASIALSNLLARRSYIKQGGDVKD
FT                   LKFKTPLYPFVPLLALVLNVTVIVGMAFIPEQRMALYCGIPFMIVCLLFYRATRNKAHK
FT                   VEHIEKTDTTEVDSL"
FT   gene            489280..490560
FT                   /locus_tag="BAA_0554"
FT   CDS_pept        489280..490560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0554"
FT                   /product="putative acetylornitine deacetylase"
FT                   /note="identified by match to protein family HMM PF01546;
FT                   match to protein family HMM PF07687; match to protein
FT                   family HMM TIGR01910"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48681"
FT                   /protein_id="ACQ48681.1"
FT                   /translation="MNEEVSQLLEQIDLRKDELLELTKTLIRFETPAPPARNTNEAQEF
FT                   VAEFLRKRNFSVDKWDVYPNDPNVVGVKKGTESDTHKSLIINGHMDVAEVSADEAWETN
FT                   PFEPFIKDGWLVGRGAADMKGGLAGALFAIQLLQEAGIELPGDVIFQSVIGEEVGEAGT
FT                   LQCCKRGYDADFAVVVDTSDLHMQGQGGVITGWITVKSPQTFHDATRRQMIHAGGRLFG
FT                   ASAIEKMMKIVQSLQELERHWAVMKTYEGYPSGTTTINPAVIEGGRHAAFIADECRLWI
FT                   TVHFYPNETHEQIIKEIEEYIGKVAAADPWLSENPPQFKWGGESMIVDRGEIFPSLEID
FT                   SEHAAVKTLSSVHESILSKNAILDMSATVTDGGWFSEFHIPAVIYGPGTLEEAHSINEK
FT                   VEIEQLIEFTKVITAFIYEWCHTKKID"
FT   gene            complement(490655..491308)
FT                   /locus_tag="BAA_0555"
FT   CDS_pept        complement(490655..491308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0555"
FT                   /product="DNA-binding protein"
FT                   /note="identified by match to protein family HMM PF01381;
FT                   match to protein family HMM PF06803"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48623"
FT                   /protein_id="ACQ48623.1"
FT                   /translation="MPKDNPNERLSKLIKKLLKERALSMRQLGMLTSIDPATISRIMNG
FT                   KQPPKQKHLQKFAECLQVPPQLLFDEMYPDSPHINKEKTDMYTSLDTIQQTLQSSNLFD
FT                   FDYTTTRVKQELENYERYAQTTEGEKRIHESFASKLEQIDSAGPFIEQLTDMYQQFCNE
FT                   TISKEERAVLGGALLYFILSTDIIPDYLFPIGYLDDAIAVELAKEKLIELKRKT"
FT   gene            491438..492049
FT                   /locus_tag="BAA_0556"
FT   CDS_pept        491438..492049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0556"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM TIGR02840"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49318"
FT                   /protein_id="ACQ49318.1"
FT                   /translation="MSTAGLFSIFLIGIASNLDNAGVGIAYGIRKIRISWFNNFIIAFL
FT                   GFLFTLLAGFFGNWIALFISEFTANLIGAIVLGIIGVFILCQPFLGQKNTVGSKDGNVL
FT                   MGILRDPEKADFDGSKTISFSEAVVLGVALSINNIAGGFDAGVTNLNLWLTATISGVFS
FT                   FICISGFAYVGKRFLAEYLGKWATVIAGLLLIFIGIDQLL"
FT   gene            492164..492322
FT                   /pseudo
FT                   /locus_tag="BAA_0557"
FT                   /note="hypothetical protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error;
FT                   identified by glimmer; putative"
FT   gene            complement(492345..492686)
FT                   /locus_tag="BAA_0558"
FT   CDS_pept        complement(492345..492686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0558"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50800"
FT                   /protein_id="ACQ50800.1"
FT                   /translation="MKLIFQMGKQPVLEKTILLFILSIVESLKLKVVSLDEAHRYIFNL
FT                   EVLELLMDRNIDDQVLELIHFGMGLEDIHHVLPEELEHTIEELKWLCIQVLSEYSMHEE
FT                   SEQLIEDIR"
FT   gene            complement(492862..493791)
FT                   /gene="glsA1"
FT                   /locus_tag="BAA_0559"
FT   CDS_pept        complement(492862..493791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glsA1"
FT                   /locus_tag="BAA_0559"
FT                   /product="glutaminase A"
FT                   /EC_number="3.5.1.2"
FT                   /note="identified by match to protein family HMM PF04960"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46106"
FT                   /protein_id="ACQ46106.1"
FT                   /translation="MQCIETNNLQQLLEQVKPYTKKGKLATYIPELGNANPDDLGIAIF
FT                   HKETEYIHAGNSQTLFTLQSISKVITLALALLDRGEEYVFSKVGMEPTGDPFNSIIKLE
FT                   TTSPSKPLNPMINAGALAITSMLAGKDNEEKMERILHFVREITDNPTINYSSKVANSEL
FT                   ETAYLNRSLCYYMKQNGIIDCDIEELMDLYTRQCAVEVNCIDLARIGLIFAMDGYDPYK
FT                   KKQIIPKHITKICKTFMVTCGMYNESGEFAIRVGIPAKSGVAGGIFGCVKGEMGIGIFG
FT                   PALDANGNSIAGFKILELLSAQEGWSIF"
FT   gene            493861..493974
FT                   /locus_tag="BAA_0560"
FT   CDS_pept        493861..493974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0560"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46801"
FT                   /protein_id="ACQ46801.1"
FT                   /translation="MKKWNDKTKVTCSILGLSFRVFYSEKGEFSFYITVWK"
FT   gene            494098..495609
FT                   /locus_tag="BAA_0561"
FT   CDS_pept        494098..495609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0561"
FT                   /product="putative PTS system, N-acetylglucosamine-specific
FT                   IIBC component"
FT                   /note="identified by match to protein family HMM PF00367;
FT                   match to protein family HMM PF02378; match to protein
FT                   family HMM TIGR00826; match to protein family HMM
FT                   TIGR01998"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46657"
FT                   /protein_id="ACQ46657.1"
FT                   /translation="MIGGIKMLQFLQRIGKALMLPIAVLPAAGLLLRLGQEDVFNIPVM
FT                   AQAGAAIFDNLALIFAIGVAIGLSVDGSGAAGLAGAIGYLVLQNTTNALSKTYSAAELN
FT                   DKLKSVQDLVGSVDPTKLADTMTKVSKAAALTPKINMAILGGIIAGVVAGLLYNKFHKI
FT                   KLPEWLGFFAGKRFVPIITSIVMLLLGLVFGQIWPTIQSGIDAVAHGIVNLGSIGAGLF
FT                   GLLNRLLIPIGLHHVMNTYFWFVLGDFTNAAGDIVHGDIARFFAKDPSAGMFMTGFFPV
FT                   MMFGLPAACFAMIAAAKPEKRKMVTGMLGGLALTSFLTGITEPIEFSFMFLSPVLYGIH
FT                   AVLTGLSLFITTTLGIHDGFSFSAGAIDYVLNFGIATKPLLLAGIGLIYAAIYFVVFYF
FT                   LIKKFDLKTPGREDEEEMAEGEEAPVAGSIGETYVAALGGKENLTVIDNCATRLRLQVK
FT                   DAGQVNEAALKRAGAKGVMKLSNTSVQVIVGTNVESVADDMKKHV"
FT   gene            495864..497102
FT                   /locus_tag="BAA_0562"
FT   CDS_pept        495864..497102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0562"
FT                   /product="putative penicillin-binding protein"
FT                   /note="identified by match to protein family HMM PF00144"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47348"
FT                   /protein_id="ACQ47348.1"
FT                   /translation="MDQEKNNANGKSRRPIVYIKRTIILVLLFSLVYFMYTKIVTHNKK
FT                   EEILKAAEMKKQEELKKKEEKKKQEAQKQKEQEEQVKQAQAAEQPAEGPPQEINENAQL
FT                   DQYLQNIGFSGTAVIVKNGKVLVNKGYGMANKEKQVPNNSETTFYIGSISKAFVATAIM
FT                   QLKDQHKLNVEDTIAKYIPDFPQGNSIQLKHLLTHTSGIPEYEQGAEDISHEELIKRIG
FT                   KQKRIGSPGEKWKYSDSNYSILAYIAEKVSGQPLEEYIKQHIFAPAGMKHSGFGRELEQ
FT                   TRFPSTGYKIVNNNMTTPNIPSMSQLYGCGDIYTSAHDLYLFNEALFSGKLISKESYDQ
FT                   MFTGGKKDYGFGWYVDPGSYSNHGVMPGWNCLNGFSKNGSVYVVLLSNIQNNIKSFGKV
FT                   NNDIYTMLRNIEV"
FT   gene            497256..497657
FT                   /locus_tag="BAA_0563"
FT   CDS_pept        497256..497657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0563"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48969"
FT                   /protein_id="ACQ48969.1"
FT                   /translation="MCLFGKYWKKLSRLFNRQLDYFLDNKLLPAVERLLFSQNFARFIQ
FT                   RNSKQATEEFIESSKFQSIICNILKECNTSPFKEIAEQYLGKNVEITVTVGQLTGVIVA
FT                   VGDDFLILQEGIGTEVLLPFASIISIKEA"
FT   gene            497674..497868
FT                   /locus_tag="BAA_0564"
FT   CDS_pept        497674..497868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0564"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48490"
FT                   /protein_id="ACQ48490.1"
FT                   /translation="MLFTDELRNHVGELVQVVTAVEIVSGVLLSVTDGAVSVRTSPSYG
FT                   PPEDVIVRIPVIAYVRLEG"
FT   gene            497849..499429
FT                   /locus_tag="BAA_0565"
FT   CDS_pept        497849..499429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0565"
FT                   /product="glycosyl transferase, group 2 family"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49498"
FT                   /protein_id="ACQ49498.1"
FT                   /translation="MFAWKGKRDKSMKVSVVIPVHNEASTLSKVLAEVKKLEPYEIIIV
FT                   DNGSTDGTKEIALQHHCRVIYYNHSLGNDVGRAIGAREAKGEIVLFLDGDIVMKSEELY
FT                   PFIKGIQQGHQIVLNNLTWSVYLKVRPHYTTVGKYMLNRYLNKKEFVVGSLIAIPHAIS
FT                   REVIEKLGWWNLADPALFQAMAMSRGVDISDMASVDVIYTNKVRPVHTGTSPDSPYPKA
FT                   TSRIMGDHLRALQYITETYGKRGGFSEGNRDREFIGKYKPVVLKKEKAKYSAIIPVSEE
FT                   KTTIRSVIQEVKKAGVDEIIIVANGADIETIKQVNLENVIVVEVTKTLGNNVARAIGAM
FT                   HATAEICLFVDGDYAIPAKKLVPFLRAIEDGSDMALNDLQCLLDIFHPADPISMGKYFV
FT                   NLVAKRPDLWNNSLTAVPHAIRKKVIEKIGYDSLIIPPLAQMKAILEGFSITTVEFVDV
FT                   IKTNRVRPEQHEFVNGRISAFDRIFGDQLEAIAYLLQHTDERGGFTDGDRDREIIQQLR
FT                   REEENTNEY"
FT   gene            499419..499619
FT                   /pseudo
FT                   /locus_tag="BAA_0566"
FT                   /note="putative polysaccharide biosynthesis protein; this
FT                   gene contains a frame shift which may be the result of a
FT                   sequencing error"
FT   gene            499985..500662
FT                   /locus_tag="BAA_0567"
FT   CDS_pept        499985..500662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0567"
FT                   /product="nucleotide sugar dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00984;
FT                   match to protein family HMM PF03720; match to protein
FT                   family HMM TIGR03026"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50635"
FT                   /protein_id="ACQ50635.1"
FT                   /translation="MYSTIFDVVVPVSSPKVAEMCKLFENIQRLVNISLVNELNTLCES
FT                   LGIDFYEALEAASTKPFGFTPYWPGPGIGGHCIPVDPLYFQWRIKKNGAMSQLIEAAHV
FT                   INEEMPEKMVQKVKGVVQPPATVLIVGIAYKKDVNDLRESPALPIIELLIKEGYEIEYH
FT                   DPYISSAKFGDKVYQSVSLNEQAVNQASCILILTDHSNIDWKLFKGIKRVVDTRGIVKK
FT                   VSK"
FT   gene            500659..501624
FT                   /locus_tag="BAA_0568"
FT   CDS_pept        500659..501624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0568"
FT                   /product="NAD-dependent epimerase/dehydratase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF01073; match to protein
FT                   family HMM PF01370; match to protein family HMM PF02719;
FT                   match to protein family HMM PF04321; match to protein
FT                   family HMM PF07993"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46473"
FT                   /protein_id="ACQ46473.1"
FT                   /translation="MSKKCLITGGAGFIGSHLAEELVGRGYNVTIVDNFYKGKNKYHDE
FT                   LMKEIRVIPISVLDKNSIYELVNQHDVVFHLAAILGVKTTMEKSIELIETNFDGTRNIL
FT                   QAALKGKKKVVFASTSEVYGKAKPPFSEEGDRLYGATSKIRWSYAICKTLEETLCLGYA
FT                   LEGLPVTIVRYFNIYGPRAKDGPYAGVIPRFISAALQGEDILVYGDGEQTRCFTYVSDA
FT                   VEATIRAMDEKVNGEIINIGSENEKSIKEVAEVIKKLTDSSSKIVQVPFEEVYPHGFEE
FT                   IPNRRPDVTKLKDLVQFQAKVTWEDGLKETIKWFREEDNG"
FT   gene            501617..503161
FT                   /locus_tag="BAA_0569"
FT   CDS_pept        501617..503161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0569"
FT                   /product="glycosyl transferase, group 2 family"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48201"
FT                   /protein_id="ACQ48201.1"
FT                   /translation="MAKSLSVIIPAWNEIDTISDVIQSVKGLNPLEIIVVANGCTDGTE
FT                   TVAEHLGCKVLRYTEKLGNDVGRAAGAKESIGDVLLFIDGDFAIQTSKLQLFLNPILYN
FT                   QADVVLNNLDALFLKRQKPNSITVWRQILNSILEREELKIDSLLAVPHALTKEVVQSIG
FT                   YECFVNPILAHLRLVQGKWRISRHCAIDVITPNKFRPTEHAAYGTDLSPSEKRMIGDHI
FT                   EAVAERIVGSDERGGYCDGNRKRDSVYHTLDFEDFYQGWGVTSNLYKGKQLSVIIPVQD
FT                   EEKTIGNVIEELRKIEPFEIIVVVNGSSDQTATIAKDKGATTIVYKEALGNDVGRSLGT
FT                   YFAKGEIVLFIDGDFVIPASELYPFAKAIADGTDVALNDLNHYLDLRVPLHLVTAFKYA
FT                   LNLACDRKDLGVGSLIAVPNAFSRKCLKQIGYRSLLAPCVAQVKAILSGFEVACVSRVE
FT                   VDKMNRIRPSEHFAKIGHPPAVLRIIGDHIEGLEQLIGLTGSRGGFHDGNRKRDIL"
FT   gene            503501..505750
FT                   /gene="pfl"
FT                   /locus_tag="BAA_0570"
FT   CDS_pept        503501..505750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfl"
FT                   /locus_tag="BAA_0570"
FT                   /product="formate acetyltransferase"
FT                   /EC_number="2.3.1.54"
FT                   /note="identified by match to protein family HMM PF01228;
FT                   match to protein family HMM PF02901; match to protein
FT                   family HMM TIGR01255"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47629"
FT                   /protein_id="ACQ47629.1"
FT                   /translation="MTQVLENVKNAWENFKGEKWKAEIDVRDFILNNVNVYEGDESFLA
FT                   GATEATKQLWDQVMDLTTKERENGGVLDMDTKIVSSITSHEPGYLNKETEKVVGFQTDK
FT                   PFKRSLQPYGGIRMAEQACESYGYEMDKELSRIFRDWRKTHNQGVFDAYTPEMRAARKS
FT                   GVITGLPDAYGRGRIIGDYRRVALYGVDHLIEAKKADLNLTGGVMSEDTMRLREELSEQ
FT                   IRALQELKQMAASHGFDISKPATNAQEAFQWLYFAYLAAIKEQNGAAMSLGRTSTFLDI
FT                   YIERDLANGTLTEEDVQEIVDHFIMKLRLVKFARTPDYNELFSGDPTWVTESIGGMALD
FT                   GRPLVTKNSFRFLHTLDNLGPAPEPNLTVLWSKQLPQNFKNYCAKMSIKTSAIQYENDD
FT                   IMRADYGDDYGIACCVSAMRIGKQMQFFGARANLAKALLYAINGGKDEKSKAQVGPEYA
FT                   PITSEVLDYEEVMHKFDMTMEWLAGLYLNTLNVIHYMHDKYSYERIEMALHDTNVLRTM
FT                   ATGIAGLSVVADSLSAIKYAKVKPIRDENGIAVDFEIEGDFPKYGNNDDRVDEIAVNLV
FT                   KTFMNKLRKHKTYRNSVHTMSILTITSNVVYGKKTGNTPDGRRTGEPFAPGANPMHGRD
FT                   TKGALASLLSVAKLPYEDAQDGISNTFSIIPKALGKEDEVQVRNLVSMLDGYAVKEGHH
FT                   LNINVFNRETLMDAMEHPEKYPQLTIRVSGYAVNFIKLTREQQIDVINRTMHESM"
FT   gene            505820..506551
FT                   /gene="pflA"
FT                   /locus_tag="BAA_0571"
FT   CDS_pept        505820..506551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pflA"
FT                   /locus_tag="BAA_0571"
FT                   /product="pyruvate formate-lyase-activating enzyme"
FT                   /EC_number="1.97.1.4"
FT                   /note="identified by match to protein family HMM PF04055;
FT                   match to protein family HMM TIGR02493"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47380"
FT                   /protein_id="ACQ47380.1"
FT                   /translation="MVKGRIHSVESCGTVDGPGIRYVIFTQGCLLRCQYCHNADTWEIG
FT                   KGKEITVEEVMQDVTCYLPFIEASGGGITVSGGEPLLQLDFLIELFKKCKEIGIHTTID
FT                   SSGGCYSEETEFQNKLDILMEYTDLVLLDLKHIDSKKHRKLTGKPNEHILQFARYLSDK
FT                   NKPIWVRHVLVPGVTDNEEDLQKLSSFIQSLSNVQKIEVLPYHKLGVYKWEALGHKYPL
FT                   ANVEPPTEKNVEQARHILQAV"
FT   gene            506964..508130
FT                   /locus_tag="BAA_0572"
FT   CDS_pept        506964..508130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0572"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04101;
FT                   match to protein family HMM PF06925"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49388"
FT                   /db_xref="GOA:C3PCX2"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="InterPro:IPR009695"
FT                   /db_xref="InterPro:IPR023589"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3PCX2"
FT                   /protein_id="ACQ49388.1"
FT                   /translation="MIKNPKVLILTAHYGNGHVQVAKTLEQTFRQKGIKDVIVCDLFGE
FT                   SHPVITDITKYLYLKSYTIGKELYRLFYYGVEKIYDKKIASWYANFGRKRLKLLLQAEK
FT                   PDIVINTFPIIAVPELKKQTGISIPVYNVLTDFCVHKIWIHREVDRYFVATDHVKKVMV
FT                   DIGVPAEQIVETGIPIRSSFELKINPDIIYNKYQLCKNKKILLIVAGAHGVLGSVKELC
FT                   QSFMSVPDLQVVVVCGKNEALKQDLVGVQETNPDALKVFGYVENIDELFRVTSCMITKP
FT                   GGITLSEAAALQVPVILYKPVPGQENENAMYFERKGAAVVIRDDSEVFAKTEALLQDDM
FT                   KLLQMKEAMKSIYRPEPADHIVDTILAENHVEPNHIPIKSPALAQSFT"
FT   gene            complement(508495..508614)
FT                   /locus_tag="BAA_0573"
FT   CDS_pept        complement(508495..508614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0573"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49032"
FT                   /protein_id="ACQ49032.1"
FT                   /translation="MDKKKRDKTKNALSSTQEVLYQREFRKADRAAGYRSKSI"
FT   gene            complement(508725..509282)
FT                   /locus_tag="BAA_0574"
FT   CDS_pept        complement(508725..509282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0574"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50347"
FT                   /protein_id="ACQ50347.1"
FT                   /translation="MLKKRDLHDSHVLYELMVDPAVFPFVRQKAYSYEEYLFLTKQTIE
FT                   AEERGELISRTILDEWGNPIGTITLFDVQEKAGFLGTWLGKPYHGKGYNKLAKDSFFSE
FT                   LFYELDIETIFMRIRKINIRSIKAAEKLQYVNLANETRKAVYDEINANEEVYNLYEIPK
FT                   DQYTLATMRDTTFQDAHHLKEA"
FT   gene            complement(509524..510654)
FT                   /locus_tag="BAA_0575"
FT   CDS_pept        complement(509524..510654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0575"
FT                   /product="chlorohydrolase family protein"
FT                   /note="identified by match to protein family HMM PF01979;
FT                   match to protein family HMM PF07969"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50164"
FT                   /protein_id="ACQ50164.1"
FT                   /translation="MKILLKQAMVYPITSQKFQGDVLVIGEKIAEVKPFIQPTQDMTVI
FT                   DARALHLLPGFIDVHTHLGLYDEGTGWAGNDANETSEVSTPHIRSLDGIHPLDIAFQDA
FT                   VQNGITTVHVMPGSQNIIGGTTCVIKTAGTCIDHMIIQEPAGLKIAFGENPKKVHSNGT
FT                   KESITRMGIMGLLRESFYEAQHYGHEADFRMLPILKALRREIPVRIHAHRADDISSALR
FT                   FATEFNLDLRIEHCTEGHFIIEELSKHNLKVSVGPTLTRRSKIELKNKTWDTYHILSKN
FT                   GVEVSITTDHPYTPIQYLNLCAAVAVREGLDEKTALEGITIFPARNLRLEDRIGSIEVG
FT                   KDADLVLWTHHPFHYLAKPVLTMIDGKIIYKKNKKN"
FT   gene            complement(510795..511700)
FT                   /locus_tag="BAA_0576"
FT   CDS_pept        complement(510795..511700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0576"
FT                   /product="cell division inhibitor-like protein"
FT                   /note="identified by match to protein family HMM PF01370;
FT                   match to protein family HMM PF08338; match to protein
FT                   family HMM TIGR01777"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47092"
FT                   /protein_id="ACQ47092.1"
FT                   /translation="MKIAISGGTGFIGTYLSTFFIQKGYTVYILTRKKTTETSHPNLQY
FT                   VQWTPDLQTFPLSSIDVVINLAGESINSRWTKKQKKIILNSRIQTTKGLIKQLQALPAK
FT                   PHTFINASAIGYYGTSETESFTEQHVTPGNDFLANTVYSWEQEASKARSLGIRTIYARF
FT                   GVILGPDGGALPKMLLPYQFYIGGTVGSGKQWLSWIHIDDVASMIDFIIHKKEIDGPLN
FT                   ITAPEPIRMKGFGETIATIMKKPHWLPVPSFMLHALLGEMSILVLEGQHVLPSKAIEHG
FT                   YQYTFPTIDHALQNILSHTM"
FT   gene            511782..512594
FT                   /locus_tag="BAA_0577"
FT   CDS_pept        511782..512594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0577"
FT                   /product="recX domain protein"
FT                   /note="identified by match to protein family HMM PF02631"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46725"
FT                   /db_xref="GOA:C3PCX7"
FT                   /db_xref="InterPro:IPR003783"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3PCX7"
FT                   /protein_id="ACQ46725.1"
FT                   /translation="MAVITKIEVQKRSKERFNIYIDKGQGEEYGFSVNEVILIKHGLQK
FT                   GLEIDEIALGNILYNEEVQKAYLQAISYLSYQMRTKLEIEDFLRKKEVGQAIISEVVSK
FT                   LLHDRYINDKEYAILYTRTQSNVNRKGPTVIKRELLNKGVQDLIIMHSLQEYTKEKQIE
FT                   NALILIEKKKKSYQKHSFLQMKLKLDEMLVRKGYSRDVIQICLEELKDEKDDEKQQEAL
FT                   HYHGNKYYEKYKKYDGWTFENKMKQALYRKGFSIDEIEIFLQMKREEG"
FT   gene            512604..512921
FT                   /locus_tag="BAA_0578"
FT   CDS_pept        512604..512921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0578"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF08838"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49368"
FT                   /protein_id="ACQ49368.1"
FT                   /translation="MNMPKRYSEMTPYELREEIGVLKEQAIKAEQLGIVNEFDVLMRKI
FT                   AMARAYMTDINKFHIGETYELVEEPGILFEITYFNGVFAWGHKQNDNEEIGIPISLLQE
FT                   K"
FT   gene            complement(512986..513138)
FT                   /locus_tag="BAA_0579"
FT   CDS_pept        complement(512986..513138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0579"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48997"
FT                   /protein_id="ACQ48997.1"
FT                   /translation="MSYRDRLDSRSELFNHTWTRPKHAKAQVNGQTQQTQSLIILANEC
FT                   KKRQF"
FT   gene            complement(513182..513340)
FT                   /gene="sspK"
FT                   /locus_tag="BAA_0580"
FT   CDS_pept        complement(513182..513340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sspK"
FT                   /locus_tag="BAA_0580"
FT                   /product="small, acid-soluble spore protein K"
FT                   /note="identified by match to protein family HMM PF08176;
FT                   match to protein family HMM TIGR03091"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50479"
FT                   /db_xref="GOA:C3PCY0"
FT                   /db_xref="InterPro:IPR012611"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3PCY0"
FT                   /protein_id="ACQ50479.1"
FT                   /translation="MGKQAEFWSESKNNSKIDGQPKAKSRFASKRPNGTINTHPQERMR
FT                   AANQQEE"
FT   gene            513462..513728
FT                   /locus_tag="BAA_0581"
FT   CDS_pept        513462..513728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0581"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46259"
FT                   /protein_id="ACQ46259.1"
FT                   /translation="MNDIYEALTKELLEKNDKLSYAQARAWVELLWEDFQTTYAKSGRY
FT                   QGEEMTEQVVRSWINNHGGRLHEMRTNNPKYSHLINQEDHLKH"
FT   gene            complement(513753..514733)
FT                   /locus_tag="BAA_0582"
FT   CDS_pept        complement(513753..514733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0582"
FT                   /product="yfhP protein"
FT                   /note="identified by match to protein family HMM PF04307"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48104"
FT                   /protein_id="ACQ48104.1"
FT                   /translation="MDTATHLVMGVTLGSLATLDPAIAQSDIGPQAVMLATIAGSNIPD
FT                   IDTVLKLRNNAKYIRNHRGITHSIPAVILWSFLISGISFAFFSDAPYLHLLLWSFIAVF
FT                   LHVFVDIFNAYGTQALRPFTKKWVALGIINTFDTVIFFIHILAIACMLVGSHKGYTALA
FT                   AYILMIIYYIGRIIMHRNIRSVVHKRFKNVEKIIISPSYRFYHYHLAVVTADYYYVARW
FT                   HRGNIMIYDKFDRVPFPDNAIMRAAKQDENISAFLSFSPVYRWDIFDYDHYYEVRFIDL
FT                   RYRSKDYYPFVAIVQLDHNLNIISSYTGWIFSEEKLRKKLELLPH"
FT   gene            514883..515980
FT                   /gene="mutY"
FT                   /locus_tag="BAA_0583"
FT   CDS_pept        514883..515980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutY"
FT                   /locus_tag="BAA_0583"
FT                   /product="A/G-specific adenine glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /note="identified by match to protein family HMM PF00633;
FT                   match to protein family HMM PF00730; match to protein
FT                   family HMM TIGR01084"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47779"
FT                   /protein_id="ACQ47779.1"
FT                   /translation="MTLEILNNFNIEQFQNDLIGWFEKEQRDLPWRKNKDPYRVWVSEI
FT                   MLQQTRVEAVKPYYANFMGKFPTLEALANADDEEVLKAWEGLGYYSRARNLHAAVKEVK
FT                   EVYGGIVPSDVKKIEKLKGVGPYTKGAILSIAYGIPEPAVDGNVVRVLSRILSVWDDIA
FT                   KPKTRKVFEEIVREIISAENPSYFNQGLMELGALICIPKNPACLLCPVREHCRGYAEGV
FT                   QKELPVKSKAKAPTMVPIVAGVLQTEDGRYVINKRPSTGLLANMWEFPNVELGEGIRNQ
FT                   KEQLIDYMKEKFELSISIEEYAMNVQHTFTHRTWDIFVFYGKVTGDIVETDTLKFVSKE
FT                   AFEQLPFSKSHRTIYENCVEKITMQ"
FT   gene            complement(516015..516239)
FT                   /locus_tag="BAA_0584"
FT   CDS_pept        complement(516015..516239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0584"
FT                   /product="yfhS protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49597"
FT                   /protein_id="ACQ49597.1"
FT                   /translation="MYIGRDMTELTMVSKNEWKEDELAYFHHSLQQILPYLNAEGQSIY
FT                   KEIVIEIESRGGLQEGEASWTHGTKISYD"
FT   gene            516365..516652
FT                   /locus_tag="BAA_0586"
FT   CDS_pept        516365..516652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0586"
FT                   /product="small acid-soluble spore protein, gamma-type"
FT                   /note="identified by match to protein family HMM PF04259;
FT                   match to protein family HMM TIGR01442"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48520"
FT                   /protein_id="ACQ48520.1"
FT                   /translation="MSKKQQGYNKATSGASIQSTNASYGTEFATETNVQAVKQANAQSE
FT                   AKKAQASGASIQSTNASYGTEFATETDVHAVKKQNAQSAAKQSQSSSSNQ"
FT   gene            complement(516636..516764)
FT                   /locus_tag="BAA_0585"
FT   CDS_pept        complement(516636..516764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0585"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49217"
FT                   /protein_id="ACQ49217.1"
FT                   /translation="MTTFVDLLEVMSFDLFSLPWPKHKENTSHELEKCFSFITDLN"
FT   gene            516841..517101
FT                   /locus_tag="BAA_0588"
FT   CDS_pept        516841..517101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0588"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50925"
FT                   /protein_id="ACQ50925.1"
FT                   /translation="MNDFDKLVGEQLETMDELLKLQAHLEKYQQIEMSEKDTCDKKELH
FT                   FIRQEIYRTELALKLLHEKFEEQTNSVIQSFETEKMISNLG"
FT   gene            complement(517059..517172)
FT                   /locus_tag="BAA_0587"
FT   CDS_pept        complement(517059..517172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0587"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50657"
FT                   /protein_id="ACQ50657.1"
FT                   /translation="MRIKKALLYFHVKKDLLSEDSGISYPKFEIIFSVSKD"
FT   gene            517334..517864
FT                   /locus_tag="BAA_0589"
FT   CDS_pept        517334..517864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0589"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04167"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48949"
FT                   /db_xref="InterPro:IPR007295"
FT                   /db_xref="InterPro:IPR016882"
FT                   /db_xref="InterPro:IPR035930"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3PCY9"
FT                   /protein_id="ACQ48949.1"
FT                   /translation="MGFPKEGEKVQIHSYKHNGSIHRMWKETTILKGTQSLVIGANDRT
FT                   VVTESDGRTWITREPAICYFHENYWFNVIGMLREEGVYYYCNLSSPFAYDSEALKYIDY
FT                   DLDIKVYPDMTYTLLDEDEYEKHSQIMQYPPVIDTILKRNVAQLTQWIHQRKGPFAPDF
FT                   VDMWYERYLMYRN"
FT   gene            517919..519679
FT                   /locus_tag="BAA_0590"
FT   CDS_pept        517919..519679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0590"
FT                   /product="ABC transporter, permease/ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47243"
FT                   /protein_id="ACQ47243.1"
FT                   /translation="MQGIKRYLQFVKPYRWLIAITIMIGLVKFGIPLIMPWLLKYIIDD
FT                   VIQGAGSLQDKTSQLVTAIGIAFFIFAVLRPPIEYYRQYFAQRIANTILYDLRKHIFGH
FT                   LQKLSLRYYSNTKTGEIISRVIHDVEQTKDFVITGLMNVWLDTATIAIAIIVMFSMNIK
FT                   LTFVALLILPIYVVAVKYFFGRLRKLTKERSQALATMQGYLHERIQGMQVTRSFALEEY
FT                   EGKQFEKRNNEFLTKALTHTSWTARTFSAVNTLTDLGPLLVIGFAAYEVIQGQLTLGTM
FT                   VAFVGYMDSLYSPLRRLVNSSTTLTQSFASMDRVFELLDEKYDIVNVPSAVQTKKLNGE
FT                   VIFDNVSFRYNADEKEILHNLSLTMLPGEKVALVGASGGGKSSLASLIPRFYDVSSGAV
FT                   YVDGIDVRKYDMRNLRSHIGIVLQDNLLFSDTIGANILYGNPKATEEEVIAAAKAAQIH
FT                   DFIIELPDGYDTVVGERGVKLSGGQRQRVAIARVFLKNPSLLILDEATPALDLENERYI
FT                   QEALQTLAADRTTIIIAHRLATITHVDTIIYIEDGEIKETGSHEELMKKRGYYYNLYQL
FT                   QHITETAPLA"
FT   gene            complement(519693..520781)
FT                   /locus_tag="BAA_0591"
FT   CDS_pept        complement(519693..520781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0591"
FT                   /product="putative lipoprotein"
FT                   /note="identified by match to protein family HMM PF06081"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46833"
FT                   /protein_id="ACQ46833.1"
FT                   /translation="MKLGARILKTGIAITLALFACILLNLPSPVFAGISAIFAVQPSVY
FT                   RSYLTALEQIQANVIGAVFAIAFATAFGHNPFIIGLTCILVIALTLQLRLENTISIALV
FT                   TVIAIMEYQGEDFFSFALLRFATIMVGIIAASLVNLVFMPPKYETKLYHRIVDNTEEIV
FT                   KWIRMNSRQASDFTTLKTDIDRMKEKMIKLNHYYLLYKEERSYTKKVQFAKIRKLVLFR
FT                   QMLATTSRALSTLKSLHRTENELRYMPEEFQESIQNELDSLTHYHEQVLLKFIGKAKKQ
FT                   QSVEMLDEVETGKQELIDIFMEYQNKDDEEAYKTWLHLFPLISAIINYSEEVEHLDLLV
FT                   DSFYTYHKPEAELKIDDKKEDE"
FT   gene            complement(521042..525478)
FT                   /locus_tag="BAA_0592"
FT   CDS_pept        complement(521042..525478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0592"
FT                   /product="putative glutamate synthase, large subunit"
FT                   /note="identified by match to protein family HMM PF00310;
FT                   match to protein family HMM PF01493; match to protein
FT                   family HMM PF01645; match to protein family HMM PF04898"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49978"
FT                   /protein_id="ACQ49978.1"
FT                   /translation="MLNKTNTWTPSLFRDYKNAEHDACGIVSVMEKRKIPTKENIDLCI
FT                   QSLVKMNHRAGFINGEGDGIGIHIDVPKALWNEKLKSSGYNPTIVDHPHFIVGHFFLNK
FT                   NENIVDLKNHIRTQLNNENFAILFESDNVINSDALGPLGKQEEPLFWQVALIAENEVVN
FT                   IEQTLFSVTIKIEENEAIHVASLSRDHVVYKVLGAGDTLVAYYNDLQHPLIASTMTLGH
FT                   NRYSTNTLSNFFRVQPFSILGHNGEINTIAKLRDQAEMIHVPLTAGGSDSQDLNRTLET
FT                   LLVQYGYSLFEAMDILFPPIINEIKLYETHLQDLYTYIREAWGHFAQGPAGIISRYKDE
FT                   AVFSVDSLGLRPVWKVEIESSYIFSSEPGVVSPTEYVAEPKPLAPGEKVGLKWNEQDEL
FT                   VLYEHDDYQTQVYNRFKKKVDVTNYHLHLSIPKTKEIPDACDSMQVETKQYVAFGWDRE
FT                   HIQLLEQMATKGVEPIRSLGHDSPLAALDTDRRNIADFIKESVAVVTNPAIDRDREVEH
FT                   FSTRTILGERPSLLSDAKKPFVVEMLSPIILEGSVAQSIAQELHTITYEQLIELFNTHS
FT                   SIATISATFSQAETLQCALSRISSEAITAVNDGASLLLIDDADAHLNERLWIDPHLVTA
FT                   KVHQVLSENKLRRNCSLVIRSGALRSLHDIVTLHGLGADSINPYLLFATVNDGTKTPIT
FT                   NLYNALNKGLEKVISTIGIHELRGYGRLYSSIGLHEEIANILQITNFLGSNDLAFSLES
FT                   LAEDAQMRADDYNDPKVRIRKSFHIFPRIWKAIGDVAKGNSYDDYRDKLSELEENNPIA
FT                   IRHLIQTKETKHVIPTEEVSISIQNHDLPFIISSMSFGSQNEIAFRAYAEAADQLNMIS
FT                   LNGEGGEIKDMIGKYPHTRGQQVASGRFGVNAELLNSSNLIEIKIGQGAKPGEGGHLPG
FT                   SKVTAKIAEARNATIGSDLISPSNNHDIYSIEDLAQMITEIKTANQLAKVAVKVPVVPN
FT                   IGTIAVGIAKAGADFINISGFDGGTGAARIHALQHVGLPVEIGVKAAHNALLEANMRHN
FT                   VEIWADGGIRSVNDALKIMLLGANRIGFGTLSMIAIGCTTCRGCHLDTCHVGIATQIES
FT                   EAQAKEHGLRRFVPRELESAVAGLLHLFTTFGEELKRLTGNLGYTNLQEIVGRSDLLEQ
FT                   VRGKNLLNLCNLLQTIEHPSVIKTEHVLEKQFEPIHSPHSKELVGVGVEQRVMGGLESC
FT                   YRVRSKLYEDTKLEPLTLKYTNGSIPGNGLGAYNSENLFIHVNGGAQDGIGKTSFGGGI
FT                   YITKAKGKDGLYYNGSVGKGFGYGAQKGALYVQGNADARAGIRLSGADMIIGGRMTKPL
FT                   REKEQGNIGAYSNIKGFAFEYMTNGRALVLGDPGPWICAGMTGGVVYLRHDSSLGLTEQ
FT                   ALKRRIAKGANVTLQPISKNGVRDVNELLLDYIRVLNEHEQYEEVALLTPLLDDMQQQF
FT                   FEIIPKKEQADPSISTE"
FT   gene            complement(525678..526982)
FT                   /gene="hemL1"
FT                   /locus_tag="BAA_0593"
FT   CDS_pept        complement(525678..526982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemL1"
FT                   /locus_tag="BAA_0593"
FT                   /product="glutamate-1-semialdehyde-2,1-aminomutase"
FT                   /EC_number="5.4.3.8"
FT                   /note="identified by match to protein family HMM PF00202;
FT                   match to protein family HMM TIGR00713"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50149"
FT                   /db_xref="GOA:C3PCZ3"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3PCZ3"
FT                   /protein_id="ACQ50149.1"
FT                   /translation="MVVKFTKSEALHKEALEHIVGGVNSPSRSFKAVGGGAPIAMERGK
FT                   GAYFWDVDGNKYIDYLAAYGPIITGHAHPHITKAITTAAENGVLYGTPTALEVKFAKML
FT                   KEAMPALDKVRFVNSGTEAVMTTIRVARAYTGRTKIMKFAGCYHGHSDLVLVAAGSGPS
FT                   TLGTPDSAGVPQSIAQEVITVPFNNVETLKEALDKWGHEVAAILVEPIVGNFGIVEPKP
FT                   GFLEKVNELVHEAGALVIYDEVITAFRFMYGGAQDLLGVTPDLTALGKVIGGGLPIGAY
FT                   GGKKEIMEQVAPLGPAYQAGTMAGNPASMASGIACLEVLQQEGLYEKLDELGAMLEKGI
FT                   LEQAAKHNIDITLNRLKGALTVYFTTNTIEDYDAAQDTDGEMFGKFFKLMLQEGVNLAP
FT                   SKYEAWFLTTEHTKEDIEYTIEAVGRAFAALADNK"
FT   gene            527104..528117
FT                   /locus_tag="BAA_0594"
FT   CDS_pept        527104..528117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0594"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50723"
FT                   /protein_id="ACQ50723.1"
FT                   /translation="MKSVIEVQGLRKEFTAYSSRPGLKGAFRDLLNRNYKIVPAVNDVS
FT                   FTVKQGEMVGYIGENGAGKSTTIKMLTGILTPTSGDILVNGMNPHKQREEFVRTIGVVF
FT                   GQRSQLWWDIAVQESFRLLKKVYGVSDAQYKEHMEHVIETLDIGPLLDKPVRKLSLGQR
FT                   MRCELAAALIHNPPLLFLDEPTIGLDVLVKLKIREFLKEMNERYKTTILLTTHDITDIE
FT                   ALCERVIMLDEGNIMYDGSLNNLRTQWGAEKEIHFQFVAPVSYQALSMVMPDSHVVWSK
FT                   AKEENAWIAKIPNEEVIISMLISKVVQAFQIKDLKINEVSTEEIIRNIYEEGIKHG"
FT   gene            528110..528901
FT                   /locus_tag="BAA_0595"
FT   CDS_pept        528110..528901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0595"
FT                   /product="putative ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF06182"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49049"
FT                   /protein_id="ACQ49049.1"
FT                   /translation="MGKYIEMIRIRFLMMLAYRTNYYSGILIYTINIGAYYFLWQAIYS
FT                   GKENIESLSISQMTTYIAIAWMARAFYFNNIDREIAMEIQEGRVAVELIRPYNYLGMKV
FT                   MQGLGEGIFRFAFFSIPGMVIVTLLFSLQITTNFQTWLYFFLSLIFSFIINTQINLMTG
FT                   MLTFFLFNNSGIMYAKRVVIDLFSGLLLPISFYPLWAQKAMVFLPFQAISYIPSMIFSE
FT                   GIQGSKLYEALLFQVIWAIVLIIPIVLMWRTARKRLIVQGG"
FT   gene            528906..529691
FT                   /locus_tag="BAA_0596"
FT   CDS_pept        528906..529691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0596"
FT                   /product="putative ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF06182"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49619"
FT                   /protein_id="ACQ49619.1"
FT                   /translation="MIYIKLFLQYASQYIKTKLEYRGDFIVGLLSDLSLQAVNLIFILV
FT                   VFGHTQALKGWSREEVIFIYGFFLVPFAIFSAFFNIWDFNDRYIIKGEMDRILTRPIHS
FT                   LFQIILERMELESLIGAITGMIVMGYAAVELQLSFYWYDFFLFLLMVGGGALVYGGIFV
FT                   TLASLGFWSDAKSSIMPLMYNIGNYGRYPVNIYNRVIRFILTFVLPFAFVGVYPAAYFL
FT                   RKTEWNSYAFATPLVGVICFTIAITLWNQGVKRYRGAGN"
FT   gene            529764..530168
FT                   /locus_tag="BAA_0597"
FT   CDS_pept        529764..530168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0597"
FT                   /product="putative potassium channel protein"
FT                   /note="identified by match to protein family HMM PF07885"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47319"
FT                   /protein_id="ACQ47319.1"
FT                   /translation="MLWGFILLIVAIAILRSVQLLWSSYSDSTRFFSLYNLATLFLIYT
FT                   TVLIAFGLSYVVLEEMGFAVLKEEGESLNAHSFQLVEICLYFSAVTLLSVGYGDISPIG
FT                   IGRWIAIGEALIGYTLPFAFVMRSVIDNEK"
FT   gene            530213..530668
FT                   /gene="bcP"
FT                   /locus_tag="BAA_0598"
FT   CDS_pept        530213..530668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcP"
FT                   /locus_tag="BAA_0598"
FT                   /product="bacterioferritin comigratory protein"
FT                   /note="identified by match to protein family HMM PF00578;
FT                   match to protein family HMM PF08534"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50461"
FT                   /protein_id="ACQ50461.1"
FT                   /translation="MVTVGEMAPEFTLEGSNGEQVRLADFRGKNVVLYFYPKDMTPGCT
FT                   TEACDFRDSYGLFQEKDTVILGVSPDPANRHLKFIEKHELPFTLLVDEDHKVAELYDVW
FT                   KLKKNFGKEYMGIERSTFLINKDGELVKEWRKVKVKGHIEDVLSYIN"
FT   gene            530966..531394
FT                   /locus_tag="BAA_0599"
FT   CDS_pept        530966..531394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0599"
FT                   /product="transcriptional regulator, Fur family"
FT                   /note="identified by match to protein family HMM PF01475"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48613"
FT                   /protein_id="ACQ48613.1"
FT                   /translation="MVKEELKEALEMLKNTGVRITPQRHAILEYLVESMTHPTADDIYK
FT                   ALEGKFPNMSVATVYNNLRVFKEVGLVKELTYGDASSRFDYVTSQHYHVICEKCGKIVD
FT                   FPYGGLEKLEEEAAKTTGFVINSHRLEIYGVCPECHKA"
FT   gene            complement(531593..531949)
FT                   /locus_tag="BAA_0600"
FT   CDS_pept        complement(531593..531949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0600"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49131"
FT                   /db_xref="GOA:C3PD00"
FT                   /db_xref="InterPro:IPR020912"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3PD00"
FT                   /protein_id="ACQ49131.1"
FT                   /translation="MSIKYSNKINKIRTFALSLVFIGLFIAYLGVFFRENIIIMTTFMM
FT                   VGFLAVIASTVVYFWIGMLSTKTVQIICPSCDKPTKMLGRVDACMHCNQPLTMDRDLEG
FT                   KEFDEKYNKKSYKS"
FT   gene            532361..533868
FT                   /gene="rrs_9"
FT                   /locus_tag="BAA_0601"
FT   rRNA            532361..533868
FT                   /gene="rrs_9"
FT                   /locus_tag="BAA_0601"
FT                   /product="16S ribosomal RNA"
FT   gene            534040..536947
FT                   /gene="rrl_9"
FT                   /locus_tag="BAA_0603"
FT   rRNA            534040..536947
FT                   /gene="rrl_9"
FT                   /locus_tag="BAA_0603"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(534064..534495)
FT                   /pseudo
FT                   /locus_tag="BAA_0602"
FT                   /note="conserved hypothetical protein; this region contains
FT                   one or more premature stops and/or frameshifts"
FT   gene            537048..537163
FT                   /gene="rrf_9"
FT                   /locus_tag="BAA_0604"
FT   rRNA            537048..537163
FT                   /gene="rrf_9"
FT                   /locus_tag="BAA_0604"
FT                   /product="5S ribosomal RNA"
FT   gene            537171..537247
FT                   /locus_tag="BAA_0605"
FT   tRNA            537171..537247
FT                   /locus_tag="BAA_0605"
FT                   /product="tRNA-Asn"
FT   gene            537248..537341
FT                   /locus_tag="BAA_0606"
FT   tRNA            537248..537341
FT                   /locus_tag="BAA_0606"
FT                   /product="tRNA-Ser"
FT   gene            537357..537433
FT                   /locus_tag="BAA_0607"
FT   tRNA            537357..537433
FT                   /locus_tag="BAA_0607"
FT                   /product="tRNA-Glu"
FT   gene            537437..537514
FT                   /locus_tag="BAA_0608"
FT   tRNA            537437..537514
FT                   /locus_tag="BAA_0608"
FT                   /product="tRNA-Val"
FT   gene            537537..537615
FT                   /locus_tag="BAA_0610"
FT   tRNA            537537..537615
FT                   /locus_tag="BAA_0610"
FT                   /product="tRNA-Met"
FT   gene            537617..537694
FT                   /locus_tag="BAA_0611"
FT   tRNA            537617..537694
FT                   /locus_tag="BAA_0611"
FT                   /product="tRNA-Asp"
FT   gene            537703..537778
FT                   /locus_tag="BAA_0612"
FT   tRNA            537703..537778
FT                   /locus_tag="BAA_0612"
FT                   /product="tRNA-Phe"
FT   gene            537797..537872
FT                   /locus_tag="BAA_0613"
FT   tRNA            537797..537872
FT                   /locus_tag="BAA_0613"
FT                   /product="tRNA-Thr"
FT   gene            537883..537966
FT                   /locus_tag="BAA_0614"
FT   tRNA            537883..537966
FT                   /locus_tag="BAA_0614"
FT                   /product="tRNA-Tyr"
FT   gene            537973..538048
FT                   /locus_tag="BAA_0615"
FT   tRNA            537973..538048
FT                   /locus_tag="BAA_0615"
FT                   /product="tRNA-Trp"
FT   gene            538066..538143
FT                   /locus_tag="BAA_0616"
FT   tRNA            538066..538143
FT                   /locus_tag="BAA_0616"
FT                   /product="tRNA-His"
FT   gene            538206..538280
FT                   /locus_tag="BAA_0617"
FT   tRNA            538206..538280
FT                   /locus_tag="BAA_0617"
FT                   /product="tRNA-Gln"
FT   gene            538286..538360
FT                   /locus_tag="BAA_0618"
FT   tRNA            538286..538360
FT                   /locus_tag="BAA_0618"
FT                   /product="tRNA-Gly"
FT   gene            538375..538448
FT                   /locus_tag="BAA_0619"
FT   tRNA            538375..538448
FT                   /locus_tag="BAA_0619"
FT                   /product="tRNA-Cys"
FT   gene            538455..538541
FT                   /locus_tag="BAA_0620"
FT   tRNA            538455..538541
FT                   /locus_tag="BAA_0620"
FT                   /product="tRNA-Leu"
FT   gene            complement(538748..539068)
FT                   /locus_tag="BAA_0621"
FT   CDS_pept        complement(538748..539068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0621"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46262"
FT                   /protein_id="ACQ46262.1"
FT                   /translation="MTHSNEKKPHGLKGIGEKLNPTIYQVRFMKLDEPIQFESFPELKK
FT                   LGDWLSTSTHMWACHSTMYKYNKEEFKKRFLEITNLTVDHVLISTGGVGFNFMSPGWRD
FT                   SL"
FT   gene            539421..540140
FT                   /locus_tag="BAA_0622"
FT   CDS_pept        539421..540140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0622"
FT                   /product="conserved hypothetical protein TIGR01033"
FT                   /note="identified by match to protein family HMM PF01709;
FT                   match to protein family HMM TIGR01033"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47137"
FT                   /db_xref="GOA:C3NZC1"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026562"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3NZC1"
FT                   /protein_id="ACQ47137.1"
FT                   /translation="MGRKWNNIKDKKASKDANTSRIYAKFGREIYVAAKQGEPDPESNQ
FT                   ALRVVLERAKTYNVPRTIIDRAVEKAKGGSEENYDELRYEGFGPNGAMVIVDTLTNNVN
FT                   RTAADVRAAFSKNSGNMGVNGSVAYMFDATAVIGLEGKTSDEVLEILMEADVDARDILE
FT                   EEDAVIVYAEPDQFHAVQSALKDAGVEEFTVAELTMLAQNDVTLPEDAQAQFEKMVDAL
FT                   EDLEDVQQVYHNVDLGE"
FT   gene            540291..540752
FT                   /locus_tag="BAA_0623"
FT   CDS_pept        540291..540752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0623"
FT                   /product="MutT/NUDIX family protein"
FT                   /note="identified by match to protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47248"
FT                   /protein_id="ACQ47248.1"
FT                   /translation="MEHKTPKHIVAVAGYLTNEKDEVLLAKVHWRADTWELPGGQVEEG
FT                   EALDQAVCREIKEETGLTVKPIGITGVYYNASMNILAVVFKVAYVSGEIKIQHEEIQEA
FT                   KFVALNEENIDEYITRPHMKSRTLDAMRSSHFIPYETWEVQPYNLIGRL"
FT   gene            541239..542015
FT                   /locus_tag="BAA_0624"
FT   CDS_pept        541239..542015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0624"
FT                   /product="penicillin-binding domain protein"
FT                   /note="identified by match to protein family HMM PF00912"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47976"
FT                   /protein_id="ACQ47976.1"
FT                   /translation="MKERVLSRVNYHQKVALNPMTKFFYKAIILLLLLSFTLLFIGNVM
FT                   IEQSDISKLHVPAKLEVPESLTHAFIATEDKRFYHHNGLDYIAIIRASVENIKAGGVVQ
FT                   GGSTITQQLSKNAFLTNERTFSRKWKEIFYTKKIERTFTKDEILKLYVSNIYYGEGAWG
FT                   IEKAANLYFGKKVSQLTLAESAMMAAVVKAPAYYSPAQNYDKAVERRNVVLRLMEKEGY
FT                   INHDEYMQAVSEKLVIRHDIKTERSMLNHAREKAVS"
FT   gene            542203..542856
FT                   /locus_tag="BAA_0625"
FT   CDS_pept        542203..542856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0625"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01323"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46293"
FT                   /protein_id="ACQ46293.1"
FT                   /translation="MKSSNKLMALGIVFSIAVLIVIGTIVYSIINDKKDKGNEMFAYST
FT                   QQSLGKDDAPVKVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDS
FT                   DLGAAAGEAIYKQDQDSFWIFYDEIYQSQKKDTEEWITEELLLNIVKEKLPKIDVEQFK
FT                   KDLHSKEIKEKVRKDSDRAQKLKVQGAPSVYVNGNLANPDFDSLKKAIDKELKK"
FT   gene            542971..543044
FT                   /locus_tag="BAA_0626"
FT   tRNA            542971..543044
FT                   /locus_tag="BAA_0626"
FT                   /product="tRNA-Gly"
FT   gene            543243..544385
FT                   /locus_tag="BAA_0627"
FT   CDS_pept        543243..544385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0627"
FT                   /product="putative iron-sulfur cluster-binding protein"
FT                   /note="identified by match to protein family HMM PF00037;
FT                   match to protein family HMM PF03130; match to protein
FT                   family HMM PF08331; match to protein family HMM TIGR00276"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48785"
FT                   /protein_id="ACQ48785.1"
FT                   /translation="MDFEQLKQDVIAYSKTIGIDKIGFASASPFEELKQRLIQQQQLNY
FT                   QSGFEEPDIEKRTNPQLLLSGAKSIIAIALAYPSKLKNAPLSKRGERRGIFCRASWGQD
FT                   YHLVLRDRLQKLEAYLIEKLPDIEVKSMVDTGELSDRAVSERAGIGWSGKNCSIITPEF
FT                   GSYVYLGEMITNVPFPPDQPIEDQCGSCTKCIDICPTGALIQGGQLDSKKCIAFLTQTK
FT                   GFLPEEYRDKIGNRIYGCDTCQTVCPKNKGMDFHNHPEMEPDPELVKPLLTPLLTISNR
FT                   DFKEKYGIMSGSWRGKKPLQRNAILALAHFKEASAIPDLIGVMKDDPRPVLRGTAAWAL
FT                   GKIGGDGVGEAIEKAMQREKDEEVLHEMNRGLELLAQKKE"
FT   gene            544430..545317
FT                   /locus_tag="BAA_0628"
FT   CDS_pept        544430..545317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0628"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47859"
FT                   /protein_id="ACQ47859.1"
FT                   /translation="MVVKINIEKQVQQFLAYVTEKRTNVDGIAEDLLQIAKRKRLLFQK
FT                   RNADIVKATADVSFMRQLNNSNHQEIDYQIHFKYLIKHKELFYIEEEQLKRRVCLNNSQ
FT                   VIGDYAIEAPEAVGMSETLEREVTKEKYGSYQYNRLEAVKYAERWWDDRNPVYRNFPDN
FT                   CTNFISQCLHTGEVPMNGYPNIRKGWWQRENQWSWSWAVAHSFYWYLSGATTGLRAEAV
FT                   ERPEDLILGDVIAYDFEDDGRWNHTTIVVAKDADGMPLVNAHSANSRRRYWNYEDSSKY
FT                   TPQMKYKFFHIING"
FT   gene            545376..545864
FT                   /locus_tag="BAA_0629"
FT   CDS_pept        545376..545864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0629"
FT                   /product="RNA methyltransferase, TrmH family, group 2"
FT                   /note="identified by match to protein family HMM PF00588;
FT                   match to protein family HMM TIGR00185"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47317"
FT                   /protein_id="ACQ47317.1"
FT                   /translation="MGVHVVLYQPEIPANTGNIARTCAATGTELHLIRPLGFSTDDKML
FT                   KRAGLDYWQHVKITYYDSIEEFYEKNKDGEFFYLTKYGEKAHTAFDYSKREKDYYFVFG
FT                   RETNGLPANVIEENFDHCLRIPMTDKVRSLNLSNTAAILIYEAFRQQNYPGLDLEIVY"
FT   gene            545992..548061
FT                   /locus_tag="BAA_0630"
FT   CDS_pept        545992..548061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0630"
FT                   /product="sensory box/GGDEF family protein"
FT                   /note="identified by match to protein family HMM PF00563;
FT                   match to protein family HMM PF00989; match to protein
FT                   family HMM PF00990; match to protein family HMM PF08447;
FT                   match to protein family HMM PF08448; match to protein
FT                   family HMM TIGR00229; match to protein family HMM
FT                   TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46662"
FT                   /protein_id="ACQ46662.1"
FT                   /translation="MKEQYSNQNTFLSMIDMDLIRRGLLHAIQDLVFIVKVIDDETFKY
FT                   IYVNKLGMDYAKLSEECYGKTFAEVLPEDTAEILQVQYAKVASEAKAHTFCDVVSLPKG
FT                   ELHYESSLNPVFDEEGVCQFIICITRDITAQIEEKMEIEEKQMLFKSLLEYNNDSIISI
FT                   DSIGRITYANPATYEIFGYRFEELNNKFIFEFINKEYEKDFQIIFKEAMQGRAKQIVSK
FT                   KYVHKEGYELYISLRTIPIIVNGEIVGVYIVTRDVTKQVLNEMRTEYLAYYDQLTGLMN
FT                   RISCTNKLNDFLNEKVAFAFIFIDLDEFHLINDTFGHKEGDKVLQKVTECLSSFQIPDM
FT                   HLFREHDDQFVMLIENITKERVEVFAKSIQKKISEHFVIEEEDVYLSASIGIVMAPTDG
FT                   EDEKILFQRVDAALEKAKEKGKGHYHFYGNGLDCEREKRFIIENQLHRAIEKNEFFLYY
FT                   QPQMNIETKKIASMEALIRWENKELGFVSPNQFIPLAERTGFIIKLDEWVINEVCRQIR
FT                   EWLNKGYEVVPIAVNISARHFRSITLIEMITRALHKYNVSAHLLAIEVTEGALIHKDIS
FT                   KRVLLQLKEQNLKIHLDDFGTGYSSLSYLKTYPIDTLKIDRSFMEGIHVDERDTNITAA
FT                   IIHLAHTLELDVIAEGVEKAEQIQFLKEKNVKFVQGYYYSRPLSKYDVENVYYK"
FT   gene            548239..548379
FT                   /locus_tag="BAA_0631"
FT   CDS_pept        548239..548379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0631"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46920"
FT                   /protein_id="ACQ46920.1"
FT                   /translation="MYVRFLEEKNLFKMNSGVKTLIPILYRIFFEFWREFYSTTVYFIL
FT                   I"
FT   gene            548453..550348
FT                   /locus_tag="BAA_0632"
FT   CDS_pept        548453..550348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0632"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06798;
FT                   match to protein family HMM PF08298"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50460"
FT                   /protein_id="ACQ50460.1"
FT                   /translation="MDILKKIEQHREAEERLQWEGTFAEYLELVKERPWVAQTAHSRIY
FT                   NMIKDAGIEEVDGRRKYNFFSNQLFGLEDALERLVEEYFHPSAKRLDVRKRILLLMGPV
FT                   SGGKSTLVTMLKRGLETYSRTDRGAIFAIKGCPMHEDPLHLIPHHLRDDFFDEYGVRIE
FT                   GNLSPLNVMRLEQEYGSRIEDVVVERIFFSEDRRTGIGTFSPSDPKSQDIADLTGSLDF
FT                   STIAEYGSESDPRAYRFDGELNKANRGMMEFQEMLKCDEKFLWHLLSLTQEGNFKAGRF
FT                   ALISADELIVAHTNETEYRSFIANKKNEALHSRIIVMPVPYNLRVSEEEHIYEKMIRES
FT                   DVSDVHIAPHTLRVAAMFTILTRLKDPKRPDIDLIKKMRLYDGETVEGYNAIDVEELQR
FT                   EYQDEGMKGIDPRYVINRISSTIIRKEVPSINALDVLRSLKDGLDQHPSISNEDRERYM
FT                   NFISLARKEYDEIAKKEVQKAFVYSYEESAKTLMDNYLDNVEAYCNKSKLRDPLTGEEM
FT                   SPDEKLMRSIEEQIGISENAKKAFREEILIRISAYARKGKRFDYNSHERLREAIQKKLF
FT                   ADLKDIVKITTSTKTPDENQLKKINDVVARLIDEHGYNSSSANELLRYVGSLLNR"
FT   gene            550794..551969
FT                   /locus_tag="BAA_0633"
FT   CDS_pept        550794..551969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0633"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04285;
FT                   match to protein family HMM TIGR02877"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50856"
FT                   /db_xref="InterPro:IPR006698"
FT                   /db_xref="InterPro:IPR014230"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3NZD1"
FT                   /protein_id="ACQ50856.1"
FT                   /translation="MGEENQPNYTISQENWSLHRKGYDDQQRHQEKVQEAIKNNLPDLV
FT                   TEESIVMSNGKDVVKIPIRSLDEYKIRYNYDKNKHVGQGNGDSKVGDVVARDGSGGQKQ
FT                   KGPGKGQGAGDAAGEDYYEAEVSILELEQAFFKELELPNLKRKEMDENRIEHVEFNDIR
FT                   KTGLWGNIDKKRTMISAYKRNAMRGKASFHPIHQEDLKFRTWNEVLKPDSKAVVLAMMD
FT                   TSGSMGIWEKYMARSFFFWMTRFLRTKYETVDIEFIAHHTEAKVVPEEEFFSKGESGGT
FT                   ICSSVYKKALELIDNKYSPDRYNIYPFHFSDGDNLTSDNARCVKLVEELMKKCNMFGYG
FT                   EVNQYNRHSTLMSAYKNIKDENFRYYILKQKADVFHAMKSFFREESGEKMA"
FT   gene            552131..555343
FT                   /locus_tag="BAA_0634"
FT   CDS_pept        552131..555343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0634"
FT                   /product="putative internalin"
FT                   /note="identified by match to protein family HMM PF00560;
FT                   match to protein family HMM PF00746; match to protein
FT                   family HMM PF05031; match to protein family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48611"
FT                   /protein_id="ACQ48611.1"
FT                   /translation="MLVAATLSLPFAVYATPILAATAATENMAVQSPKKHVFDAVIKAY
FT                   KDNSDEESYATVYIKDPKLTIENGKRIITATLKDSDFFDYLKVEDSKEPGVFHDVKVLS
FT                   EDKRKHGTKVIQFEVGELGKRYNMQMHILIPTLGYDKEFKIQFEVNMRTFVESDIEEDE
FT                   EEQIEDTQNIIRDKRLQQAINKNVLNRKDVNEPIFEEDLKEIKELNIYAGQGIESLKGL
FT                   EYMENLERITIQGSDVRNIAPISQLKRLKVVDLSFNKIENVEPLVNLEKLDILELQNNR
FT                   IADVTPLSQLKKVRTINLSGNKISDIKPLYNVSSLRKLYVSNNKITDFTGIEQLNKLGT
FT                   LGVGSNGLVNIEPISQMSGIVELNLEKNDIKDITSLSKLTGLQSLNLEENYVSDVSSLS
FT                   NLINLYELKLATNEIRDIRPIQELGKRIKIDAQRQKVFLDEAYMNEEVKIPVYDVNGTA
FT                   LQNIEWKSEGGSITNGVIKWNSLGEKMYEFKMDAGESKIRFQGRVIQNIVEKREESSNV
FT                   IQDMKLRQYMNKHNFERKNVNTPITKEDLLTVKALKITDGKKEGITDFSGLEFMTNVEE
FT                   LTLQNVNMKNAEFISSLRNLKSVDLSYNQIEDIKPLHSLEDLEKLNVSDNGIKNVPELF
FT                   KMQKLKTLDLSNNKLDNAALDGIHQLENLDALLVNNNEINNLDEISKVSKLNKLEMMSN
FT                   KVRDISPLASLKNLQWLNLSDNKIQDISTLSSMLDLLSLKLAGNEIRDVRPVIQLAQWI
FT                   TVDIKNQKIVLEDGQMNQEIQIPIYDLEGEIFEDIELKSTDGIVTDRGTVVWKTPGAKI
FT                   YSFSLNGNYHGLSLLFSGTVTQNIVAKEEPKEPVEEVEGSKEEPIKEAEGSKEEPKEPA
FT                   KEVEGSKEEPKEPAKEVEGSKEEVKEPAKEVEGPKEEVKEPTKEVEGPKEEVKEPTKEV
FT                   EGPKEEVKEPMKEVEGSKEEVKGPTKEAEGSKEEVKEPTTEVEGSKEVKEPGKEVEGSK
FT                   DAINQSAVAQETNVNNQVGKEKVVENQNMKENKPAVTKQEESKKSLGATGGQENTSTLL
FT                   SGLALVLSALSMFVFRKRLFKK"
FT   gene            555498..556364
FT                   /locus_tag="BAA_0635"
FT   CDS_pept        555498..556364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0635"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47880"
FT                   /protein_id="ACQ47880.1"
FT                   /translation="MHVSSILKIEEVASFIASMNKDATQYVGYCGDEKEELLQTIIQDF
FT                   SHIGWEKSFVVTYENNKIIGVLGFDVDEVKKCADIWGPFIKAENWEEVALHMWKELIEK
FT                   VPFHIEKFYGFYHVENNNCARLMKKLHVKEQGRHSIFSLSHNTVEERSICNVEEALPKV
FT                   FGQFVALHNYVFPNTYYEGNEIIGRLSDTNKLFVSMKNEKLEGYVYVEVNPEFQEANIE
FT                   FIATAENSRRKGVGERLLQAAIQYIFSFQGMREIELCLNTNNDRAVKLYKKVGFEEKAC
FT                   LQHYIIE"
FT   gene            complement(556468..558018)
FT                   /gene="opuD1"
FT                   /locus_tag="BAA_0636"
FT   CDS_pept        complement(556468..558018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="opuD1"
FT                   /locus_tag="BAA_0636"
FT                   /product="glycine betaine transporter"
FT                   /note="identified by match to protein family HMM PF02028;
FT                   match to protein family HMM TIGR00842"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47531"
FT                   /protein_id="ACQ47531.1"
FT                   /translation="MIKKENSVFYISILLTTLFIIWGITPASWIQGYDLQSVTSSLNSF
FT                   ILNKFGWFYSLLMTAMIILATYLAFSKYGSIRLGKDGEKPKYSYPSWLSMLFGAGMGIG
FT                   LLFYGIAEPISHFTDPLTGKAGTEESAKLAMQYSFFHWGLFPWALYAMVALTIAYFTFR
FT                   KQKGSTIGATVTPLFNRSKNSPIGKTVDILAVLATVFGIVPSVGIGAQQIAGGLSYLFP
FT                   SIHNTLLTQLVLIAIFAVLYLTSAQTGLDRGIKYLSNLNFSLTGILLVSFLLLGPTVFI
FT                   MKYFTSTLGSYIGALPSMGLNLGAFNEKSSSWIENWTIFYWGWWISWSPFVGTFIARIS
FT                   KGRTIKEFIFGVVLVPTLICTFWFAVFGGTAIHMEMFQSLGVADEIAKNGTEIGLFAVI
FT                   SHLPFSTFLTIIGLILVATFFVTSADSATFVVSMQTSNGSLSPKNSLKLIWGLTIAIIA
FT                   AILLQAGGLNALQIAAIIAALPFSIVVVLMVTSLFKELRKEDINSQTKEVPKKIKKVM"
FT   gene            558287..561184
FT                   /locus_tag="BAA_0637"
FT   CDS_pept        558287..561184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0637"
FT                   /product="putative microbial collagenase"
FT                   /EC_number="3.4.24.3"
FT                   /note="identified by match to protein family HMM PF00801;
FT                   match to protein family HMM PF01752; match to protein
FT                   family HMM PF04151; match to protein family HMM PF08453"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48103"
FT                   /protein_id="ACQ48103.1"
FT                   /translation="MNKKSKINKVMLSISTMALSLGAIQTHVSAEEKVPYNVLHSKPVG
FT                   IEKPVDEIGHVSKAEETLSFQERLKVGDFSQRPASITNKVTVKQVKESYSMADLNKMNN
FT                   QELVETLGSIKWHQITDLFQFNEDAKAFYKDKGKMQVVIDELAHRGSTFTKDDSKGIQT
FT                   FTEVLRSAFYLAFYNNELSELNERSFQDKCLPALKAIAKNPNFKLGTTEQDTVVSAYGK
FT                   LISNASSDVETVQYASNILKQYNDNFTTYVNDRMKGQAIYDIMQGIDYDIQSYLIEARK
FT                   EANETMWYGKVDGFINEINRIALLNEVTQENKWLVNNGIYFASRLGKFHSNPNKGLEVV
FT                   TQAMHMYPRLSEPYFVAVEQITTNYNGKDYSGNTVDLEKIRKEGKEQYLPKTYTFDDGS
FT                   IVFKTGDKVSEEKIKRLYWAAKEVKAQYHRVIGNDKALEPGNADDILTIVIYNSPEEYQ
FT                   LNRQLYGYETNNGGIYIEETGTFFTYERTPEQSIYSLEELFRHEFTHYLQGRYEVPGLF
FT                   GRGDMYQNERLTWFQEGNAEFFAGSTRTNNVVPRKSIISGLSSDPASRYTAERTLFAKY
FT                   GSWDFYNYSFALQSYLYTHQFETFDKIQDLIRANDVKNYDAYRENLSKDLKLNEEYQEY
FT                   MQHLIDNQDKYNVPEVADDYLAEHTPKSLTAVEKEITETLPMKDAKMTKHSSQFFNTFT
FT                   LEGTYTGSVTKGDSEDWNAMSKKVNEALEQLAQKEWSGYKTVTAYFVNYGVNSSNQFEY
FT                   DVVFHGIAKDDEENKAPTVNINGPYNGLVKEGIQFKSDGSKDEDGKIVSYLWDFGDGST
FT                   SAEVNPVHVYESEGSYKVALIVKDDKGKESKSEITVTVKGGSLTESEPNNRPEEANRIG
FT                   LNTTIKGSLIGGDHTDVYTFNVASAKNIDISVLNEYGIGMTWVLHHESDMQNYAAYGQA
FT                   NGNHIEANFNAKPGKYYLYVYKYDNGDGTYELSVK"
FT   gene            561431..561979
FT                   /locus_tag="BAA_0638"
FT   CDS_pept        561431..561979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0638"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01957"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45988"
FT                   /protein_id="ACQ45988.1"
FT                   /translation="MVLFGYPLETIYLYGFIIATILTVIYIFFGDIFESIFSFGGGSVS
FT                   IVTLLLSFFAMLCGLSYIGEYLFSFNSILIFVAAFAISFIGVFIMKILILKPIAEAEQN
FT                   TVQRMDEFIGCKGEVITTIPTEGFGEVLISSQFGSNAIPAKTIGKKDISQGTEVIIEGV
FT                   QDGVLLVQNIAYSLKKPKL"
FT   gene            561992..563572
FT                   /locus_tag="BAA_0639"
FT   CDS_pept        561992..563572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0639"
FT                   /product="SPFH domain/band 7 family protein"
FT                   /note="identified by match to protein family HMM PF01145"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46665"
FT                   /protein_id="ACQ46665.1"
FT                   /translation="MTIPLIIGGVLLAILILLILVFITKYRTVGPDEALIVTGNWLGGG
FT                   KNVVTTDDGKKIKIIRGGGTFVVPIMQRAEPLSLLNYKLEVGTRDTYTKQGVPVTVNGV
FT                   SIIKVGSTIEEVSTAAEQYLGKETEELKVEAKEVLEGHLRAILSSMTVEDAYSNREQFA
FT                   QKVHEVASTDLKKMGLRIVSFTIKEIMDKNGYLDALGQPQIATVKRDATIANAEREKEA
FT                   RIEKARAEKEAKEAEYQRDAQIAEAEKHKELKVQSYKREQEQARADADLSYELQQAKAQ
FT                   QGVTEEQMRVKIIEREKQIELEEKEIARREKQYDAEVKKKADADRYAVEQSAEAEKVKQ
FT                   IKKADADQYKIEAEARARAEEVRVEGLAKAEIEKAQGQAKAEVQKAQGTAEADVIRLKG
FT                   LAEAEAKQKIAEAFELYGQAAIMDMVLKMLPSYAKEVASPLSNIDKITVVDTGGGGKNS
FT                   GAGKIAGYATDLMATMQETLKASSGIDLKELLEGFAGKGAVQQLSSDKPVVSVVEDEKK
FT                   EVEKDKDKE"
FT   gene            563809..565785
FT                   /locus_tag="BAA_0640"
FT   CDS_pept        563809..565785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0640"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="identified by match to protein family HMM PF00015;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02743"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46489"
FT                   /protein_id="ACQ46489.1"
FT                   /translation="MLQGKLRRSSLKAKLLVSFVIVLILPSIVIGWTSYQQAKTNFNET
FT                   ILQSAEDNVKILNNVINKEIDSKKVDAVYFTKLFNGVSYGTDQLQNVQNKLEEYNKLHP
FT                   EIEAIYTGSSTGQFIQSPSIQMPDGYNPTERDWYKEAAKKSGEVVITAPYKSSTTGNIV
FT                   ITIAKQNEDKSGVLGIDLIINDIVNTSKMVNIGKTGFVAIFDQSKHVIAHPTIKPGDKI
FT                   EEKVEKELYKQETGDFKFKLDGDDRNITFITNKQTGWKIAGIMPSKEIIEAANPIFYKT
FT                   LTVIGISLIIGGVLIYFIIASIISPLKQLVISSKKISEGDLTETITVHSKDEIGQLGES
FT                   FNEMAASLHHVISNINTSASHVAASSEELTASMKQTSEATEQITQAIEQVSSGAEIQTK
FT                   EVEEGATLLEEVTEGIQRVADSSSLVSTASMYTKKKAEDGGKLVEQTVNQMQLIHESVS
FT                   QSDKVIVLLDDKSKQIGAILEVIQHIAEQTNLLALNAAIEAARAGEQGRGFAIVADEVR
FT                   KLAEQSGQSSTEIGKLVKEIQFDIKETVSSMKLVGTEVQSGLVVANETKQSFAEILKST
FT                   DDTVVQIDNMVDVAKQMTVDARQVSASINEIAATIEENAASVQNIAGSSEEQLASVDEI
FT                   NAAAVHLSQMAEELQEMIGKFKV"
FT   gene            565943..567547
FT                   /locus_tag="BAA_0641"
FT   CDS_pept        565943..567547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0641"
FT                   /product="sensor histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="identified by match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46866"
FT                   /protein_id="ACQ46866.1"
FT                   /translation="MKFKKLKLQPRITLTISALILVVLMLTSYLFYYILSETVEEQIGK
FT                   RALHVAKTVAAIPEIKEAFQTENPASIIQPIAERIRMDTEADFIVVGNKEGIRYAHPER
FT                   DKIGEAMIGGDNKGVLLEGKSYVSKATGSLGPSLRGKVPIRNQENEIIGVVSVGFSMDD
FT                   IHGAVEVYGKRVFWITIIGLLIGVIGSIYLAGSIKRMMFGMEPEEISSLYEEHSTVIQS
FT                   VREGIIVIDQNGMISLVNQAAYDILALDEQRNIIGEFILDIIPNSTILDVLQTGEEQFD
FT                   RQLNIKGQAVIANRLPIKVKNKVTGVVSSLRLKSEMDQLTAELSQTKQYTEALRAQTHE
FT                   YNNLLYTLSGLIQLELYEDALELIHKETAVYQDFVQFIMKRIQNPWLGGILIGFYNRAR
FT                   ELKIEFMLDRESSLDKLSPPIESNYVVSILGNLITNAFEAIERNEEHDKKVRMFVTDIG
FT                   EEIVIEVEDSGQGIHDEVITSIFYKGFSTKEGEKRGYGLAKVKELVEDLNGSIAIEKGD
FT                   LGGALFIIALPKERGDL"
FT   gene            567547..567930
FT                   /pseudo
FT                   /locus_tag="BAA_0642"
FT                   /note="response regulator; this gene contains a frame shift
FT                   which may be the result of a sequencing error; identified
FT                   by match to protein family HMM PF00072"
FT   gene            567921..568238
FT                   /pseudo
FT                   /locus_tag="BAA_0643"
FT                   /note="transcriptional regulatory protein CitT; this gene
FT                   contains a frame shift which may be the result of a
FT                   sequencing error"
FT   gene            complement(568282..569586)
FT                   /locus_tag="BAA_0644"
FT   CDS_pept        complement(568282..569586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0644"
FT                   /product="citrate transporter, CitM family"
FT                   /note="identified by match to protein family HMM PF03600;
FT                   match to protein family HMM PF03606; match to protein
FT                   family HMM PF06808; match to protein family HMM TIGR00784"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47935"
FT                   /protein_id="ACQ47935.1"
FT                   /translation="MLALLGFAMVFVFMFLIMKKRMSALVALILIPITFALIGGFYADM
FT                   GPMMLEGIQKLAPTGIMLMFAILYFGIMIDSGLFDPVISRILKFVKGDPLKIVVGTAIL
FT                   TIIVSLDGDGTTTYMITVSAMYPLYKRLGMNPLILAGVVMLGAGVTNLTPWGGPTARVM
FT                   SALGLDASELFTPLIPGMIAGALWVVFVAYYLGKKERKRLGIMDVQYLKQMQTTDEQAA
FT                   TVEAAVHKRPKLLWINFLLTATLLVCLILEVMPLPVLFTIAFAIAVMLNYPNLEQQKER
FT                   IASHAGNVLAVVSLVFAAGIFTGILSGTKMVDAMAKSVVTLIPDALGPQLPIITALLSM
FT                   PFTFFMSNDAFYFGVLPILTKAAATYGISAAEMGRASLLRQPVHLLSPLVASTYLLVGM
FT                   AKVDFGEHQRFTLLWAVGTTMVMLITGILIGVIPI"
FT   gene            569838..570092
FT                   /locus_tag="BAA_0645"
FT   CDS_pept        569838..570092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0645"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48713"
FT                   /protein_id="ACQ48713.1"
FT                   /translation="MKTRMEEICSSYEGKVEEIFVNESSYVYEWEKLMMIRKNNGELEK
FT                   VAVGISGNIRLVNVVVGQQIHTDTLLVRLEDDLLITGCE"
FT   gene            570227..570730
FT                   /locus_tag="BAA_0646"
FT   CDS_pept        570227..570730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0646"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47786"
FT                   /protein_id="ACQ47786.1"
FT                   /translation="MRTKYVMFAICLFFVFTIVGCGKKQAEAVAIDEKHDKCDICQIGV
FT                   MDNQFATEIILENGKALKFDDIGCMYKWMEINPGEKTKEKFVRDYDSKDWISLEDATYV
FT                   YDKTITTPMAYNVISFKNKKDAENFVSNYKGKVLSYKELAEHKWEMNKEMMGNQKKGNH
FT                   GGHH"
FT   gene            571020..571889
FT                   /locus_tag="BAA_0647"
FT   CDS_pept        571020..571889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0647"
FT                   /product="ankyrin repeat domain protein"
FT                   /note="identified by match to protein family HMM PF00023"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47805"
FT                   /protein_id="ACQ47805.1"
FT                   /translation="MHSRRVIVCDGGMVKKTLSFIGAVVVRKQKILLCMLLGLLMTVVA
FT                   CDKQEEPESKPVHVKNEKKQEKHKEKEESKEEKSINLMDKQLLLSATLGDTETAMKLIQ
FT                   DGANINVEGDNGETPVLAATYQNHVETVKALIGAGANIEIKDEKQSNPLLYASREGYTD
FT                   IVKVLINAGVNTKETTKLGGTALISASERGHVEVVKELLEHTDIDVNYKNARGGTALVE
FT                   AIVLGNGSENHKKVIQMLIDHGADVSMANKENITPLQFAEKRGFKDIANMLRAAGANEV
FT                   VEPQQPVE"
FT   gene            572448..573014
FT                   /locus_tag="BAA_0648"
FT   CDS_pept        572448..573014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0648"
FT                   /product="putative glycerol uptake operon antiterminator
FT                   regulatory protein"
FT                   /note="identified by match to protein family HMM PF04309"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50901"
FT                   /protein_id="ACQ50901.1"
FT                   /translation="MFKEPYIAMIKDWKGYNTYKKLPKTVFLMTGSMLELPERVYELQK
FT                   HGHDVFLHCDFIQGLNTNTEEALSYIQDVIGAQGIISTKGSTIRNANKIGLKTIQRISI
FT                   VDTLSLTKSIENCKTTKPNAVEIMPGIMPSIIKQLAEEIEFPIIAGGLIQTREDAEIAI
FT                   RSGASAISTSHYEVWIQEEKRSAIL"
FT   gene            573011..574108
FT                   /locus_tag="BAA_0649"
FT   CDS_pept        573011..574108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0649"
FT                   /product="putative glycerol-3-phosphate ABC transporter,
FT                   ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF08402"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45962"
FT                   /protein_id="ACQ45962.1"
FT                   /translation="MIELKNVSKVYQNAEETAVKGVSVHIKKGEFFVLVGPSGCGKSTL
FT                   LRMIAGLEEISSGDLIINERVANDLEPKDRNLSMVFQNYALYPHLSVEENILFGLKVRK
FT                   VQKEERQKRLMEAVEMVGLKEYVKMKPGQLSGGQRQRVALARAIVSQAPICLMDEPLSN
FT                   LDAKLRAQMRIEIREIQQRLGITMIYVTHDQIEAMTMGDRIMVLNKGSVQQVGTPLDIY
FT                   NKPANEFVASFIGSPSMNMNDGEVDEEKGVLHIGQLQIPLSIGQLKQLPAGTVRVGMRP
FT                   EHIALSEEGQEVTLQSVEVLGNESILNFVINGTTWSAKVIGQLLLNKGDKVKLLFSEEK
FT                   LCFFHQNTNERLKVVAEEELKVVAK"
FT   gene            574108..575040
FT                   /locus_tag="BAA_0650"
FT   CDS_pept        574108..575040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0650"
FT                   /product="putative glycerol-3-phosphate ABC transporter,
FT                   permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49793"
FT                   /protein_id="ACQ49793.1"
FT                   /translation="MIEVSKLPVQTKVSKKKNLWGRTKDLRIGLLFLAPSILLFSIFLF
FT                   YPLFRTIYYSFYLTDIHGEANLFVGLENYQYLFSNPAFYKSIKSTLLFVLYTVPTSIIF
FT                   ALFLALIANGKVRGIGLFRVLFSSTMGISVAASAVIWLFLFHPSVGLFNNILASMNLPA
FT                   IAWLTSPDWALFSVSVTTVWVNTGFAFLVILGGLQNIDTSLYESASIDGASYLYKLRRV
FT                   TLPMLSPTLFFIVTVTLISAFQSFGQIDILTHGGPNDATNLIVYSIYKEAFVNHQFGTA
FT                   SAQAMVLFVFIFIATLLQFKFAERKVHYK"
FT   gene            575037..575858
FT                   /locus_tag="BAA_0651"
FT   CDS_pept        575037..575858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0651"
FT                   /product="putative glycerol-3-phosphate ABC transporter,
FT                   permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50658"
FT                   /protein_id="ACQ50658.1"
FT                   /translation="MIVKQWKQNFLLYMLLIISAVMVFFPVLYAFLISFMTPDDIQMRR
FT                   IFPTQFTFDNFINIFQKVPLFAYLYNSLVVSTVVMIGQLIVSSLAAYAFVFLQFKGRNL
FT                   IFFLFISTMLIPWEATMVPNFLTIQNFGWINSFAGMTVPFFATAFGIFLLRQHFMTLPN
FT                   ELKEAAFIEGIGNVRFLFSVVIPYCKTSFITLGVYSFLTTWNMYLWPLLVTTDETVRTV
FT                   QIGVKQLQSQEVATDWGSVMAGVTVIVIPTLILLFLGQKQLQQGLTKGAIK"
FT   gene            575880..577256
FT                   /locus_tag="BAA_0652"
FT   CDS_pept        575880..577256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0652"
FT                   /product="putative glycerol-3-phosphate ABC transporter,
FT                   glycerol-3-phosphate-binding protein"
FT                   /note="identified by match to protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48629"
FT                   /protein_id="ACQ48629.1"
FT                   /translation="MSLVKKGAALLMVATMALSSAACSNSKTEGKPEAQAKVAPVEKNG
FT                   DKTVIRFWHAMGGKTQGVLDGLVADYNKSQNKYEIKAEFQGTYEESLTKFKTMSATKEA
FT                   PALVQSSEITTKYMIDSKKITPIDSWIKKDKYDTSKLEKAITNYYSVDGKMYSMPFNSS
FT                   TPVLIYNKDAFAKAGLDPEKAPKTYAELQEAAKKLTIKEGGNVKQYGFSMLNYGWFFEE
FT                   LLATQGALYVDNENGRKDAAKKAVFNGKEGQKVFGMLDELNKAGALGKYGASWDDIRAA
FT                   FQSGQVAMYLDSSAGVRDLIDASKFNVGVSYIPYPEDSKQNGVVIGGASLWMTNMVSEE
FT                   TQQGAWDFMKYLTKPDVQAKWHTATGYFSINPDAYNEPLVKEQYEKYPQLKVTVDQLQA
FT                   TKQSPATQGALISVFPESRDAVVKALEAMYDGENSKEALDEAAKATDRAISISARTSQK
FT                   "
FT   gene            577672..578376
FT                   /locus_tag="BAA_0653"
FT   CDS_pept        577672..578376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0653"
FT                   /product="putative serine/threonine phosphatase"
FT                   /note="identified by match to protein family HMM PF00149"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49492"
FT                   /protein_id="ACQ49492.1"
FT                   /translation="MKRILVISDIHGEIEKFEQLLEEAQYDAKQDQLILLGDYVDRGPN
FT                   ARAVIEKVKELKEDGALVLKGNHEDMMIKALTTDEERSWNHWVKRNGGDKTLYSYGFVE
FT                   EDIMVNEKDFRKPILQSLVLEEHVKFIQKLDHYIETEEYIFVHAGVEPLKRVSECEPYT
FT                   LMWIRNEFHSEYSGEKVVVFGHTETKTLHGNDNCNVYFGNNRIIGIDGGAVYGGQLNCL
FT                   ELPSKKVYVVKS"
FT   gene            578526..579197
FT                   /locus_tag="BAA_0654"
FT   CDS_pept        578526..579197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0654"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46957"
FT                   /protein_id="ACQ46957.1"
FT                   /translation="MRLLVVEDNASLLESIVQILCDEFEVDTALNGEDGLFLALQNIYD
FT                   AILLDVMMPEMDGFEVIQKIRDEKIETPVLFLTARDSLEDRVKGLDFGGDDYIVKPFQA
FT                   PELKARIRALLRRSGSLTTKQTIRYKGIELFGKDKDVQVDGQSMKLTLKQYELLEYLVQ
FT                   NSGKILMREQIFDRVWGFDSDTTVAIVEVYVHHLRKKLEPFGYQKDIQTVRGIGYILKE
FT                   Q"
FT   gene            579194..580444
FT                   /locus_tag="BAA_0655"
FT   CDS_pept        579194..580444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0655"
FT                   /product="sensor histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48116"
FT                   /protein_id="ACQ48116.1"
FT                   /translation="MKKGSMFQKTRIRLTILNSLVFIILIGVLGSIIYSYTYKRIYSGV
FT                   NESIEKAVQHRKNADDKKLPKKIRGYPPIGDPRIMELTWLGNTVEIDIENGKRRFIFED
FT                   NLEKFSPKKLGTLQDIEVQGRYFRIFAFQKDAKIVQIARDITAEKEMLHTLFLILVIGC
FT                   SIGSLCAIGIGFFLAGRALVPIQNSWEKQQQFVSDASHELRTPLAVIQSKTDILFQSPS
FT                   ATIEEKAMDISTISKECRRLSKLVANLLLLARSDSNQIEMDKKIFELDKLLEEIVEPYK
FT                   EIASYQEKEMILKVEYDISFMGDRERIHQMMVILLDNAMKYTNEGGHIQIDCTQTNSSI
FT                   RIRVKDDGIGVKGEDIPKLFDRFYQGDKARSASEGAGLGLSIANWIVEKHYGKISVESQ
FT                   WGEGTCFEVILPKNQRI"
FT   gene            580651..581472
FT                   /locus_tag="BAA_0656"
FT   CDS_pept        580651..581472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0656"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45983"
FT                   /protein_id="ACQ45983.1"
FT                   /translation="MKKKMMMVFTIGVMSLSILGGASPSETSKGKTDYKQRSKEQLNNG
FT                   KIHAVHTEEKAEKLGIETTGKEQITLEKEIHETEVGREAKQLGISIEGKDVGTLSEEIY
FT                   ETKVEQEALKLGISIENTSIVNLINQINTIKINDEADKLGISTNGKEIEDIAEEIYGTK
FT                   VREEAGKLGISPKGKEIEVLAQEVYEQKVQEEAKEYHIDLYGKDIYQVLSEINEQKVLQ
FT                   MADELNMDKTNMNVQELAEKIKKDQPEKGKELNFVPVIRTDADAFYSYLTN"
FT   gene            581516..582232
FT                   /locus_tag="BAA_0657"
FT   CDS_pept        581516..582232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0657"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50208"
FT                   /protein_id="ACQ50208.1"
FT                   /translation="MALLGIAVWGIYTNGITKYVEKLTFFNIQSGKQVEFNRDEKVILS
FT                   NVPFIQQLPELDRGCEVTSLAMMLQYAGITVDKMKLANEIKKVDFMNDGVRGNPNEGFV
FT                   GNIYTFSESGYGVYHGPLFQLAKKYLPNKAVDLTGKSIEELYKSVKAGQPVVIITNATF
FT                   APLDEDEFTTWETNNGDVSITYNEHCVVLIGYDQESVYIRDPLKDSLDVKVPREKFEQA
FT                   WVQMGSQAISYVKRSK"
FT   gene            582486..584468
FT                   /locus_tag="BAA_0658"
FT   CDS_pept        582486..584468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0658"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="identified by match to protein family HMM PF00015;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02743"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47055"
FT                   /protein_id="ACQ47055.1"
FT                   /translation="MQKIFNWVKCMSIKKKLIISFFLILTIPGLIIGGVSYQTAKTNFE
FT                   QQITGKAKENISILNTVISQNIEEKFVDAAYFADILTEDTYPNGQEEIVRTKLAQYIKL
FT                   HPEVEGIYIGTQTGKFIREPFIQMSDGYNPTDRDWYKEAHENKGKVIVTAPYQSASTKN
FT                   MVVTIAKEVKDGKGVIGINLNLDNILKISKMINIGEKGYAVILDQNKQIVSHPSRKPGA
FT                   KVTDPWIKPIYEDKQRNVAYTEKDDKKNLIFATNEKTGWKVVGVMFDEEITQAANPVFY
FT                   KTFIVIAIAIVFGSVLIYFITKSITRPLRKIADSAYKISKGDLTEKITIHSKDDIGKLG
FT                   NSFNEMSASLQDVITQISFSAEHVAASAEELTASVQQANDATDQITIAMEQVSGGAESQ
FT                   SQGVEEGAATLQQVNTAIQDVNGSAESISISSLHARERAKEGEDLVEQTATQMQSISRS
FT                   VSESDAIIKLLDEKSKQVGAISEAIQNIATQTNLLALNAAIEAARAGEQGRGFAIVADE
FT                   VRKLAEQSGESSGEIANLIAEIKADIEHTVKAMDNVNGEVQQGLDVVTKTKVSFTEILS
FT                   STTHIVSQVNEMVETTKRIAGDANEVTNAIDEIAAAAEENTASMQSVAASTEEQVNSME
FT                   EISSASQNLAEMAEELQAMTSKFKV"
FT   gene            584547..586151
FT                   /locus_tag="BAA_0659"
FT   CDS_pept        584547..586151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0659"
FT                   /product="sensory box histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="identified by match to protein family HMM PF00989;
FT                   match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48828"
FT                   /protein_id="ACQ48828.1"
FT                   /translation="MKKRKRLWNLWKTITLLVCTVVIFSLLVTDILISHNVERTTEDSQ
FT                   AEKAKTIAHIVANDSIVIDGLIGKADTSAIQTYTNRILKNTGVQFIVVMDMNGIRKSHP
FT                   NPQKIGHHFIGGDEGPALKGKEHVSLAEGTLGISMRVFVPIFSETGEQLGAVAVGISAD
FT                   NVKERVKESRHIIYIGVGVGVLVGIIGAILLARHIKKSLFGLEPHRIAKILEERNTMLQ
FT                   SVKEGIIAVDKEARVTLINNEAKRLFKKSGLEEDFIGKDVELYMPNSRIKEVLQTGEVQ
FT                   LNEEQNIYGITIVTNRVPLYVKEEIVGAIATFRDKTEIRKLAEELTGIRLYAEALRAQS
FT                   HEFMNKMHVVLGLTHMKQYEELQKYISGMVSEHQYEIGGVMKRIKSPVFAGFLLGKLSY
FT                   AREKNIKLIISEDSYMPEIDDESITHELITIVGNLIDNALEAVTNCEKKRVEVKIQHED
FT                   ILTITVQDTGKGIQEKEIEELFTKGYSTKGDNRGYGLYLVKESIQRINGEIHMHSLVGK
FT                   GTTITIEIPKGRDERQI"
FT   gene            586148..586855
FT                   /locus_tag="BAA_0660"
FT   CDS_pept        586148..586855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0660"
FT                   /product="response regulator"
FT                   /note="identified by match to protein family HMM PF00072"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50024"
FT                   /protein_id="ACQ50024.1"
FT                   /translation="MIKVLIVEDDPMVAMLNTHYLEQVGGFELVQAVNSIKSAIEVLEE
FT                   SRIDLVLLDIFMPEETGFELLMYIRNQEKEIDIMMISAVHDMGSIKKALQYGVVDYLIK
FT                   PFTFERFKEALTIYREKLTFMKEQQKISQSELDSLILQKEKREPTVTKELPKGLTKQTL
FT                   QLIWQKIESLNGRVFTTDEMAQLVGISRVSIRKYVMFLTDIGVLENEMMYQHVGRPVSK
FT                   LRCVDQKKIEFYV"
FT   gene            586978..588324
FT                   /locus_tag="BAA_0661"
FT   CDS_pept        586978..588324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0661"
FT                   /product="citrate cation symporter family"
FT                   /note="identified by match to protein family HMM PF03390"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49304"
FT                   /protein_id="ACQ49304.1"
FT                   /translation="MGIQKNVEAVSFSEGNEVQRESFASKIMNVKIGVIPLPLYVVLAA
FT                   IIYGASVYNKLPADMIGGFAVIMIMGIFLGDIGMRIPILKNIGGPAILSLFIPSLLVFF
FT                   NWMNPASMEAATMLMKKSNFLYLYISCLVVGSILGMNRKVLVQGFVRMFIPLVVGTLAS
FT                   VAVGLLVGSLFGFEMKHTFFFIIVPIVSGGIGEGILPLSLAYSDILNESSATFVSQLIP
FT                   AAIIGNMFAIVSAGYMKRLGEKKPELSGNGVLVKTDNQAELLKEQNTEKPIDFSLMGAG
FT                   LLIACTFFIFGGFASKFIGIPGAIIMIFSAALVKYFKLMPAKMEQGAFHLYKFISKNLT
FT                   WPLMVGLGLLYIPLKDVAAVLSVGYVVVCASVVLTMVASGFLVGKVMKMYPVESAIVTG
FT                   CHSGLGGTGDVAILSASNRMELMPFAQISTRLGGAAMVVTATILLKMFS"
FT   gene            588384..589583
FT                   /locus_tag="BAA_0662"
FT   CDS_pept        588384..589583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0662"
FT                   /product="putative malate dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00390;
FT                   match to protein family HMM PF03949"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48503"
FT                   /protein_id="ACQ48503.1"
FT                   /translation="MLANQINERSLLLHKELVGKIEITSKVEVNSADDLSLTYTPGVAE
FT                   SCKAIAADEETVYDYTARGNMVAVVSDGTAVLGLGNIGPKAAMPVMEGKSILFKKFANV
FT                   DAFPLCLGTTDVDEIVTLVKNLEPTFAGINLEDIAAPRCFEIEKRLKEETNIPVFHDDQ
FT                   HGTAIVVLAAVINALKVVSKQMDHVKIVINGAGSAGIAIGKLLLKAGAQHITLVSLEGI
FT                   VCEGEAWMNEAQIEVSKKTNREHVRGTLKEAIHQADIFIGVSAPNVLTKELVQMMNEKA
FT                   IVFAMANPIPEIFPEDALEAGAAVVGTGRSDYANQVNNVLAFPGIFRGALDVRATDITE
FT                   EMKLAAAYGIANIITDEERNANYVIPNPLDKRVVPSVAEAVAKAAIDSGVAQIMKIPSY
FT                   "
FT   gene            complement(589879..590403)
FT                   /locus_tag="BAA_0663"
FT   CDS_pept        complement(589879..590403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0663"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48435"
FT                   /protein_id="ACQ48435.1"
FT                   /translation="MKKIGTMLLFSILIAGCTQAQPDLKKPKKEAIATSSTQVNAPSFF
FT                   HLSVLKDVNWEETPSFIQEKIPLKGIEEKIAMADSPIIANEKNEIMWYFLDPEMPTGKL
FT                   SIIALKQGSVTPTPLLFQQESSEPTWTTSNTIDSTTNELPLTMSLPSSGLWVLNIYVNE
FT                   KYYDQFVITAE"
FT   gene            complement(590519..591445)
FT                   /locus_tag="BAA_0664"
FT   CDS_pept        complement(590519..591445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0664"
FT                   /product="transporter, EamA family"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47696"
FT                   /protein_id="ACQ47696.1"
FT                   /translation="MNNSRRIGLIMIITGATLWGLSGPMIQWLFQHTNVSSVDFLTIRL
FT                   LLAGIFILSFLLIKKQNIFQIWKHPRYSIQLIIFSILGMLGAQYAFIETVHISNAVTAT
FT                   LFQFLGPVLITMYVAFEQRKSPAPIQLLAIITALTGTYFIITNGSIENIVLSKEAIIFG
FT                   LLTAIGFAFYTLHPASLIKECGTIVVIGWGMLIGGIALLICNRSFEWTQLSQTFTLKTF
FT                   SMLILIIISGTLSFLLYIGSLKYLAATETSILSSIEPLVAAIVSIAWLNESFGAYQLLG
FT                   GLCIVLSVIFLTMPQKENEATFSTEQI"
FT   gene            591566..592966
FT                   /locus_tag="BAA_0665"
FT   CDS_pept        591566..592966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0665"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00155;
FT                   match to protein family HMM PF00392"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46962"
FT                   /protein_id="ACQ46962.1"
FT                   /translation="MLELTPNLNMNSKKALYVQLYEYIKKEIKDGTISAFTKLPAKRKL
FT                   AGYLQVSKNTIEAAYEQLLAEGYIESISRKGYFVCEFEQMMDVEGSEAEVEEIPFREGN
FT                   YTFDFTQTGVDTNTFPFTTYRKLINDVWQPHNNDLLFLGHPQGELSLREEIANYLYESR
FT                   GVRCSASQIVLGAGTQILVKLLFQLLKGSNYAVENPGYHRKMVVFEQGEKKVQMLSLDR
FT                   DGICMADLENSDANVVFVTPSHQFPYGMIMPITRRTQLLQWAKKEEDRYIIEDDYDSEF
FT                   RYSGRPIPALQGLDTDGKVIYMGTLSKALLPSLRMSYIVLPKNLIKKYQKEYLFYTQSV
FT                   SRMDQEVIRKFLNEGYWEKHIHKMRVVYRKKRDRLVFEIEKYFSNRVEVIGEDSGLHIL
FT                   LKVHNGMREEELIKAAAKYSIKIYPFSTYYKDDTAPENVVLLGFAILSEEEIAKAIQLL
FT                   HKAWFTRK"
FT   gene            complement(593000..593512)
FT                   /locus_tag="BAA_0666"
FT   CDS_pept        complement(593000..593512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0666"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46300"
FT                   /protein_id="ACQ46300.1"
FT                   /translation="MDIHVLTKDEAEIYLELRVEGLKQNPEAFSSSYEDIINKECAIEY
FT                   KAQKLAQDENYTLGAFKDGKLIGVATLETKPYVKQEHKAKIGSVYVSPKARGLGAGKAL
FT                   IKECLELAKSLEVEQVMLDVVVGNDGAKKLYESLGFKTFGVQERSLKYNGQYWDEEHMV
FT                   LFLDENK"
FT   gene            complement(593659..595122)
FT                   /locus_tag="BAA_0667"
FT   CDS_pept        complement(593659..595122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0667"
FT                   /product="sensor histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50300"
FT                   /protein_id="ACQ50300.1"
FT                   /translation="MSKLSLKIGTYFLILALCIETIAFVSFYKSISKMRIEEETLALLE
FT                   KGNRYSNKITRRAKWSAHAQEKKNIERTEYNKNPNRPIYPDFDIADEAEHLVESESISN
FT                   SDIAIIITDNNGKIISTSEPVTKAMQKQLTCKTEPIPKDGLIVEKNWKKSKFITTVSPI
FT                   HTTEFQGKLYMLLKTSFLENMLLKLMKQFLIISVLTIILTTISVFIFSRVITEPLIKMK
FT                   RATEKMSKLNKPIQLGIKRNDELGSLAKTIEDLSSELTYMKKERGEFLASVAHELLTPL
FT                   TYMKGYAKVAKRDSLTKEEREEYLQIIEDETDSVTDLVQDLFMLVQLEQHQFVIKKQKV
FT                   LLRPFLERMVEKTKTTLTNKQMQLHVYCKDDLEVCIDERRMEQVMLNLLHNAYQHSLEN
FT                   TTITIRVLAETNSFTISVQDEGEGIPEGDIPHIFDRFYRVDKSRTRATGGKGIGLAVAK
FT                   EIVELHNGSILVTSKLDVGTNFIIELPFE"
FT   gene            complement(595188..595859)
FT                   /locus_tag="BAA_0668"
FT   CDS_pept        complement(595188..595859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0668"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49790"
FT                   /protein_id="ACQ49790.1"
FT                   /translation="MVKILLVDDEERMLRLLDLFLSPRGYFCMKATSGLEALKLIEQKD
FT                   FDIILLDVMMPNMDGWDTCYQIRQISNVPIIMLTARNQNYDMVKGLTMGADDYITKPFD
FT                   EHVLVARIEAILRRTKKDGFVSFNGIEWDKTKHTVTVYDEKISLTPIEFSLLRLFLQNT
FT                   NRAYSRDDLIEKIWGYETDIEYRTIDSHIRNIRDKLRKKGFPVENYLETVYKVGYKWKS
FT                   E"
FT   gene            596189..596311
FT                   /locus_tag="BAA_0669"
FT   CDS_pept        596189..596311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0669"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47907"
FT                   /protein_id="ACQ47907.1"
FT                   /translation="MNPKEEISKKEKQDRNTVVMCIAVSMVIIISCVNKIWGIL"
FT   gene            complement(596693..597199)
FT                   /locus_tag="BAA_0670"
FT   CDS_pept        complement(596693..597199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0670"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46148"
FT                   /protein_id="ACQ46148.1"
FT                   /translation="MEIRLLTTEDAEIYLKVCMEGLTKNPEAFSSSYEDVLKHEDPVAA
FT                   MAKRLSNPDKYTLGVFKDKDLIGIATLETKPFIKQEHKAKIGSVFVSPKARGLGAGRAL
FT                   IKAIIENADKLHVEQLMLDVVVGNDAAKKLYESLGFQTYGVQERSLKHNGQYWDEEHMV
FT                   LFLND"
FT   gene            complement(597428..598234)
FT                   /gene="fdhD1"
FT                   /locus_tag="BAA_0671"
FT   CDS_pept        complement(597428..598234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdhD1"
FT                   /locus_tag="BAA_0671"
FT                   /product="formate dehydrogenase accessory protein FdhD"
FT                   /note="identified by match to protein family HMM PF02634;
FT                   match to protein family HMM TIGR00129"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49392"
FT                   /protein_id="ACQ49392.1"
FT                   /translation="MGPTQETYTIVRYHSGTFSKQIDEIVTESPITIKLNGEEYVTVVC
FT                   TPNYIEDMVIGFLISEGIISSYKDVGELWVQKDNGIVHVTSSKVNPLYQNLYNKRYITS
FT                   CCGKGRQGFIFANDAAKAKNLHNIHVTITPEECFHLMNTLQQSSTTFRQTGGVHNTALC
FT                   DRNNILLSRMDIGRHNALDKIYGHCLRNDISVKGKIIAFSGRISSEILLKVSKIGCEIV
FT                   LSKSAPTKLALQLAHDLGITVVGFIRNESCNIYTHPHRIDGYQSNN"
FT   gene            598538..601474
FT                   /locus_tag="BAA_0672"
FT   CDS_pept        598538..601474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0672"
FT                   /product="molybdopterin oxidoreductase family protein"
FT                   /note="identified by match to protein family HMM PF00037;
FT                   match to protein family HMM PF00111; match to protein
FT                   family HMM PF00384; match to protein family HMM PF01568;
FT                   match to protein family HMM PF04879; match to protein
FT                   family HMM TIGR01591"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47500"
FT                   /protein_id="ACQ47500.1"
FT                   /translation="MAEQTVRVTVDGKEFSASGEKTILQLFNESNLEHPQICHVPEVDP
FT                   IQTCDTCIVEVDGKLMRACSTQIENGMHIERQSQRAKEAQTEAMDRILENHLLYCTVCD
FT                   NNNGNCKVHNTVHMMGIEEQKYPYEPKVSACEVDMSHPFYRYDPNQCIACGQCVEVCQN
FT                   LQVNETISIDWSLDRPRVIWDHGVSINDSSCVSCGQCVTVCPCNALMEKSMLGEAGFMT
FT                   GLKPDVLDPMIDFVKDVEPGYSSILAVSEVEAAMRKTKVNKTKTVCTFCGVGCSFEVWT
FT                   KDRHILKVQPVSDAPVNGISTCVKGKFGWDFVNSEDRITKPLIRQGDMFVEASWEEALE
FT                   VVASNMQHIKSAYGSDAFGFISSSKVTNEENYLMQKLARQIYGTNNVDNCSRYCQSPAT
FT                   DGLFKTVGMGGDAGTVKDIAEAGLVIIVGANPTEGHPVLATRVKRAHKLHEQKLIVADL
FT                   RKHEMAERADLFIHPRQGTDYVWLAGITKYIIDQDWHDKKFIAENVKNFDEYSKMVEKY
FT                   TLDYTEKITGISKENLKEMARMVYEADGTCVLWGMGVTQNTGGSTTSAAISNLLLVTGN
FT                   YRRPGAGAYPLRGHNNVQGACDMATLPNWLPGYQAVSDDTLRAKFEKAYGTTIPKAPGL
FT                   NNIAMLLAAEEGKLRGMYVMGEEMALVDSNANHVQHILANLDFLVVQDMFLSKTARFAD
FT                   VILPAAPSLEKEGTFTNTERRIQRLYEVLKPLGDSKPDWWILQKVARALGGDWNYESPS
FT                   EIMDEIASLAPLYSQATYDRLEGWNSLCWGSHDGSDTPLLYVDGFNFPDKLARLSLDEW
FT                   IPPVVAPDEYDLLLNNGRMLEHFHEGNMTNKSAGILSKVSEVFVEISPELAIERNVKDG
FT                   GLVELASPFGKIKVQALITDRVTGKELYLPMHATINEEAINILTGTATDLYTCTPAYKQ
FT                   TMVKMRVLREKGNRPLPPSNPRDKNRNPQNGVEIEQKWQRKQYVSLVD"
FT   gene            601487..601612
FT                   /pseudo
FT                   /locus_tag="BAA_0673"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   premature stop which may be the result of a sequencing
FT                   error"
FT   gene            601625..601969
FT                   /pseudo
FT                   /locus_tag="BAA_0674"
FT                   /note="conserved protein YrhD; this gene contains a
FT                   premature stop which may be the result of a sequencing
FT                   error; identified by match to protein family HMM PF07849"
FT   gene            602126..603997
FT                   /locus_tag="BAA_0675"
FT   CDS_pept        602126..603997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0675"
FT                   /product="glycerophosphoryl diester phosphodiesterase
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF03009"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47175"
FT                   /protein_id="ACQ47175.1"
FT                   /translation="MQHRKRLSIPGVMGHSFQTVKFAFWNVLTFQLAYKLLAAIVFVPL
FT                   FGIIFNKLLYFGGYANATNDELLAFLKTPYGILAIVILSLLALFLIFTEFAVLIIISYF
FT                   AHKRQKVRLRPILYKTVTYLPTLFTYCLPGFILYAVVLLPLLNMGYETALIPQIQIPNF
FT                   ITGELFKTTMGQVGYYTFFAVVAYLNLRWIFVLPIVVLEQKPFRVAARKSAKLVKESFF
FT                   KVLFFLVGFFISIGIVYVLFLGIYLLCLWGVYEFTNPKGTFALLAESTMSVFLTSTLYL
FT                   FSFIVTPFYIMAITRLYLQKVPVEDVLLEEGLDYSKTKADKCFFQKHRWKFIGVYIVGI
FT                   ITAGMVVAFIVTFITNTYKEPIIMAHRGYISKGVENTKEALQGAIDAKADYAEIDVLQT
FT                   KDGELAVIHDLKLKRLANANVHVSDLTMDELRQLTLSQDGFSGQISTLDEIIKLAKGKI
FT                   KLNIEVKLHGGEKDFVNKVLKTIKDNEFEKQCVIQTLHYPLIKEFKRANPNIKVGYILY
FT                   ASRAHLKNVKADFYVAEEYMLNKKLVKEARKLNKPIYVWTVNDMESLKGYYKLNVDGII
FT                   TDYPEDARETIKMLKEQEEEESDLFDKITETTDDLFSKLFISYPAAS"
FT   gene            604365..605498
FT                   /gene="ald1"
FT                   /locus_tag="BAA_0676"
FT   CDS_pept        604365..605498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ald1"
FT                   /locus_tag="BAA_0676"
FT                   /product="alanine dehydrogenase"
FT                   /EC_number="1.4.1.1"
FT                   /note="identified by match to protein family HMM PF01262;
FT                   match to protein family HMM PF01488; match to protein
FT                   family HMM PF05222; match to protein family HMM TIGR00518"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46596"
FT                   /protein_id="ACQ46596.1"
FT                   /translation="MRIGVPAEIKNNENRVAMTPAGVVHLIRNNHEVFIQKGAGLGSGF
FT                   TDAQYVEAGAKIVDTAEEAWNMEMVMKVKEPIESEYKHFSEGLILFTYLHLAPEPELTK
FT                   ALIEKKVVSIAYETVQLENRSLPLLAPMSEVAGRMAAQIGAQFLEKNKGGKGILLAGVP
FT                   GVKRGKVTIIGGGQAGTNAAKIAVGLGADVTIIDLSAERLRQLDDIFGNQVKTLMSNPY
FT                   NIAEAVKESDLVIGAVLIPGAKAPKLVTEEMIKSMEPGSVVVDIAIDQGGIFETTDRIT
FT                   THDNPTYEKHGVVHYAVANMPGAVPRTSTLALTNVTVPYAVQIANKGYKEACLGNSALL
FT                   KGINTLDGYVTFEAVAEAHGVEYKGAKELLEAETVSC"
FT   gene            605602..607017
FT                   /locus_tag="BAA_0677"
FT   CDS_pept        605602..607017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0677"
FT                   /product="amino acid permease family protein"
FT                   /note="identified by match to protein family HMM PF00324;
FT                   match to protein family HMM PF03845"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50339"
FT                   /protein_id="ACQ50339.1"
FT                   /translation="MANLFKKKSVTQLLGESKSKTLTKTLGAFDLTMLGIGAIIGTGVL
FT                   VLTGLVAARDAGPAVIFSFMIAAIVCGFAALCYAEVASTLPVSGSVYTYSYATIGEFIA
FT                   HLMGWTLLSVYVVTTAAVAGGWTGYFNNLVSGFGLEIPTELLKIPSQGGIVNLPAVVIT
FT                   LVLTWLLSRGTKESKRVNNIMVLIKIGIVILFIAVGAFYVQPENWTPFAPYGISGIFAG
FT                   GAAVFFAFLGFDALATSAEEVKNPQRDLPIGIIASLVICTIIYVVVCLVMTGMVSYKEL
FT                   DVPEAMAYVLEVVGQDKVAGVIAVGAVIGIMAVIFAYIYATTRVFFAMSRDGLLPKSFA
FT                   KINKKTEAPVFSTWLTGIGSALIAGFIDLKELSNLANIGALLTFAMVGVSVIILRKTHP
FT                   NLKRGFMVPLVPTLPLISIACCLFLMFNLPLTTWIYFGIWLAIGVVVYFVYSKKHSHLK
FT                   DDGSSQDNLEQAN"
FT   gene            607284..607661
FT                   /locus_tag="BAA_0678"
FT   CDS_pept        607284..607661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0678"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="identified by match to protein family HMM PF01022"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0678"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46950"
FT                   /protein_id="ACQ46950.1"
FT                   /translation="MAGNKVETPQETCSQTIIHEEVVDQVKQTIPTDESLSKVAELFKV
FT                   LGDRTRTRILHALFEAEMCVCDLAYLLGMTQSSISHQLRVLKQAKLVKNRKEGKVVYYS
FT                   LADQHVIHIFEQAFEHVNEEE"
FT   gene            607686..610052
FT                   /locus_tag="BAA_0679"
FT   CDS_pept        607686..610052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0679"
FT                   /product="heavy metal-transporting ATPase"
FT                   /note="identified by match to protein family HMM PF00122;
FT                   match to protein family HMM PF00403; match to protein
FT                   family HMM PF00702; match to protein family HMM TIGR01494;
FT                   match to protein family HMM TIGR01512; match to protein
FT                   family HMM TIGR01525"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0679"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47817"
FT                   /protein_id="ACQ47817.1"
FT                   /translation="MAEALVKKKLMLEGLDCANCAMKIEKGVGNIEGVNSCSVNFATKT
FT                   MVLETAQNKESEVVTEAKKLVTKLEPHIKVQEEKNTKVAKEVFILEGLDCANCAMKIEN
FT                   KVKEMPTVSAATVDFVSKKLRVEVANKRELEATVANITNVVQKLEPDVKVVREEKGGHD
FT                   HGHSHDHGEANVKKMVGRLVVGGILTAIAALAGLPQMITIPLFVLAYLLIGGDIVWRAV
FT                   RNITRGQVFDENFLMAIATLGAFAIQQYPEAVAVMLFYQVGELFQSIAVNRSRKSITSL
FT                   MDIRPDYANVKIGNETKQVSPEDVQIGDYIIVKPGEKVPLDGKVVEGTSMVDTSALTGE
FT                   SVPREVEVGNDVLSGFVNQNGVLTIEVTKEFGESTVSKILDLVQNASSKKAPTENFITK
FT                   FARYYTPVVVITAAIMAFIPPLILEGATFSDWIYRALVFLVISCPCALVVSIPLGFFGG
FT                   IGGASKSGVLVKGSNYLEALNDVKYIVFDKTGTLTKGVFKVTKMEPSEGITNEELLEYA
FT                   AFAEVYSNHPIAQSIRNAYRKSIDEKIIDDYNEISGHGTVVKVQGKEIFAGNAKLMRKE
FT                   NITFKQPETVGTLVHVAVDGKYAGYIVISDEVKEDSKQAIQKLKELGIKKTVMLTGDAK
FT                   LVGEAVGKELGLDEVHAELLPQQKVEEIEKIDAAKHGKEKVAFVGDGINDTPVLARADV
FT                   GIAMGGLGSDAAIEAADIVIMTDEPSKIATAVNIAKRTRRIVWQNIIFALGVKGLVLLL
FT                   GAFGIATMWEAVFSDVGVTLLAVLNAMRVLRVKDL"
FT   gene            complement(610256..611719)
FT                   /locus_tag="BAA_0680"
FT   CDS_pept        complement(610256..611719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0680"
FT                   /product="putative nicotinate phosphoribosyltransferase"
FT                   /note="identified by match to protein family HMM PF04095;
FT                   match to protein family HMM TIGR01513"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49481"
FT                   /protein_id="ACQ49481.1"
FT                   /translation="MTYYKDDSYALHTDLYQINMAYTYWKDGIHNRRSVFDLYFRKLPF
FT                   ENGYAVFAGLEKIVEYIENFSFTESDIAYLAELQFEEEFLHYLQNMKFTGTVRSMQEGE
FT                   VVFNNEPLLRVDAPLGEAQIIETALLNIVNYQTLIATKAARMKHAANNDELLEFGTRRA
FT                   HEFDAALWGTRAAFIGGFSSTSNVRAGKRFGIPVAGTHAHSFVQAYRDEYVAFKKYAET
FT                   HKKCVFLVDTYDTLKSGVPNAIRVAKEFGDRIDFYGIRLDSGDMAYLSKKARKLLDEAG
FT                   FTNTKIIASSDLDEYTIMHLKSQGAKINVWGVGTKLITSFEQPALGAVYKLVAIEDTDG
FT                   KLNDTIKISSNPEKITTPGLKRIYRIINRVNDHAEGDYIALDYEEPGKEERLKMFHPVH
FT                   TYISKFVTNFEARELHKDIFVNGERTYELPSILDIQKYNEQSLSLFWEEYMRTLNPEEY
FT                   PVDLSQECWDHKMNYIQTVREQVEKNIQK"
FT   gene            611920..613188
FT                   /locus_tag="BAA_0681"
FT   CDS_pept        611920..613188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0681"
FT                   /product="transcriptional regulator/TPR domain protein"
FT                   /note="identified by match to protein family HMM PF00515;
FT                   match to protein family HMM PF01381; match to protein
FT                   family HMM PF07719"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0681"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49212"
FT                   /protein_id="ACQ49212.1"
FT                   /translation="MQQTLEKIGKQVFYKRLQQKMTQEELCQGICSVSYLSKIENGKIE
FT                   ASEEILQLLCTRLEIAVTDLRDVEEDVKGKLDEWLNALVHLDKPQVERIYEELQSEMKH
FT                   VLDFEIINYYKLLYTRYLIMKRDIATLEEELDRLKKVYKKYSPFQKLLYMYSRGLLCCL
FT                   QYRWKEGLDYLLKTEVMAKEQGYHETGLYYNIALVYTHLDIHHLAIHFVNIALEGFRSE
FT                   YKFRNIINCQILIAVSYTEKGQYEEALKMYESILRESASFADKDVLLAITLSNMGSIYY
FT                   KKGKYQQAKKYYLDSLQLQKQIDLNYLDTIYEMAVVCIKLEELEEAKALIDKGIDAAKQ
FT                   EERFNAKLYLLLMLRYKYFEEAKDYKAFLENEAIPLYKSAGNKIELKKVYIELAEHFSS
FT                   LSRFEESNRYYRLVIDLMNDKEE"
FT   gene            613191..613322
FT                   /locus_tag="BAA_0682"
FT   CDS_pept        613191..613322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0682"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50914"
FT                   /protein_id="ACQ50914.1"
FT                   /translation="MKKMVFGALAFIVTLTVAGGIHQYSSKPDIVGQEAKTVQQINS"
FT   gene            613489..615189
FT                   /locus_tag="BAA_0683"
FT   CDS_pept        613489..615189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0683"
FT                   /product="neutral protease Npr599"
FT                   /EC_number="3.4.24.-"
FT                   /note="identified by match to protein family HMM PF01447;
FT                   match to protein family HMM PF02868; match to protein
FT                   family HMM PF03413; match to protein family HMM PF07504"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0683"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50630"
FT                   /protein_id="ACQ50630.1"
FT                   /translation="MKKKSLALVLATGMAVTTFGGTGSAFADSKNVLSTKKYNETVQSP
FT                   EFISGDLTEATGKKAESVVFDYLNAAKGDYKLGEKSAQDSFKVKQAKKDAVTDSTVLRL
FT                   QQVYEGVPVWGSTQVAHVSKDGSLKVLSGTVAPDLDKKEKLKNKNKIEGAKAIEIAQKD
FT                   LGVTPKYEVEPKADLYVYQNGEETTYAYVVNLNFLEPSPGNYYYFIEADSGKVLNKYNK
FT                   LDHVANEDKSPVKQEAPKQEAKPAVKPVTGTNAVGTGKGVLGDTKSLNTTLSASSYYLQ
FT                   DNTRGATIFTYDAKNRSTLPGTLWVDADNVFNAAYDAAAVDAHYYAGRTYDYYKATFNR
FT                   NSINDAGAPLKSTVHYGSRYNNAFWNGSQMVYGDGDGVTFTSLSGGIDVIGHELTHAVT
FT                   EYSSDLIYQNESGALNEAISDVFGTLVEYYDNRNPDWEIGEDIYTPGKAGDALRSMSDP
FT                   TKYGDPDHYSKRYTGTGDNGGVHTNSGIINKAAYLLANGGTHYGVTVNGIGKDKVGAIY
FT                   YRANTQYFTQSTTFSQARAGLVQAAADLYGASSAEVAAVKQSYSAVGVN"
FT   gene            complement(615252..615800)
FT                   /locus_tag="BAA_0684"
FT   CDS_pept        complement(615252..615800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0684"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF09335"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0684"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49821"
FT                   /protein_id="ACQ49821.1"
FT                   /translation="MAETIQNFLTDYYSIAIPLSILINIIISLLGFIPSIFLTAINIQL
FT                   FGVTNGTIISIAGEALGAIISFYIYRIGLQKFTHSKVNKYPKVERLLYVKGKEAFLLVL
FT                   SFRLIPFIPSSIVTLFAALGKMSLLSFSIASTIGKIPALLIEVYSAYHVINGTNEAKWI
FT                   VTIAGAIGLFYLWKKWRKK"
FT   gene            616179..616697
FT                   /locus_tag="BAA_0685"
FT   CDS_pept        616179..616697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0685"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0685"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46990"
FT                   /protein_id="ACQ46990.1"
FT                   /translation="MKRISSLFLSSLLALMLILSGCAGKEQKTEKQTGNQSTSVEKISD
FT                   NILDEMEGPPKNGHTIERHVGKSEEDLKNRLKTDKVSAASTYYDKETATKAVKDSLKQH
FT                   DKEIQDWLKNSKEARLVLNTTHSFPVGKTVIKKNMNVKDKLVKTVTVLARDKSGDLGYK
FT                   IITSYPSDK"
FT   gene            616713..616985
FT                   /locus_tag="BAA_0686"
FT   CDS_pept        616713..616985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0686"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0686"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46292"
FT                   /protein_id="ACQ46292.1"
FT                   /translation="MYTTLQYFLKSYCTLSIHEDEIVGVMEEFIEQEDEEIVLKLRDEL
FT                   LYMKKKDAWEEACVLAARQGNRMWSLEETKDHLTTFLVLLQKKKA"
FT   gene            complement(617034..618296)
FT                   /locus_tag="BAA_0687"
FT   CDS_pept        complement(617034..618296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0687"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04294"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0687"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49299"
FT                   /protein_id="ACQ49299.1"
FT                   /translation="MKLSKILIGSAIAGGILLCVGGVSGYQYVSKLNNQLDTTALPNTT
FT                   FEGISLDGKNKKDIQAIINQKITELDQKSLTYIFQNDKQTYTWKDLGINYKEKDIIDKI
FT                   FKEQEGNAINRYKMRKQAENGELKRDYKLTPQLNTTAYESFMKDKYNKTLKNPVNAELS
FT                   IEGTTVNISQSQNGEKIDKGKLTDLTKQAITSGTSDITLPVTLLKPERSTEDIQKMGIK
FT                   EVIAEYSTPMAGRNGNQSFNVNKSANTLSGVIVAPDETFSFNGRVGVTDAAHGYKSAAV
FT                   YSQGKVIQSAGGGVCQVSSTLYSAALRADLGIVSRSNHSMPVNYLPLGQDAAVADYGPD
FT                   LKFKNNTGNHIYIQAFSNGGSITTRIFGTNTGKNVEVSSQVISRTNDKITAVTYKKVTQ
FT                   NGEVISNGQISKSVYKSAPKQ"
FT   gene            complement(618531..619547)
FT                   /locus_tag="BAA_0688"
FT   CDS_pept        complement(618531..619547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0688"
FT                   /product="transcription antiterminator, LytR family"
FT                   /note="identified by match to protein family HMM PF03816;
FT                   match to protein family HMM TIGR00350"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0688"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48729"
FT                   /protein_id="ACQ48729.1"
FT                   /translation="MMKSDMNKDTRAKKGRSKKKRLLWFLLIPLLIIALGAGGYSFHIY
FT                   SKAKSILSNAYSELGRGDKSSKREKAVKPMTDNISILIMGVDESDIRDKNYGKATRTDA
FT                   LLLATINKNDKSVKLVSIPRDSRVYIKSREKYDKITHAHVFGGVDSTIDTVENFLDVPV
FT                   DYYVKFNFKSFIKIVDSLGGITVDVPVEFTEQNSKDEADAIHLKKGRQHLNGEEALALA
FT                   RTRHIDSDYMRGQRQQLVLEAIAEKALSLNSINKIGGLLDAVDKDLKTNLTFDDMMTIA
FT                   KNSMGSNLKMDKLQVEGTDKYIGGIYYYVPNEKSVNNISTTLQEHLGVTNKNEHKKL"
FT   gene            complement(619808..620986)
FT                   /locus_tag="BAA_0689"
FT   CDS_pept        complement(619808..620986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0689"
FT                   /product="nucleoside transporter, NupC family"
FT                   /note="identified by match to protein family HMM PF01773;
FT                   match to protein family HMM PF07662; match to protein
FT                   family HMM PF07670; match to protein family HMM TIGR00804"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0689"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47980"
FT                   /protein_id="ACQ47980.1"
FT                   /translation="MKFITFFLGLIVVFFLAYIASNNKKHIKFKPIFIMLLIQLILTYL
FT                   LLNTEIGLILIRVISSLFTKLLEYAADGINFVFGGLANKGEMPFFLTVLLPIVFISVLI
FT                   GILQHFKILPFFIHWIGYFLSKINGLGKLESYNAIASAIVGQSEVFITVKKQLAQIPKH
FT                   RLYTLCASAMSTVSMSIVGAYMTMIEPKYVVTALVLNLFSGFIIVLIINPYDVKDDEDI
FT                   LEIKGEKQSFFEMLGEYILDGFRVAIVVGAMLIGFVALISCINDLFLIIFGITFQQLIG
FT                   YVFAPIAFLIGVPSSEIVAAGSIMATKLVTNEFVAMMDLSKISNSLSPRTVGIISVFLV
FT                   SFANFSSIGIISGAVKGLNEEQGNVVARFGLKLLYGATLVSILSAIIVSIML"
FT   gene            621078..621464
FT                   /locus_tag="BAA_0690"
FT   CDS_pept        621078..621464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0690"
FT                   /product="glyoxylase family protein"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0690"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47600"
FT                   /protein_id="ACQ47600.1"
FT                   /translation="MNISRVHHVAIICSNYEVSKDFYTRILGFKAINEVYRKERDSYKL
FT                   DLCVGKEYQIELFSFPNPPKRPSFPEAAGLRHLAFAVTNIEEAVQDLSQCGVETEAIRI
FT                   DEITGKKFVFFQDPDGLPLELYEV"
FT   gene            621572..622657
FT                   /locus_tag="BAA_0691"
FT   CDS_pept        621572..622657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0691"
FT                   /product="CBS domain protein"
FT                   /note="identified by match to protein family HMM PF00571;
FT                   match to protein family HMM PF01595"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0691"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46853"
FT                   /protein_id="ACQ46853.1"
FT                   /translation="MDILKLLMVAILIGLTAFFVAVEFAIIKVRSSRIDQLVSEKRRGA
FT                   LAAKKVTSNLDEYLSACQLGITITALGLGWLGEPTIKHLLEPLFLKLNLSPAIASTVSF
FT                   IIAFAVITFLHVVIGELAPKTFAIQRAEQVSLLLSKPLIYFYRIMYPFIWALNGSARLV
FT                   TGLFGLHPASEHEVAHSEEELRLILSESYESGEINQREFKYVNNIFEFDNRVAKEIMVP
FT                   RTEVIGLYEDEPFETHIKIIAQEKYTRYPVFGEDKDEIIGMVNVKDLFIRYMDGNRDEE
FT                   CSITPYTRPVIEVLENIPIHDLLLQMQRKHIPLAVLYDEYGGTAGIVTLEDILEEIVGE
FT                   IRDEYDEDEHPPIEHISEGGH"
FT   gene            622741..624174
FT                   /gene="aspA1"
FT                   /locus_tag="BAA_0692"
FT   CDS_pept        622741..624174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspA1"
FT                   /locus_tag="BAA_0692"
FT                   /product="aspartate ammonia-lyase"
FT                   /EC_number="4.3.1.1"
FT                   /note="identified by match to protein family HMM PF00206;
FT                   match to protein family HMM TIGR00839"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0692"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48868"
FT                   /protein_id="ACQ48868.1"
FT                   /translation="MIATKDIRIEKDFLGEKEVPSIAYYGVQTLRAVENFPITGYRIHP
FT                   SLITAMAIVKKAAALANMDTGYLAKDIGHEIAEAAQEIVDGKFHDQFIVDPIQGGAGTS
FT                   INMNTNEVIANRALERMGYEKGEYAKISPNTHVNMAQSTNDAFPTGIHIATLMRLEELL
FT                   ITMEELHAAFRAKAKEFDHVIKMGRTHLQDAVPIRLGQEFEAYSRVLARDIKRIKQSRQ
FT                   HLYEVNMGATAVGTGLNANPTYIEQVVKHLRTFSGFPLVGAEHLVDATQNTDAYTEVSA
FT                   ALKVCMMNMSKIANDLRIMASGPRVGLAEIQLPARQPGSSIMPGKVNPVMAEVINQVAF
FT                   QVIGNDHTICLASEAGQLELNVMEPVLVFNLIQSISIMNNGFRVFREYCIKGITANEEL
FT                   LKQYVEKSVGIITAVNPHIGYEAASRIAREAIETGKSVRELCLEHGVLTEEELDIILDP
FT                   FEMTHPEIAGASLLKDKKM"
FT   gene            complement(624214..625833)
FT                   /gene="lldP1"
FT                   /locus_tag="BAA_0693"
FT   CDS_pept        complement(624214..625833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lldP1"
FT                   /locus_tag="BAA_0693"
FT                   /product="L-lactate permease"
FT                   /note="identified by match to protein family HMM PF02652;
FT                   match to protein family HMM TIGR00795"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0693"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50888"
FT                   /protein_id="ACQ50888.1"
FT                   /translation="MSTWTQIYDPLNNIWLSALIAALPIFCFIICLVGFKMKGYMAGLY
FT                   SVIVAIILAIFVYKMPTTAAVASAGFGVLSGFYPICTIVIAAIFLYKLTVKTEQFNVIR
FT                   DSISSITNDQRLQVLLIAYSFGAFLEGAAGFGVPVAITAALLVGMGFNPLKAAGICLVA
FT                   NIAGGAMGAMGIPVTVPAQLTGIDALTVGRQAVYILPFISIVLPFLLVSMVDGFKGIKE
FT                   TWQGILVSGVSFAITQFVVTYFLGAELTNIFAAVVSMVALALFLRVWQPKSSAKEEKQE
FT                   EKESHTFNQILYAWSPFVFLTAFVTIFNLKPIKALFAPDGPLANLVFNIQFPGLHNQVI
FT                   KTAPITKADTPFAAIFKLDVFSSTTTAIVLAIIVSLIVYRVNGKMIKELMIETIKELKV
FT                   PVYTICSVIALAYVENYSGMSSTLGLAFSSTGNAFPILSPILGWIGVFITGSVVSSGSL
FT                   FAPLQAVTADQLNIVPSTLVSLNVVGGTIAKMVSPQSVAVACAAVGLVGKESALFKTVM
FT                   KYSLIFLAIISLLQLNAVFNIF"
FT   gene            626670..626957
FT                   /locus_tag="BAA_0694"
FT   CDS_pept        626670..626957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0694"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="identified by match to protein family HMM PF01022"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0694"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47437"
FT                   /protein_id="ACQ47437.1"
FT                   /translation="MSQNQFECRISEEDVQMLRALAHPLRLRLVMELMQRGTCNVTQLQ
FT                   EVLEIPQSTVSQHLTKLKQNKVVRFERRGLEVYYQIHNDKVSEVVKTLFS"
FT   gene            627072..627251
FT                   /locus_tag="BAA_0695"
FT   CDS_pept        627072..627251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0695"
FT                   /product="small acid-soluble spore protein, H-type"
FT                   /note="identified by match to protein family HMM PF08141;
FT                   match to protein family HMM TIGR02861"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49424"
FT                   /protein_id="ACQ49424.1"
FT                   /translation="MDVKRVKQILSSSSRIDVTYEGVPVWIESCDEQSGVAQVYDVSNP
FT                   GESVHVHVNALEEK"
FT   gene            complement(627292..628650)
FT                   /locus_tag="BAA_0696"
FT   CDS_pept        complement(627292..628650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0696"
FT                   /product="proton/peptide symporter family protein"
FT                   /note="identified by match to protein family HMM PF00854;
FT                   match to protein family HMM PF07690; match to protein
FT                   family HMM TIGR00924"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0696"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45972"
FT                   /protein_id="ACQ45972.1"
FT                   /translation="MDAALKLDKAGEQQSPKKHPPGLYLLFLTEMWERFSYYGMRGLLV
FT                   LYLTTAAVSGGLGFDKAFAVQLYGTFTAAVYFMPIIGGWLTDHYITRRHAITLGGIIMA
FT                   IGNFVLFSMNTKTGLFLGLVLLVIGNGFFKPNISTLLGELYEENDSRRDSAFTIFYMGI
FT                   NVGAFFAPLICGFLAEDFFKTSVDGVMVMGYKYGFLAACIGMIIGQIVFNLLAPRYLGT
FT                   AGTTVIGKKTKNQPAVEKKPLTKQEKNRTWAIVILTCFVVFFWAGFEQAGSSLTLYTDK
FT                   FVDRTIFGWEIPTSWFQSVNPAFIVLLAPFVSMLWLKLSKSKRGDLKIPTKMAFGMILL
FT                   GIGYLVLTLAVLKTGSSEADITVKANLLFIVITYMFHTIGELFLSPIGLSMVSAIAPVK
FT                   LASLLMGVWLAGKLASFTQSLGYLEVFASIGIIVIVLGLVLLLFSKKVASMME"
FT   gene            complement(629032..629997)
FT                   /locus_tag="BAA_0697"
FT   CDS_pept        complement(629032..629997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0697"
FT                   /product="iron compound ABC transporter, iron
FT                   compound-binding protein"
FT                   /note="identified by match to protein family HMM PF01497"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0697"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49647"
FT                   /protein_id="ACQ49647.1"
FT                   /translation="MNFMRKKSFTVFVFSLAFSLLLSACGKSNTKEESKEDTKKEMIPV
FT                   EHAMGKTEVPANPKRVVILTNEGTEALLELGVKPVGAVKSWTGDPWYPHIKDKMKDVKV
FT                   VGDEGQVNVETIASLKPDLIIGNKMRHEKVYEQLKAIAPTVFSETLRGEWKDNFKFYAK
FT                   ALNKEKDGQKVLAAYDKRMKDLKAKLGDKVNQEISMVRFMPGDVRIYHGDTFSGVILKE
FT                   LGFKRPGDQNKNDFAERNVSKERISAMDGDVLFYFTFDKGNEKKGSELEKEYINDPLFK
FT                   NLNAVKNGKAYKVDDVIWNTAGGVMAANLLLDDIEKRFVK"
FT   gene            630170..631174
FT                   /locus_tag="BAA_0698"
FT   CDS_pept        630170..631174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0698"
FT                   /product="iron compound ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF01032"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0698"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46748"
FT                   /protein_id="ACQ46748.1"
FT                   /translation="MLLKTNRAKWIGLFVGIIAVITCIWGSIIFGYTNTSWKLALDAFF
FT                   HFNGSNEHIIIQNVRLPRALIAASVGASLAIAGCLMQTLTKNPLASPDFIGLNSGAAFF
FT                   IVVAIVIFSVTSLSAFTWIAFLGAAIAAVLVFASSSLGKEGTTPLKLTLAGVAISALFS
FT                   SLTQGLLVLNEKALEEVLFWLAGSVQGRKLEILQSVFPYLLIGWIASIMMTGKVNTLMM
FT                   GEDVAKGLGQRTILMKSFVLLIIVLLSGGSVAVAGPIGFIGIVTPHFARFLVGVDHRWR
FT                   VPYSGLLGAILLILADIAARYVIMPQEVPVGVMTAFIGAPFFIYIARKRGLSK"
FT   gene            631171..632229
FT                   /locus_tag="BAA_0699"
FT   CDS_pept        631171..632229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0699"
FT                   /product="iron compound ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF01032"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0699"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50947"
FT                   /protein_id="ACQ50947.1"
FT                   /translation="MKKYIPFRIGKGELSFLMYKRACLVLFSLLVVLIGLFFASAGMGD
FT                   MKIAPYDVWQAITGNGDAMSNMVVNKFRMPRILIAILVGIALAVAGCILQGLVRNPLAS
FT                   PDIIGITGGASVAVVLFLAIFSDKNNALTVSIHYMPLAAFIGATIVALFVYLFAWRNDG
FT                   LSPISLVLIGVGFWALTKAATTLFMLLAPIYQASQANVWITGTVYGSSWQNVMVLAPWV
FT                   LILTVISFIAARHLNAQELGDDIAVGLGVPLTKSRIFMLLLSTALIGGAVAFAGGIGFV
FT                   GLMAPHISRRLVGSLYGALLPVAAIVGAILVLAADLIGRTVFTPLEIPAGVFTSAIGAP
FT                   YFIYLLYKSRNS"
FT   gene            632242..633063
FT                   /locus_tag="BAA_0700"
FT   CDS_pept        632242..633063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0700"
FT                   /product="iron compound ABC transporter, ATP-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0700"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49642"
FT                   /protein_id="ACQ49642.1"
FT                   /translation="MQKALETKRLTLSYGETIIIDELNLEIPKGEITIFIGSNGCGKST
FT                   LLRSLARLLKPTTGDILLDNQAIQSMQTKQIARQMAILPQGPQAPEGLTVLQLVKQGRY
FT                   PYQTWLKQWSEKDEEMVQNALAATGMTEFAERDVHALSGGQRQRAWIAMTLAQDTDIIL
FT                   LDEPTTYLDMTHQIEVLDLLFELNETEQRTIVMVLHDLNLACRYADNIVAIQDKQIYAQ
FT                   GKPEEVVDEKLVRDVFRMECQISTDPLFGTPLCIPHGKGRRVRKEVAHAMR"
FT   gene            complement(633095..633826)
FT                   /locus_tag="BAA_0701"
FT   CDS_pept        complement(633095..633826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0701"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF08241;
FT                   match to protein family HMM PF08242"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0701"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47497"
FT                   /protein_id="ACQ47497.1"
FT                   /translation="MAFTESDVYNNEAFFKQYMKRRYRENSPNELLEKPAFFQLIGDVK
FT                   GKKILDLGCGDAKFGKELLEKDCHSYTGIEGSQLMYEKAKKQLENKNGIVHFLNLKDYT
FT                   YPPATFDLVTSRLALHYIEHLPIIFQNVYETLKTNGTFTFSVQHPVITSSFESLQTSGK
FT                   RTSWLVDDYFKTGKRVEPWIDQEVIKYHRTTEEYFTLLQQAGFTITNLKEATPNQTYFQ
FT                   SAEEYERRLRIPLFLLFSCRK"
FT   gene            634039..635229
FT                   /locus_tag="BAA_0702"
FT   CDS_pept        634039..635229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0702"
FT                   /product="putative 8-amino-7-oxononanoate synthase"
FT                   /note="identified by match to protein family HMM PF00155;
FT                   match to protein family HMM TIGR01825"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0702"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50462"
FT                   /protein_id="ACQ50462.1"
FT                   /translation="MSSKTLAKFLEENLEDLKSKGLYNVIDPLESSNGPIITIGGKEYI
FT                   NLSSNNYLGLATDSRLQEAAIGAIHKYGVGAGAVRTINGTLDLHIKLEETIAKFKHTEA
FT                   AIAYQSGFNCNMAAISAVMDKNDAILSDELNHASIIDGSRLSKAKIIVYKHSDMEDLRQ
FT                   KAIAAKESGLYNKLMVITDGVFSMDGDVAKLPEIVEIAEELDLMTYVDDAHGSGVLGKG
FT                   AGTVKHFGLSDKVDFQIGTLSKAIGVIGGYVAGKQNLIDWLKVRSRPFLFSTAVTPADA
FT                   AACMRSIEILMESTELHDRLWENGRYLKQGLKELGFNIGESETPITPCIIGDEVLTQEF
FT                   SKRLNEEGVYAKSIVFPTVAKGTGRVRNMPTAAHTKEMLDEAIRKYEKVGKEMGII"
FT   gene            635274..636227
FT                   /pseudo
FT                   /locus_tag="BAA_0703"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF01073; match to
FT                   protein family HMM PF01370; match to protein family HMM
FT                   PF02719; match to protein family HMM PF07993"
FT   gene            636293..636715
FT                   /locus_tag="BAA_0704"
FT   CDS_pept        636293..636715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0704"
FT                   /product="MutT/NUDIX family protein"
FT                   /note="identified by match to protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0704"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45981"
FT                   /protein_id="ACQ45981.1"
FT                   /translation="MQRVDVVYALIHDEETDKILMVHNVEQNVWSLPGGAVEKGETLEE
FT                   ALVREVKEETGLTAVAGGLVAINEKFFEEPGNHALLFTFRAHVVKGELVAADEGEISAI
FT                   EWVDRAIANERFPFYDGGFDSLLEVAIPYKFQPETK"
FT   gene            complement(636755..638635)
FT                   /locus_tag="BAA_0705"
FT   CDS_pept        complement(636755..638635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0705"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0705"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46677"
FT                   /protein_id="ACQ46677.1"
FT                   /translation="MRQIFSDKKIDASLFLQMENLMYALLKEDDAYLEYGYKAYYDEIE
FT                   KKVVISHFWDDRKEEDTVIGLKSEVFLKALGNKHYSDMTLIRSYAIELQESPLKKFLTQ
FT                   LFVLLEDLRVEEIVKNLRPGTKHVFKRRKEMYRNYFSSQNEINRVRNYHGDRLFCLCYL
FT                   SLTSDKYEMFNNEYFEQIEAILHETFQARNTEDIMYIVEKIRYRLEELLESDMLNNYFG
FT                   HAPLYLSVIADEKDSRPEKLTNDDTQIVDDENKNKMNESFSTWHRENKNNENENFLRFE
FT                   LESGTKTNMMGDTARESEDGDQALGSVQGTSQKSTQSNFDGADTEEARASHASSQNDGA
FT                   YGKYNVGASHTFKEARKSTPDEKKDYQAIKSVVNKDVKELKKIIEKTIENKTNANSDKY
FT                   YGRLRKKFLRIYTEKQPRMFYKKGQESQELDVAFQLLVDCSGSMYNKMEETKKSVVLFH
FT                   EALKSLKIPHAISGFWEDASSAKPEDKPNVIHEVVTYKNSTLPNVGPEIMQLREEEDNR
FT                   DGYIIRIVSEKLAKRPEKHKFLLVFTDGEPSALDYQQDGILDTHEAVKLARKSGMEVIG
FT                   IFIEEGEAKEATYQLMKNIYNHHFLVANHAEDLRLKIKPLLKKLLLKTIE"
FT   gene            complement(638639..639532)
FT                   /locus_tag="BAA_0706"
FT   CDS_pept        complement(638639..639532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0706"
FT                   /product="putative norQ protein"
FT                   /note="identified by match to protein family HMM PF07726;
FT                   match to protein family HMM PF07728"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0706"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48267"
FT                   /protein_id="ACQ48267.1"
FT                   /translation="MLEQFHIHADLKQQLSTIHEKNKQEAGENAHLIGTKIYKASDNSI
FT                   IEDAITALLLGKNILLKGPTGSGKTVLAETLSSLFQKPMHSINCSVDLDVEGILGYNTL
FT                   QTKDGASEVTFVNGPLMKAMKNGHFLYIDEINMAKPETLPLLHGALDYRKMITNPFTQE
FT                   VVYGDDEYRVIAAINEGYVGTSELNEALKNRFVIIEVPYIQGDTLKELLLAESKLKDVA
FT                   TIEKFVAFASDLMPLARDGRVSEEAASIRGIIDACDLGVYIPVMRAIERSIIAKLNDET
FT                   EQMTVRELAESYFFEG"
FT   gene            complement(639660..641189)
FT                   /gene="cls1"
FT                   /locus_tag="BAA_0707"
FT   CDS_pept        complement(639660..641189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cls1"
FT                   /locus_tag="BAA_0707"
FT                   /product="cardiolipin synthetase"
FT                   /EC_number="2.7.8.-"
FT                   /note="identified by match to protein family HMM PF00614"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0707"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47274"
FT                   /protein_id="ACQ47274.1"
FT                   /translation="MKKPIIQLLLIFTIVSIVPFLLNTSYISLYTFVGVLWSITIVGIS
FT                   FVIFIENRSPQSTLAWFLVLALLPVVGVLLYSIFGRSRWRRKKHLHRSEEQRKLFREIL
FT                   EGRRLELSLKVPLSERSVHLTEVVQKFGGGPAADRTTTKLLTNGDQTFSEILQAIEQAK
FT                   HHIHIQYYIYKSDEIGTKVRDALIKKAKDGVIVRFLYDGLGSNTLRRRFLQPMKEAGIE
FT                   IVEFDPIFSAWLLETVNYRNHRKIVIVDGEIGFTGGLNVGDEYLGRSKKFPVWRDSHLK
FT                   VEGKALYKLQAIFLEDWLYASSGLNTYSWDPFMNRQYFPGKEISNAEGAVQIVASGPSS
FT                   DDKSIRNTLLAVMGSAKKSIWIATPYFIPDQETLTLLRLSAISGIDVRILYPGKSDSII
FT                   SDQASQSYFTPLLKAGASIYSYKDGFMHAKILLVDDKIATIGTANMDVRSFELNYEIIS
FT                   VLYESETVHDIKRDFEDDFKHSTEIKWNAFQKRSIKKRILESFMRLISPLL"
FT   gene            641373..641609
FT                   /locus_tag="BAA_0708"
FT   CDS_pept        641373..641609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0708"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0708"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50071"
FT                   /protein_id="ACQ50071.1"
FT                   /translation="MYGRPIGGFGHGGGFGHGGFHGGFGHSPFFGGGFFPGFVAGALLS
FT                   PGFGYGGYGYPYYSDYSYYTGYQQDPYYSYNTY"
FT   gene            641640..641978
FT                   /locus_tag="BAA_0709"
FT   CDS_pept        641640..641978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0709"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0709"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47171"
FT                   /protein_id="ACQ47171.1"
FT                   /translation="MNYIENNGLYYRNHHHGGHHHNGGHHHHGGHNHHDHHHHHGGGWG
FT                   WGGGSWGGGFFPGSFAGGVLGGLTAGALTGAAGGGYYPAPYPVTYPAPYPVPYPTPYPG
FT                   YQQTPYPY"
FT   gene            642337..644040
FT                   /locus_tag="BAA_0710"
FT   CDS_pept        642337..644040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0710"
FT                   /product="sensory box/GGDEF family protein"
FT                   /note="identified by match to protein family HMM PF00563;
FT                   match to protein family HMM PF00989; match to protein
FT                   family HMM PF00990; match to protein family HMM PF08447;
FT                   match to protein family HMM TIGR00229; match to protein
FT                   family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0710"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50531"
FT                   /protein_id="ACQ50531.1"
FT                   /translation="MLEQRGHALYESSLRDLKLALDESSIVAITDRKGLITYVNDKFCE
FT                   ISKYTREELIGKDHRILNSGYHPKTFFQMLWKRILSGKVWRGEIRNQAKDGTYYWVKTT
FT                   IVLFLNEKGEPYQFIAIRNDISSRKEAEQRLRLSESRYRELAYHDALTSLPNRLQLITT
FT                   VNELIADKNEFGMIYFDLDRFKLVNDTLGHMIGDLLLSEVASRLHYVLGEKDVLARLGG
FT                   DEFVLLTKNHKQDEMRQLATSVLSCFQAPFMLEGHEVYISASLGLCSYPQDGQDVETLL
FT                   KNSDLAMYSAKEQGRNAACFFTDELRAKINRRMKIEFALQKAIRDEELDVVLQPIIDLK
FT                   TKKYTGIEALVRCTTEEGPISPSEFIPIAEESGLIIKLGDWVLEKSCRLFKTLPEYEEG
FT                   LKLSVNLSIQQLMQKRFIISVRSILRRTGFPANRLILEITESIAVRHFDYIIATLQELR
FT                   NMGILIALDDFGTGYSSLYYLKQLPLDIVKIDRNFIREFHYDHAQPERTIVKSVIEIAH
FT                   SLNLAVVAEGVETVEQESLLKSMGCDYVQGFYYAKPLSVAELKEKLIIDF"
FT   gene            complement(644071..645468)
FT                   /locus_tag="BAA_0711"
FT   CDS_pept        complement(644071..645468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0711"
FT                   /product="amino acid permease family protein"
FT                   /note="identified by match to protein family HMM PF00324;
FT                   match to protein family HMM PF03222"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0711"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50029"
FT                   /protein_id="ACQ50029.1"
FT                   /translation="METKKWGLWVLTAFVIGNMVGGGVFMLPANLAQVSGPMGSTLAWS
FT                   ITGLGVFMIALVFGNLAIRKPELKAGPQSYAQAMFPSKKAGKVAGYSMAWGYWAANWAA
FT                   TASVIISFAGYLSTFFPVLQSKQILFSTNGFSLELGKGLTFLVCSLMLWGIQYILSQNI
FT                   DRAGNMNLLATIAKIIGFTMFIVITLFIFNASNFGDGQTFMNEAGQSISLGGQINSAAI
FT                   ATLWAFIGIESAVMLSNRAKSQRDVKKATIFGLIIALLIYMSITLLTMGALSQDALKDS
FT                   QKPLVDALNLAIGNKGAYIMALLALVSLFGSTVDWIVVSSEVPYQAAKNGLFPKFFAKT
FT                   NKKGSPSKSLFITNVMTQIFLFSTISGTVSEAYNFAIVVATLAYLIPYLVSTLYQFKLV
FT                   ITGETYDILPGSRIKDGIITTLAFVYSIWVIKTGTADLKTFFLGIGLFVLGLILYPVLM
FT                   KDSQKMN"
FT   gene            645920..646630
FT                   /gene="treR"
FT                   /locus_tag="BAA_0712"
FT   CDS_pept        645920..646630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="treR"
FT                   /locus_tag="BAA_0712"
FT                   /product="trehalose operon repressor"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07702; match to protein
FT                   family HMM TIGR02404"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0712"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47013"
FT                   /protein_id="ACQ47013.1"
FT                   /translation="MMSKYEQIYTAISKSIDNKQLKEGCKIPSETELMKQYEASRGTVR
FT                   KAVDLLQERGYVQKIHGKGVFVLKRKNIEFNFGGIVSFQEENERLGRHCITEVVEIEKI
FT                   KATKEIAKLLNVKEKTEIDHIKRVRNIDGEKVILDINHFVSEHIPGLTSEIAAGSIYKY
FT                   IEKELGLHISYSQRVIEVQSCTEDDRKYLDLNGTDYVVVVKNFTHFYDGSQFEYTESRH
FT                   RLDIFHFSDVARRK"
FT   gene            646768..648195
FT                   /gene="treB"
FT                   /locus_tag="BAA_0713"
FT   CDS_pept        646768..648195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="treB"
FT                   /locus_tag="BAA_0713"
FT                   /product="PTS system, trehalose-specific IIBC component"
FT                   /EC_number="2.7.1.69"
FT                   /note="identified by match to protein family HMM PF00367;
FT                   match to protein family HMM PF02378; match to protein
FT                   family HMM TIGR00826; match to protein family HMM
FT                   TIGR01992"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0713"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47917"
FT                   /protein_id="ACQ47917.1"
FT                   /translation="MGKDYRKTAEEVLQYIGGKDNIEQAAHCVTRLRIALKDESKIDND
FT                   KLQSVSLVKGAFHNAGVFQIVIGPGDVDRVYAELITLAGMKEATVADVKDSGNQKLNPA
FT                   QKFVKVFSDVFMPILPAIVTAGLLMGINNLLGAKDLFFDGKNLLDVYPNLSGLWDLINM
FT                   MANTAFVFLPALVGWSATKRFGGSPILGIVMGLMLVHPALLNAWDYGKAATGLDGQKIE
FT                   YFNILGLFQIEKVGYQGQILPVLVAAFVLSKVEIFLKKHVPNAIQLLVVPITTIVVTGV
FT                   LALGIIGPVTRHIGDLLTAGLVGVYETVPVVGAVLFGALYAPLVITGMHHMFIAIDLQL
FT                   IAQHGGTFIWPMIALSNIAQGSAALAMFWISKNQNDKSMASTSAISAYFGITEPAMFGV
FT                   NLRNKFPFYAAIIGSAVAAIFITLNGVLAPAIGIGGLPAFISIIPKSIPMFIVGMVIAV
FT                   VIPFTLTWLFAKRVKQK"
FT   gene            648209..649870
FT                   /gene="treC"
FT                   /locus_tag="BAA_0714"
FT   CDS_pept        648209..649870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="treC"
FT                   /locus_tag="BAA_0714"
FT                   /product="alpha,alpha-phosphotrehalase"
FT                   /EC_number="3.2.1.93"
FT                   /note="identified by match to protein family HMM PF00128;
FT                   match to protein family HMM TIGR02403"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0714"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49716"
FT                   /protein_id="ACQ49716.1"
FT                   /translation="MKDWHKSVVYQIYPKSFNSYYNKETGDIKGVTEKLDYLKELGVDY
FT                   IWLTPIYQSPQNDNGYDVSDYYSIDPSYGTMEEFEELLEEAKARNIEIMLDIVVNHSST
FT                   EHKWFKEAKKDKNSPYRNYYIWRDEKNNWQSKFGGSAWKYDEKTKQYFLHLFDETQADL
FT                   NWENEKLREEVYDMMRFWLDKGVTGFRLDVINLISKDQQFLNDDGSTATSDGRKYYTDG
FT                   PRVHEYLQEMNRNVFEGKDVLTVGEMSSTTIDNCIKYSNPDRNELSMTFSFHHLKVDYP
FT                   NGDKWTKADFDFIKLKEIMSNWQIEMQKGGGWNALFWCNHDQPRIVSRFGNDEKYRNES
FT                   AKMLATAMHMLQGTPYIYQGEEIGMTNPNFESIEQYRDVESLNIYDIKLEEGLSKEEII
FT                   GILKQKSRDNSRTPMQWNEDVNSGFTTSTPWISVAENFKEINVEKALEDKESVFYYYKK
FT                   LIELRKTYDVITEGEYAILDENDSEIWAYTRTTESEVLLVINNFYGEEITYSVPAHVQL
FT                   DGMKQEVLLSNYKDSSKDIAKLNLRPYESIVYRYTK"
FT   gene            complement(649902..651026)
FT                   /gene="gerKC"
FT                   /locus_tag="BAA_0715"
FT   CDS_pept        complement(649902..651026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerKC"
FT                   /locus_tag="BAA_0715"
FT                   /product="spore germination protein GerKC"
FT                   /note="identified by match to protein family HMM PF05504;
FT                   match to protein family HMM TIGR02887"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0715"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46846"
FT                   /protein_id="ACQ46846.1"
FT                   /translation="MFKKRVKLLFILCTSAFLSGCWDQEPLREARLAYSIGSDITEENK
FT                   LQQTIELVKSSSGEQASFENEIHSATGHNIRDTSDALKKNVTGNIRYFKYGVQLLGTKI
FT                   LKKGVLPYLDVSFRDPTNPTALVKLIAVDGETSEILEKKKVGNLLIGDFLKKKVKSLED
FT                   MSVFPKETLETAATKMLDPGKDFTLPSIKIKGREVITNGLALFNNDKLTGHLPLKQSVL
FT                   FVLLTGKMGTSARITQKLTSDESEKTSDYLTMEVSNRKLKRDLKITTDKKGNVYAHIKL
FT                   QLKVIALEAPRDNLYKMDERKKLNKELSKQLTKEAKKITNKLQKANCDAFGIGRHLIAY
FT                   HPDLWKKKKWNKDYAKVKFKPEVDVNILYSGVLK"
FT   gene            complement(651007..652113)
FT                   /gene="gerKB"
FT                   /locus_tag="BAA_0716"
FT   CDS_pept        complement(651007..652113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerKB"
FT                   /locus_tag="BAA_0716"
FT                   /product="spore germination protein GerKB"
FT                   /note="identified by match to protein family HMM PF03845;
FT                   match to protein family HMM TIGR00912"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0716"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49360"
FT                   /protein_id="ACQ49360.1"
FT                   /translation="MTNTQSKISLVQFTFFVIQCQIGVGILSLPNRLHPIAKGGGWISA
FT                   LIAGLAIQLIILLMWLFLKRFPDADMYESVCMLFGNKFGKLLGFAYVFYFTLIGMTVML
FT                   NACNVIKVWVLQATPWYAILLLFTIACCYIAYNTFKVIVRFYVMASILILPMALLIALG
FT                   FSRADFSYIFPITEAGWWNIIQASKETITAMYGFEIILIAFPKVNGSSVAKLKAISIAN
FT                   GFVTLFYTFTVWICFIVFSPKQIELIPEPVAYLLRSLHIGIIDRTDLLFIPIWMITVVA
FT                   SIASYYCAASIGIGHIFNLANHKKAVPIVGIIAFSVALFIDTPEELKVIATFTDKFTYI
FT                   FIVVLPLLFLLYSVIRNKKGEQYVQKKS"
FT   gene            complement(652094..653596)
FT                   /gene="gerKA"
FT                   /locus_tag="BAA_0717"
FT   CDS_pept        complement(652094..653596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerKA"
FT                   /locus_tag="BAA_0717"
FT                   /product="spore germination protein GerKA"
FT                   /note="identified by match to protein family HMM PF03323"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0717"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50916"
FT                   /protein_id="ACQ50916.1"
FT                   /translation="MTEQKEQQESTGQKHMFPSLPENINYIENKLCHSDDIKKLDLPFQ
FT                   NGKGTILYIESLADPNLIHQLALEPLLTRSDLSLDKAFATLNMKKETNLNYGVQLLLQG
FT                   KSLYFHEHVDSFCIFETAISLKRDIAEPDNEGIVRGPHTGFVEDLATNLTSIRKLIKSP
FT                   NIVVKYFTLGEEMHTKVAIAYMQNIANDDLVTEVKRRLETIKTDALMPPGYIQEFIEDT
FT                   SFSPFPQQLNTERPDRVAANLMEGRVAIFSDGDPTALIVPVTLFAFYQSPDDYNNRWIV
FT                   GSFVRMIRLVSFLIAFLLPAIYIATVAFHPDVLPLELVYTIKASLEKVPLPPIFEALLM
FT                   ELIFELLREAGIRLPSRVGQTIGIVGGLVIGDAIVKAGLVSYTMIIVVALTAISSFLVP
FT                   SNDMSSAVRILRFPLMLLAALFGYVGISFGLIITFVHLCQLHSFHTPYLSPVAPMRIKD
FT                   MKDSFVRLPIWSFWERPHDPKPKKMQRQHVTREEEDGDKHAK"
FT   gene            653746..654432
FT                   /locus_tag="BAA_0718"
FT   CDS_pept        653746..654432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0718"
FT                   /product="CAAX amino terminal protease family protein"
FT                   /note="identified by match to protein family HMM PF02517"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0718"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50201"
FT                   /protein_id="ACQ50201.1"
FT                   /translation="MTLRHMWGWKEVLYLFMFVFVIVPVTVESLFYKYILEVIGNSLYA
FT                   GVLMGFIMAVIFTTVVYLFCIKRYKLSWKDIGIRKLSWKDILWTVGAVIFLIVASIAVL
FT                   VIMEKMGISFENSKTETVQNDKSIYSFCIAVIGAAIISPIYEEILYRGVFYTFFRNRYG
FT                   IWSGMFISSIIFTVVHIPTYNTLPVNFLSGVVFAWLYEKTNSILSAMIAHALFNFIAVL
FT                   LTFMSN"
FT   gene            654456..655427
FT                   /locus_tag="BAA_0719"
FT   CDS_pept        654456..655427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0719"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01636"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0719"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49536"
FT                   /protein_id="ACQ49536.1"
FT                   /translation="MEIAVERVFTKEIVKRAASLFHVTVDEKPLGDFENYIFKAKGDRG
FT                   EDYVLRLTHSSHRSKQGVEAELDFLRYVAENGAKVAGPLYSTSRNLVEEIVAEDGTFFF
FT                   ASLFTYAKGEQVKGEESPYWGDAYFEAWGKAIGQLHRLTMNYPKTNHRDTWEEDESGIV
FT                   NELEDDQVKKIATVLMDEIKALPVERETFGLMHGDIHPGNFHYDGKELTIFDFDDAAYN
FT                   YFIHDLAMVLYYSVLFTPWTAEEKTDFARKQLQVLRKGYEYEHRLADSWYESLPLFLRL
FT                   RDIGLYGTLQKKFKGKDMPDNFQKLSEELYERIISEEPIVNI"
FT   gene            655555..657015
FT                   /locus_tag="BAA_0720"
FT   CDS_pept        655555..657015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0720"
FT                   /product="sodium/alanine symporter family protein"
FT                   /note="identified by match to protein family HMM PF01235;
FT                   match to protein family HMM TIGR00835"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0720"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49548"
FT                   /protein_id="ACQ49548.1"
FT                   /translation="MEAFVNWLNNIVWSPALVYLCLGVGLYFSIRTRFLQVRHVGEMVK
FT                   LTFQGEKSEAGVSSFQALALSLSGRVGTGNIAGVATAVAFGGPGAVFWMWAVAFLGAGS
FT                   AYVESTLAQIYKTKHQGQFRGGPAYYIEKGLGVKWYALVFVAATILATGLLLPGVQANS
FT                   IAVSLETAFGINTTLSGALLVVVLALIIFGGVKRIVNVAQVVVPFMAVGYILVACVIVA
FT                   MNIEKLPEAFMLIIRSAFALEAAFGGIIGLAISWGVKRGIYSNEAGQGTGPHAAAAAEV
FT                   SHPAKQGLVQAFSVYIDTLFVCSATAFMMIITGMYNVFDASGKNFIVNKLNGAQPGPGY
FT                   TQAAVESVFPGFGNGFVAISLLFFAFTTIMAYYYIAETNIAYLNRDKDRPWLSMVLKFV
FT                   FLGAVFYGCIKTAATAWALGDIGVEIMAWVNIIAILLLQKPALVALKDYEKQKKEGKDP
FT                   VFDPGPLGIKNADFWEHEYGKGKKEEVS"
FT   gene            657092..657880
FT                   /locus_tag="BAA_0721"
FT   CDS_pept        657092..657880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0721"
FT                   /product="amino acid ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0721"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48940"
FT                   /protein_id="ACQ48940.1"
FT                   /translation="MPIFEYKKNVHALLGEGVSMLIEFRNVNKYYGNFQVLKDINVQVK
FT                   KGEVVVVVGPSGSGKSTLLRCINQLESITDGELIVQNTEVHNAKTDMNELRRNIGMVFQ
FT                   HFYLYPHKTVLQNITLAPIKVNKISKEEAEKTAMFYLEKVGIPEKANVYPHQLSGGQQQ
FT                   RVAIARGLAMQPEIMLFDEPTSALDPEMIGEVLDVMKTLAKEGMTMVVVTHEMGFAREV
FT                   ADRILFMDDGKIIEDTTPAQFFASPEQERARLFLSRVLNH"
FT   gene            657893..658723
FT                   /locus_tag="BAA_0722"
FT   CDS_pept        657893..658723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0722"
FT                   /product="amino acid ABC transporter, amino acid-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00497"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0722"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48399"
FT                   /protein_id="ACQ48399.1"
FT                   /translation="MLKMKKLFTLIVFSCLFVLVVAGCGSKKDEAKETNTKQGGAVEQI
FT                   KKRGKLVVGVKNDTNLFGLKNPSTGQVEGFDVDVAKALAKKILGDEKKLELKEVTSKTR
FT                   IPLLKNGDIDAIIATMTITEERKKEVDFSDVYFKAGQSLLVKKGSDIKSIDDVKKGVKV
FT                   LAVKGSTSTNNIRQKSPEATVLEFENYSEAFTALKAGKGDVLTTDNAILYGMAKQDSNY
FT                   EVVGKIFTDEPYGIAVQKGADDLTKEINSLIKDMKANGEYDKLYEKWIGQKPEK"
FT   gene            658786..659442
FT                   /locus_tag="BAA_0723"
FT   CDS_pept        658786..659442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0723"
FT                   /product="amino acid ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR01726"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0723"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47294"
FT                   /protein_id="ACQ47294.1"
FT                   /translation="MPDFSILTNNIDMYLEGFKYTVMSSVIALIGSFILGVVLAIMRIA
FT                   PIRILNWLGTAFVEFVRNIPLVLIAFIFYFALPVVGITLNGFVAGTVTLTVYTAAFIAE
FT                   VIRAGILSVAKGQMEAARSSGLTYTQAMYHVVLPQAMKIVIPPLGNQFLNLVKNSSILG
FT                   IIAGADLMYQGDLISTKTFVTFDVYIFVGMFYLILTIPLSMLVRYLEKRLAKEAV"
FT   gene            659443..660087
FT                   /locus_tag="BAA_0724"
FT   CDS_pept        659443..660087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0724"
FT                   /product="amino acid ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR01726"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0724"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46027"
FT                   /protein_id="ACQ46027.1"
FT                   /translation="MDFKGALTGDHILFLLKGLLITLEVALVAIVLSFIIGSVIGILRY
FT                   MKIPVVSQVLGIIVEVIRNLPLLLIIFFTYFALPEAGLKLEIITAVIVALTIFEAAMIS
FT                   EIVRSGLLSIEKGQIEAARSSGLTYVQALWHIILPQALRRMVPPLVSQFISLLKDTSLA
FT                   VAISLPELMHNAQIISGQNVNYMIPTFIVVACMYFIVNYSLSILSRRLELR"
FT   gene            660292..661719
FT                   /locus_tag="BAA_0725"
FT   CDS_pept        660292..661719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0725"
FT                   /product="amino acid ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0725"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50497"
FT                   /protein_id="ACQ50497.1"
FT                   /translation="MQQTTNEKLHRTMKSRHLFMIALGGVIGTGFFLGSGYTINQAGPG
FT                   GAILSYLVGGFIMYLTMLCLGELTVAMPVSGSFQKYATKFIGPGTGFMIGWLYWLGWAV
FT                   TVGLELTSIGLMMKRWFPNVDVWVWCLVFGVILYASNAISAKSYAELEFWFSSIKVITI
FT                   LAFVVLGGSALLGFISYDGKEAAPLFSNFVSEGGLFPNGLAAVLLTMITVNFSFQGTEL
FT                   IGIAAGESENPEKTIPRAIRNTVWRIMLFFILTMTILVGLISWKEAGVIESPFVVVFDK
FT                   IGIPYAADIMNFVIITALLSVANSGLYAATRILWSLANEGMAPTSFQKVNKRGIPITAL
FT                   VVTIAVAGLSLFTSFLAEDTVYMYLLSIAGLSAVSSWIIIALSQLRFRSQYIKGGGKLE
FT                   DLKYRTPLYPIVPILALITNSIVVISLAFIPEQRMALYCGIPFIIFCYIYYYINKKRQK
FT                   PMKVEMEKANETNNQTR"
FT   gene            661694..662071
FT                   /locus_tag="BAA_0726"
FT   CDS_pept        661694..662071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0726"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02566"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0726"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50014"
FT                   /protein_id="ACQ50014.1"
FT                   /translation="MKLTIKHDDIEADLSYGPLAIGKENGYSPLQLLVSSIAGCSAIVF
FT                   RTILEKKRIPYDTFTIETEIGRSEALSKPVESVHLHYKIKAQNITEEQLDKALQLAVKN
FT                   CTIVQSVKDSIKITETIELIK"
FT   gene            662133..662567
FT                   /locus_tag="BAA_0727"
FT   CDS_pept        662133..662567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0727"
FT                   /product="HIT family protein"
FT                   /note="identified by match to protein family HMM PF01230"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0727"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50846"
FT                   /protein_id="ACQ50846.1"
FT                   /translation="MECLGCRLAGGEEKIYKVYEDDYVTCFLDHEPFYTGHTLIVPKQH
FT                   VVEVDELDDVVAKSIMDASKLITKAIKLLYKPDGVTVCQNGGIFNELTHYHMHVVPRYK
FT                   ERSFAEFYMVQQGENKNYNFEETKNLLKEAIERILCTEKV"
FT   gene            662744..663301
FT                   /locus_tag="BAA_0728"
FT   CDS_pept        662744..663301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0728"
FT                   /product="RNA polymerase sigma-70 factor, ECF subfamily"
FT                   /note="identified by match to protein family HMM PF04542;
FT                   match to protein family HMM PF04545; match to protein
FT                   family HMM PF08281; match to protein family HMM TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0728"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49576"
FT                   /protein_id="ACQ49576.1"
FT                   /translation="MKVTDNDYEKMEELYELYEQKVYYVAYSILNNIQQAEDAVQETFI
FT                   TLYKNLEKLHNLNIQEFKRYILRVAKNKAIDSYRKNKRHETFLEEYERESIEAVDENIE
FT                   EWEKRKMSEVQIDTLLKELNESNRQVFKYKVFYNLTYQEISSVMGIKEANVRKQFERAR
FT                   KRVQNMIGGIQHDEFKELQRNI"
FT   gene            663267..664700
FT                   /locus_tag="BAA_0729"
FT   CDS_pept        663267..664700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0729"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0729"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49020"
FT                   /protein_id="ACQ49020.1"
FT                   /translation="MTNSKNSKEIYEFAEKIALDDFDKIEEKHEFSHTYTRKKKLFMEE
FT                   MKLKNRQPQKKRKRHRMLIAAACLLIGMPTTVFGAVKVYNMIVQKQNYEVNVSLTNKDS
FT                   KKSDQWYKLKVGKLPENMEAIDDSAMKYSFKDNYAKGGFSFILWRVGKDSNFKTLYSKS
FT                   YEEKEINGKKAVIVNKENGNNNLAFNREVFLFFEKEGIMLQSYIGNDVNEEQMVDVLGN
FT                   ISLEPTSKEKASDITDYDKKYFSEESKPKKTKVIPLKKDSKRLFHIGQKVPVTISMDNS
FT                   KIEYMIEKVEVFDSIKDFKQENFSELGLGILSENQALDQTGQLIPYRRDEYKFGNGKDS
FT                   IDKLVDSKLVHPKFVYLTTTVKNIGKKSTEEIYMHPSIKLLKSEGNAWNYAERDGIAEK
FT                   NIMTGEVDYLEPHGDGKSFYNIGSIRPGETVKVNLGYFVDEDKLDSIFLDAFRYSGSSG
FT                   TENMNEKNRWWFDIRQQSK"
FT   gene            complement(664734..665687)
FT                   /locus_tag="BAA_0730"
FT   CDS_pept        complement(664734..665687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0730"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF08279"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0730"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48608"
FT                   /protein_id="ACQ48608.1"
FT                   /translation="MSKAKRLLDILIFASAKKTFTAQEIADEFNISVRTVHRYIVDLSD
FT                   MGLPIYAEQGRNGGYKVLTNRVIPPILFTEEEAVSIFFAFQSLSYYRDLPFNTEINSVT
FT                   HKLYSSLQHDAKTKVDKIRSYIAFWNPKRTVNTPLLNEVLTAAIENKNLHFQYESKSGI
FT                   KTKHVHPIGVYAHDGLWYLPSYDFSRKKVLLYRVDRILSILSAEENESTFMNLEEWFDS
FT                   NSNVVHSPTQLHVLLTTEGVRQCKSVPYLEEFVVVNEDGTGYIHSTIDKGEINFITPLF
FT                   YRLGKDTRVLEPKELIDGLRIRAKEILHMYEDEKSC"
FT   gene            665794..666315
FT                   /locus_tag="BAA_0731"
FT   CDS_pept        665794..666315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0731"
FT                   /product="dihydrofolate reductase family protein"
FT                   /note="identified by match to protein family HMM PF01872"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0731"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48052"
FT                   /protein_id="ACQ48052.1"
FT                   /translation="MSREIVLFIAASLDGYIAKEDDDLEWLMETEGEGDNGYTEMYETI
FT                   DTIIMGKRTYDYVVEHMDIFPYVDKKCYVFSNSEKGSNEHAEFVNEDVVEFTKGLKAQE
FT                   GSKIWMVGGGSLLREFFKNNLIDEYVVTITPHILGSGVPLFQDKNPEIHLTLTDTKRFG
FT                   QFVNLYYKVK"
FT   gene            complement(666329..667720)
FT                   /locus_tag="BAA_0732"
FT   CDS_pept        complement(666329..667720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0732"
FT                   /product="sensor histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0732"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48166"
FT                   /protein_id="ACQ48166.1"
FT                   /translation="MKRISIQFGFYFLIVTLLIESVLFVLLYYSLVNTRVNEEMTALLK
FT                   RGNSHRDVLEKYYDEQTISHVALMESEAETTVVITNTNKEVLAKSNKINTTIKNHISSM
FT                   QTRTNHDGAIIENHWKTSNYICTVSPIIVAGKHEGYVYMFLGTESIEKLVNGLTKQFII
FT                   AGAITFLLTVITIFLLSRLLTKPLLHMKHATEKMSKGDLSVSLTTTRNDEIGELSSSIQ
FT                   TLANDLHYMKTERSEFLASVAHELRTPLTYVRGYADIALKETTSPEQRLRYLSIIKDES
FT                   DYITNLVQDLFSLAQMEQHNFSIQVKEVHLHTFLTRISEKVNAMYKERYITVSFSCPPT
FT                   LLVNLDEQRFEQVVVNILNNAYRHSKEHSQIHISVIEENKRISITMEDEGEGIPPEDLP
FT                   HIFERFYRVDKARSRATGGTGLGLSIVKEIVELHGGNITVTSEVDHGSCFTISLPSIKK
FT                   HDYHQ"
FT   gene            complement(667732..668409)
FT                   /locus_tag="BAA_0733"
FT   CDS_pept        complement(667732..668409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0733"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0733"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47409"
FT                   /protein_id="ACQ47409.1"
FT                   /translation="MIDILLVDDEPRMLELLTLYLTPIGYNCICARSGEEAISHIENQN
FT                   FKFILLDIMMPKMDGWETCKKIRSFSNVPIIMVTARDQTIDVVQGLKLGADDYVTKPFH
FT                   EEELFARIEAVLRRTNQHAQIQYHGILWNEAKHSASVHNEELLLTPIEFSLLGLFLRHV
FT                   NYVLSRDQLIERIWGLNTNTEDRTVDSHIRNLRDKLRKVNFPIDNHLKTVYGVGYRWID
FT                   IEH"
FT   gene            668583..668822
FT                   /pseudo
FT                   /locus_tag="BAA_0734"
FT                   /note="putative lipoprotein; this gene contains a frame
FT                   shift which may be the result of a sequencing error"
FT   gene            668833..669834
FT                   /pseudo
FT                   /locus_tag="BAA_0735"
FT                   /note="transcriptional regulator, ArsR family protein; this
FT                   gene contains a frame shift which may be the result of a
FT                   sequencing error"
FT   gene            669992..671443
FT                   /locus_tag="BAA_0736"
FT   CDS_pept        669992..671443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0736"
FT                   /product="sulfate permease family protein"
FT                   /note="identified by match to protein family HMM PF00860;
FT                   match to protein family HMM PF00916"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0736"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50346"
FT                   /protein_id="ACQ50346.1"
FT                   /translation="MFQTIKNDWFSNVKGDVLSGIVVALALIPEAIAFSVIAGVDPTVG
FT                   LYAAFCIAVTISFVGGRTGMISAATGAMALLMVTLVKDHGLQYLFATTILTGIVQIIFG
FT                   VFKLSSFMKFVPKSVMSGFLNALGILVFTAQLPQLKNATWQMYALVALGLAIIYVFPRI
FT                   TTAVPSTLIAIIIVTSIALMSGLQLKTVGDMGSLPKELPFFSIPDVPFTLETLGIILPY
FT                   AVMLAIIGLLESLLTASVLDDMTHTESNKHKEARGQGIANIVAGFFGGMAGCAMIGQSV
FT                   INIKSGGRGRLSTFVAGGFLIVLLFVLGDYVVHIPMAALVAVMIMVSIGTFDWNSVATI
FT                   HKVPKGNAFVMIVTVVVVLITHNLGLGVVIGTVISAVLFAFNMAKIHVKHLYIENKKIY
FT                   EIHGQLFFASTADFINNFSFNEDVKEIEMNFTHAHVWDDSAVASIDKVIMKYEQSGVKV
FT                   SITGLNERSAKLVTNLATYNKRIAS"
FT   gene            671509..671931
FT                   /locus_tag="BAA_0737"
FT   CDS_pept        671509..671931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0737"
FT                   /product="universal stress protein family protein"
FT                   /note="identified by match to protein family HMM PF00582"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0737"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50770"
FT                   /protein_id="ACQ50770.1"
FT                   /translation="MYKQIILACDGSEHALRAAEHATHIAKFNEETNVEVVYVVDNRTA
FT                   KSDIIQGQTDLETVSASRKDKLKEIEGLLKKENISYKITILHGDPGDTIVQYVNTGDID
FT                   LVIAGSRGLNTLQEMVLGSVSHKIAKRVKCPVMIIK"
FT   gene            672149..672265
FT                   /locus_tag="BAA_0738"
FT   CDS_pept        672149..672265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0738"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0738"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48577"
FT                   /protein_id="ACQ48577.1"
FT                   /translation="MKALQDLSYSQGVGLICLGGFAASVTLAVVIKIIHQIF"
FT   gene            complement(672369..674150)
FT                   /locus_tag="BAA_0739"
FT   CDS_pept        complement(672369..674150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0739"
FT                   /product="oligopeptide ABC transporter,
FT                   oligopeptide-binding protein"
FT                   /note="identified by match to protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0739"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49612"
FT                   /protein_id="ACQ49612.1"
FT                   /translation="MNKPKLYKVLSTLAASTLLLSACGGADSGSKKTNTKKVETNKFSA
FT                   AVKNDGKEIKDGSLTYGLVSNSPFAGVLSRVLYEVAPDSEIMDFFDEGLLASDKNWEIT
FT                   NDGAATYTISEDKKTITIKIKDNVKWHDGNPVTAEDLEYSYLIIGNSKYTGIRYDTQMQ
FT                   MIEGMEEYHAGKADKISGIKVVDPKTISITYKEVNPSLKTGIWTYPTPKKYLGDVPIEK
FT                   LAESDKIRQNPIGFGPFKVKKIVPGESVEYERFDDYWAGKPKLKNVTLKVVNPSIVSAS
FT                   LKKGDIDIASITADQYPNVSKLKNTQLVGKTALAYTYIGFKFGHMDKAKNEAVMDNDKF
FT                   KDVRLRQAMAYAIDREKLGEKVYHGLRVPANSPIPPSMPKYHNNNAGAYNLDVDKAKKL
FT                   LDEAGYKDKNGDGFREDPKGNEFKINFLASNGSETSEPLAKFYIQSWKDIGLKVELVDG
FT                   RLHEFNAMREMIKKDDPKVDIFSGAWNTGSDPDLSGLWGKNAGFNYQRWVNDENTKLLD
FT                   AGLSEKATDEKYRKEVYDKWQKLIHDEAPMIPIHYTFDLTGVNKRVKDFDVNAEVNQIT
FT                   SHWKDVTVTSEKPEVEK"
FT   gene            complement(674165..675070)
FT                   /locus_tag="BAA_0740"
FT   CDS_pept        complement(674165..675070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0740"
FT                   /product="oligopeptide ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0740"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48055"
FT                   /protein_id="ACQ48055.1"
FT                   /translation="MLANPEKQTEVIHYEKIPSGFSIMWREFRKDKLAMFSLFFLALIL
FT                   IAVYTTSFIMKQEDIVRVDLFAIYDPPSAEHWLGTDYGGRDIFGQLIIGTRNSFTVGLA
FT                   ITLLSTLIGLTMGLIAGYFGGVVDNIIMRFIDFMMILPFLMIVIVFISLVPTFNITTFI
FT                   LIMTAFLWVGKARLIRSKVLTEKELDYVSASKTLGTPNWKIIFQQILPNLSSIIIVNIT
FT                   LNLAGNIGIESSLTYLGFGLPESTPSLGTLVSYATNPDVLQEKWWIWLPASIMILVLML
FT                   CINFIGQALKRAADARQRKG"
FT   gene            complement(675089..676057)
FT                   /locus_tag="BAA_0741"
FT   CDS_pept        complement(675089..676057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0741"
FT                   /product="oligopeptide ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0741"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46180"
FT                   /protein_id="ACQ46180.1"
FT                   /translation="MWKFILRRILVMIPQLFVLSVLVFTLAKAMPGDALSGAELANPKA
FT                   DPKVIEEQREKLGLNDPIPTQYVRWISNAVQGDFGISYAHKIQVTDIIGERLGNTVLLA
FT                   LLILILTYLIAIPLGVISGRWNDTWADRLITLYNFLGFGTPLFIFGLVMLFLFGFLYPI
FT                   FPTSGSVDPQVAAGSFDYYLSKLNHMILPALSGALIGTVGTVQYLRSEIIDTKHKDFVR
FT                   TVKAKGVPESKVYSRHILRNSFLPIAAFLGYEITGLVGGSIILENIFGYPGIGQLFFQS
FT                   ITQRDFSVVTALVLFTGFATLLGTLLSDIILSIVDPRIRID"
FT   gene            complement(676072..676998)
FT                   /locus_tag="BAA_0742"
FT   CDS_pept        complement(676072..676998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0742"
FT                   /product="oligopeptide ABC transporter, ATP-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF08352"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0742"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50055"
FT                   /protein_id="ACQ50055.1"
FT                   /translation="MALLKVEDLKVHFPIKGGVFGRTLDYVRAVDGVSFELQPGETYGI
FT                   VGESGSGKSTTGKAIMHLTKATGGSIHFNNRDLTKLSRSELREQRKDIQMIFQDPYSSL
FT                   NPKKRVMDIIAEPLRNFEKLSPDEERRAVQDYLDKVGLNPESIYKYPHEFSGGQRQRIG
FT                   IARALTLKPKLIIADEPVSALDVSVQAQVLNFLQDLQSELGLTYLFISHDLGVIRHMCD
FT                   RIGVMYRGRIVEEATSAEIYNNPQHIYTKRLISAIPDIRPENREQQRKLRREVSAEYEK
FT                   SYENYFNENGRAYDLKPISPTHRVALP"
FT   gene            complement(676985..678004)
FT                   /locus_tag="BAA_0743"
FT   CDS_pept        complement(676985..678004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0743"
FT                   /product="oligopeptide ABC transporter, ATP-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF08352; match to protein
FT                   family HMM TIGR01727"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0743"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49992"
FT                   /protein_id="ACQ49992.1"
FT                   /translation="MKNPLLRIENLQTSFRIQDQYHAAVDDVSLTVHENEIVAIVGESG
FT                   CGKSALALSIMRLHNEANTKLQGQLNYRDKDLLTMSAAEMNKVRGSNIGMIFQEPLTAL
FT                   DPLMTVGKQIEENLDYHTSLSKVEKKERTLELLHQVGIPKPELTYKQYPHELSGGMRQR
FT                   IVIAIAIACNPALIIADEPTTALDVTIQAQILDLLKSIQEQTKMGIILITHDLSVVAET
FT                   ADRIVVMYAGQVVETGKVEEIFNNPLHPYTRSLLNSIPSAYAEKEKLHVIQGVVPTLAK
FT                   LPRTGCRFQARIPWIRPDQHEENPILHEVKPNHWVRCTCYKHFNFQDKKGDDVTHGTA"
FT   gene            complement(678289..679638)
FT                   /gene="glpT"
FT                   /locus_tag="BAA_0744"
FT   CDS_pept        complement(678289..679638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpT"
FT                   /locus_tag="BAA_0744"
FT                   /product="glycerol-3-phosphate transporter"
FT                   /note="identified by match to protein family HMM PF07690;
FT                   match to protein family HMM TIGR00712; match to protein
FT                   family HMM TIGR00881"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0744"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50863"
FT                   /protein_id="ACQ50863.1"
FT                   /translation="MFFTQFFKPAPHAERLPADRVDSEYRKLRLQVFLGIFIGYAGYYF
FT                   VRKNFSLAMPYLIEQGFSKGELGVILSAVSIAYGLSKFLMGIVSDRCNPRYFLAAGLFL
FT                   SGIINIIFGSFSFITTSIILMFVLQFLNGWVQGMGWPPCGRTMVHWFSISERGTKMSIW
FT                   NVAHNVGGALMPSLVTLGLYFFANDWKSIFYFPGILSILVGVYVLITMKDTPQSCGLPS
FT                   IEEHTGEYPPDEKIKDRERELSAKEILFKYVLNNKFLWYIAIANVFVYFVRYGVVDWAP
FT                   TYLVEEKSFTHSSSRTAYALYEWAGIPGTLLCGWMSDKLFKGRRAPAGILFMVGVFIAV
FT                   LVYWLNPPGNPMVDSIALVAIGFLIYGPVMLIGLHALDLAPKKAAGTAAGLTGFFGYLG
FT                   GAAFASAAMGFIVDAFGWDGGFILLLASCVLAMFFLALTLKTGSVKQKQA"
FT   gene            679911..680369
FT                   /locus_tag="BAA_0745"
FT   CDS_pept        679911..680369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0745"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="identified by match to protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0745"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48551"
FT                   /protein_id="ACQ48551.1"
FT                   /translation="MPNDMTHIDKIQALAFSIGKKMQTELLEQMQATGLTPPQFYILKI
FT                   LDHYGASRATKLAKKMYVKPSAITVMIDRLIDQELVERYHDKDDRRVVIIELTKKGKAR
FT                   VEEAMVARNEHIAKYFSHLELQEREDLLRLFEKLETIICGTQEKKENN"
FT   gene            680389..681819
FT                   /pseudo
FT                   /locus_tag="BAA_0746"
FT                   /note="putative multidrug resistance protein; this gene
FT                   contains a frame shift which may be the result of a
FT                   sequencing error; identified by match to protein family HMM
FT                   PF07690; match to protein family HMM TIGR00711"
FT   gene            681816..681989
FT                   /pseudo
FT                   /locus_tag="BAA_0747"
FT                   /note="drug resistance transporter, EmrB/QacA family; this
FT                   gene contains a frame shift which may be the result of a
FT                   sequencing error"
FT   gene            682127..683098
FT                   /gene="rbsR"
FT                   /locus_tag="BAA_0748"
FT   CDS_pept        682127..683098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsR"
FT                   /locus_tag="BAA_0748"
FT                   /product="ribose operon repressor"
FT                   /note="identified by match to protein family HMM PF00356;
FT                   match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0748"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50127"
FT                   /protein_id="ACQ50127.1"
FT                   /translation="MSTIKDVAKLAGVSVSTVSRVLNKNGYVHEDTLKKVERAIEMLDY
FT                   KPSTVARSLYNKKSRLIGLVVPNIVNPFFPEVARAVEDVAHKQGYTVVLCNSDESLEKE
FT                   KQYIDVLRQNNVDGFIVATNPQNSVNYMNLSVPVVAIDRMFNERIPAVYADNYAGSQAA
FT                   TKLLIDKGCKRIAHIRGPRDVSTANERFEGFVDVITQNNLSYMIAESTFDPANSERVAV
FT                   ELLEEYPHIDGIVAGNDLIAIGIVKAALQKGISIPDDLQIIGFDGISLTEMMYPSITTV
FT                   AQPIYEMGKVATELLLEQMEGNVLEEKHYRLPIEIIERNTTK"
FT   gene            683112..684008
FT                   /gene="rbsK"
FT                   /locus_tag="BAA_0749"
FT   CDS_pept        683112..684008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsK"
FT                   /locus_tag="BAA_0749"
FT                   /product="ribokinase"
FT                   /EC_number="2.7.1.15"
FT                   /note="identified by match to protein family HMM PF00294;
FT                   match to protein family HMM TIGR02152"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0749"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50858"
FT                   /protein_id="ACQ50858.1"
FT                   /translation="MPNIAVVGSISMDLVAVSKKRPKAGETVIGEAFHTIPGGKGANQA
FT                   VAAARLGANVAMVGAVGDDNYGTVVKRNLENERVFIDYVVPVTDAATGIAHIVLAEEDN
FT                   SIVVVQGANALVNESVVNRSKDLLIKADMVVLQLEIPLETVKYVLAICQEHKIPVMLNP
FT                   APAQVLSEDILEKATYITPNEHECRIVLDDFTSPIEDLLAKYPNKLLMTEGSNGVRFHN
FT                   GTEIVHVPSIAVDVVDTTGAGDTFNGALAVALSEGETLQKAIRFANIAGGLSVTKLGAQ
FT                   GGMPTRDRVREVQVIVG"
FT   gene            684005..684400
FT                   /gene="rbsD"
FT                   /locus_tag="BAA_0750"
FT   CDS_pept        684005..684400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsD"
FT                   /locus_tag="BAA_0750"
FT                   /product="ribose ABC transporter protein"
FT                   /note="identified by match to protein family HMM PF05025"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0750"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46133"
FT                   /db_xref="GOA:C3P0E9"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023064"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3P0E9"
FT                   /protein_id="ACQ46133.1"
FT                   /translation="MKKHGVLNSEIAAVLASLGHTDTIVIADCGLPIPDGVKRIDLAVE
FT                   IGKPSFLDVLQVVADDMAIEKVTLAEEVINNNAEVNKEIELKLIEPAFEYVCHEQFKEH
FT                   TKKAKAIIRTGEATPYANVILHAGVIF"
FT   gene            684413..685903
FT                   /gene="rbsA"
FT                   /locus_tag="BAA_0751"
FT   CDS_pept        684413..685903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsA"
FT                   /locus_tag="BAA_0751"
FT                   /product="ribose ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0751"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46815"
FT                   /protein_id="ACQ46815.1"
FT                   /translation="MGMRIEMKNISKAFNGNPVLKNAQFMIETGEVHALMGENGAGKST
FT                   LMKILTGVYKRDGGTITIDGQERTFKNAKEAEEYGIAFIHQELNILPNLTVAENMFLGK
FT                   ELMYGKTGILRTRQMNAIAQQQLAELGLHVKGAMLAGELSVGQQQIIEIAKALMTNASV
FT                   IIMDEPTAALTDREIETLFTVINKLRKEGVSFVYISHRMEEIFSICDAITILRDGEYVG
FT                   KRSIPETSFDEVVSMMVGRSIGERYPERNSQIGDVIFEMRNGTKKGKFENVSFQVRKGE
FT                   ILGVAGLMGAGRTDIMKAIFGYEPLDSGQIFINGQEVKIDSPIDAIRQRIAFITEDRKS
FT                   EGLVLDFSIRENLALPNLESLSKGSVLSNELEQQFTADMMKLLNVKASSGEQAVKSLSG
FT                   GNQQKVVIAKWLGIHPQLLILDEPTRGVDVGAKKEIYSIMNKLTEEGDAVIMVSSELPE
FT                   VLGMSDRVLVIHEGKVGGILEKDEASQESIMALATGGE"
FT   gene            685906..686841
FT                   /gene="rbsC"
FT                   /locus_tag="BAA_0752"
FT   CDS_pept        685906..686841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsC"
FT                   /locus_tag="BAA_0752"
FT                   /product="ribose ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0752"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48633"
FT                   /protein_id="ACQ48633.1"
FT                   /translation="MAKKGNVLQQLGSLIGLALIIVVITALNPAFIEIPNLFNILRQVS
FT                   INALIAFGMTFVILTGGIDLSVGSILALSSALVAGMMASGMDPFLAMAVGLLAGLVMGI
FT                   VNGIIIAKGKVAPFIATLATMTIFRGLTLVYMDGRPITGLGDHLMFQMFGRGYFLGIPV
FT                   PAVTMMIAFAVLYFILKKTTFGRRTFAIGGNEEAAALSGINVTKIKVMIYGLSGILAAF
FT                   AGIVLTSRLDSAQPTAGTSYELDAIAAVVLGGTSLSGGRGWIVGTFIGVLIIGVLNNGL
FT                   NLLGVSSFFQQVVKGLVILLAVLIDRRKEA"
FT   gene            686856..687782
FT                   /gene="rbsB"
FT                   /locus_tag="BAA_0753"
FT   CDS_pept        686856..687782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsB"
FT                   /locus_tag="BAA_0753"
FT                   /product="ribose ABC transporter, ribose-binding protein"
FT                   /note="identified by match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0753"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49343"
FT                   /protein_id="ACQ49343.1"
FT                   /translation="MKKWLLILVACMMVITAGCSMEPPEWAKDSSDKGRNKTIKVGFSV
FT                   STLNNPFFVTLKKGAEKKAKESGIELIAVDAQNDAAKQTNDVEDLIQKGVDVVVINPTD
FT                   SDAVASAVSAANAANVPVITVDRVANSGKVVSHIASNNIEGGQMASDYIRELVGEGANV
FT                   AELEGIPGSSAARERGKGFHNVADKSLKVVAKQAADFDRAKGLSVMENILQANGDIKAV
FT                   FAHNDEMALGALEALKSAGKTDVVVVGFDATEDAVKAVNDGRMAATVAQKPELIGEKAM
FT                   QTAKEITQGKKVDKSIPIELELIKKNK"
FT   gene            687817..688464
FT                   /locus_tag="BAA_0754"
FT   CDS_pept        687817..688464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0754"
FT                   /product="putative transaldolase"
FT                   /note="identified by match to protein family HMM PF00923;
FT                   match to protein family HMM TIGR00875"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0754"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49724"
FT                   /protein_id="ACQ49724.1"
FT                   /translation="MKFFIDTANINEIKEANALGVLAGVTTNPSLVAKEGVDFHERIRE
FT                   ICNVVEGPVSAEVISLEADKMIEEGKELAKIAPNVVVKVPMTTEGLKAVKAFSDLGIRT
FT                   NVTLVFSAVQALLAARAGATYVSPFLGRLDDIGHNGMDLIRQIAEIFAIHGIETEIIAA
FT                   SVRHSVHVTDAALNGAHIATIPANVIASLVKHPLTDQGIEKFLADWEKTQEK"
FT   gene            688781..691180
FT                   /gene="inhA"
FT                   /locus_tag="BAA_0755"
FT   CDS_pept        688781..691180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="inhA"
FT                   /locus_tag="BAA_0755"
FT                   /product="immune inhibitor A metalloprotease"
FT                   /EC_number="3.4.24.-"
FT                   /note="identified by match to protein family HMM PF05547;
FT                   match to protein family HMM TIGR03296"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0755"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50273"
FT                   /protein_id="ACQ50273.1"
FT                   /translation="MRRKAPLKVLSSLAIAAIIGCTSVMSAPLAYAETPAKEKENVSTT
FT                   PIDYNLIQEDRLAEALKERGTINPASSKEETKKAVEKYIEKKQGDQANKEILPADTAKE
FT                   ASDFVKKVKEKKMEEKEKVKKPEKNVSPEQKPEPNKKQLNGQVPTSKAKQAPYKGSVRT
FT                   DKVLVLLVEFSDYKHNNIDQTPGYMYSNDFSREHYQKMLFGNEPYTLFDGSKVKTFKQY
FT                   YEEQSGGSYTTDGYVTEWLTVPGKASDYGADGSSGHDNKGPKGARDLVKEALHAAAEKG
FT                   LDLSQFDQFDRYDTNSDGNQNEPDGVIDHLMVIHAGVGQEAGGGKLGDDAIWSHRSKLA
FT                   IDPVAIEGTKSKVDYFGGKVAAHDYTIEPEDGAVGVFAHEFGHDLGLPDEYDTKYTGTG
FT                   SPVEAWSLMSGGSWTGKIAGTEPTSFSPQNKDFLQKNMGGNWAKILEVDYDKIKRGVGV
FT                   PTYIDQSVTKSNRPGVVRVNLPGKSVETIKPEFGKHAYYSTRGDDMHTTLETPFFDLTK
FT                   GTNAKFDYKANYELEAECDFVEVHAVTEDGTKTLIDRLGEKVVQGDKDTTDGKWIDKSY
FT                   DLSQFKGKKVKLQFDYITDPAVTYKGFAMDHVNVTVDGQVVFSDDAEGQSKMNLNGFVV
FT                   SDGTEKKAHYYYLEWRNYAGSDNGLKAGKGPVYNTGLVVWYADDSFKDNWVGVHPGEGF
FT                   LGVVDSHPEAFVGNLNGKPTYGNTGMQIADAAFSFDQTPAWSVNSLTRGQFNYSGLQGV
FT                   TTFDDSKVYSNNQIADAGRKVPKLGLKFQVVGQADDKSAGAVWIKR"
FT   gene            691499..691840
FT                   /locus_tag="BAA_0756"
FT   CDS_pept        691499..691840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0756"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0756"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50838"
FT                   /protein_id="ACQ50838.1"
FT                   /translation="MKEVIECPQCEGNITAQHIMDLPHSFSFRCPHCKVKLKEMRITPC
FT                   LILVAICIIPLFIMIGESIKELLVKYFSIIDGVPTVLIFFLFCYPLYYLYEKYNAILFI
FT                   KYGLLKVKS"
FT   gene            complement(691878..693050)
FT                   /locus_tag="BAA_0757"
FT   CDS_pept        complement(691878..693050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0757"
FT                   /product="putative multidrug resistance protein"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0757"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48583"
FT                   /protein_id="ACQ48583.1"
FT                   /translation="MKYFIYFIVIVAFLDTFSQLPIMSTFAQSLGGSPLIIGLVVGMYS
FT                   FANMIGNIIAGAAVDKFGAKKILYISMGLTSFIVLLYTVVQSGEQLLVVRFMHGFSDGF
FT                   LIPAAFTFLSKQTNAARQGKAMALSGAAVGTAAIVGPAFSGIMKATAGIEWVFITISIL
FT                   MVLGTIVSLFFLPNNVSRKDTSRTQMMNKEDMFELLKSEPLLQAYIGAFTLMFSQGIVT
FT                   YMLPVKVEALALKASTTGMMLSAFGITAILFFLLPTNRIYDRFNRSKLMLIGIAVMALA
FT                   LSLLGLFATKGMLFIVMMIYGIGFAILFPSINALLVENTTNDKRGKAFGLFYAFFSLGV
FT                   VAGSFTVGAIGASPSVSFVIGTAFLLTFAGMIYVRSKVKGRDKVKKTMIG"
FT   gene            693276..694328
FT                   /locus_tag="BAA_0758"
FT   CDS_pept        693276..694328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0758"
FT                   /product="oxidoreductase, zinc-binding dehydrogenase
FT                   family"
FT                   /note="identified by match to protein family HMM PF00107;
FT                   match to protein family HMM PF08240"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0758"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48344"
FT                   /protein_id="ACQ48344.1"
FT                   /translation="MKALLWHNQRDVRVEEVPEPTVKPGAVKIKVKWCGICGTDLHEYL
FT                   AGPIFIPTEEHPLTHVKAPVILGHEFSGEVVEIGEGVTSHKVGDRVVVEPIYSCGKCEA
FT                   CKHGHYNVCEQLVFHGLGGEGGGFSEYTVVPEDMVHHIPDEMTYEQGALVEPAAVAVHA
FT                   VRQSKLKEGEAVAVFGCGPIGLLVIQAAKAAGATPVIAVELSKERQELAKLAGADYVLN
FT                   PATQDVLAEIRNLTNSLGVNVSFEVTGVEVVLRQAIESTSFEGQTVIVSVWEKDATITP
FT                   NNLVLKEKEVVGILGYRHIFPAVIKLISSGQIQAEKLITKKITVDQVVEEGFEALVKDK
FT                   TQVKILVSPK"
FT   gene            694447..694791
FT                   /locus_tag="BAA_0759"
FT   CDS_pept        694447..694791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0759"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07885"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0759"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47188"
FT                   /protein_id="ACQ47188.1"
FT                   /translation="MLSFMLTLKRMLKACLRAWKDKEFQVLFVLTFLTLTSGTIFYSTV
FT                   EGLRPLDALYFSVVTLTTVGDANFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQL
FT                   PSILSNRKKE"
FT   gene            695045..695896
FT                   /gene="plC"
FT                   /locus_tag="BAA_0760"
FT   CDS_pept        695045..695896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plC"
FT                   /locus_tag="BAA_0760"
FT                   /product="phospholipase C"
FT                   /EC_number="3.1.4.3"
FT                   /note="identified by match to protein family HMM PF00882"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0760"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46796"
FT                   /protein_id="ACQ46796.1"
FT                   /translation="MKKKVLALAAAITLVAPLQNVAFAHENDGGSKIKIVHRWSAEDKH
FT                   KEGVNSHLWIVNRAIDIMSRNTTLVKQDRVAQLNEWRTELENGIYAADYENPYYDNSTF
FT                   ASHFYDPDNGKTYIPFAKQAKETGAKYFKLAGESYKNKDMKQAFFYLGLSLHYLGDVNQ
FT                   PMHAANFTNLSYPQGFHSKYENFVDTIKDNHKVTDGNGYWNWKGTNPEDWIHGAAVVAK
FT                   QDYSGIVNDNTKDWFVKAAVSQEYADKWRAEVTPMTGKRLMDAQRVTAGYIQLWFDTYG
FT                   DR"
FT   gene            695970..696971
FT                   /gene="sph"
FT                   /locus_tag="BAA_0761"
FT   CDS_pept        695970..696971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sph"
FT                   /locus_tag="BAA_0761"
FT                   /product="sphingomyelin phosphodiesterase C"
FT                   /EC_number="3.1.4.12"
FT                   /note="identified by match to protein family HMM PF03372;
FT                   match to protein family HMM TIGR03395"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0761"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46773"
FT                   /protein_id="ACQ46773.1"
FT                   /translation="MKGKLLKGVLSFGIGLGVLYGGSSAQADTSTDQNNTLKVMTHNVY
FT                   MLSTNLYPNWGQSERADLIGAADYIKNQDVVILNEVFDNSASDRLLGNLKKEYPNQTAV
FT                   LGRSNGNEWDKTLGSYSSATPEDGGVAIVSKWPIVEKVQYVFANGCGPDNLSNKGFVYT
FT                   KIKKNDRFVHVIGTHLQAEDSMCGKTSPASVRTNQLKEIQDFIKNKNIPNDEYVLFGGD
FT                   MNVNKINAENNSDSEYASMFKTLHASIPSYTGHTATWDATTNSIAKYNFPDSPAEYLDY
FT                   IIASKDHANPSFIENKVLQPKSPQWTVTSWLKKYTYNDYSDHYPVEATISMK"
FT   gene            697079..698251
FT                   /locus_tag="BAA_0762"
FT   CDS_pept        697079..698251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0762"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0762"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46090"
FT                   /protein_id="ACQ46090.1"
FT                   /translation="MDRGIFKEVPLPCAFLDEVALDRNIQSIIELSGNKKIRIASKSLR
FT                   SVPVMQRILAASDRFQGIMCFSPREALFLIEQGFNDLLLGYPAYDERALHEISLLTKQG
FT                   LIITCMVDCEDHIVYLEKIAEKSKGCFRVCLDIDMSSRFFKFHFGVKRSPVKDGQGALK
FT                   IVKRLKESSFLILDGVMGYEAQIAGVGDHIPNQRVKSKVISYLKKKSVLEVKERRGHIV
FT                   KEIQNLGIELRFVNGGGTGSIKTTEQDHSVSEITIGSAFYAPKLFDYYKEVQFHPAVGF
FT                   ALPVVRKPAPTIYTCLGGGYIASGAIGKDKEPEIWRPGGAKLLALEGAGEVQTPIFYNG
FT                   EERVEIGDSILFRHSKAGELCERFPFLYRVKEGEIVGEYSTYRGDGQCFL"
FT   gene            698239..699552
FT                   /locus_tag="BAA_0763"
FT   CDS_pept        698239..699552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0763"
FT                   /product="oxidoreductase, FAD-binding"
FT                   /note="identified by match to protein family HMM PF01565;
FT                   match to protein family HMM PF04030; match to protein
FT                   family HMM TIGR01679"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0763"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50179"
FT                   /protein_id="ACQ50179.1"
FT                   /translation="MLSIKGQKWRNWTGNVEGTPHYTMYPESIQDVVEVIELARKKGKK
FT                   IRVVGSGHSFTPLVQTEEILVSLDEMKGIVNIDTEKMIAEVWAGTKLHELGKLLEEKGY
FT                   AQENLGDIDSQSIAGAISTGTHGTGITFGSLSTQVIEITAVLSTGETIVCSEMENVEYW
FT                   RAFQLSLGMLGIIVRIKLNIIRAYSLVYESEKQSLATVMNKLEEYKKNRHFEFFVFPYS
FT                   DEVQVKVTNETTGKKSDLKWHKLKVELLENKMFSLLSKGCKWFPSISKGVSRLSAKAVP
FT                   NTKIIGPSYEVFATSRAVPFYEMEYSVPSKYMQAVVEEISNLIEKKKYKVHFPIECRYV
FT                   KRDDIWLSPAYGRDSAYIAVHMYKGMKYAAYFGEVEKIFLKYEGRPHWGKMHTLTYEKL
FT                   QNIYPELHSFLKVRKLLDEAEMFSNPYTEKLFTIMKKS"
FT   gene            complement(699560..700711)
FT                   /locus_tag="BAA_0764"
FT   CDS_pept        complement(699560..700711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0764"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF04892"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0764"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49444"
FT                   /protein_id="ACQ49444.1"
FT                   /translation="MTAYLFPVKTAFILFPFLAMFLLIPFLIFNYRKYGYLNKWRSFIL
FT                   YSLLLYLLNAYFLVILPLPQTYDTCSLQPANTQHMQLSPFYFIQEISNHTSAILTKPAT
FT                   YFYLLKESAFLQVAFNVLLTVPFGIYLRYYFRRSFLQTICISFCLSLFFELTQVTGLYG
FT                   IYNCAYRLFDIDDLFLNTLGGVIGFIIAPIFMYFLPKANELDSHVDLETKPVGFVRRFI
FT                   AMQIDWIFLSIVVPVIKNKGNSFFVSNIQAYTNIYELIFITCSILIYFIIIPYFTNGKT
FT                   IGKALLRIYVKGKSDRITMKELFIRYGIFYFILGGINYILSSSSILNLKEPLVLIVIVL
FT                   FQLVINGLFIIHVLLHVFSRDKLLFYERISQTRNAIILKKADK"
FT   gene            700884..701087
FT                   /locus_tag="BAA_0765"
FT   CDS_pept        700884..701087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0765"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0765"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49348"
FT                   /protein_id="ACQ49348.1"
FT                   /translation="MRYELFSVSGNHITTFESAWCFQEGEQIFVHDDQTKRNFIIIRLT
FT                   HDVFQQNKHVIRLYCQEKKVYA"
FT   gene            complement(701145..701957)
FT                   /locus_tag="BAA_0766"
FT   CDS_pept        complement(701145..701957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0766"
FT                   /product="undecaprenol kinase family protein"
FT                   /note="identified by match to protein family HMM PF02673"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0766"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47212"
FT                   /protein_id="ACQ47212.1"
FT                   /translation="MEQFYYILKYLILGLFQGLTEPIPISSSGHLVLAQHLLGLKIEGF
FT                   SFELLVNSASLLAVLLIYRNDLIRLTKNGLSYIFTRAEDAKSDFFFIIYLVIATIPAGV
FT                   IGVLFKDYIDQYLKGVKMVGISLLITAVGLWIIRNLRGRRNDGDLSMKDAIIVGLAQAC
FT                   ALIPGISRSGATIVAAMLLGMKQETALRFSFLLYIPVSLGGLLLSITDIAKDPNLDTLF
FT                   VPYIVAFIATFIMTYISLKWFMNIMAKGNLKYFSFYCIIVGVLTLIFL"
FT   gene            complement(702090..703034)
FT                   /locus_tag="BAA_0767"
FT   CDS_pept        complement(702090..703034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0767"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="identified by match to protein family HMM PF00015"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0767"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47591"
FT                   /protein_id="ACQ47591.1"
FT                   /translation="MFTQKKSLQHKIDQLENRIQELKAELKQKDIEQQETISSIHDRVQ
FT                   NIVQEHKLVNNQHHTLQNLVQQLNSCFENVSTRTTHSNELNNEMLQKEQSLIQSIEEII
FT                   DCSNEGKESVHRLLIVINKLAEQSQRTSNSMNHLSERSKEIEQIVEVIQNIAAQTNLLA
FT                   LNASIEAARAGEHGKGFAVVANEVRKLAESTAESTKNIGNLTKKIQEEIEKAYDNTKDN
FT                   LHLVDEGVEMSADTNARIENILIMIQTLQNGATNVIKAIENQKSCNDDILREFANTQQM
FT                   FQKLNTTIMNHIHDAEKVDVQLTKSLEETVVSH"
FT   gene            703255..704517
FT                   /locus_tag="BAA_0768"
FT   CDS_pept        703255..704517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0768"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06725"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0768"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46074"
FT                   /protein_id="ACQ46074.1"
FT                   /translation="MNYFKRISSLVLAGIIGLSSTVAVKAESNDEKLNNMQQQLQQNDA
FT                   EMQKKEQEKQAVSKEIQGIENELHNLNNTIAKNKEDQAAIQRKIDETHKQIEQKKNEIV
FT                   VLEDKVLARKDIMRKRMVSVQNSSNTSLVVEVVVESKNFADFLQRMNAVSTILEADKEI
FT                   LRLQEQDLRQIEEDKKTIDEKEASLVVDKQKLAKAQAELQDNLKKRQANLQTVQAKYNQ
FT                   VASQLNLAAEEKAKIESNMKAVQETIAREQEAARIAAEERAKAEAAAKAEQEALAKAQA
FT                   EVAEKKKQEQASKPAEPVANNNSKVEPVQPSKPTAGGREIYVHATAYTADPAENGYGPG
FT                   QQVYSAWGGYNLTANPGMKLIAVDPSVIPLGSRVYVEGYGEAIAADTGGAIKGHKIDVL
FT                   MPDKASSSKWGRKNVKLTILS"
FT   gene            704630..704848
FT                   /locus_tag="BAA_0769"
FT   CDS_pept        704630..704848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0769"
FT                   /product="DNA-binding protein"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0769"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48071"
FT                   /protein_id="ACQ48071.1"
FT                   /translation="MTILNRVKELRARFNFSQSVLAEKVGVTRQTIAAIEKGDYVPSLL
FT                   LALMICDVFQLKMEDVFVLNKEGEEDE"
FT   gene            704841..705314
FT                   /locus_tag="BAA_0770"
FT   CDS_pept        704841..705314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0770"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0770"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47372"
FT                   /protein_id="ACQ47372.1"
FT                   /translation="MNRLVFSYMLNVLLMVLAGWAFIELYYFTIEVANFIQTKRVPFEV
FT                   SVSLMPLGLLLIFGIVSTVLYKVQKKKYKELSYWMFPLLFPQEDEREKAITEKACRTTF
FT                   MSLWYVLPCAVGFLTLSPIVNLYVPAYPIYIAFSIFFIQMTIFHVSLYRNKIA"
FT   gene            705431..706063
FT                   /locus_tag="BAA_0771"
FT   CDS_pept        705431..706063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0771"
FT                   /product="LPXTG-site transpeptidase family protein"
FT                   /note="identified by match to protein family HMM PF04203;
FT                   match to protein family HMM TIGR01076"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0771"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49512"
FT                   /protein_id="ACQ49512.1"
FT                   /translation="MNKQRIYSIVAILLFVVGGVLIGKPFYDGYQAEKKQTENVQAVQK
FT                   MDYEKHETEFVDASKIDQPDLAEVANASLDKKQVIGRISIPSVSLELPVLKSSTEKNLL
FT                   SGAATVKENQVMGKGNYALAGHNMSKKGVLFSDIASLKKGDKIYLYDNENEYEYAVTGV
FT                   SEVTPDKWEVVEDHGKDEITLITCVSVKDNSKRYVVAGDLVGTKAKK"
FT   gene            complement(706092..707477)
FT                   /locus_tag="BAA_0772"
FT   CDS_pept        complement(706092..707477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0772"
FT                   /product="proton/peptide symporter family protein"
FT                   /note="identified by match to protein family HMM PF00854;
FT                   match to protein family HMM PF07690; match to protein
FT                   family HMM TIGR00924"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0772"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48787"
FT                   /protein_id="ACQ48787.1"
FT                   /translation="MESAIQLEKEQQRKKKHPPGLYLLFFTEMWERFSYYGLRGLLTLY
FT                   LTTALVSGGLGFSPAWALSIYGFYTGACYFTPMIGGYLTDRFLGRRKAITIGGITMAIG
FT                   NLTLFAMQNQVGLYLGLALIIIGNGFFKPNISTLVGELYEENDPKRDSAFTIFYMGINV
FT                   GSFLAPLVCGFLSENLFKTTVDGVVHYGFRYGFLAASIGMIIGQILFTTLSNRFLGDIG
FT                   KKPTRDLQTTDGQPSVGDTPLTKKEKQRTAVIVILTCFVVFFWAGFEQAGSSLTLYTNK
FT                   FVDRSVFGWEVPTSWFQSVNPLFIILLAPVISALWAKLATRKRGDLKIPTKMGLGMILL
FT                   GIGYIILVIATLKTGSDEHNITEKANLLFIVFTYLFHTLGELFLSPVGLSMVSALAPVK
FT                   LASLLMGVWLASSGIANILGGQLASFTTSLGYAEVFTVIGAVAIVLGCVLLLISKKLVK
FT                   WMD"
FT   gene            707730..709031
FT                   /gene="brnQ1"
FT                   /locus_tag="BAA_0773"
FT   CDS_pept        707730..709031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="brnQ1"
FT                   /locus_tag="BAA_0773"
FT                   /product="branched-chain amino acid transport system II
FT                   carrier protein"
FT                   /note="identified by match to protein family HMM PF05525;
FT                   match to protein family HMM TIGR00796"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0773"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50934"
FT                   /protein_id="ACQ50934.1"
FT                   /translation="MKLLQKKEILLISLMLFSMFFGAGNLIFPPFLGYEAGEHVWISLV
FT                   GFIISATGLPILGVIAIAKAGSFQALAGRVHSSFAIIFPCIVYLFIGPGLGIPRAGSLA
FT                   FEMGPGQFFPEAGSIVLLCYTVIFFSIVYWLSLSPSKLMGLFGKVLTPLLLGMIALIFI
FT                   KSMFTSVGSVKEAAGNYGQAPMFQGFLDGYLTMDALAALIFGIVIANALRAKGIEDDKG
FT                   LAKYMSIAGIGAGLLLSIIYVILGYVGSMSGSLGTFDNGAQVLAQVMTTLFGQGGVVLL
FT                   GLIFTIACLCVSIGLVTSCSQFFASAFPKVAYKFWAFILSFVSMILANLGLTQILKVSV
FT                   PILGFIYPVALTLIILGLFQKYIGKYAYVYAVTVGIVAVFSAIDIFNKNVMLNQWTSVL
FT                   KYIPFYTEGVGWIVPAIIGACIGVIVSFVFNKKK"
FT   gene            709167..710888
FT                   /locus_tag="BAA_0774"
FT   CDS_pept        709167..710888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0774"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0774"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50227"
FT                   /protein_id="ACQ50227.1"
FT                   /translation="MKEDLNKKIEALETTIETMQEALFELKAKQREIEVENAQQHVSKE
FT                   KKEYIETVIEEKQKEEVVTIKEPVQEREVKQVDISAFKPEPFNIIKFCQTWLPRIFVGI
FT                   MLLGVIWLFKAGVDAGLLTPAIRIVFGIVLSMGFYYIGDIQIKRERQALGLVLAGGSIT
FT                   GIVLTTFAAHYLYGFIPASIAFVCNIAWVILGIYIAKRYQSEYLTIFVAVGAFFVPFLL
FT                   NSTTPNPYIFFGYETILTLSLLWYALKNRYQYLYMISYAVAAIVLFVFFAVMSMLVEDL
FT                   QVQLTVVYGLIHLLLFWHMFTERSFIVEPRLAIFSANAVFFILAISKILEFTTWGLMIS
FT                   ALVHANMFVFEYRKNRHSTFTNLLFGFAMGAFSLAILYEYSLVNAAIVLLLQGFLGMVT
FT                   SIKGKQQIKLYVSATVYAIGMIQTIFSPFDQFISAGFVAHLILIGTFYYCMRQAKDVLA
FT                   SFGKYVYSIALYWFMVIVFITITRIGEVLSTDGSIISVSVSLLWMVYALFAVWLGRNKH
FT                   MNEILYAGLIVLVVTIGKLFLLDLPEVSMMIRAVLFLIVGSIGIVISRMFFSKEEK"
FT   gene            complement(710924..712471)
FT                   /locus_tag="BAA_0775"
FT   CDS_pept        complement(710924..712471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0775"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0775"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49447"
FT                   /protein_id="ACQ49447.1"
FT                   /translation="MKNKKWITFSLATAITLSIGASFIPSTYAESSVDPAPEIAAKVVN
FT                   QNNGKKVLFDNTHGQTAGTADWVIDGGFSDFGNGIAQNGYHVKELRKSTPITYEDLKDY
FT                   NVFIVPEANIPYKKSEQDAMLQYVKNGGSIFFIADHYNADRNKNRWDSSEVFNGYRRGA
FT                   WDNPAKGMSNEEANSQAMQGVESSDWLSDNFGIRFRYNAIGDVAAKNIVSPEQSFGITE
FT                   GVSSVAMHAGSTLAITNPKLAKGLVYLPENPSKWNNAVDSGVYNGGGVAEGPYAAIAKV
FT                   GLGKAAFIGDSSPVEDATPKYVREDSGQTKKTYDGYKEENDAILLENIVNWLSNKETFT
FT                   SLDQVNGLQLDLPTTLQTFEQPSLSTEPQPEPWSAPNAGYQWFNTNTFKPGSYGYNGAV
FT                   TANDYVVTHPSILPNNEVFQMKIQVNNLLPNTTYDNYSLGIFTTGGTQVAKVQNTNGTW
FT                   PSTFGYSSAFSFTTNSLGSAEKIVNVQINPNTTGQATLRLRQNTTAKYSETVTINKK"
FT   gene            complement(712653..714044)
FT                   /locus_tag="BAA_0776"
FT   CDS_pept        complement(712653..714044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0776"
FT                   /product="amino acid permease family protein"
FT                   /note="identified by match to protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0776"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48863"
FT                   /protein_id="ACQ48863.1"
FT                   /translation="MQHSNKSGTLNRGLKERHITLMSLGSAIGVGLFLGSASAIKLAGP
FT                   SILLGYMIAGLVIFFIMRALGEMAIEQPVAGSFSKYAYDYLGPLAGYITGWNYWFLWVV
FT                   TCMAEITAAGIYMQYWFPDIPRWTWALLALLLMSAFNFLSVKVFGELEFWFALIKIVTI
FT                   ICMIVVGAGIILFGFGNGGIATGISNLWSHGGWFPNGFSGLLLSMQMVLFAYLGVELIG
FT                   VTAGEAQNPKKTLAKAIDNVFWRILLFYVGALFVMMAIYPWNELGEKGSPFVLTFQQIG
FT                   IAKAAGIINFVVLTAALSSCNGGLFSTGRMLYTLAQQKKAPERFGRLNKNGIPSQGIVA
FT                   TAIVLLIGVILNYLVPAKVFTWLTSISTFGAIWTWGIILVAQIKFRKSLPTQNRQKLSY
FT                   KMPLYPLSSYFSLAFLVLVLGIMAYSEDTRIALIVGPIWLIGLAIVYYMKGFHKIDETP
FT                   NSKIS"
FT   gene            714325..715617
FT                   /locus_tag="BAA_0777"
FT   CDS_pept        714325..715617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0777"
FT                   /product="xanthine/uracil permease family protein"
FT                   /note="identified by match to protein family HMM PF00860;
FT                   match to protein family HMM PF00916"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0777"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46313"
FT                   /protein_id="ACQ46313.1"
FT                   /translation="MFQLQKYNTSVKQEFLAGITTFFTFAYILVINPKILSDAGVPFDQ
FT                   AFTATIIATVVGTIGMAIFANYPIVIAPAMGMNAYFAYSVVQKAEGITYVIAFSAVFVT
FT                   GIIFLLLSFTSFRQKLILAIPDSLKHAIAGGIGLFIAFIGLRLFGIIVDHPSNLVTIGD
FT                   FHSPAVILTLIGLILAAVLMALRVSGALFISMIVTGVIAFFTGQLKFTDKIVAMPHLPE
FT                   GIIVSNPINAFSDVIEYGLYGVVFSFLLVLLFDTTGALLGLIKQAGLITDNTEKRFGKA
FT                   FIADAIGGTTGSIFGTSPTAATIESSAGIAAGGKTGLTGIVVVGLTIITAFFSPVIASL
FT                   SSVAAITAPSLIIVGSLMAQSIRDINWNEFEDALPAFLIFVGIPLTSSIANGIAIGFLV
FT                   YPVLKIVKGKGMEVHPLLYLFTILFGCHLFL"
FT   gene            715749..715949
FT                   /locus_tag="BAA_0778"
FT   CDS_pept        715749..715949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0778"
FT                   /product="DNA-binding protein"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0778"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48393"
FT                   /protein_id="ACQ48393.1"
FT                   /translation="MAVSKIKVARVQLDLTQQQLAEKVGVTRQTISLIEKGKYNPSLDL
FT                   CLKICYAVDKTLNDLFWEEKE"
FT   gene            715954..716382
FT                   /locus_tag="BAA_0779"
FT   CDS_pept        715954..716382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0779"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0779"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50223"
FT                   /protein_id="ACQ50223.1"
FT                   /translation="MKIVKDERLMIEGLKHIRLVFILQNIFILGIVFYRYVLQDAGYES
FT                   VSDLLMVFMGGIVVINFLNLKNSVEVYEHTGGVSRSYFMKLLLVPVSIVIGILAICIVV
FT                   TPDISIKEISMTGLIMFACFLVPSLFIYIYMKKIKSED"
FT   gene            complement(716420..716857)
FT                   /locus_tag="BAA_0780"
FT   CDS_pept        complement(716420..716857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0780"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0780"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49825"
FT                   /protein_id="ACQ49825.1"
FT                   /translation="MITVKNIDGSETYVLRQKILRSSQTLADCKYSSDYETDTFHLGAF
FT                   INDKLISIASFSKEMHPDLQAGMHYRLRGMATLPEFRNNHAGSSLIQKAEQILQERQAN
FT                   ILWCNGRVTVANYYKRLGFQEHGEIFEIEPIGLHKVLYKRI"
FT   gene            complement(716872..717093)
FT                   /locus_tag="BAA_0781"
FT   CDS_pept        complement(716872..717093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0781"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0781"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49102"
FT                   /protein_id="ACQ49102.1"
FT                   /translation="MSIITLALLLLAEILVAIILIGVSIEICSYGWKKSNGIKYSCLLL
FT                   SLLLGTASILGLFAAPAYFFIQLTEKAL"
FT   gene            complement(717183..719012)
FT                   /locus_tag="BAA_0782"
FT   CDS_pept        complement(717183..719012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0782"
FT                   /product="sodium/hydrogen exchanger family protein/TrkA
FT                   domain protein"
FT                   /note="identified by match to protein family HMM PF00999;
FT                   match to protein family HMM PF02080; match to protein
FT                   family HMM PF02254"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0782"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48688"
FT                   /protein_id="ACQ48688.1"
FT                   /translation="MEHHTSVLSLMVVVAIAFFVPLLLQRFKLKALPVVVAEIIAGIFV
FT                   GKSGFNIIEPDMWLQVLSTLGFIFLMFLSGLEIDFSIFKQKGKKNTTNEPNTFQAASVI
FT                   FLFIFILSYALSLLFVWLGFVDNAMFMTLIISTISLGVVVPTLKENNLGKTAIGQIILL
FT                   VAVIADLVTMILLAVFVGLNSESGQSMWLLLLLFGAGIVIYFVAKRFKNIPYLDSLKAG
FT                   SVQIDTRAVFALILILVGLSESVGAENILGAFLAGVLVSLLSPNEDMVEKLDSIGYGFF
FT                   IPIFFVMVGVNLEVWSIFKEPSSMLMIPILIVGLFISKLIPSLVLRKWYPRNIVLGSAI
FT                   LLTSTLSLVIAAAQIGEKLGIISPSLSASLILSAVITCIFAPILFKKMFPKVETPKPKV
FT                   SIIGASRITLPLSLDLKREDYDVTLYMMRQNKINDEEAKSHDFPIVKLDDITIASLTEQ
FT                   TAFHADRVVVATSDDEQNLLLAEHAKELGVEHVIASVEDPLLQEKATQEHIAVFSTINS
FT                   TRILLRALIDKPSLVRLITTANETVREVELRSNKYNGVALRRLPFLGDVLVIQIYRGNK
FT                   ALIPHGDTRLQHGDTLLVTGSKEHIDTLKSILE"
FT   gene            complement(719234..719545)
FT                   /gene="qoxD"
FT                   /locus_tag="BAA_0783"
FT   CDS_pept        complement(719234..719545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qoxD"
FT                   /locus_tag="BAA_0783"
FT                   /product="cytochrome aa3 quinol oxidase, subunit IV"
FT                   /EC_number="1.10.3.-"
FT                   /note="identified by match to protein family HMM PF03626;
FT                   match to protein family HMM TIGR02901"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0783"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47982"
FT                   /protein_id="ACQ47982.1"
FT                   /translation="MGQNNNQANGHAHSGFPWSHVFGFILSLALTFLALYVALYTNLPL
FT                   STILTTIIAMAVAQALLQLIMFMHLKEGEGRVQILTMIYSFFVATATVGLTVWIFFSM"
FT   gene            complement(719546..720148)
FT                   /gene="qoxC"
FT                   /locus_tag="BAA_0784"
FT   CDS_pept        complement(719546..720148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qoxC"
FT                   /locus_tag="BAA_0784"
FT                   /product="cytochrome aa3 quinol oxidase, subunit III"
FT                   /EC_number="1.10.3.-"
FT                   /note="identified by match to protein family HMM PF00510;
FT                   match to protein family HMM TIGR02897"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0784"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47578"
FT                   /protein_id="ACQ47578.1"
FT                   /translation="MAALDKSLPLEYQSEQSRLNILGFWIFLGAEIMLFATLFASYLVL
FT                   AGRTADGPTPAQLFELKTLLIQTLLLLTSSFTCGIVIHEMRKHNQKAMLGWFVLTLLLG
FT                   AGFLFFEIEEFIMYIGEGATIQTSAFLSGFFVLLGTHGAHVTGGIIWAICVIIQILKRG
FT                   LTPVTARKVFIISLYWHFLDLVWVFIYTLVYLNGMVA"
FT   gene            complement(720162..722096)
FT                   /gene="qoxB"
FT                   /locus_tag="BAA_0785"
FT   CDS_pept        complement(720162..722096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qoxB"
FT                   /locus_tag="BAA_0785"
FT                   /product="cytochrome aa3 quinol oxidase, subunit I"
FT                   /EC_number="1.10.3.-"
FT                   /note="identified by match to protein family HMM PF00115;
FT                   match to protein family HMM TIGR02882"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0785"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48570"
FT                   /protein_id="ACQ48570.1"
FT                   /translation="MKLDEFFVTGDPIIYGADASIVLVTLAIIFVLTKYKKWKWLWDEW
FT                   LTTVDHKKIGAMYIISAVIMLFRGGMDGLMIRAQLTFPETTYLNAEHYNGIFTTHGTVM
FT                   ILFMAMPFVMGLMNLVVPLQIGARDVAYPFLNALSFWLFFVGAMLFNIAFVIGGSPDAG
FT                   WTSYFPMAGTEFTSGVGNNYYAIALQISGLGTLMTGINFLVTILKMRTPGMTLMRMPMF
FT                   TWSILITTIIIIFAFPVLTVALALMTFDRLFDAHFFTMASGGMPMLWANLFWVWGHPEV
FT                   YIVILPAFGIFSEIISTFSRKRLFGYSAMVYSMVAISLLSFVVWLHHFFTMGAGPAVNS
FT                   FFSISTMAISIPTGVKIFNWLFTLYKGRIRFTVPMLWSLAFIPNFVVGGVTGVMLGMAA
FT                   ADYQYHNSYFLIAHFHYVLIAGTVFAMLAGFTFWYPKMTGHMLNERLGKWTFWIFMSGF
FT                   NICFFPMYFLGLDGMTRRMYTYSESLGWGWLNQIASVGAVMMGIGFLLLCYNVIWSARH
FT                   GERDTTGDPWDGRTLEWATQSPVQHYNFAKLPEIKEADAFWYMKKRGETVTPAAEDIKP
FT                   IHMPSNSGVPIIASGFFGLAGFALVFSWFWLAAIGGIGILACLIYRSFDYDEGYYISVD
FT                   EIKKSEHVA"
FT   gene            complement(722130..723005)
FT                   /gene="qoxA"
FT                   /locus_tag="BAA_0786"
FT   CDS_pept        complement(722130..723005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qoxA"
FT                   /locus_tag="BAA_0786"
FT                   /product="cytochrome aa3 quinol oxidase, subunit II"
FT                   /EC_number="1.10.3.-"
FT                   /note="identified by match to protein family HMM PF02790;
FT                   match to protein family HMM TIGR01432"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0786"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49690"
FT                   /protein_id="ACQ49690.1"
FT                   /translation="MQLKKAFWKLASLLPLSLLLFLGGCDKKLAVLNPQGPVAKAQYDL
FT                   IVWSFLLMSLIIAIVFILFTVILIRYREKPENMDYEPPEQHGNTLLEIIWTLVPVIIVI
FT                   ALSIPTVKATYASEEVPKESKHIKPVEIYVTSANWKWLFSYPEEKIETVNYLNIPAGVP
FT                   IQFKLTSVGPMNAFWVPELGGMKYTMDGMIMDLYLQADKPGSYLGRSANFSGEGFTHME
FT                   FEVEAKTKEKYDKWVKEVQQTAPKLTEDKYNEIVKPGVVGRMTFSSHHLSYVDPKSLEY
FT                   CDYNYYKNKK"
FT   gene            723541..724251
FT                   /locus_tag="BAA_0787"
FT   CDS_pept        723541..724251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0787"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0787"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50698"
FT                   /protein_id="ACQ50698.1"
FT                   /translation="MKKLKYLFVFGIIFAAVFFIGKDKIIQKAQVLRLDFLSEMKEAAM
FT                   IENVPFIKQLPELPRGCEVTSLAMLLQYKGVQVDKMQLASEIHRVPFEQDGLRGNPYEG
FT                   FVGNIYTKAEPGYGVYNKPIFNLAEKYVSEKVINLTDRDVNDLYKVISSGSPVWVIINT
FT                   TFKPLAESSFETWNTSSGEVKITYFEHSVVVVGYDQNFVYVNDPLKNNPRFAVPRAEFE
FT                   KAWEQMGKQAITIL"
FT   gene            724384..725559
FT                   /locus_tag="BAA_0788"
FT   CDS_pept        724384..725559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0788"
FT                   /product="N-acyl-L-amino acid amidohydrolase"
FT                   /note="identified by match to protein family HMM PF01546;
FT                   match to protein family HMM PF07687; match to protein
FT                   family HMM TIGR01891"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0788"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50099"
FT                   /protein_id="ACQ50099.1"
FT                   /translation="MDVAKELVLSKDQLVEWRRHFHKYPELSFQEEKTSQFVFDILRKI
FT                   PCLEVSRPTKYSVMARLIGKQSGKTIAVRADMDALPIHEENEFDFISAYPGVMHACGHD
FT                   GHIAILLGVVHKLVEAREKIKGEVRFLFQHAEENFPGGAEEMVAAGVMEGVDYIVGAHL
FT                   WASLEVGKVGVIYGPAMAAPDVFKITIEGKGGHAGIPHETVDSIAIGTQVVSQLQQIVS
FT                   RLTNPLDSLVVSVTQFHAGTTHNVIPAQTEIEGTVRSLRHELREETEKRIEQIVKHVTE
FT                   AYGAKYTFSYEYGYRPVVNDYEVTEIIEQTALQLYGRERVTRLQPTMAGEDFSAFLQKV
FT                   PGTFFFIGAGSKEKGIIYPHHHPRFTIDEDALPIGVQVFVSSIMNFISKGE"
FT   gene            725561..725758
FT                   /locus_tag="BAA_0789"
FT   CDS_pept        725561..725758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0789"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0789"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49924"
FT                   /protein_id="ACQ49924.1"
FT                   /translation="MKKIHVLALIPVFCLVVGPVFANSVTPYILGMPFLLFWILLSVLI
FT                   TSLCMGIVYVFDPANKGDVK"
FT   gene            725755..727227
FT                   /locus_tag="BAA_0790"
FT   CDS_pept        725755..727227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0790"
FT                   /product="sodium/solute symporter family protein"
FT                   /note="identified by match to protein family HMM PF00474"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0790"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46831"
FT                   /protein_id="ACQ46831.1"
FT                   /translation="MTALLIIILFLFLALFLGIRAQHGKDMNLEQWSVGGRGFGTIFVF
FT                   LLMAGEIYTTFTFLGGSGWAYSKGAPTFYILGYGALAYILSYFLLPPVWKYAKEHNLVS
FT                   QPDFFVKKYKSQALGLIVSIIGVISIIPYLVLQLKGLGIIVSEASYGRVSPVIAVWIGA
FT                   IVITIYVMVSGIHGSAWTAALKDIMILFIVMFLGIYLPYHYYGGFQPMFEAVEAAKPGF
FT                   LSLPDEGMSISWFVSTIILTALGFYMWPHTFASAFSAKNEKVFRKNAAIMPLYSLVLLF
FT                   VFFAGFAAILQVPGLKGGDVDLSLFRLALQTFDPWFIGIIGSAGVLTALVPGSMLVMAA
FT                   STLLAKNIYRTMVPSASDRQVAKVAKLFVPVVTLVAVLFTFKGGETIGALLLMGYSIVT
FT                   QLFPALVCSLFPRQTITKQGAIAGMGIGLLVVAYITLSGSTIATMFPGFPQYIKDLNVG
FT                   IVALLMNMIVMFIVSGFTKNVSIKKDNIIVEK"
FT   gene            727339..728808
FT                   /gene="gerLA"
FT                   /locus_tag="BAA_0791"
FT   CDS_pept        727339..728808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerLA"
FT                   /locus_tag="BAA_0791"
FT                   /product="spore germination protein GerLA"
FT                   /note="identified by match to protein family HMM PF03323"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0791"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46455"
FT                   /protein_id="ACQ46455.1"
FT                   /translation="MLELKGNLFEVMKKIRDELGSPNDLTIREVALAGSFTRCAVVFLC
FT                   GLTDKDNVYKYVVRTLQYEEIQKDEAVVQTLLDRFISIAEVGKKTTFPDIINAILAGDT
FT                   VILIDNIQTAIVINSRAWEKRSLESPVTEDLIRGPRIGLNEDINVNKMLIRRSLRDPKL
FT                   RFQSYIMGKRSQKEVTLVYIEDIINPYIVKELDRRLQSIVTDVVFETGTIEQLIQDNNL
FT                   SPFPQFLNTERPDNIVASLAKGKAAILVDGSPFALIAPLVFVDIFQSVEDHYERWVIGT
FT                   LLRILRMGSGIVAILMPAMYVALVSYHQGLIPSKLAYSIAGAREGVPFPAYIETLMMAL
FT                   TMELIREAGIRLPKPMGQTIGIVGGLVIGEAAVNAGIVNPFLVIIIAVTAIATFSLPVY
FT                   SITITFRILLFVFVLAATAFGLYGIILALIALAVHITNLTSVGVPYTTPIAPAFYKDWK
FT                   EEFIRMPKSMLKERPEYLQTKDSTVRPKERE"
FT   gene            728809..729933
FT                   /gene="gerLB"
FT                   /locus_tag="BAA_0792"
FT   CDS_pept        728809..729933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerLB"
FT                   /locus_tag="BAA_0792"
FT                   /product="spore germination protein GerLB"
FT                   /note="identified by match to protein family HMM PF03845;
FT                   match to protein family HMM TIGR00912"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0792"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47837"
FT                   /protein_id="ACQ47837.1"
FT                   /translation="MKPFEYGDEEIGSREIGFAVSSTIIGIGALSMPRDIANQTLFSDG
FT                   WIILLLGGLICAVLGWFVTRVAILFPKQNFVQYTSAHLTKPVAYTISMVLVLTFAALTA
FT                   YESRMIAIISQTYLFSETPVQLLSFFFLLVVIYGIAGSRAALLRLNVMFLPIVLIAIVL
FT                   LSLLNINLMEINNLFPAFQTEVSQYAVGVKNSIFTFIGFEVALFYAVLLNDKTAKKAPM
FT                   AVAKAVIVNVLSYILIYVTCISVFTYMTTRGLTYPTIELGKEIEIGGGFLERFDAIFFT
FT                   TWIITIYNTTAMYYDVASLLFCAMFPKVKKHIFIFGSAPLIFMLNMLPGNLDTLSSYGT
FT                   YLAWIDMGFVVLAPLLVFIVYKIKRRNGRNETPS"
FT   gene            729941..731083
FT                   /gene="gerLC"
FT                   /locus_tag="BAA_0793"
FT   CDS_pept        729941..731083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerLC"
FT                   /locus_tag="BAA_0793"
FT                   /product="spore germination protein GerLC"
FT                   /note="identified by match to protein family HMM PF05504;
FT                   match to protein family HMM TIGR02887"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0793"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47547"
FT                   /protein_id="ACQ47547.1"
FT                   /translation="MVIVLAGSISGCSELEEIEERGFVVGAAYDIVKKKKSNPIMKGTY
FT                   QMVLPSKLAQQGGQGDGDSENYINVSAKADSVFEQIRIIAKKISRTLFFPHIQVIIFSD
FT                   KLLANPYVLQNTLDVYFRDHEMRRNIRLFVSKKNAESILKQSAKPENLPAQYIDMLAEH
FT                   PPKNAQMIEAARIGEVQGKMIADRSFALPLLGLTKQGVQMEGAALIRGKDNKCVGTLSG
FT                   EQTLGMNYVIGKKIGGFFTVRKKNQLITYEIHKLRRKIQVSTENATKPKFDIHLSTEGI
FT                   LAELHFNEPKQVMNEKFLKKEISKEMKKRIEKSIQLVQKKYKVDVLELGEVYKRHNYKE
FT                   WKKISKNWDQGQNYFSNAEINVHVDPTIEHSGSALPKKVK"
FT   gene            731095..731232
FT                   /locus_tag="BAA_0794"
FT   CDS_pept        731095..731232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0794"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0794"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49664"
FT                   /protein_id="ACQ49664.1"
FT                   /translation="MFTGLGISCTILIAILPGAIYFIHKKLTTYGAQPWNTDVQKKKPE
FT                   "
FT   gene            complement(731294..732694)
FT                   /locus_tag="BAA_0795"
FT   CDS_pept        complement(731294..732694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0795"
FT                   /product="ferrous iron transport protein B"
FT                   /note="identified by match to protein family HMM PF02421;
FT                   match to protein family HMM PF07664; match to protein
FT                   family HMM PF07670"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0795"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49667"
FT                   /protein_id="ACQ49667.1"
FT                   /translation="MESHSASKALPLDYIIQHAQTLSKEDIRDDIVGDIYRTSASICKE
FT                   SVQYTNTDKLYRSEKLDKIFTSPIWGFPIMLGILSIIFYLTIAGANVPSDMIAEFFGWA
FT                   EGYLTSWFHAAHAPEWLHGILILGLFRGIGAVISVMLPPMAIFFPMFALLENYGYLPRV
FT                   AFNMDRLFKRSGAHGKQSLTMAMGFGCNAAAIMSTRIIESPRERLLAILTNNFVPCNGR
FT                   WPMLILMASLFMAAGYTGSMQTLVTAGVVVGMVVIGIIMTLTVSWVLSKTALKGVPTHY
FT                   TLELPPYRKPKVWNTIVRATLDKSVYVLKRAVVVAAPAAALTWLLANIFIGDTSLLMYF
FT                   VNFLDPFAKMLGLDGFILAAFILGLPANEIVIPILLMSYLSTGALTEIDDFNQIKNLFL
FT                   ENGWTWLTALNTMLFSLLHFPCGTTLVNIYKETKSAKWTFLSFAIPTVIAIVVTFLSTQ
FT                   LVHWLGLV"
FT   gene            complement(732672..733394)
FT                   /locus_tag="BAA_0796"
FT   CDS_pept        complement(732672..733394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0796"
FT                   /product="ferrous iron transport protein B, N-region"
FT                   /note="identified by match to protein family HMM PF01926;
FT                   match to protein family HMM TIGR00231"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0796"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47491"
FT                   /protein_id="ACQ47491.1"
FT                   /translation="MSKHRIALAGNPNTGKSTLFNTLTGLKQHTGNWTGKTVLKAEGEY
FT                   EHNGSKYTLIDLPGTYSLYSNSADEEVARDYIIFEKPEVTVVVIDATAMERNLNLALQV
FT                   MEMTSNVVICINLIDEAEKKGIVIDEKKLAKSLGVPVVKISARNRVGIGHLLNVIAKVA
FT                   NKKLIPTPIKVTYSEKIENMIRELEPQIYKVFGDTYPARWIALRILDGDKNFLTALQKH
FT                   HNEPLVREVVINGISLSQ"
FT   gene            complement(733391..733648)
FT                   /locus_tag="BAA_0797"
FT   CDS_pept        complement(733391..733648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0797"
FT                   /product="putative ferrous iron transport protein A"
FT                   /note="identified by match to protein family HMM PF04023"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0797"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49172"
FT                   /protein_id="ACQ49172.1"
FT                   /translation="MVSANTKPLSEFKTGEFVQIEKIQLEGTMKRRLLDLGFIPGATIK
FT                   VLQRSPLGDPVAYQVSNTTIALRKEESSLIFGVLIGDDFR"
FT   gene            734161..735060
FT                   /locus_tag="BAA_0798"
FT   CDS_pept        734161..735060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0798"
FT                   /product="putative phosphate ABC transporter,
FT                   phosphate-binding protein"
FT                   /note="identified by match to protein family HMM PF01547;
FT                   match to protein family HMM TIGR02136"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0798"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48500"
FT                   /protein_id="ACQ48500.1"
FT                   /translation="MVMKKGIKFSLAALVVAGSLVGCGKAEETSGKDAKGSDNAKQELS
FT                   GTIAAAGSTALQPLAEEAGKKFMEKNSNVSIQVQGGGSGTGINQVASGAVQIGNSDVPS
FT                   ADKIKDADKAKELVDNKVAGIAFALVVNKDVKVDNLTVQQVQDIFTGKVTNWKEVGGKD
FT                   EKINVINRPASSGTRATFEKTIMKDAKINDGTGTTQDSNGAVEQAINSTPGSVSYLAMS
FT                   YMVGEKKGALQTVKIDGAEPKVENIASGKYPFWSYEYMVTKGEAKEATKAYIDYVKGKD
FT                   FEKQVEDMGYIPMSKLNK"
FT   gene            735131..736021
FT                   /locus_tag="BAA_0799"
FT   CDS_pept        735131..736021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0799"
FT                   /product="putative phosphate ABC transporter, permease
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR02138"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0799"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50612"
FT                   /protein_id="ACQ50612.1"
FT                   /translation="MKGKKQINYVKSEYIGRSLVTFCGIFIVLVTLAIIAFICGKGIQS
FT                   FTQSGISFTEMLTSTKWSPNADEGTFGAVIFIVGSTVVSLGAVIISAPIAIALAIFMNL
FT                   ISPKFGNKVLKPVLELLVGIPSVVYGLLGVTILVPLLRDSFGGVGFSLIAGIVVLSIMI
FT                   LPTIASIASDAIRSVPFDYLEASYGLGSTKWQAISRVIVPAAKKGILTGVVLGLARAFG
FT                   EALAVQMVIGNTIKLPEGIYSPTATLTGILTMDMTNTLNGTAWNNALWTLAMILLVISF
FT                   LFILVIRAIGQRGER"
FT   gene            736024..736944
FT                   /locus_tag="BAA_0800"
FT   CDS_pept        736024..736944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0800"
FT                   /product="putative phosphate ABC transporter, permease
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR00974"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0800"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49938"
FT                   /protein_id="ACQ49938.1"
FT                   /translation="MNARTVNKVWTGIFYAIAALVVALLVFLVFEILQKGWGFWDPNFL
FT                   FGEPSNTRAGGGIGPQLFNSFYMLVITLIISIPLGLGAGIYLAEYAKQGRFLNFVRLCI
FT                   ETMASLPSIVVGLFGLLVFVTMTGWGYTVMGGALALTILNLPGLTRVCENAISEVPSNV
FT                   KEASLGLGATKWQTITRIIIPSSLPQIITGVILAAGRIFGEAAALIYTAGLTSPILNSA
FT                   ADFSSPAHPLNPFRPAETLAVHIWKLNSEGIIPDAKLIATKSAAVLIIMVLLFNVISRL
FT                   VASILHKRFTGAKRKSKTTKKVKAA"
FT   gene            737130..737654
FT                   /locus_tag="BAA_0801"
FT   CDS_pept        737130..737654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0801"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0801"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50172"
FT                   /protein_id="ACQ50172.1"
FT                   /translation="MFFLQMSGFPGSGKSTVSKYIGELTGAIIVDHDVLKSALLRSLEV
FT                   KGIESTIIGGLAYDAEWALIDSYLEQGHSVILDSPCLYEGMVGKGIKLSNKHGVKYKYI
FT                   ECYLNDMEEINMRLQTRKRLVSQIEKVESEVAFKKWLDGGKRPLNSEYLIVNSSEPLER
FT                   YAEKMMDYMSR"
FT   gene            complement(737698..740742)
FT                   /locus_tag="BAA_0802"
FT   CDS_pept        complement(737698..740742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0802"
FT                   /product="transporter, AcrB/AcrD/AcrF family"
FT                   /note="identified by match to protein family HMM PF00873"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0802"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46749"
FT                   /protein_id="ACQ46749.1"
FT                   /translation="MDRLTKFSLKNRAAVIIMVFLISILGVYSGSKLPMEFLPSIDNPA
FT                   VTVTTLSPGLDAEAMTKEVTDPLEKQFRNLEHIDNITSSTHEGLSRIDIAYTSKANMKD
FT                   ATREVEKAINTIKLPKDATKPIVSQLNTTMIPLAQIAIQKQNGFSKADEKQIEKEIVPQ
FT                   LESIDGVANVMFFGKSTSELSIILDPNQLKDKNVTTEQILKVLQGKETSTPAGAVTVNK
FT                   EEYNLRVIGDIKNVDDIKNITVAPHVKLQDVAQIELKQHYDTISHINGEEGTGLIIMKE
FT                   PSKNAVAIGKEIDKKIKDISKQYKDQFSIKLLASTHEQVENAVTSMGKEVILGAIAATL
FT                   IILIFLRNFRTTLIAVVSIPLSILLTLFLLHQSNITLNTLTLGGLAVAVGRLVDDSIVV
FT                   IENIFRRLQKEYFSKDIILDATKEVAVAITSSTLTTVAVFLPIGLVSGVIGKLMLPMVL
FT                   AVVYSILSSLIVALTVVPLMAFLLLKKIKHKKPSSSPRYVATLKWALSHKFIILLTSFL
FT                   LFAGSIAAYVLLPKANIKSEDDTMLSINMTFPADYALETQKQKAFDFEKKLLSNSDVTD
FT                   VILRMGSSAEDAQWGQTTKNNLASIFVVFKKGSDIDQYIKELKKEHNAFEPAELDYIKT
FT                   SYSSSGGGNNLQFNVTATNETNLKKAATIVETKLKNMDDLSKVKTNLEDSKKEWQIHVD
FT                   QTKAEQLGLTPELAAQQVAFLMKKSPIGEVSINNEKTTIMIEHKKESITKQEDILNTNI
FT                   LSPINGPIPLKDIATISEKQLQTEVFHKDGKETIQITAEASNEDLSKVSAEVNKAITDL
FT                   DLPSGAKVNIAGATESMQENFTDLFKIMGIAIGIVYLIMVITFGQARAPFAILFSLPLA
FT                   AVGGILGLIISGTPVDVNSLIGALMLIGIVVTNAIVLIERVQQNREHGMETREALLEAG
FT                   STRLRPIIMTAITTIVAMLPLLFGQSQAGSMVSKSLAVVVIGGLAVSTVLTLVVVPVMY
FT                   ELLDKIGRKRRSRRKINTSTETPDI"
FT   gene            741463..742971
FT                   /gene="rrs_10"
FT                   /locus_tag="BAA_0803"
FT   rRNA            741463..742971
FT                   /gene="rrs_10"
FT                   /locus_tag="BAA_0803"
FT                   /product="16S ribosomal RNA"
FT   gene            743150..746057
FT                   /gene="rrl_10"
FT                   /locus_tag="BAA_0805"
FT   rRNA            743150..746057
FT                   /gene="rrl_10"
FT                   /locus_tag="BAA_0805"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(743174..743605)
FT                   /pseudo
FT                   /locus_tag="BAA_0804"
FT                   /note="conserved hypothetical protein; this region contains
FT                   one or more premature stops and/or frameshifts"
FT   gene            746159..746274
FT                   /gene="rrf_10"
FT                   /locus_tag="BAA_0806"
FT   rRNA            746159..746274
FT                   /gene="rrf_10"
FT                   /locus_tag="BAA_0806"
FT                   /product="5S ribosomal RNA"
FT   gene            746279..746356
FT                   /locus_tag="BAA_0807"
FT   tRNA            746279..746356
FT                   /locus_tag="BAA_0807"
FT                   /product="tRNA-Val"
FT   gene            746367..746441
FT                   /locus_tag="BAA_0808"
FT   tRNA            746367..746441
FT                   /locus_tag="BAA_0808"
FT                   /product="tRNA-Gln"
FT   gene            746446..746521
FT                   /locus_tag="BAA_0809"
FT   tRNA            746446..746521
FT                   /locus_tag="BAA_0809"
FT                   /product="tRNA-Lys"
FT   gene            746535..746620
FT                   /locus_tag="BAA_0810"
FT   tRNA            746535..746620
FT                   /locus_tag="BAA_0810"
FT                   /product="tRNA-Leu"
FT   gene            746646..746720
FT                   /locus_tag="BAA_0811"
FT   tRNA            746646..746720
FT                   /locus_tag="BAA_0811"
FT                   /product="tRNA-Gly"
FT   gene            746736..746826
FT                   /locus_tag="BAA_0812"
FT   tRNA            746736..746826
FT                   /locus_tag="BAA_0812"
FT                   /product="tRNA-Leu"
FT   gene            746828..746906
FT                   /locus_tag="BAA_0813"
FT   tRNA            746828..746906
FT                   /locus_tag="BAA_0813"
FT                   /product="tRNA-Arg"
FT   gene            746913..746989
FT                   /locus_tag="BAA_0814"
FT   tRNA            746913..746989
FT                   /locus_tag="BAA_0814"
FT                   /product="tRNA-Pro"
FT   gene            747002..747079
FT                   /locus_tag="BAA_0815"
FT   tRNA            747002..747079
FT                   /locus_tag="BAA_0815"
FT                   /product="tRNA-Ala"
FT   gene            747096..747188
FT                   /locus_tag="BAA_0816"
FT   tRNA            747096..747188
FT                   /locus_tag="BAA_0816"
FT                   /product="tRNA-Ser"
FT   gene            747243..747335
FT                   /locus_tag="BAA_0817"
FT   tRNA            747243..747335
FT                   /locus_tag="BAA_0817"
FT                   /product="tRNA-Ser"
FT   gene            747355..747433
FT                   /locus_tag="BAA_0818"
FT   tRNA            747355..747433
FT                   /locus_tag="BAA_0818"
FT                   /product="tRNA-Met"
FT   gene            747436..747513
FT                   /locus_tag="BAA_0819"
FT   tRNA            747436..747513
FT                   /locus_tag="BAA_0819"
FT                   /product="tRNA-Asp"
FT   gene            747520..747597
FT                   /locus_tag="BAA_0820"
FT   tRNA            747520..747597
FT                   /locus_tag="BAA_0820"
FT                   /product="tRNA-Phe"
FT   gene            747605..747682
FT                   /locus_tag="BAA_0821"
FT   tRNA            747605..747682
FT                   /locus_tag="BAA_0821"
FT                   /product="tRNA-Thr"
FT   gene            747684..747759
FT                   /locus_tag="BAA_0822"
FT   tRNA            747684..747759
FT                   /locus_tag="BAA_0822"
FT                   /product="tRNA-Trp"
FT   gene            747765..747843
FT                   /locus_tag="BAA_0823"
FT   tRNA            747765..747843
FT                   /locus_tag="BAA_0823"
FT                   /product="tRNA-Ile"
FT   gene            747850..748002
FT                   /locus_tag="BAA_0824"
FT   tRNA            747850..748002
FT                   /locus_tag="BAA_0824"
FT                   /product="tRNA-Glu"
FT                   /note="may contain an intron"
FT   gene            748137..748556
FT                   /locus_tag="BAA_0825"
FT   CDS_pept        748137..748556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0825"
FT                   /product="CBS domain protein"
FT                   /note="identified by match to protein family HMM PF00571"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0825"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48210"
FT                   /protein_id="ACQ48210.1"
FT                   /translation="MTRVRDVMSTHIVQCTPLDNVYEAAVKMKEESIGLIPVVENEQVV
FT                   GLVTDRDLVVRGIAEKHPGSNKITNVMTTNIISVAPDDSLEKATELMAQHQIRRLPVVE
FT                   SDQLVGMLALGDLAIRESADDQAGFALSEISEHTE"
FT   gene            748851..750002
FT                   /locus_tag="BAA_0826"
FT   CDS_pept        748851..750002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0826"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0826"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47154"
FT                   /protein_id="ACQ47154.1"
FT                   /translation="MKAVQRDPNWNLVTDTYIEPNNFAELFSLLVPCHPKGEGKERTIL
FT                   VWKEKEFYKEENLAAFIVYGMNKAKNLPQFHKDEIPTLVRILRLCQEIGWYEEANTFMV
FT                   NQGLAEFVHTSLEYETWDLLTQAVALNYLIIKYRIGELTDGDVEIWDRVKFNEKCITDC
FT                   KHLLSHKEVLEFTFFYMCKRAKSLSKEQLNSDMMSLAMYCNTFVYDLYTYDLLRKYRKC
FT                   TDFLSYYGPSQAVLACQRAVLSQISDRLDPLKTTHVDDYLYVMKDMMEHMTIGIMDRYD
FT                   HFIGKLLSYVPFFEMIQVPQHAYYCEELLYICKGIAYKEEILRNYLFIQLHDCLPSFFK
FT                   LFLKNKRYATIHDILFYWCDDEQRMSLERKYNLSFIYEKYACG"
FT   gene            complement(750061..750216)
FT                   /locus_tag="BAA_0827"
FT   CDS_pept        complement(750061..750216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0827"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0827"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46326"
FT                   /protein_id="ACQ46326.1"
FT                   /translation="MYQSFKDNPLKYILNLYKKINTFFGIQGSYTAQSLLYGMLFLVLI
FT                   TFSLLY"
FT   gene            complement(750231..750563)
FT                   /locus_tag="BAA_0828"
FT   CDS_pept        complement(750231..750563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0828"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0828"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48518"
FT                   /protein_id="ACQ48518.1"
FT                   /translation="MPRNIPLLIEYLAFLGLICCLIIYNTNTLFLSIIIAFVALEIMME
FT                   AFQVQLKQKIAHIYNAIFLLSALITNIISNGFYLTTVFPVFFMAILLFIARYIHVPNNK
FT                   KHEQEA"
FT   gene            complement(750569..751729)
FT                   /locus_tag="BAA_0829"
FT   CDS_pept        complement(750569..751729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0829"
FT                   /product="peptidase, M23/M37 family"
FT                   /note="identified by match to protein family HMM PF01551;
FT                   match to protein family HMM PF08239"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0829"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49211"
FT                   /protein_id="ACQ49211.1"
FT                   /translation="MNMKATALTATTVAIASLLPSMGETNVQTANAEQLSNVKTGYVKV
FT                   HQVALHTKDNANSSSIDTIRFNTKVNILETTNGWYKVSVNNKVGYVQKDSILLKNKLQS
FT                   NNQYIVNANALNVRSEPNLESSILDVLPNGKFVTIQEEQGEWYKILHNGKAGYVQKAFV
FT                   SNDSQPLVKGITVQNNTKYTVATPKLNVRSNASTSSALLGSLQNGTQLQVVETVGTWYK
FT                   IRFGTGYGYVAKHYVVQNQTQSQTQTAQPTSIPAVFKFPTQGRISSTFDMRWEQMHYGI
FT                   DIAAQGNVSIQAAAAGKVVKSYYSASYGNVVFIAHQINGKLYTTVYAHMKDRTVQAGDQ
FT                   VQAGQLVGHMGNTGHSYGQHLHFELHNGEWNFEKTNAVNPLPYLVR"
FT   misc_binding    751999..752111
FT                   /bound_moiety="thiamin/thiamin pyrophosphate"
FT                   /note="TPP riboswitch (THI element)"
FT   misc_binding    752172..752275
FT                   /bound_moiety="thiamin/thiamin pyrophosphate"
FT                   /note="TPP riboswitch (THI element)"
FT   gene            752360..753055
FT                   /locus_tag="BAA_0832"
FT   CDS_pept        752360..753055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0832"
FT                   /product="putative transcriptional activator TenA"
FT                   /note="identified by match to protein family HMM PF03070"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0832"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47738"
FT                   /protein_id="ACQ47738.1"
FT                   /translation="MKFCDRLLETVQPVWEMSHNHPFVVGMGDGTLEKDKFQYYIIQDY
FT                   LYLLDYAKLYAIGVVKATNPQVMGKFAEQIDGILNGEMTIHKQYAKRLGISIEEIESAK
FT                   PSAKNLAYTNYMMSVSQNGTLAELIAALLPCMWSYWEIGKRLNDIPGARDHEFFGEWIQ
FT                   GYSSEEYGNLCIWLIDLLNEMAVGKSEKELDRLEEIFLYSSRFEYLFWDMSYRKEMWGF
FT                   EEQEHTTVS"
FT   gene            753024..753773
FT                   /locus_tag="BAA_0833"
FT   CDS_pept        753024..753773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0833"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0833"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48411"
FT                   /protein_id="ACQ48411.1"
FT                   /translation="MRSKNILQFHNVSFHYDEKPIINELNASIQDKEFVSIIGPSGCGK
FT                   STLFRLITGLEEASTGQIELTETKSHPVGYMPQKDMLLPWRTIIENAALPLECQGVQKK
FT                   EAQIKAKELLQKFGLQGYETKYPKDLSGGMRQRVSFIRTLLTGGEILLLDEPFSALDAL
FT                   TKASLQEWLFEQWKEWEKTILFITHDVEEALFLSNRIFVVENQPITTLTERIVPLDRNR
FT                   TRKDLYKPEVLALKDELLSMLQRQVLV"
FT   gene            753773..754525
FT                   /locus_tag="BAA_0834"
FT   CDS_pept        753773..754525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0834"
FT                   /product="putative ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0834"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48419"
FT                   /protein_id="ACQ48419.1"
FT                   /translation="MSRLKELIPALTLSSILLTMWEVGARIVDEMYILPSPSAIVMKIW
FT                   KLKDILFTVHLPATLYVVLIGVVISVVLGVGLAMLMNASSWMERAFYPLLVASQTIPIT
FT                   ALAPLFVLWFGYTIWSKVVVTVLITFFPIAVNTYDGLRSTKKEWEELLVTYGATKKDVF
FT                   LKLKLPSALPYFFSALKIAVPLSVIGAAIGEWLGAQAGLGYFSKRMMTQLDGAGVFAPI
FT                   VLLSLLAIFFVILISVLEKKFISWRKHS"
FT   gene            754522..755523
FT                   /locus_tag="BAA_0835"
FT   CDS_pept        754522..755523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0835"
FT                   /product="putative ABC transporter, substrate-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF09084"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0835"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46285"
FT                   /protein_id="ACQ46285.1"
FT                   /translation="MKFLKRIFVFTLLVAMIAGCSSNSASDKSKKEKEITVMLDWYPNA
FT                   VHSFIYAAIEKGYFKEEGVKVNIKFPSNPTDPLTLAAAGKVTVGLYYQPDVVMAKANEQ
FT                   IPVKSIGAVVRSPLNHVVSLKSAGIQSPKDLEGKTVGYFGTPLSEMYLKTMVKEAGGNP
FT                   DTVKVVDVGFDLVPALITKKVDAVTGAYINHEVPVMRHEGHEPAYFNPADYGVPNYHEL
FT                   VFVTGDKTLKKDKEALQAFLRGAKKGYDFMKKNPDEALNILLNHQEKENFPLVPEVEKE
FT                   SMKILLEKMETKDEPFLSDSKESWEKQNKWLKDKGMTKEIVPANELFENILK"
FT   gene            755534..756154
FT                   /gene="tenI"
FT                   /locus_tag="BAA_0836"
FT   CDS_pept        755534..756154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tenI"
FT                   /locus_tag="BAA_0836"
FT                   /product="regulatory protein TenI"
FT                   /note="identified by match to protein family HMM PF02581"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0836"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46948"
FT                   /protein_id="ACQ46948.1"
FT                   /translation="MKNELHVISNGHMSFEELVSVAMQIESEIDYLHIREREKSTKELY
FT                   EGVESLLKKGFPASKLVINDRIDIAILLNIPRVQLGYRSTDVRSVKEKFSYLHVGYSVH
FT                   SLEEAIEAFKNGADSLVYGHVFPTECKKGVPARGLEEISDIARSLSIPIIAIGGITPEN
FT                   TKDILASEVSGIAVMSGIVSSSNPYSKAKSYKESIRKWAEKHV"
FT   gene            756147..757256
FT                   /gene="thiO"
FT                   /locus_tag="BAA_0837"
FT   CDS_pept        756147..757256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiO"
FT                   /locus_tag="BAA_0837"
FT                   /product="glycine oxidase ThiO"
FT                   /EC_number="1.4.3.19"
FT                   /note="identified by match to protein family HMM PF01266;
FT                   match to protein family HMM TIGR02352"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0837"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50512"
FT                   /protein_id="ACQ50512.1"
FT                   /translation="MCKKYDVAIIGGGVIGSSVAHFLAERGHKVAIVEKQQIASEASKA
FT                   AAGLLGVQAEWDEYDPLFDLARESRAIFPQLAEVLREKTGIDIGYEEKGIYRIAQNEDE
FT                   KERILHIMDWQQKTGEDSYFLTGDRLREQEPYLSESIIGAVYYPKDGHVIAPELTKAFA
FT                   HSAAISGADIYEQTEVFDIRIENKKVIGIVTSEGMISCEKVVIAGGSWSTKLLGYFHRE
FT                   WGTYPVKGEVVAVKSRKQLLKAPIFQERFYIAPKRGGRYVIGATMKPHTFNKTVQPESI
FT                   TSILERAYTILPALKEAEWESTWAGLRPQSNHEAPYMGEHEEIKGLYACTGHYRNGILL
FT                   SPVSGQYMADLIEGKQENHLLDSLLSKTV"
FT   gene            757272..757475
FT                   /gene="thiS"
FT                   /locus_tag="BAA_0838"
FT   CDS_pept        757272..757475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiS"
FT                   /locus_tag="BAA_0838"
FT                   /product="thiamine biosynthesis protein ThiS"
FT                   /note="identified by match to protein family HMM PF02597;
FT                   match to protein family HMM TIGR01683"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0838"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46291"
FT                   /protein_id="ACQ46291.1"
FT                   /translation="MNLKINGNQIEVPESVKTVAELLTHLELDNRIVVVERNKDILQKD
FT                   DHTDTSVFDGDQIEIVTFVGGG"
FT   gene            757478..758248
FT                   /gene="thiG"
FT                   /locus_tag="BAA_0839"
FT   CDS_pept        757478..758248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiG"
FT                   /locus_tag="BAA_0839"
FT                   /product="thiazole biosynthesis protein ThiG"
FT                   /note="identified by match to protein family HMM PF05690"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0839"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46986"
FT                   /db_xref="GOA:C3P0L4"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3P0L4"
FT                   /protein_id="ACQ46986.1"
FT                   /translation="MLNIGPFSFHSRLLLGTGKFPDFDVQQKAIDVSEAEVLTFAVRRM
FT                   DIFDAKQPNLLEKLDVKKYKLLPNTAGAKNAEEAVRIAKLAKASGLCDMIKVEVIGDDR
FT                   TLLPDPVETLRASEMLLEEGFIVLPYTSDDVVLARKLQELGVHAIMPGASPIGSGLGIV
FT                   NPLNLSFIIEQATVPVIVDAGIGSPADAAFAMELGADGVLLNTAVSGAKDPIKMAQAMK
FT                   LSIEAGRLGFEAGRIARKRCATASSPLEGMSVVE"
FT   gene            758241..759260
FT                   /locus_tag="BAA_0840"
FT   CDS_pept        758241..759260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0840"
FT                   /product="hesA/moeB/thiF family protein"
FT                   /note="identified by match to protein family HMM PF00899;
FT                   match to protein family HMM PF05237; match to protein
FT                   family HMM TIGR02356"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0840"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49423"
FT                   /protein_id="ACQ49423.1"
FT                   /translation="MNNRYSRQELFSPIGEEGQQKIRKKHVLIIGAGALGSANAEMFVR
FT                   AGVGTVTIVDRDYVDWSNLQRQQLYVESDVENNLPKAVAAKKRLEEINSEVRVKALVQD
FT                   VTAEELEELVTNVNVMIDATDNFETRFIVNDIAQKYSIPWIYGACVGSYGLSYTILPSK
FT                   TPCLSCLLQSIPLGGATCDTAGIISPAVSLVVSHQVTEALKLLVEDYESLRDGLVSFDV
FT                   WKNEYSCMNVQKLRKHNCPSCGENALYPYLNKENTSKTAVLCGRNTVQIRPPYKEEMDF
FT                   ERYKELLNDRVNDLNVNPYLLSFSVEEKRLVAFKDGRVLVHGTKDISEAKTVYHRYFG"
FT   gene            759276..760088
FT                   /gene="thiD1"
FT                   /locus_tag="BAA_0841"
FT   CDS_pept        759276..760088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiD1"
FT                   /locus_tag="BAA_0841"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /EC_number="2.7.4.7"
FT                   /note="identified by match to protein family HMM PF08543;
FT                   match to protein family HMM TIGR00097"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0841"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49023"
FT                   /protein_id="ACQ49023.1"
FT                   /translation="MKVNKALTIAGSDSGGGAGIQADLKTFQELGVYGMTAITAITAQN
FT                   TLGVQGVYPVSLEGITEQLNSIGTDLTPDAVKIGMLFSSEIIQIVAEYINKFGWNNIVL
FT                   DPVMIAKGGASLLQQEAVQALKEYLLPVATVITPNVPEAEVLTGLEIHNIEDSKEAAKV
FT                   LHELGAKYVLMKGGHAEYQGNEVIDLLFDGEKFIEFRSERIPSKQTHGSGCTFASAVTA
FT                   GLAKGYSMEEAVQEAKRFISIAIEEPLHIGSGHGPTNHFAYKMNKAQV"
FT   misc_feature    760172..760319
FT                   /note="ydaO/yuaA leader"
FT   gene            760530..760799
FT                   /pseudo
FT                   /locus_tag="BAA_0843"
FT                   /note="hypothetical protein; this gene contains a premature
FT                   stop which may be the result of a sequencing error;
FT                   identified by glimmer; putative"
FT   gene            760822..761046
FT                   /locus_tag="BAA_0844"
FT   CDS_pept        760822..761046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0844"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0844"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50420"
FT                   /protein_id="ACQ50420.1"
FT                   /translation="MLLLGDIANRWAVSIERVQELVMLDPIFPKPYIILPSKDALYLKT
FT                   DVIEYEQLHAELSQVYIRGRNLRTFLRGE"
FT   gene            761076..761207
FT                   /locus_tag="BAA_0845"
FT   CDS_pept        761076..761207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0845"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0845"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46698"
FT                   /protein_id="ACQ46698.1"
FT                   /translation="MQQAMHFMSFALFISYLKDHFYEKARKDEKIDGIILIILNVSV"
FT   misc_feature    761308..761453
FT                   /note="ydaO/yuaA leader"
FT   gene            761754..763421
FT                   /gene="kdpA"
FT                   /locus_tag="BAA_0847"
FT   CDS_pept        761754..763421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpA"
FT                   /locus_tag="BAA_0847"
FT                   /product="K+-transporting ATPase, A subunit"
FT                   /EC_number="3.6.3.12"
FT                   /note="identified by match to protein family HMM PF03814;
FT                   match to protein family HMM TIGR00680"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0847"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45995"
FT                   /db_xref="GOA:C3P0L9"
FT                   /db_xref="InterPro:IPR004623"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3P0L9"
FT                   /protein_id="ACQ45995.1"
FT                   /translation="MIWVAVVITMLLFILVAKPTGIYLEKAFQGSKKLDKVFGPFEKLI
FT                   FKITGVKEYNQTWKQYALSLVLLNGFMIVVVYFIFRLQGVLPLNPAHIEGMEPTLAFNT
FT                   AISFMADTNLQHYSGENGLSYLSQLIGITFLMFAAPATTLALVMAFIRGLAGKELGNFF
FT                   IDFTRALTRVFLPIAFMAALVFVALGVPQTLDGAVTAQTIDGAKQSILRGPVASFVAIK
FT                   ELGNNGGGFFGANSTHPFENPGQMSNILQMMLMMLLPTALPFTYGRMVGNKKQGRILFV
FT                   SLFMVFLLGFITITTSELNGNPALNAMGIEHVQGSTEGKEVRFGTVFSSLYATVTTAAE
FT                   TGAVNTMHDTLTPIGGLVPLVNMMLNTVYGGVGAGFVNIIMYAIIAVFISGLMVGRTPE
FT                   FLGKKIEGKEMKLIAVTILFHPLLILGFSALALSTSLGTDAISHSGFHGLTQVVYEYTS
FT                   SAANNGSGFEGLGDNTPFWNITTGLVMFLGRYFSLITMLAVAASLKEKTVVPETVGTFR
FT                   TDNGLFGGIFIGTIVIVGALTFFPMLVLGPIAEFLTLK"
FT   gene            763435..765525
FT                   /gene="kdpB"
FT                   /locus_tag="BAA_0848"
FT   CDS_pept        763435..765525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpB"
FT                   /locus_tag="BAA_0848"
FT                   /product="potassium-transporting ATPase, B subunit"
FT                   /EC_number="3.6.3.12"
FT                   /note="identified by match to protein family HMM PF00122;
FT                   match to protein family HMM PF00702; match to protein
FT                   family HMM TIGR01494; match to protein family HMM
FT                   TIGR01497"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0848"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48127"
FT                   /protein_id="ACQ48127.1"
FT                   /translation="MRPVVVKEKRVNESHIHAVEDEVRQAKTMDRDIVKHAMKQSVAKL
FT                   NPKVMIKNPIMFVVEIGFVITFILSFLPSHSSSIPGWFNITVSLILLFTVLFANFAEAL
FT                   AEGRGKAQADSLKQSKKDVFANVVKENGEIVQVSATDLRKDDVVIVKQGEMIPSDGEVI
FT                   KGLASVDESAITGESAPVIKEAGGDFCSVTGGTMVVSDEITIVITSNPGKSFIDKMISL
FT                   VEGAARQKTPNEIALNTVLTSLTLIFLIVVVTLPIFTNYLGFQIDTAVLVALLVCLIPT
FT                   TIGGLLSAIGIAGMDRVTKFNVLAMSGKAVEAAGDINTIILDKTGTITFGNRMAHTLLP
FT                   VGNETIEQVGKWAAISSVLDETPEGRSVIEYVQAKSISYNRELAEQGEFIPFKAETRMS
FT                   GVDLQDGMKVRKGAVGSVIEWVRSQGGTIPKDVNQKADFISKEGGTPLVVAVDNRIYGL
FT                   IYLKDTVKPGMRERFEQLRQMGIKTVMCTGDNPLTAATIAKEAGVDEFVAECKPEDKIA
FT                   VIKAEQDKGKLVAMTGDGTNDAPALAQADVGLAMNSGTTAAKEAANMIDLDSNPTKIIE
FT                   VVGIGKQLLMTRGALTTFSIANDIAKYFAIIPAMFTLAIPQMEALNIMKLTSPLSAILS
FT                   ALLFNAVIIPLLIPLAMKGIAYKPMSSNALLGRNLLIYGLGGVIVPFIGIKVIDIIVGL
FT                   FI"
FT   gene            765542..766123
FT                   /gene="kdpC"
FT                   /locus_tag="BAA_0849"
FT   CDS_pept        765542..766123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpC"
FT                   /locus_tag="BAA_0849"
FT                   /product="K+-transporting ATPase, C subunit"
FT                   /EC_number="3.6.3.12"
FT                   /note="identified by match to protein family HMM PF02669;
FT                   match to protein family HMM TIGR00681"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0849"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47594"
FT                   /db_xref="GOA:C3P0M1"
FT                   /db_xref="InterPro:IPR003820"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3P0M1"
FT                   /protein_id="ACQ47594.1"
FT                   /translation="MAKKQSILSPIIRITFTFLVLCGLVYPLIVTGIAQAVMKDNADGS
FT                   LIYNDKNEVIGSKLIGQNFTDPRYFHGRVSSIEYKAEASGSNNYAPSNPDLEKRVEKSI
FT                   EEWKKQNPSVPVTEVPIDLVTNSGSGLDPDISPKAASVQVERISKLTNIPKETLDQLIK
FT                   DQTEGAALGLFGETRVNVLKLNLGLQKIMK"
FT   gene            766186..767334
FT                   /gene="kdpD"
FT                   /locus_tag="BAA_0850"
FT   CDS_pept        766186..767334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpD"
FT                   /locus_tag="BAA_0850"
FT                   /product="sensor histidine kinase KdpD"
FT                   /EC_number="2.7.13.3"
FT                   /note="identified by match to protein family HMM PF00582;
FT                   match to protein family HMM PF02702"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0850"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46553"
FT                   /protein_id="ACQ46553.1"
FT                   /translation="MLYADDYKPTFQRRTPEEYLEYIRQQNRGKLKLYVGAAPGVGKSY
FT                   KMLYDAREMKKDGMDIVIGLIETHGRKETEEAIADLEKVPLKEIQYKGKVFYELDVEGI
FT                   IKRAPQVVVVDELAHSNVPGSKNKKRYMDVQELIDAGISVLSAFNIQHLESVHDIVAQI
FT                   TNVKVRERIPDFILQKANEIQLVDATPEVLRKRLIDGKIYKEEKIQQSLQNFFTLNNLG
FT                   ALRELSLREVADDMDEKISQTVIEPIGVKEKILVCVQYSSTAEKLIRRGWRMADRLNAE
FT                   LYVLNVEREKIDSLSAGKKQTIEEWKSLTNQFDASFVLEEANGRKPADVIIEVAKRLQV
FT                   TQILLGQSARTRWDEIRKGSIVNEIMRETKYIDIHIVADQRA"
FT   gene            complement(767359..768540)
FT                   /locus_tag="BAA_0851"
FT   CDS_pept        complement(767359..768540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0851"
FT                   /product="major facilitator family transporter"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0851"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46075"
FT                   /protein_id="ACQ46075.1"
FT                   /translation="MKKSKLTFILYVVCMSALLGSFAQNIYTPILPMIQNSFHTSLYLV
FT                   NVTVSLFTFVLAIMQLIYGPLIDTKGRKSVLIPSLIISTIGSIGCAFSANIYLFLFFRA
FT                   VQAIGIAAIPVVAATIIGDLFEGKERGEAMSLYQMLLALAPAIGPLIGGYLGSINGHVS
FT                   VFLFLSILGILLLTINISLLPETKPTVSQQPQSKKNHWFILKNKTGFSITLIGFIQFCI
FT                   YFCFLVFLPSISTNLFHLTASEIGLMFVPMSLSIMLGSYCFKLLQKRFTTKQALFITSF
FT                   FNIICVTLFSFTYSINIPFIIIVTSLYGFSMGLSMPTHTTLLTEEFVQERATAIGMYNF
FT                   IRYLGMGTVPLVGGFLVFNQNYFWIFFLGAIMFLLIILYAMKMLRFPTTQKVK"
FT   gene            768681..769142
FT                   /locus_tag="BAA_0852"
FT   CDS_pept        768681..769142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0852"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="identified by match to protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0852"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47816"
FT                   /protein_id="ACQ47816.1"
FT                   /translation="MKHAMKQMEILSDIRTLLHKKEEHLKRQNEKFLYETGVSSMSLSE
FT                   LHVIECIGKNGLMNVTAITTEMGMTKGAISKICTKLFQKQFVEKMQMLDNQKEIFFRLT
FT                   ESGNEIYKAHEKLHKQAEEKWLLLLDRYTKEEQDFIQRFVKDVSDHLEI"
FT   gene            769271..770125
FT                   /locus_tag="BAA_0853"
FT   CDS_pept        769271..770125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0853"
FT                   /product="phospholipase, patatin family"
FT                   /note="identified by match to protein family HMM PF01734"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0853"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48383"
FT                   /protein_id="ACQ48383.1"
FT                   /translation="MLENTGLVLEGGGMRGVYTGGILEYFMEQDLYFPYVIGVSAGACH
FT                   AASYLSRQRNRNKTVNIDYASHPKYLSYKNLWRKRQLFDMDFIFHEIPEKHVPFDFETY
FT                   FNSPERFLVGTTDCETGQSVYFEKEGTNDDALNLLQASSSLPFIAPVVNYRGKQLLDGG
FT                   ISDPIPVRKAQEDGFKKSVVILTRNHGYAKKKSRFGWVAAKAYKKYPNLVNTMLNRYEV
FT                   YNETLHYIEKEEQAGNLFVIRPEVPLQVDRMEKDTAKLQSLYEQGYEDAKRQFADLKAF
FT                   LQK"
FT   gene            770295..770456
FT                   /locus_tag="BAA_0854"
FT   CDS_pept        770295..770456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0854"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0854"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46257"
FT                   /protein_id="ACQ46257.1"
FT                   /translation="MMLIFGGVFLLRWFIHDEMLLDQLIGCSVGMVMVISSVFIQKYSK
FT                   ELQVEEKY"
FT   gene            complement(770554..771855)
FT                   /locus_tag="BAA_0855"
FT   CDS_pept        complement(770554..771855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0855"
FT                   /product="xanthine/uracil permease family protein"
FT                   /note="identified by match to protein family HMM PF00860;
FT                   match to protein family HMM PF00916"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0855"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46964"
FT                   /protein_id="ACQ46964.1"
FT                   /translation="MFNLSKHKTSIKTEIMAGIITFLTMAYIIVVNPVILGDAGVPFEQ
FT                   AFTATIIAAVVGTLFMAIFTNLPIAIAPGMGLNAYFSYSVVKAHEGMTFAIAFSAVFVA
FT                   GMILILLSFTSFRTKLMEAIPENLKHAITAGIGLFIAFIGLRLTGIVTKNEANLVGLGD
FT                   LHSAPVLLALAGLGITIVLMSLNVNGALFIGMLLTGIIAFFTGQLTFSNGVTSMPGLPE
FT                   GIIVSNPITAVSDVINYGLYGVVFSFFLVTLFDTTGTLLGVAQQGGFMKDGKLPKAGRA
FT                   LLSDSFSATIGSMFGTTPSTAYIESSAGVAAGGRTGLTTVTVAVLFALAAFFGPLVSAV
FT                   SGVSAITAPSLIIVGSLMMGSVRHIDWDAFDEAFPAFLVILSMPLTSSIATGIALGFIS
FT                   YPLMKVAKGKFRAVHPLVYVFGILFAYQLIFLPH"
FT   gene            772057..772923
FT                   /locus_tag="BAA_0856"
FT   CDS_pept        772057..772923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0856"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0856"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49895"
FT                   /protein_id="ACQ49895.1"
FT                   /translation="MPQQKNFVTMPAQHQNKQPGIESLMNPLPQFEDPNYKGSEKLKGK
FT                   NVLITGGDSGIGRAVSIAFAKEGANIAIAYLDEEGDANETKQYVEKEGVKCVLLPGDLS
FT                   DEQHCKDIVQETVRQLGSLNILVNNVAQQYPQQGLEYITAEQLEKTFRINIFSYFHVTK
FT                   AALSHLKQGDVIINTASIVAYEGNETLIDYSATKGAIVAFTRSLSQSLVQKGIRVNGVA
FT                   PGPIWTPLIPSSFDEKKVSQFGSNVPMQRPGQPYELAPAYVYLASSDSSYVTGQMIHVN
FT                   GGVIVNG"
FT   gene            772990..773226
FT                   /pseudo
FT                   /locus_tag="BAA_0857"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            773352..773750
FT                   /pseudo
FT                   /locus_tag="BAA_0858"
FT                   /note="conserved domain protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error"
FT   gene            773855..774106
FT                   /pseudo
FT                   /locus_tag="BAA_0859"
FT                   /note="putative membrane protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            complement(774117..775058)
FT                   /gene="scrK"
FT                   /locus_tag="BAA_0860"
FT   CDS_pept        complement(774117..775058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="scrK"
FT                   /locus_tag="BAA_0860"
FT                   /product="fructokinase"
FT                   /EC_number="2.7.1.4"
FT                   /note="identified by match to protein family HMM PF00294"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0860"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46273"
FT                   /protein_id="ACQ46273.1"
FT                   /translation="MRNVFCIGELLIDFVCRNTNVSLVNGSNFEKKAGGAPANVAAAIT
FT                   KLGGHATFMGQVGNDPFGEFLEQTLQHAHVDTSMLIKDKQTTLAFVSIDQNGERDFTFM
FT                   RGADGEYHFNSIDLSKIKTNDLIHFGSATALLSSPLKDTYFQLLQHARESGQFISFDPN
FT                   YRNALITNTEQFIQDCLTFIKHAHFVKVSQEEAIMLSKESDLQQSALKLLNHGAKAVAI
FT                   TLGKDGTLLATKDKQTIVPSISIQQVDTTGAGDAFVGAMLYQIAKSEQMFLHNFEGLTT
FT                   FISFANKVGALTCTNYGAISSLPSLTDVKAYE"
FT   gene            complement(775055..776530)
FT                   /gene="scrB"
FT                   /locus_tag="BAA_0861"
FT   CDS_pept        complement(775055..776530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="scrB"
FT                   /locus_tag="BAA_0861"
FT                   /product="beta-fructofuranosidase"
FT                   /EC_number="3.2.1.26"
FT                   /note="identified by match to protein family HMM PF00251;
FT                   match to protein family HMM PF08244; match to protein
FT                   family HMM TIGR01322"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0861"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47151"
FT                   /protein_id="ACQ47151.1"
FT                   /translation="MSKYKTILQSNKDELHSLYEIANQDSWKPIYHIHPPFGLMNDPNG
FT                   VSYYNDEYHVFYQWYPFGPIHGMKHWGHVKSKDLINWERMPVAIIPTESYESHGAYSGS
FT                   AIVKDDLLHLLYTGNIKNPDDSRDAKQCMATMDSQYTMTKYSNNPVIDIIPDGYTKHVR
FT                   DPKVWKHNDIYYMLLGAQRKNKTGTLLLYKSKDLYNWNFQGEITTNLKEFGFMWECPDY
FT                   FQLSGKDVLLFSPQGIEKDREDFHNIYNVVYAIGHFDIKNLYFHIDSYYEADKGFDFYA
FT                   PQTLEDSTSRRLLFAWAGSSEITYPSDDYMWAHCLTLPRELTLEDNILKQKPVSELTKL
FT                   RTTKKEISGDITAGLNVLSTLDNEGSYELIVTLKTEDAKRFGLSLFHNEEECFPITFNR
FT                   EQGTISIDRGNFYHQFGGEYGFERCKKIDIQDTIELQIFVDKSIVEIFLYDGSTVFTSR
FT                   VFPRKDMKHHIAIFSDAKLNFTITQYKLKRGIV"
FT   gene            complement(776548..777924)
FT                   /gene="scrA"
FT                   /locus_tag="BAA_0862"
FT   CDS_pept        complement(776548..777924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="scrA"
FT                   /locus_tag="BAA_0862"
FT                   /product="PTS system, sucrose-specific IIBC component"
FT                   /EC_number="2.7.1.69"
FT                   /note="identified by match to protein family HMM PF00367;
FT                   match to protein family HMM PF02378; match to protein
FT                   family HMM TIGR00826; match to protein family HMM
FT                   TIGR01996"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0862"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48718"
FT                   /protein_id="ACQ48718.1"
FT                   /translation="MNMKQIATQVLQNIGGKENIMRATHCATRLRLVLKDETKINASEI
FT                   ENIDEVKGAFATTEQYQIIFGTGIVNKVYDEFSKLIGIAELDSTRSNDIPKKKMNPIAR
FT                   LAKTLSNIFVPIIPAIVASGLLMGLLGMLKAFKLVPGDHSLIQLLDMFSSAAFIILPIL
FT                   IGVSAAKEFGGNIFLGAVVGGILTHPSLTNPWTLSNAKPTVLHFLGMDIDMIGYQGTVL
FT                   PILLCVYVMSTIEKELRKRVPNSLDLLVTPFLTIIITGFLSLIIIGPIGYKIGDGITYL
FT                   LNTIYQFAGPVAGLIFGGLYSTIVLTGLHHSFHAIEAGLLANKDIGVNFLLPIWSMANV
FT                   AQGGATLAVYFKTKNKKTKEIAIPAAASAFLGITEPAIFGVNLKLGKPFIAAAIGGAIG
FT                   GAYVVWMQVAANAYGLTGIPMLTIVAPLGMMNMIHYIIGFAIAVTTAFVATFILYKESK
FT                   "
FT   gene            complement(778053..779039)
FT                   /gene="scrR"
FT                   /locus_tag="BAA_0863"
FT   CDS_pept        complement(778053..779039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="scrR"
FT                   /locus_tag="BAA_0863"
FT                   /product="sucrose operon repressor"
FT                   /note="identified by match to protein family HMM PF00356;
FT                   match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0863"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49243"
FT                   /protein_id="ACQ49243.1"
FT                   /translation="MTKTIADIAKLAGVAKSTVSRYLNGGYVSDKTKLKIESIIQETNF
FT                   SPNTFAQSLKAKTTNLIGVIIPRLDSFATMKTLIGIDNTLQENNYQMLVANANQTIETE
FT                   IQAMENFIKQRVAGIILLTKTLTNKHQQIIANSNIPILFVGQEYKDQYCLVHDDYDAAY
FT                   ELGAYVLSQGHRNIAYLGVEKDDISVGINRKNGFQKAIENLEPTCSVCYYETSFHIEDA
FT                   MKQVQHILDNNRPTLIVCATDNIALGAMKVIHSHSLSVPGDISVTGFGGYDISEMVHPS
FT                   LTTIAFDYEYAGKLAATSLSQLVENKTIPKILHSRYTLKIQESVDKI"
FT   gene            complement(779157..779372)
FT                   /locus_tag="BAA_0864"
FT   CDS_pept        complement(779157..779372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0864"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07561"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0864"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47609"
FT                   /protein_id="ACQ47609.1"
FT                   /translation="MPEVRCSVSNCSFWGQGNFCQASAIIVQPDADESGQTENNSYTNA
FT                   VLTNETLESSVATSVETCCHTFKPRY"
FT   gene            complement(779445..779864)
FT                   /locus_tag="BAA_0865"
FT   CDS_pept        complement(779445..779864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0865"
FT                   /product="putative thioredoxin"
FT                   /note="identified by match to protein family HMM PF00085"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0865"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48180"
FT                   /protein_id="ACQ48180.1"
FT                   /translation="MKKMLIFGGIIIVLFAAIFAVTQMEKKNASTDEKGYYSNKISLED
FT                   LNKNIEDKKEQTISFYQTSCVHCQKVSPIVVPLAKDLNVDMKVIDIENLNEPWDKYNIQ
FT                   GTPTIIHFKDGKEVSRISGEQSKDKFKEWFEQTKK"
FT   gene            complement(779877..780296)
FT                   /locus_tag="BAA_0866"
FT   CDS_pept        complement(779877..780296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0866"
FT                   /product="putative disulfide bond formation protein B"
FT                   /note="identified by match to protein family HMM PF02600"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0866"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46464"
FT                   /protein_id="ACQ46464.1"
FT                   /translation="MGREKKQEYALFTAWGASFIATLGSLYFSEIMKFEPCVLCWYQRI
FT                   FMYPFVLWLGIAVVKKDYRIASYSLPIASIGACISLYHYVIQKVAAFSAAGAACGRVPC
FT                   TGEYINWFGFVTIPFLALIGFITIAVCSFIVIKNK"
FT   gene            complement(780462..780710)
FT                   /locus_tag="BAA_0867"
FT   CDS_pept        complement(780462..780710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0867"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0867"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47168"
FT                   /protein_id="ACQ47168.1"
FT                   /translation="MQKYNDYDKALYYTYCCNWDKLLVLMVQTNDQLFSKRIEHFLHAY
FT                   QYSKELPEVDKQLQLLFQYIDHASQKSHVEEVEQIQM"
FT   gene            complement(780827..781336)
FT                   /locus_tag="BAA_0868"
FT   CDS_pept        complement(780827..781336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0868"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0868"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49326"
FT                   /protein_id="ACQ49326.1"
FT                   /translation="MKKYVFSLLAVLSLILAGCGSSGTNEKKSSESKEEHDHASHTQQA
FT                   DIQEKTKGVDTLPTFLDKLDPQMKDIYTVAGQNAELLDWIPCYCGCGESVGHKNNKNCF
FT                   IREIKKNGEVVWDSHATTCVNCLEIAVESASMKQKGKSTLEIRNYIDNKYKEGYGKPTP
FT                   TPMPKA"
FT   gene            complement(781382..782002)
FT                   /pseudo
FT                   /locus_tag="BAA_0869"
FT                   /note="spore germination protein GerYB; this gene contains
FT                   a frame shift which may be the result of a sequencing
FT                   error; identified by match to protein family HMM PF03845"
FT   gene            complement(782122..782490)
FT                   /pseudo
FT                   /locus_tag="BAA_0870"
FT                   /note="spore germination protein B; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            complement(782503..783498)
FT                   /gene="gerYC"
FT                   /locus_tag="BAA_0871"
FT   CDS_pept        complement(782503..783498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerYC"
FT                   /locus_tag="BAA_0871"
FT                   /product="spore germination protein GerYC"
FT                   /note="identified by match to protein family HMM PF05504;
FT                   match to protein family HMM TIGR02887"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0871"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49766"
FT                   /protein_id="ACQ49766.1"
FT                   /translation="MIHVGGFDITKNKKFRGTILYPDYTKGVQSKPETQSTHAGTIETI
FT                   SSLLNAKSPHTIAVGQMRVVLFGKAFGEHGLGDVINNLQRDPNIGRDVQLALVDGSSEE
FT                   LLKHVRTNGSLYLSELLEQNIKTETIPRTALNIFLYNFYSSGCDPFLPYIQVSEDKSAS
FT                   IKGLAFLKKDKVAMYTDRKRSFLFKLLINPTKNGRYEVPIRQGKHKGVIATQNLSGNSV
FT                   CSLSSNGDIPKVNIHLKLNGLVKNAPSWLDLSKGKNVTYVKRHIEKMLEKDLNELIKQF
FT                   QENKIDPIGIREEIRSHSRKWSMKQIQDMYPNVDIAVNVKINVVQSGIGE"
FT   gene            complement(783582..785087)
FT                   /gene="gerYA"
FT                   /locus_tag="BAA_0872"
FT   CDS_pept        complement(783582..785087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerYA"
FT                   /locus_tag="BAA_0872"
FT                   /product="spore germination protein GerYA"
FT                   /note="identified by match to protein family HMM PF03323"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0872"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47375"
FT                   /protein_id="ACQ47375.1"
FT                   /translation="MFHLSSKKKKQTFCSIPDFIHAMKKSSDFSSYNIIEDGTLCLFYY
FT                   KSTVESLIIKRFILAPIKNKLDEIQHIDDILNVVSIEDTLINPSIDDIREKLLGGYVLL
FT                   QLKKGSGQAAYALLRAESTVLGTRLVNDTENEYSVIGPKVGFVENVDINIHLLRRNIVT
FT                   EQLIFKEVSIGSMSKTKIVVAYIEGITNEQHINTAMQRLQDIDFDYPFDATLVEQLISD
FT                   NSNSPFRVLLPTERLDRSVYALLNGGVVILTDGSPYALAGPATLLDFFVSPEDYYLPWI
FT                   AGSFLRLVRFFGAAFSLFSSAIYTAVLTYHYQMIPADLLGPIIYSRANVPFPPVLEALF
FT                   LEITIELLREAGARLPTKVGQTIGIVGGIVIGQASVEAALTSTILLIAVALSALASFTT
FT                   PTVKMSSTIRILRFPLIILAGAFGGVGLIVGFVFILAHLIHLKSLGSPYLLPLYPFRGL
FT                   GTAEGLLRLPFSQTAERASFLRPKKKWRYDPNKAKEKRDGEEK"
FT   gene            complement(785212..785457)
FT                   /pseudo
FT                   /locus_tag="BAA_0873"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error"
FT   gene            complement(785463..785807)
FT                   /pseudo
FT                   /locus_tag="BAA_0874"
FT                   /note="group-specific protein; this gene contains a frame
FT                   shift which may be the result of a sequencing error"
FT   gene            786040..786600
FT                   /locus_tag="BAA_0875"
FT   CDS_pept        786040..786600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0875"
FT                   /product="nitroreductase family protein"
FT                   /note="identified by match to protein family HMM PF00881"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0875"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46672"
FT                   /protein_id="ACQ46672.1"
FT                   /translation="MTTYTSIANVIKERRSVRTFTDKAVDKELLIELLNDATWAPNHKH
FT                   REPWNCKLYIGEGRQKLVDAVLNSFTEEERAKRGKILSDRFLSTPAQIVVYINEDPRQI
FT                   QRDEDYAATCAFMQNFQLLAWERGLGCVWKSGGLNYNPLFIEGLGLTRGQRIVGILHLG
FT                   YFDKSPEGKARTPITEKMEIIEG"
FT   gene            786716..788134
FT                   /gene="spoVR"
FT                   /locus_tag="BAA_0876"
FT   CDS_pept        786716..788134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVR"
FT                   /locus_tag="BAA_0876"
FT                   /product="stage V sporulation protein R"
FT                   /note="identified by match to protein family HMM PF04293"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0876"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49596"
FT                   /protein_id="ACQ49596.1"
FT                   /translation="MRASDDKALQYAIAEITEIATGFGLDFYPMRYEICPAEIIYTFGA
FT                   YGMPTRFSHWSFGKQFFRMKLQYDLGLSKIYELVINSDPCYAFLLDTNSLIQNKLIVAH
FT                   VLAHCDFFKNNIRFSNTKRDMVESMSATAEWVKAYEHKYGKEEVETFLDAVLAIQEHID
FT                   PSLMRPKLAWSIDDLEEEEVEKKKASQYDDLWNLDNRNKKQERSNVRKKKKIPPQPEKD
FT                   LLLFIEEYSRELEDWQRDILTMMREEMLYFWPQLETKIMNEGWASFWHQRILREMDLTS
FT                   DEAIEFAKLNAGVVQPSKTSINPYYLGIKMFEDIEERYNNPTEEMKRRGVKPGSGRDKI
FT                   FEVREIEWDVSFLRNYLNKDLVMREDMYLFQRQGKEYKVIDKEWEHVRDQLVNMRTNGG
FT                   FPYLVVEDGDYLKNGELYIKHSYEGIELDLKYLEKVLPYLHQLWGRTVHMESIVESKGV
FT                   VFSYDGKMVHRKYV"
FT   gene            788127..788264
FT                   /locus_tag="BAA_0877"
FT   CDS_pept        788127..788264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0877"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0877"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50299"
FT                   /protein_id="ACQ50299.1"
FT                   /translation="MCDGKNGHRMLCPFFFIWNKVKYAILEKGSYIEKWRDSNEQSRGM
FT                   "
FT   gene            788242..789504
FT                   /locus_tag="BAA_0878"
FT   CDS_pept        788242..789504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0878"
FT                   /product="alkaline ceramidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0878"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48204"
FT                   /protein_id="ACQ48204.1"
FT                   /translation="MSKVGVCKVDITPPIGIDFVGYHRETGINNIEEHIYGTVFVFEKD
FT                   EMKIVFISIDNIGMLVEDTNMIREQVASELHVPFERITVVYTHTHSGPETVGDDPLVQS
FT                   YKTILVNNVVHGAVTANKNLKQCEVGWGVTTGDIGVNRRERTFDGRAKMGTNIEGVVDK
FT                   RIGMLAIRHAETKELSGIVVFCTAHPNVLKGDSDVLSADYPGMTREILEKIVNCPVIIV
FT                   QGAAGNVNAKYRGSREALKKMAYTLSGHVLTMLPTVTYSPIVNVRTVSSTMQMKLKDIP
FT                   EMNEIRSMAQLVEKQWGVNTDEWLTIVLEKYKQGIRQLRIDLEVQLFQINDGIFSGIPM
FT                   EPFSETALEMKESLQNELAFFGGYTNGYIGYLPTKEEFAYGGYEVELSPVVYGPVTNLL
FT                   MPLEENTAELVVKRVMGLYNT"
FT   gene            complement(789626..790096)
FT                   /locus_tag="BAA_0879"
FT   CDS_pept        complement(789626..790096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0879"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="identified by match to protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0879"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48906"
FT                   /protein_id="ACQ48906.1"
FT                   /translation="MDQTFNELDLTSLLSLSFSTLITELHDKLSELGFEDIRPAHGFMF
FT                   KRILPNGATGIELAEYLGVSKQAVSKMVDSLENSGYVTRKTHPTDKRGKIIVLTERGLA
FT                   VMKAKEEIVAEIEQRWIENIGTERMQMLKEDLTTFVTKENTEKLSSNIRPVW"
FT   gene            790194..790778
FT                   /locus_tag="BAA_0880"
FT   CDS_pept        790194..790778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0880"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0880"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48380"
FT                   /protein_id="ACQ48380.1"
FT                   /translation="MVHIVKVRGSVFAPYALLEPIKDPATGRLFEYAGDAREFTPYAAN
FT                   AKRSRLEQEVNIDFYKREIFTYADACIVTVKITNPDGSTEYQKGEISTENIVCTNIVWG
FT                   EDEVSFEMRASASNPLNAAAPAADYLLAIRVNKSGTVHVEGVHDGFPCYEFYKQVDFGP
FT                   FESIYIHDFRETNDTPAALAGEMEYSFKTTV"
FT   gene            790912..791496
FT                   /locus_tag="BAA_0881"
FT   CDS_pept        790912..791496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0881"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0881"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48934"
FT                   /protein_id="ACQ48934.1"
FT                   /translation="MTNIIKIRASVFIPMSWTEAKMDMETGQVIQFEGDSREFTPHAVN
FT                   TMRSRVEQEVVVDFYKQEVFSYANTGITTEKVISPDGSVNKRTGKASTENIVCTDIVWN
FT                   SGGVQFKMSASASNPLNVYAPPVDYVLNVCVKKDGSIDVQGEHDGFPCFEFYKQVDFGP
FT                   FEKIYTHDFRETGDTAAALGGNMDYSFTKRL"
FT   gene            791705..793369
FT                   /locus_tag="BAA_0882"
FT   CDS_pept        791705..793369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0882"
FT                   /product="pyridine nucleotide-disulfide oxidoreductase,
FT                   class I"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF00581; match to protein
FT                   family HMM PF02852; match to protein family HMM PF07992;
FT                   match to protein family HMM TIGR03385"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0882"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46804"
FT                   /protein_id="ACQ46804.1"
FT                   /translation="MSRKIVVVGGVAGGASVAARLRRLSEEDEIIMVERGEYISFANCG
FT                   LPYYIGGVITERQKLLVQTVERMSKRFNLDIRVLSEVVKINKEEKTITIKNVTTNETYN
FT                   EAYDVLILSPGAKPIVPSIPGIEEAKALFTLRNVPDTDRIKAYIDEKKPRHATVIGGGF
FT                   IGVEMVENLRERGIEVTLVEMANQVMPPIDYEMAAYVHEHMKNHDVELVFEDGVDALEE
FT                   NGAVVRLKSGSVIQTDMLILAIGVQPESSLAKGAGLALGVRGTIKVNEKFQTSDPHIYA
FT                   IGDAIEVKDFVTETETMIPLAWPANRQGRMLADIIHGHTDSLYKGTLGTSVAKVFDLTV
FT                   ATTGLNEKILKRLNIPYEVVHVQANSHAGYYPNATPVLIKLIFNKDSGKIYGAQTLGRD
FT                   GVDKRMDVIATAIKANLTVLDLPDLELSYAPPYSSAKDPVNMVGYAASNIVDGFVDTVQ
FT                   WHEIDRIVENGGYLIDVREPNELKQGMIKGSINIPLDELRDRLEEVPVDKDIYITCQLG
FT                   MRGYVAARMLMEKGYKVKNVDGGFKLYGTVLPERIVY"
FT   gene            793555..793818
FT                   /locus_tag="BAA_0883"
FT   CDS_pept        793555..793818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0883"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02583"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0883"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46475"
FT                   /protein_id="ACQ46475.1"
FT                   /translation="MEYNQDMKNRLKRIEGQVRGVLRMMEEGKDCREVITQLTASRSAL
FT                   DRTIGLVVGTNLEQCLREQFESGNGSNEELIKEAVQLLVKSR"
FT   gene            793907..794467
FT                   /locus_tag="BAA_0884"
FT   CDS_pept        793907..794467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0884"
FT                   /product="rhodanese domain protein"
FT                   /note="identified by match to protein family HMM PF00581;
FT                   match to protein family HMM PF01206"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0884"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47325"
FT                   /protein_id="ACQ47325.1"
FT                   /translation="MSIKVDMSLDCKGLACPMPIVKTKKAIEGLASGQVIEVKATDKGS
FT                   TVDIKSWANKVGHQYIGTKHESDILMHYVRKAHEHEVNEVVKYPHTITNIELEEILVSG
FT                   EECTVLDVREAAEFAFGHIPSATSMPLGELESLVLDKTKQIYVVCRTGNRSDVACQMLK
FT                   EKGYTNVKNVIPGMIEWQGNIEN"
FT   gene            794506..795636
FT                   /locus_tag="BAA_0885"
FT   CDS_pept        794506..795636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0885"
FT                   /product="metallo-beta-lactamase family protein"
FT                   /note="identified by match to protein family HMM PF00753"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0885"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47625"
FT                   /protein_id="ACQ47625.1"
FT                   /translation="MEVKSLQAKDVAEKVLFGELFILDVRNETDYEDWKIEGKQISSIN
FT                   KPYFDLLDGVDQIVSELPKDKDVLVVCAKEGSSIFVAEQLTEAGLENIYYLAGGMKAWS
FT                   EYVKPIKVGDLKNGGSMYQFNRLGKGCLSYMVVSNGEAAVIDAIRTVEAYEQFAKENGV
FT                   TITNVMDTHLHADHISGGRKLAEKVGGTYWLPPKDAEEVVFSYEPLVEGSVITVGGTKI
FT                   EIDALYSPGHTIGSTSFIVDNSYLLSGDILFVDSIGRPDLAGKAEDWVSDLRNTLYSRY
FT                   KELSQSLIVLPAHYSKISEMDESGIVSAKLKDLFEHNAGLNIEDEGEFRKVVTENLPPQ
FT                   PNAYEEIRQTNMGKIHPSVDEEREMEIGPNRCAVHK"
FT   gene            795668..795898
FT                   /locus_tag="BAA_0886"
FT   CDS_pept        795668..795898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0886"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01206"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0886"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49567"
FT                   /protein_id="ACQ49567.1"
FT                   /translation="MMNVKQVLDAKDLACPMPIVRTKRAMDTLQTGEVLEVQVTDKGSV
FT                   KDIPAWANKSGHDIVKHEEEGDVLKFWIKKA"
FT   gene            795975..796289
FT                   /pseudo
FT                   /locus_tag="BAA_0887"
FT                   /note="rhodanese-like domain protein; this gene contains a
FT                   frame shift which may be the result of a sequencing error;
FT                   identified by match to protein family HMM PF00581"
FT   gene            796304..796600
FT                   /locus_tag="BAA_0888"
FT   CDS_pept        796304..796600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0888"
FT                   /product="rhodanese domain family protein"
FT                   /note="identified by match to protein family HMM PF00581"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0888"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50130"
FT                   /protein_id="ACQ50130.1"
FT                   /translation="MKEMIAKELEEKLLRKEAVNIVDVREVEEVAEGKIPEACNIPLGL
FT                   LEFRMHELDKKKEYIIVCRSGGRSARAVQFLEGYGFRVINMVGGMLAWEGKVE"
FT   gene            796661..797140
FT                   /pseudo
FT                   /locus_tag="BAA_0889"
FT                   /note="NADH dehydrogenase; this gene contains a premature
FT                   stop which may be the result of a sequencing error"
FT   gene            797174..797938
FT                   /locus_tag="BAA_0890"
FT   CDS_pept        797174..797938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0890"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF01925"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0890"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46172"
FT                   /protein_id="ACQ46172.1"
FT                   /translation="MSLVVLLFIIGFIGSFISGMVGIGGAIINYPMILYIPVLLGFTGY
FT                   TAHEVSGITAVQVFFATFAGAWAYRKSNDMDKTLVVYMGASILIGSFIGSFGANALEEH
FT                   TVNVVYAALATIAAIMMFVPKRNNGDELKYNKWLASLLAFIVGGASGIIGAGGSFLLVP
FT                   IMLVILKLPIRRTIATSIAITFISSVGITTGKVITGQVVVMPALIIAIASIFAAPLGAR
FT                   VGKRINQKALQYMLSILIVGTAVKMWIDMISK"
FT   gene            complement(797972..798412)
FT                   /locus_tag="BAA_0891"
FT   CDS_pept        complement(797972..798412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0891"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0891"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48434"
FT                   /protein_id="ACQ48434.1"
FT                   /translation="MKAAVKHNISDFKDYLKSNDIYMEENIDENDGSVHFSVGLETEAG
FT                   AKIQLIAAFQNEHPTVDIYCFNVAHVPDATATNDILHVINELNTSYRFAKFTLNKQNAI
FT                   DISTSLAFSEPNFNPALVFEHTRMLYKLANDEYKNLMKVIWA"
FT   gene            complement(798558..799754)
FT                   /locus_tag="BAA_0892"
FT   CDS_pept        complement(798558..799754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0892"
FT                   /product="transcription antiterminator, LytR family"
FT                   /note="identified by match to protein family HMM PF03816;
FT                   match to protein family HMM TIGR00350"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0892"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46781"
FT                   /protein_id="ACQ46781.1"
FT                   /translation="MEQNPSLQENTRSKPKKSKKKIKIIISVILFFLIVGGGYTWFLVN
FT                   KASSAVRNAAHDLARGDKSDLRDKAVKPITNNVSVLVMGVDESDVRGKEYGEAIRTDAL
FT                   LLATFNKDSKTVKLLSIPRDTYTYIPVEKKKDKITHAHAYGSTKNGKDGGPQASIDAVE
FT                   KLLNVPVDYFVKFNFKSFMKIVDDLGGIEVDVPVEFTEQDSNDNADAIHLKKGVQKLNS
FT                   EEALALARTRHIDSDAMRGQRQQLVIEAILEKLTSVGSVTKVGNIIDDINGQFVTNLTF
FT                   DDMLSFYKYGADSSIEKLQIQGDDCYMEKGDDTCSKSAGGGRTYFYNPDKKELAKVTND
FT                   LRTHLGLPAYTKTDSDSKKTSTEKTKESKSENSSERESSNNESKNSNEDKETSSNDNE"
FT   gene            800068..801066
FT                   /locus_tag="BAA_0893"
FT   CDS_pept        800068..801066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0893"
FT                   /product="putative quinone oxidoreductase, YhdH/YhfP
FT                   family"
FT                   /note="identified by match to protein family HMM PF00107;
FT                   match to protein family HMM PF08240; match to protein
FT                   family HMM TIGR02823"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0893"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50780"
FT                   /protein_id="ACQ50780.1"
FT                   /translation="MNHTSFRAIVVNETESKQFVRNVVAREVSSLPEGDVFIQVHYSSL
FT                   NYKDALSATGNKGVTRIYPHTPGIDAAGVVVSSKDATIKAGDQVIVTGYDLGMNTSGGF
FT                   GEYIRVPASWIVPLPEEMSLKESMMYGTAGFTAALSVYKLIGAGITPSMGDVLVTGATG
FT                   GVGSVAVSILSKLGFNVVGATGKMEEEEMLLRLGAKKVIHRAELNDESGRPMLQGIYAG
FT                   VIDTVGGHMLETALKTVKYGGCVTTCGNVAGQELQTTVYPFILRGISLLGIDSVQCPVD
FT                   VRRDVWTLLANEWGNKELRSYTEECILEELDEKFTLILQGRLKGRTVINMK"
FT   gene            complement(801101..802756)
FT                   /locus_tag="BAA_0894"
FT   CDS_pept        complement(801101..802756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0894"
FT                   /product="Na/Pi-cotransporter family protein"
FT                   /note="identified by match to protein family HMM PF01895;
FT                   match to protein family HMM PF02690; match to protein
FT                   family HMM TIGR00704"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0894"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48782"
FT                   /protein_id="ACQ48782.1"
FT                   /translation="MEYNVQDMIFQFIGGLGIFLFGIKYMGDGLQQAAGDRLRDILDRF
FT                   TTNPLMGVLAGMLVTVLIQSSSGTTALTVGLVSAGFMTLRQAIGVIMGANIGTTVTAFI
FT                   IGIKIGEYALPIMAVGAILLFFFKNKKVHSLGQVIFGFGMLFFGLELMSTGMKPLRSLE
FT                   SFQELTVSMSDNPILGIVVGTVFTLIVQSSSATIGILQELFGQGAIDLQAALPVLFGDN
FT                   IGTTITAVLAAIGTSIAARRAALVHVIFNIVGTIIFTILLIPFTNLIQYFQTSLNLNPE
FT                   MTIAFAHGTFNVTNTIIQFPFIAVLAWIVTKIIRGEDAAIDFKPQHLNPIFIEQSPAIA
FT                   LTEAQKEIIRMAEFSLHGLKEANQFLNTQDKKHVDMATQLEGAINNLDKKITEYLVLLS
FT                   EKPLSPTDSEKHSVLAGVVGDIERVGDHVENLVELVDFQISNRVSLSNEALAELNEMLE
FT                   LTISTLQDAINALTNFDTELAQTVIAKERKIDQMERVLRKRHVLRLNERSCSGDASIIY
FT                   VDMVSNLERIGDHAVNIADGVLGEQGKINLKQSL"
FT   gene            complement(802877..803044)
FT                   /locus_tag="BAA_0895"
FT   CDS_pept        complement(802877..803044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0895"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0895"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47483"
FT                   /protein_id="ACQ47483.1"
FT                   /translation="MHFPTYFFNFHQKIYDELADAFFDIQPNITFLKSVIFLQKYDLQK
FT                   IKTNKIQLFL"
FT   gene            complement(803087..804286)
FT                   /locus_tag="BAA_0896"
FT   CDS_pept        complement(803087..804286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0896"
FT                   /product="major facilitator family transporter"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0896"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48051"
FT                   /protein_id="ACQ48051.1"
FT                   /translation="MGEAILVKREPLWTKEFVALILANLCMFLGFQMLIPTLPVYVKEI
FT                   GGTSSNIGFVVGMFTVAALFVRPLTGNALQKFSKKIILMIGTAICLLAMGSYLFASTVF
FT                   LLLAVRILHGAGFGITTTTYGTVVSDLIPQARRGEGMGYFGLSGTIAMALGPLIGLWLM
FT                   QTYNFTILFLCALSCTIVSLILTKLLQIKKSPQPPKQTSGTFLDGFIERKALLPSLLIL
FT                   CITLMYGGIGSFITLFATEVGIADISLFLFNALAIAVTRPFSGKLYDAKGHSFVIIPGV
FT                   IITFAGIILLSYTTTIPSLIIAAACYGSGFGAIQPALQAWMIDRVAPHRRGVATATFFS
FT                   AFDLGIGAGAIIFGFIAHFTNYATVYRYSSLLLIAFLFIYITSVKKQKHGDKNTEKAAG
FT                   "
FT   gene            804605..805693
FT                   /locus_tag="BAA_0897"
FT   CDS_pept        804605..805693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0897"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05913"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0897"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47894"
FT                   /protein_id="ACQ47894.1"
FT                   /translation="MRRLGISIYPEHSTVEKDKEYLTLASKYGFNRVFTCLLSVDGEKE
FT                   KIIEEFKETISHANALGFQVLVDISPAVFEQLGISYNDLSFFHELGAYGIRLDVGFSGL
FT                   EESIMTYNPYGLKIEINMSNGTKYVDNIMSHRPNRENLIGCHNFYPHRYSGLSYNHFIT
FT                   CSKQFKDYGMRTAAFISSFDATYGPWPVTEGLCTLEQHRELPMTTQAKHLFATELIDDV
FT                   IIANAYAPEEELQALGALNKEKQTFDIELYDTTTELERIIVLDEPHFYRGDVSEYMIRS
FT                   TQSRVKYKKEEFKPHHTREIKRGDLLIDNEQYGQYKGELQIALKDMVNTGKTNVVGRIV
FT                   EEEIFLLDYLQAWDKFGFTLKR"
FT   gene            805766..807706
FT                   /locus_tag="BAA_0898"
FT   CDS_pept        805766..807706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0898"
FT                   /product="transcription antiterminator, BglG family"
FT                   /note="identified by match to protein family HMM PF00359;
FT                   match to protein family HMM PF00874; match to protein
FT                   family HMM PF05043; match to protein family HMM PF08279"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0898"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ45948"
FT                   /protein_id="ACQ45948.1"
FT                   /translation="MTKVHQRLISILEEFLEEKSMLNRAFLASRLHVSTKTIQKDIKLL
FT                   NDILEENGAKIESQRGTGYELEIIQTKKFEEFCVSLFQKQTEKIPTSYEERIAYILQRI
FT                   LTTEGYVKLSQLAEEIYVSKSTVNLIMKDVTDICGRYQLQIEKRPYYGIRIVGEEFHIR
FT                   SCLSQYGLPRYDHTPFHEQFEQSDTYVSLPHIPLIRSVILKYIEGGTIYLSDIEIDNLV
FT                   IHIAIALKRCEDQHYMKGLNEEQAELIIKKEYAIAKQIVGDLEKELHLSFPEEEVLYVT
FT                   MHLLSTAVTSKDRYENVEELLGKDLYAFMQHILFKVAEERNLVFYYDEELLFGFGVHLK
FT                   TLLNRLKYKLNTRNPLLAEVKKNYPYAFEIAVLVGDIIGEYTGESIPESEIGYIAIHFG
FT                   GAMSRLQEQNQKKRCLLVCATGQGSAQLLKYKILSQFRDKLEIVGITGYYQLKVEDLYK
FT                   EKIDCIISTIHIPSGLPVPIIKVNSIFDDKEIKSIGQQLFTHVNNSVQQYMKEDLIFLN
FT                   HSASTKEEVIQFLCEKAAEKNYVPEHFYDSVMERENTSPTAVGNLVAIPHPMQLLSAET
FT                   FLMFCTLEKAVDWGDKKVQVIILFSVKRNNNEDLQRLYDFLYDIMSSQSTIEKLTHAEG
FT                   IEDFQEVLLSI"
FT   gene            807818..808138
FT                   /gene="celC1"
FT                   /locus_tag="BAA_0899"
FT   CDS_pept        807818..808138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="celC1"
FT                   /locus_tag="BAA_0899"
FT                   /product="PTS system, cellobiose-specific IIA component"
FT                   /EC_number="2.7.1.69"
FT                   /note="identified by match to protein family HMM PF02255"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0899"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47128"
FT                   /protein_id="ACQ47128.1"
FT                   /translation="MADMQTPFALILHGGNARSIALEAIAFARQGDFENASEKMTLASE
FT                   EISAAHRIQTDLIQEEARGNHAEISLLLVHAQDHLMNAITVKELAEEFITLHKRMEEKV
FT                   IA"
FT   gene            808140..808445
FT                   /gene="celA1"
FT                   /locus_tag="BAA_0900"
FT   CDS_pept        808140..808445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="celA1"
FT                   /locus_tag="BAA_0900"
FT                   /product="PTS system, cellobiose-specific IIB component"
FT                   /EC_number="2.7.1.69"
FT                   /note="identified by match to protein family HMM PF02302"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0900"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49803"
FT                   /protein_id="ACQ49803.1"
FT                   /translation="MYILLCCAAGMSTSMVVRKMQEEAKKQGKDYKIKAVDSELVKLEI
FT                   KNADVVLIGPQVKYLFPAVQFLAKSYDIPVAIIEQRDYGMCDGLKVLKQAEQLVLA"
FT   gene            808528..809838
FT                   /gene="celB1"
FT                   /locus_tag="BAA_0901"
FT   CDS_pept        808528..809838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="celB1"
FT                   /locus_tag="BAA_0901"
FT                   /product="PTS system, cellobiose-specific IIC component"
FT                   /EC_number="2.7.1.69"
FT                   /note="identified by match to protein family HMM PF02378;
FT                   match to protein family HMM TIGR00410"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0901"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ48867"
FT                   /protein_id="ACQ48867.1"
FT                   /translation="MNGFMSFMEQKIMPTTQKIAGQRHLLAIRNGVISTLPLTIVGSFF
FT                   VIFLNLPIDAYMEWIAPFRHILDIPFRFTVGLMALYAAFGVGASLANFYQLNQLSAGLL
FT                   SVLAFLLASVEPIQITKAVPGVIDAGRYISVGTLSATSLFGAIVTALIAVEIYHFMIKH
FT                   NISIKLPDSVPPAVSNSFAALIPTLAVILLFWGIRYGLKFDVNTTITYLIAPLKSVLVG
FT                   NNLFGGLLTVFLIVFFWSFGIHGPAILGPIIRPMWDSAILENMEVFTATGNAHQLPNLF
FT                   TEQFIQWFVWIGGSGSTLALVIMFMFSKSKFLKELGRLSFVPGLFNINEPIIFGAPIVM
FT                   NPILIIPFVITPLVTTTVSYFAVVSGMIPLMMAKLPFTMLAPIAAVISTDWTIMAGVLV
FT                   LVNFVISFVIYYPFFKMYEKQQLAGEEKEKCSEQLSS"
FT   gene            809814..810092
FT                   /locus_tag="BAA_0902"
FT   CDS_pept        809814..810092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0902"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0902"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ49813"
FT                   /protein_id="ACQ49813.1"
FT                   /translation="MLGAIIILITFVAGQCIAHYSKWVQSKSLLVLLLVSIVFIGCSMG
FT                   AYVMLSLQSPYVIIVPTILCATCLSAKYRFTSMALIQRVKEMQKHGA"
FT   gene            810082..811167
FT                   /locus_tag="BAA_0903"
FT   CDS_pept        810082..811167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0903"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05913"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0903"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47865"
FT                   /protein_id="ACQ47865.1"
FT                   /translation="MERKLGISLYPEHSTKEQDMAYISAAARHGFSRIFTCLLSVNRPK
FT                   EEIIAEFKEIINHAKDNNMEVILDVAPAVFDQLGISYSDLSFFAELGADGIRLDLGFDG
FT                   LTEAKMTNNPYGLKIELNVSNDIAYLENILSHQANKSALIGCHNFYPQKFTGLPYEYFI
FT                   RCSERFKKYGIRTAAFITSHAANIGPWDINDGLCTLEEHRNLPIEVQAKHLWATGFIDD
FT                   VIIGNAYASEEELEKLGNLNRYMLQLKVHFVDEVTEVEKRATLQELHVRRVDITEYMVR
FT                   STEVRKKYKDYDFPVRKSVRQERGQVVIGNNSFGKYKGELQIILKEMPIDERKNIVGTI
FT                   AEEELFLLDYVGAWTQFTCVE"
FT   gene            complement(811437..812597)
FT                   /locus_tag="BAA_0904"
FT   CDS_pept        complement(811437..812597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0904"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06347;
FT                   match to protein family HMM PF06725; match to protein
FT                   family HMM PF08239"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0904"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ47293"
FT                   /protein_id="ACQ47293.1"
FT                   /translation="MKKFMGIATAAVFGLGIFTTSAKAETIVTTDVLNVRENPTTESKV
FT                   VGKLLDGYKVNVLHTENGWSKVKLNSGKEAFISADYTKDTYYVTANVLNVRAGANTDSE
FT                   ILGKLKQDDVIETTHQVENGWIQFEYNGKTAYVHVPYLTGKAPVKVQPVVKAEKTTTVQ
FT                   DTAKAVATTKAREVAETQAKAKAEEATKAREVAEAQAAAKAREAAKAQEAAKAQAEAKA
FT                   QEAAEAQAAAKAQEAAKAREAAKAQAEAKAQEAAEAREAAKAQKPATQQPVAKETETSA
FT                   PSSSRELRVVATAYTADPLENGYKAGDQVKSALGHNLTANPNMKLIAVDPSVIPLGSKV
FT                   WVEGYGVAIAGDTGGAIKGNKIDVLMPDKGTSSNWGRKTVTVKVLN"
FT   gene            complement(813168..814358)
FT                   /locus_tag="BAA_0905"
FT   CDS_pept        complement(813168..814358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0905"
FT                   /product="putative ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0905"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46808"
FT                   /protein_id="ACQ46808.1"
FT                   /translation="MERLILNTSENIRMALSSIFAHKMRSILTMLGIIIGISAIITIIS
FT                   MGDGTNAKFKKELGQGKDNEVTIYYNNPDYGTDNAKITADMLNRLQTVPGVKDVYPDVS
FT                   MKVKASAGSKDVNLDLKGGTGAFMTDSKIKLVHGRELNDSELNQAIPAVILNEEAFNKL
FT                   FSGWESNQYTDIKGKPYKIVGVYETKNDFGMPMPEGYTSLENAPVISGVTEYDSVRLTM
FT                   TSPTERKSVEKQAVSVLNEMKAPKFEHKFEAQDLGEFTKQLDESIGMMKMVFGGIAAIS
FT                   LLVGGIGVMNIMLVSVTERTREIGIRKALGATRGKVLTQFLIESCILTGLGGFIGFMLG
FT                   IFFAWIVSIFAGWPLVVSKELGLLAVGISMLIGIIFGLLPANKAAKLDPIECLRYE"
FT   gene            complement(814346..815020)
FT                   /locus_tag="BAA_0906"
FT   CDS_pept        complement(814346..815020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0906"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0906"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46121"
FT                   /protein_id="ACQ46121.1"
FT                   /translation="MINLKGITKSFQNGAESIQILHGIDVTLNQGEFTSIMGPSGSGKS
FT                   TLMNIIGCLDKPTTGTYELAGQNISNMSKTELAHVRNKEIGFVFQNFMLLPRLSALQNV
FT                   ELPLIYAGVDKKERRERSLAALTKVGLADRATHLPNELSGGQKQRVAVARAIVNNPKFI
FT                   LADEPTGALDTKTSTQIMDLFYELNKQGSTIIMITHDREIGEAAARQIVIRDGNIVQDW
FT                   RG"
FT   gene            complement(815017..816123)
FT                   /locus_tag="BAA_0907"
FT   CDS_pept        complement(815017..816123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0907"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM TIGR01730"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0907"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46272"
FT                   /protein_id="ACQ46272.1"
FT                   /translation="MKKKNKVLITSVVAIGIAAGSYFAFAGGGGSEVAMAYSGYKVTEK
FT                   QIENAQKFGGEVIPNGIETISFDPTKGTYELAVKKGDEVKKGQLLFKYNDPAAKQGVTE
FT                   AEMQKKIAQKEVTLFQKQIDAAKQKLQKDKNAGLPAEALKASEIEVQQLESQLEMKKFE
FT                   VEKSDEMIKAAKERVNTLSVTSPADGVIDDIVKIADEKTGMSGITLRHAGPFKVKGQLS
FT                   EYELASMKVGQEVTVSSKTVAGKTWTGKVTEIGSTPLKSMDENKTVSNYQFTVTLDNSE
FT                   ELQNGFHVYVTSKSGEATGTIVPKSSIVKKGDKNVVFVIKDGKAKEQAVTVEFETDSEA
FT                   KVSGVKKGEQIISKPEKDLKDGMEVVVE"
FT   gene            816334..817068
FT                   /locus_tag="BAA_0908"
FT   CDS_pept        816334..817068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0908"
FT                   /product="putative ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF09529;
FT                   match to protein family HMM TIGR02206"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0908"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50784"
FT                   /protein_id="ACQ50784.1"
FT                   /translation="MEAYFSAHPLKPFIPYSRQHAIILFIMLVGIVFLYQYQDVLRQNE
FT                   WNITVRYAIAILFIGSEIGLHMWEWKAGIFELATSLPFELCTISLLLASIMIVTKSYRI
FT                   YEIVFFTGIIGASQAILTPNLQYAFPHFRFIEYFIAHILLIWAPLFMTWVEGYRPTVQS
FT                   IKRTMIFLNILIPIVSFVNYKTGGNYMFLAHKPETASLLDMLGPHPYYIISLELAALIG
FT                   CFILYMPFAKREGHTHKESLGS"
FT   gene            817157..817858
FT                   /pseudo
FT                   /locus_tag="BAA_0909"
FT                   /note="putative ABC transporter, permease protein; this
FT                   gene contains a frame shift which may be the result of a
FT                   sequencing error"
FT   gene            817888..818022
FT                   /pseudo
FT                   /locus_tag="BAA_0910"
FT                   /note="oligopeptide ABC transporter, permease; this gene
FT                   contains a frame shift which may be the result of a
FT                   sequencing error"
FT   gene            818024..819028
FT                   /locus_tag="BAA_0911"
FT   CDS_pept        818024..819028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAA_0911"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0911"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ46865"
FT                   /protein_id="ACQ46865.1"
FT                   /translation="MWTYIKRDKRFWISIGFLLLLVLLSIGNTLWNDGHIRQVTLQYDA
FT                   DENPQVPPFSPSLQFLLGTDRKGYDLLHLVIEGAKWTIGISILIAALRMVIGVFFGVVL
FT                   GAYIKRGFSKIESFFDSFTVIPTVMIAYFFLQFASTFGSGEETTTFFERASFQVVLLVM
FT                   LVMPVIALYVAKEVRKLRTEEFVDAARILGGSRRHIVIKHLFPHLYMTFILVFFQQFTQ
FT                   TLTILLHLGLLEIFFGGTVKFLGPIEEIESYTHEWSGLIGVYFRSLTVNPWIPLVPITF
FT                   FGLTIFSGNMIVKSIEEAMMKVRLGGELKKDVAEGEQSVVQSKEELFTFKHTM"
FT   gene            complement(819073..820389)
FT                   /gene="brnQ2"
FT                   /locus_tag="BAA_0912"
FT   CDS_pept        complement(819073..820389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="brnQ2"
FT                   /locus_tag="BAA_0912"
FT                   /product="branched-chain amino acid transport system II
FT                   carrier protein"
FT                   /note="identified by match to protein family HMM PF05525;
FT                   match to protein family HMM TIGR00796"
FT                   /db_xref="EnsemblGenomes-Gn:BAA_0912"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ50254"
FT                   /protein_id="