(data stored in ACNUC7421 zone)

EMBL: CP001600

ID   CP001600; SV 2; circular; genomic DNA; STD; PRO; 3812301 BP.
XX
AC   CP001600;
XX
PR   Project:PRJNA34853;
XX
DT   09-JUN-2009 (Rel. 101, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 8)
XX
DE   Edwardsiella ictaluri 93-146, complete genome.
XX
KW   .
XX
OS   Edwardsiella ictaluri 93-146
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Hafniaceae; Edwardsiella.
XX
RN   [1]
RP   1-3812301
RX   DOI; 10.1128/JB.06522-11.
RX   PUBMED; 22247535.
RA   Williams M.L., Gillaspy A.F., Dyer D.W., Thune R.L., Waldbieser G.C.,
RA   Schuster S.C., Gipson J., Zaitshik J., Landry C., Banes M.M.,
RA   Lawrence M.L.;
RT   "Genome Sequence of Edwardsiella ictaluri 93-146, a Strain Associated with
RT   a Natural Channel Catfish Outbreak of Enteric Septicemia of Catfish";
RL   J. Bacteriol. 194(3):740-741(2012).
XX
RN   [2]
RP   1-3812301
RA   Williams M.L., Gillaspy A.F., Dyer D.W., Thune R.L., Waldbieser G.C.,
RA   Schuster S.C., Gipson J., Zaitshik J., Landry C., Lawrence M.L.;
RT   ;
RL   Submitted (19-MAR-2009) to the INSDC.
RL   College of Veterinary Medicine, Mississippi State University, 240 Wise
RL   Center Drive, Mississippi State, MS 39762, USA
XX
RN   [3]
RC   Sequence update by submitter
RP   1-3812301
RA   Williams M.L., Gillaspy A.F., Dyer D.W., Thune R.L., Waldbieser G.C.,
RA   Schuster S.C., Gipson J., Zaitshik J., Landry C., Lawrence M.L.;
RT   ;
RL   Submitted (16-OCT-2012) to the INSDC.
RL   College of Veterinary Medicine, Mississippi State University, 240 Wise
RL   Center Drive, Mississippi State, MS 39762, USA
XX
DR   MD5; c80856a60bedeb483554cea5eb324a18.
DR   BioSample; SAMN02603942.
DR   EnsemblGenomes-Gn; NT01EI_R0001.
DR   EnsemblGenomes-Gn; NT01EI_R00010.
DR   EnsemblGenomes-Gn; NT01EI_R00011.
DR   EnsemblGenomes-Gn; NT01EI_R00012.
DR   EnsemblGenomes-Gn; NT01EI_R00013.
DR   EnsemblGenomes-Gn; NT01EI_R00014.
DR   EnsemblGenomes-Gn; NT01EI_R00015.
DR   EnsemblGenomes-Gn; NT01EI_R00016.
DR   EnsemblGenomes-Gn; NT01EI_R00017.
DR   EnsemblGenomes-Gn; NT01EI_R00018.
DR   EnsemblGenomes-Gn; NT01EI_R00019.
DR   EnsemblGenomes-Gn; NT01EI_R0002.
DR   EnsemblGenomes-Gn; NT01EI_R00020.
DR   EnsemblGenomes-Gn; NT01EI_R00021.
DR   EnsemblGenomes-Gn; NT01EI_R00022.
DR   EnsemblGenomes-Gn; NT01EI_R00023.
DR   EnsemblGenomes-Gn; NT01EI_R00024.
DR   EnsemblGenomes-Gn; NT01EI_R00025.
DR   EnsemblGenomes-Gn; NT01EI_R0003.
DR   EnsemblGenomes-Gn; NT01EI_R0004.
DR   EnsemblGenomes-Gn; NT01EI_R0005.
DR   EnsemblGenomes-Gn; NT01EI_R0006.
DR   EnsemblGenomes-Gn; NT01EI_R0007.
DR   EnsemblGenomes-Gn; NT01EI_R0008.
DR   EnsemblGenomes-Gn; NT01EI_R0009.
DR   EnsemblGenomes-Gn; NT01EI_T0001.
DR   EnsemblGenomes-Gn; NT01EI_T00010.
DR   EnsemblGenomes-Gn; NT01EI_T00011.
DR   EnsemblGenomes-Gn; NT01EI_T00012.
DR   EnsemblGenomes-Gn; NT01EI_T00013.
DR   EnsemblGenomes-Gn; NT01EI_T00014.
DR   EnsemblGenomes-Gn; NT01EI_T00015.
DR   EnsemblGenomes-Gn; NT01EI_T00016.
DR   EnsemblGenomes-Gn; NT01EI_T00017.
DR   EnsemblGenomes-Gn; NT01EI_T00018.
DR   EnsemblGenomes-Gn; NT01EI_T00019.
DR   EnsemblGenomes-Gn; NT01EI_T0002.
DR   EnsemblGenomes-Gn; NT01EI_T00020.
DR   EnsemblGenomes-Gn; NT01EI_T00021.
DR   EnsemblGenomes-Gn; NT01EI_T00022.
DR   EnsemblGenomes-Gn; NT01EI_T00023.
DR   EnsemblGenomes-Gn; NT01EI_T00024.
DR   EnsemblGenomes-Gn; NT01EI_T00025.
DR   EnsemblGenomes-Gn; NT01EI_T00026.
DR   EnsemblGenomes-Gn; NT01EI_T00027.
DR   EnsemblGenomes-Gn; NT01EI_T00028.
DR   EnsemblGenomes-Gn; NT01EI_T00029.
DR   EnsemblGenomes-Gn; NT01EI_T0003.
DR   EnsemblGenomes-Gn; NT01EI_T00030.
DR   EnsemblGenomes-Gn; NT01EI_T00031.
DR   EnsemblGenomes-Gn; NT01EI_T00032.
DR   EnsemblGenomes-Gn; NT01EI_T00033.
DR   EnsemblGenomes-Gn; NT01EI_T00034.
DR   EnsemblGenomes-Gn; NT01EI_T00035.
DR   EnsemblGenomes-Gn; NT01EI_T00036.
DR   EnsemblGenomes-Gn; NT01EI_T00037.
DR   EnsemblGenomes-Gn; NT01EI_T00038.
DR   EnsemblGenomes-Gn; NT01EI_T00039.
DR   EnsemblGenomes-Gn; NT01EI_T0004.
DR   EnsemblGenomes-Gn; NT01EI_T00040.
DR   EnsemblGenomes-Gn; NT01EI_T00041.
DR   EnsemblGenomes-Gn; NT01EI_T00042.
DR   EnsemblGenomes-Gn; NT01EI_T00043.
DR   EnsemblGenomes-Gn; NT01EI_T00044.
DR   EnsemblGenomes-Gn; NT01EI_T00045.
DR   EnsemblGenomes-Gn; NT01EI_T00046.
DR   EnsemblGenomes-Gn; NT01EI_T00047.
DR   EnsemblGenomes-Gn; NT01EI_T00048.
DR   EnsemblGenomes-Gn; NT01EI_T00049.
DR   EnsemblGenomes-Gn; NT01EI_T0005.
DR   EnsemblGenomes-Gn; NT01EI_T00050.
DR   EnsemblGenomes-Gn; NT01EI_T00051.
DR   EnsemblGenomes-Gn; NT01EI_T00052.
DR   EnsemblGenomes-Gn; NT01EI_T00053.
DR   EnsemblGenomes-Gn; NT01EI_T00054.
DR   EnsemblGenomes-Gn; NT01EI_T00055.
DR   EnsemblGenomes-Gn; NT01EI_T00056.
DR   EnsemblGenomes-Gn; NT01EI_T00057.
DR   EnsemblGenomes-Gn; NT01EI_T00058.
DR   EnsemblGenomes-Gn; NT01EI_T00059.
DR   EnsemblGenomes-Gn; NT01EI_T0006.
DR   EnsemblGenomes-Gn; NT01EI_T00060.
DR   EnsemblGenomes-Gn; NT01EI_T00061.
DR   EnsemblGenomes-Gn; NT01EI_T00062.
DR   EnsemblGenomes-Gn; NT01EI_T00063.
DR   EnsemblGenomes-Gn; NT01EI_T00064.
DR   EnsemblGenomes-Gn; NT01EI_T00065.
DR   EnsemblGenomes-Gn; NT01EI_T00066.
DR   EnsemblGenomes-Gn; NT01EI_T00067.
DR   EnsemblGenomes-Gn; NT01EI_T00068.
DR   EnsemblGenomes-Gn; NT01EI_T00069.
DR   EnsemblGenomes-Gn; NT01EI_T0007.
DR   EnsemblGenomes-Gn; NT01EI_T00070.
DR   EnsemblGenomes-Gn; NT01EI_T00071.
DR   EnsemblGenomes-Gn; NT01EI_T00072.
DR   EnsemblGenomes-Gn; NT01EI_T00073.
DR   EnsemblGenomes-Gn; NT01EI_T00074.
DR   EnsemblGenomes-Gn; NT01EI_T00075.
DR   EnsemblGenomes-Gn; NT01EI_T00076.
DR   EnsemblGenomes-Gn; NT01EI_T00077.
DR   EnsemblGenomes-Gn; NT01EI_T00078.
DR   EnsemblGenomes-Gn; NT01EI_T00079.
DR   EnsemblGenomes-Gn; NT01EI_T0008.
DR   EnsemblGenomes-Gn; NT01EI_T00080.
DR   EnsemblGenomes-Gn; NT01EI_T00081.
DR   EnsemblGenomes-Gn; NT01EI_T00082.
DR   EnsemblGenomes-Gn; NT01EI_T00083.
DR   EnsemblGenomes-Gn; NT01EI_T00084.
DR   EnsemblGenomes-Gn; NT01EI_T00085.
DR   EnsemblGenomes-Gn; NT01EI_T00086.
DR   EnsemblGenomes-Gn; NT01EI_T00087.
DR   EnsemblGenomes-Gn; NT01EI_T00088.
DR   EnsemblGenomes-Gn; NT01EI_T00089.
DR   EnsemblGenomes-Gn; NT01EI_T0009.
DR   EnsemblGenomes-Gn; NT01EI_T00090.
DR   EnsemblGenomes-Gn; NT01EI_T00091.
DR   EnsemblGenomes-Gn; NT01EI_T00092.
DR   EnsemblGenomes-Gn; NT01EI_T00093.
DR   EnsemblGenomes-Gn; NT01EI_T00094.
DR   EnsemblGenomes-Tr; NT01EI_R0001-1.
DR   EnsemblGenomes-Tr; NT01EI_R00010-1.
DR   EnsemblGenomes-Tr; NT01EI_R00011-1.
DR   EnsemblGenomes-Tr; NT01EI_R00012-1.
DR   EnsemblGenomes-Tr; NT01EI_R00013-1.
DR   EnsemblGenomes-Tr; NT01EI_R00014-1.
DR   EnsemblGenomes-Tr; NT01EI_R00015-1.
DR   EnsemblGenomes-Tr; NT01EI_R00016-1.
DR   EnsemblGenomes-Tr; NT01EI_R00017-1.
DR   EnsemblGenomes-Tr; NT01EI_R00018-1.
DR   EnsemblGenomes-Tr; NT01EI_R00019-1.
DR   EnsemblGenomes-Tr; NT01EI_R0002-1.
DR   EnsemblGenomes-Tr; NT01EI_R00020-1.
DR   EnsemblGenomes-Tr; NT01EI_R00021-1.
DR   EnsemblGenomes-Tr; NT01EI_R00022-1.
DR   EnsemblGenomes-Tr; NT01EI_R00023-1.
DR   EnsemblGenomes-Tr; NT01EI_R00024-1.
DR   EnsemblGenomes-Tr; NT01EI_R00025-1.
DR   EnsemblGenomes-Tr; NT01EI_R0003-1.
DR   EnsemblGenomes-Tr; NT01EI_R0004-1.
DR   EnsemblGenomes-Tr; NT01EI_R0005-1.
DR   EnsemblGenomes-Tr; NT01EI_R0006-1.
DR   EnsemblGenomes-Tr; NT01EI_R0007-1.
DR   EnsemblGenomes-Tr; NT01EI_R0008-1.
DR   EnsemblGenomes-Tr; NT01EI_R0009-1.
DR   EnsemblGenomes-Tr; NT01EI_T0001-1.
DR   EnsemblGenomes-Tr; NT01EI_T00010-1.
DR   EnsemblGenomes-Tr; NT01EI_T00011-1.
DR   EnsemblGenomes-Tr; NT01EI_T00012-1.
DR   EnsemblGenomes-Tr; NT01EI_T00013-1.
DR   EnsemblGenomes-Tr; NT01EI_T00014-1.
DR   EnsemblGenomes-Tr; NT01EI_T00015-1.
DR   EnsemblGenomes-Tr; NT01EI_T00016-1.
DR   EnsemblGenomes-Tr; NT01EI_T00017-1.
DR   EnsemblGenomes-Tr; NT01EI_T00018-1.
DR   EnsemblGenomes-Tr; NT01EI_T00019-1.
DR   EnsemblGenomes-Tr; NT01EI_T0002-1.
DR   EnsemblGenomes-Tr; NT01EI_T00020-1.
DR   EnsemblGenomes-Tr; NT01EI_T00021-1.
DR   EnsemblGenomes-Tr; NT01EI_T00022-1.
DR   EnsemblGenomes-Tr; NT01EI_T00023-1.
DR   EnsemblGenomes-Tr; NT01EI_T00024-1.
DR   EnsemblGenomes-Tr; NT01EI_T00025-1.
DR   EnsemblGenomes-Tr; NT01EI_T00026-1.
DR   EnsemblGenomes-Tr; NT01EI_T00027-1.
DR   EnsemblGenomes-Tr; NT01EI_T00028-1.
DR   EnsemblGenomes-Tr; NT01EI_T00029-1.
DR   EnsemblGenomes-Tr; NT01EI_T0003-1.
DR   EnsemblGenomes-Tr; NT01EI_T00030-1.
DR   EnsemblGenomes-Tr; NT01EI_T00031-1.
DR   EnsemblGenomes-Tr; NT01EI_T00032-1.
DR   EnsemblGenomes-Tr; NT01EI_T00033-1.
DR   EnsemblGenomes-Tr; NT01EI_T00034-1.
DR   EnsemblGenomes-Tr; NT01EI_T00035-1.
DR   EnsemblGenomes-Tr; NT01EI_T00036-1.
DR   EnsemblGenomes-Tr; NT01EI_T00037-1.
DR   EnsemblGenomes-Tr; NT01EI_T00038-1.
DR   EnsemblGenomes-Tr; NT01EI_T00039-1.
DR   EnsemblGenomes-Tr; NT01EI_T0004-1.
DR   EnsemblGenomes-Tr; NT01EI_T00040-1.
DR   EnsemblGenomes-Tr; NT01EI_T00041-1.
DR   EnsemblGenomes-Tr; NT01EI_T00042-1.
DR   EnsemblGenomes-Tr; NT01EI_T00043-1.
DR   EnsemblGenomes-Tr; NT01EI_T00044-1.
DR   EnsemblGenomes-Tr; NT01EI_T00045-1.
DR   EnsemblGenomes-Tr; NT01EI_T00046-1.
DR   EnsemblGenomes-Tr; NT01EI_T00047-1.
DR   EnsemblGenomes-Tr; NT01EI_T00048-1.
DR   EnsemblGenomes-Tr; NT01EI_T00049-1.
DR   EnsemblGenomes-Tr; NT01EI_T0005-1.
DR   EnsemblGenomes-Tr; NT01EI_T00050-1.
DR   EnsemblGenomes-Tr; NT01EI_T00051-1.
DR   EnsemblGenomes-Tr; NT01EI_T00052-1.
DR   EnsemblGenomes-Tr; NT01EI_T00053-1.
DR   EnsemblGenomes-Tr; NT01EI_T00054-1.
DR   EnsemblGenomes-Tr; NT01EI_T00055-1.
DR   EnsemblGenomes-Tr; NT01EI_T00056-1.
DR   EnsemblGenomes-Tr; NT01EI_T00057-1.
DR   EnsemblGenomes-Tr; NT01EI_T00058-1.
DR   EnsemblGenomes-Tr; NT01EI_T00059-1.
DR   EnsemblGenomes-Tr; NT01EI_T0006-1.
DR   EnsemblGenomes-Tr; NT01EI_T00060-1.
DR   EnsemblGenomes-Tr; NT01EI_T00061-1.
DR   EnsemblGenomes-Tr; NT01EI_T00062-1.
DR   EnsemblGenomes-Tr; NT01EI_T00063-1.
DR   EnsemblGenomes-Tr; NT01EI_T00064-1.
DR   EnsemblGenomes-Tr; NT01EI_T00065-1.
DR   EnsemblGenomes-Tr; NT01EI_T00066-1.
DR   EnsemblGenomes-Tr; NT01EI_T00067-1.
DR   EnsemblGenomes-Tr; NT01EI_T00068-1.
DR   EnsemblGenomes-Tr; NT01EI_T00069-1.
DR   EnsemblGenomes-Tr; NT01EI_T0007-1.
DR   EnsemblGenomes-Tr; NT01EI_T00070-1.
DR   EnsemblGenomes-Tr; NT01EI_T00071-1.
DR   EnsemblGenomes-Tr; NT01EI_T00072-1.
DR   EnsemblGenomes-Tr; NT01EI_T00073-1.
DR   EnsemblGenomes-Tr; NT01EI_T00074-1.
DR   EnsemblGenomes-Tr; NT01EI_T00075-1.
DR   EnsemblGenomes-Tr; NT01EI_T00076-1.
DR   EnsemblGenomes-Tr; NT01EI_T00077-1.
DR   EnsemblGenomes-Tr; NT01EI_T00078-1.
DR   EnsemblGenomes-Tr; NT01EI_T00079-1.
DR   EnsemblGenomes-Tr; NT01EI_T0008-1.
DR   EnsemblGenomes-Tr; NT01EI_T00080-1.
DR   EnsemblGenomes-Tr; NT01EI_T00081-1.
DR   EnsemblGenomes-Tr; NT01EI_T00082-1.
DR   EnsemblGenomes-Tr; NT01EI_T00083-1.
DR   EnsemblGenomes-Tr; NT01EI_T00084-1.
DR   EnsemblGenomes-Tr; NT01EI_T00085-1.
DR   EnsemblGenomes-Tr; NT01EI_T00086-1.
DR   EnsemblGenomes-Tr; NT01EI_T00087-1.
DR   EnsemblGenomes-Tr; NT01EI_T00088-1.
DR   EnsemblGenomes-Tr; NT01EI_T00089-1.
DR   EnsemblGenomes-Tr; NT01EI_T0009-1.
DR   EnsemblGenomes-Tr; NT01EI_T00090-1.
DR   EnsemblGenomes-Tr; NT01EI_T00091-1.
DR   EnsemblGenomes-Tr; NT01EI_T00092-1.
DR   EnsemblGenomes-Tr; NT01EI_T00093-1.
DR   EnsemblGenomes-Tr; NT01EI_T00094-1.
DR   EuropePMC; PMC3264089; 22247535.
DR   EuropePMC; PMC3359876.
DR   EuropePMC; PMC4481286; 26112788.
DR   EuropePMC; PMC4508803; 26193880.
DR   EuropePMC; PMC4559741; 26337892.
DR   EuropePMC; PMC4683224; 26679579.
DR   EuropePMC; PMC4888880; 27303737.
DR   EuropePMC; PMC5122678; 27881536.
DR   EuropePMC; PMC5741614; 29326601.
DR   EuropePMC; PMC6090022; 30131791.
DR   EuropePMC; PMC6279896; 30546354.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00018; CsrB.
DR   RFAM; RF00021; Spot_42.
DR   RFAM; RF00022; GcvB.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00034; RprA.
DR   RFAM; RF00040; rne5.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00057; RyhB.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00078; MicA.
DR   RFAM; RF00079; OmrA-B.
DR   RFAM; RF00081; ArcZ.
DR   RFAM; RF00082; SraG.
DR   RFAM; RF00083; GlmZ_SraJ.
DR   RFAM; RF00101; SraC_RyeA.
DR   RFAM; RF00110; RybB.
DR   RFAM; RF00111; RyeB.
DR   RFAM; RF00112; CyaR_RyeE.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00128; GlmY_tke1.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00368; sroB.
DR   RFAM; RF00391; RtT.
DR   RFAM; RF00506; Thr_leader.
DR   RFAM; RF00514; His_leader.
DR   RFAM; RF00552; rncO.
DR   RFAM; RF00630; P26.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01394; isrK.
DR   RFAM; RF01396; isrN.
DR   RFAM; RF01405; STnc490k.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01707; JUMPstart.
DR   RFAM; RF01728; STAXI.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01769; greA.
DR   RFAM; RF01770; rimP.
DR   RFAM; RF01794; sok.
DR   RFAM; RF01796; frnS.
DR   RFAM; RF01830; StyR-44.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01859; Phe_leader.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01988; SECIS_2.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF02029; sraA.
DR   RFAM; RF02030; tp2.
DR   RFAM; RF02031; tpke11.
DR   RFAM; RF02221; sRNA-Xcc1.
DR   SILVA-LSU; CP001600.
DR   SILVA-SSU; CP001600.
XX
CC   On Oct 16, 2012 this sequence version replaced gi:238867551.
CC   Source DNA is available from Dr. Mark Lawrence at
CC   lawrence@cvm.msstate.edu.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3812301
FT                   /organism="Edwardsiella ictaluri 93-146"
FT                   /strain="93-146"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:634503"
FT   gene            60..1451
FT                   /locus_tag="NT01EI_0001"
FT   CDS_pept        60..1451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0001"
FT                   /product="chromosomal replication initiator protein DnaA,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67263"
FT                   /db_xref="GOA:C5BHC5"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BHC5"
FT                   /protein_id="ACR67263.1"
FT                   /translation="MSLSLWQQCLARLQDELPATEFSMWIRPLQAELSDNTLALYAPNR
FT                   FVLDWVRDKYINNINGLLNDFCGSDAPVLRFEVGSKPIVPVAVSSAASSGASVPPAAVR
FT                   ASSLARPSWERVTAQPELSYRSNVNPKHTFDNFVEGKSNQLARAAARQVADNPGGAYNP
FT                   LFLYGGTGLGKTHLLHAVGNGIMARKPNAKVVYMHSERFVQDMVKALQNNAIEEFKRYY
FT                   RSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSR
FT                   FGWGLTVAIEPPELETRVAILMKKADENDIRLPGEVAFFIAKRLRSNVRELEGALNRVI
FT                   ANANFTGRAITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKVADLLSKRRSRSV
FT                   ARPRQMAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLI
FT                   RTLSS"
FT   gene            1476..2576
FT                   /locus_tag="NT01EI_0002"
FT   CDS_pept        1476..2576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0002"
FT                   /product="DNA polymerase III, beta subunit, putative"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67264"
FT                   /db_xref="GOA:C5BHC6"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHC6"
FT                   /protein_id="ACR67264.1"
FT                   /translation="MKFIVEREHLIKPLQQVSSPLGGRPTLPILGNLLLQVEDGHLSLT
FT                   GTDLEMEMVARVPLVQPHEAGATTVPARKFLDICRGLPDGAEISVALDGDRMLVRSGRS
FT                   RFSLSTLPAADFPNLDDWQSEVEFTLPQATLKRLIEATQFSMAHQDVRYYLNGMLFETE
FT                   GEELRTVATDGHRLAVCSMPIGQSLPSHSVIVPRKGVIELMRLLDGGETPLRLQIGSNN
FT                   LRAHVGGFIFTSKLVDGRFPDYRRVLPKNPDKALEAGCDELKQAFARAAILSNEKFRGV
FT                   RLHVSHNQLKITANNPEQEEAEELLDVDYPGSDLEIGFNVSYVLDVLNALKCERVVMML
FT                   TDAVSSVQIEDAASQAAVYVVMPMRL"
FT   gene            2653..3729
FT                   /locus_tag="NT01EI_0003"
FT   CDS_pept        2653..3729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0003"
FT                   /product="DNA replication and repair protein RecF,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67265"
FT                   /db_xref="GOA:C5BHC7"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BHC7"
FT                   /protein_id="ACR67265.1"
FT                   /translation="MALTRLVIRDFRNIEEADLALAPGFNFLVGANGSGKTSVLEAIYT
FT                   LGHGRAFRSLQAGRVIRHDCSAFVLHGRIDDGGGRERAVGLSKDRQGDSKVRIDGSDGH
FT                   KVAELAQMLPMQLITPEGFTLLNGGPKYRRAFLDWGCFHGERSFFTAWNNLRRVLKQRN
FT                   AALRQVTRYAQIRPWDQELVPLAEQVSALRAAYSEAIAQDIAATCSQFLPEYALSFSFM
FT                   RGWDRESDYAALLERHFERDRALTYTAQGPHKADFRIRADGTPVEDLLSRGQLKLLMCA
FT                   LRLAQGEYLTRHSGRQCLYLIDDFASELDAGRRRLLAERLKSTGAQVFVSAVNADQIGD
FT                   MVDEKGKMFHVEQGKIAV"
FT   gene            3773..6187
FT                   /locus_tag="NT01EI_0004"
FT   CDS_pept        3773..6187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0004"
FT                   /product="DNA gyrase, B subunit, putative"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67266"
FT                   /db_xref="GOA:C5BHC8"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHC8"
FT                   /protein_id="ACR67266.1"
FT                   /translation="MSNTYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVVD
FT                   NAIDEALAGYCKDIIVTIHSDNSVSVQDDGRGIPTGIHPEEGVSAAEVIMTVLHAGGKF
FT                   DDNSYKVSGGLHGVGVSVVNALSEKLELVIRRDGHVHEQIYRHGVPAAPLKVVGDTDLT
FT                   GTRVRFWPSMETFSNVVEFQYDILAKRLRELSFLNSGVSIRLCDKRNDREDHFHYEGGI
FT                   KAFVEYLNKNKTPIHPNVFYFSTMKDDIGVEVALQWNDGFQENIYCFTNNIPQRDGGTH
FT                   LAGFRAAMTRTLNSYMENEGYTKKSKISATGDDAREGLIAVVSVKVPDPKFSSQTKDKL
FT                   VSSEVKSAVESLMNERLAEYLLENPSDAKIVVGKIIDAARAREAARKAREMTRRKGALD
FT                   LAGLPGKLADCQERDPAHSELYLVEGDSAGGSAKQGRNRKNQAILPLKGKILNVEKARF
FT                   DKMLSSQEVATLITALGCGIGRDEYNPDKLRYHSIIIMTDADVDGSHIRTLLLTFFYRQ
FT                   MPEIIERGHVYIAQPPLYKVKKGKQEQYIKDDEAMDQYQMSIALDGAALHINAAAPALA
FT                   GEPLEKLVAEYYQAQKLIGRMERRYPKAVLNQLIYQPTLSDADLGNQAQVEQWINSLVA
FT                   TLNEKELHGSVYSARALENRERQMFEPLVRVRTHGVDTDYGFDFDFVHGAEYRRICALG
FT                   EKLRDLLEESAFVERGERRQPVASFEQALDWLVKESRRGLAIQRYKGLGEMNPDQLWET
FT                   TMDPEGRRMLRVTIKDAVAADQLFTTLMGDAVEPRRAFIEENALKASNLDF"
FT   gene            6277..7095
FT                   /locus_tag="NT01EI_0005"
FT   CDS_pept        6277..7095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0005"
FT                   /product="Cof-like hydrolase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67267"
FT                   /db_xref="GOA:C5BHC9"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHC9"
FT                   /protein_id="ACR67267.1"
FT                   /translation="MPIKLIAIDLDGTLLNEAREITPAVKAAIAAARRQGVRVVLATGR
FT                   PLVGVQRYLQELGLDSAGEYCLCNNGGLIVHADSGETLFETALDYGDYRYLEALAREVN
FT                   CHFHALDADRLFTANKDISKYTVHESFITGIPLYFCPAEQMDPSLRFPKVMMIDHPAVL
FT                   EAAIARIPAQVYQRYTLLRSSPFFLEILHRDVDKGKGIARLAQHLGIERQAVMCIGDHG
FT                   NDLAMIEYAGLGVAMGNAEAAILEAAQHVTASNREDGVAQAIRQWVLNAA"
FT   gene            7172..8470
FT                   /locus_tag="NT01EI_0006"
FT   CDS_pept        7172..8470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0006"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67268"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR022223"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHD0"
FT                   /protein_id="ACR67268.1"
FT                   /translation="MRHPSEVQLTHDARGHQLTNTGVWTPDSHWIAYDVRPHGGSFSGV
FT                   TIERVSVPDGQCEVIYHAGDEACVGVVTVAPTLPERYVFIHGPEHPDAQWQYDFHHRRG
FT                   AIVSADRPGQAETLDALSITAPYLPGALRGGSHVHVFSPDGSRLSFTYNDHVMHEHCPE
FT                   RDQRNIGVALPMGAVRVKKQHPREYDGSHFCVLVSATTPTPRPGSDDITRAYEEGWIGK
FT                   QGYLKEDGQHQRWALAFIGDTLDLDGRRVAELFIVDLPAEMAAYRCAGDQPLQGTLSSL
FT                   PAPPAGICQRRLTFTHQRRHPGLATVPRHWVRSAPDGSAIAFLMRDEQGVVQLWLISPN
FT                   GGEARQITHGAHDVQSAFNWHPDGRSVLMVMDNSVVRCDVASGAVTRITGRTAQPPCAD
FT                   AVIPSPDGRWVAYMREVNGWTQIFVARLTSDGE"
FT   gene            complement(8477..8746)
FT                   /locus_tag="NT01EI_0007"
FT   CDS_pept        complement(8477..8746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0007"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67269"
FT                   /db_xref="InterPro:IPR010780"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHD1"
FT                   /protein_id="ACR67269.1"
FT                   /translation="MTRVGPHQGYYAGTKNDLQMISSEESGWVMRPLLVLDLPLSALVD
FT                   TLLLPYDYYRTDDEPATESPRARVQRAEQASATNGMVPPAAPEN"
FT   gene            8829..8963
FT                   /locus_tag="NT01EI_0008"
FT   CDS_pept        8829..8963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0008"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67270"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHD2"
FT                   /protein_id="ACR67270.1"
FT                   /translation="MSSWADSNLPPSLSATLLSIYRNIDAVFVFQPNFINLCCIIKFR"
FT   gene            9102..9515
FT                   /locus_tag="NT01EI_0009"
FT   CDS_pept        9102..9515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0009"
FT                   /product="Hsp20/alpha crystallin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67271"
FT                   /db_xref="GOA:C5BHD3"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR023728"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHD3"
FT                   /protein_id="ACR67271.1"
FT                   /translation="MRNFDLAPLYRSAIGFDRLFNLIESGQNNTNGGYPPYNVELVDDN
FT                   HYRISIAVAGFDEAELEIIYHVNSLIIKGSHLVSDKRRTYLYQGIAERNFERKFQLAEH
FT                   IHINEARLENGLLFIDLERIVPESQQARKIDIK"
FT   gene            9631..10098
FT                   /locus_tag="NT01EI_0010"
FT   CDS_pept        9631..10098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0010"
FT                   /product="Hsp20/alpha crystallin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67272"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHD4"
FT                   /protein_id="ACR67272.1"
FT                   /translation="MRNYDLAPLMRQWIGFDKLANAMQTSLEPQGFPPYNIEKSDDNHY
FT                   RISLALAGFRQSELDLEVEGPRLTVRGNPVKPEKPVEYLHQGLVCKAFELSFTLAEHLT
FT                   VEGAAFENGLLNIDLVRHVPEALQPQRIVISAAPRDPAALECRNEPDTHQQ"
FT   gene            10289..11548
FT                   /locus_tag="NT01EI_0012"
FT   CDS_pept        10289..11548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0012"
FT                   /product="aminotransferase, classes I and II"
FT                   /EC_number="2.6.1.66"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67273"
FT                   /db_xref="GOA:C5BHD5"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHD5"
FT                   /protein_id="ACR67273.1"
FT                   /translation="MTFSAFGERFTRYSAITRLMDDLNSGLRTPGTIMLGGGNPARIVQ
FT                   MEDYFTSLYRELLEEGTLGEALCNYDGPQGKDTLLEALARLLSEQYGWPIGAQNIALTN
FT                   GSQSAFFYLFNLFAGRCSDGARRRILFPLAPEYIGYADAGLEDDLFVAHKPSIALLPQG
FT                   QFKYHIDFDRLKIEDDIGLICVSRPTNPTGNVLTDEELTRLDALARQHRIPLLIDNAYG
FT                   VPFPGILFTDVTPQWNPNTILCMSLSKLGLPGVRCGIVVADERTIQALSNMNGVISLSP
FT                   GSMGPALALRMIERGDLLRLSREVIRPFYQQRVDQTLAILRRYLPEERCLIHRPEGAIF
FT                   LWLWFKDLPIGSEVLYQRLKQRGVLMVPGDHFFPGLAQDWPHTRQCMRMNYVPDPALIE
FT                   RGVQILAEEVERAYREAGAA"
FT   gene            complement(11620..12339)
FT                   /locus_tag="NT01EI_0013"
FT   CDS_pept        complement(11620..12339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0013"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67274"
FT                   /db_xref="InterPro:IPR021413"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHD6"
FT                   /protein_id="ACR67274.1"
FT                   /translation="MTFAVKTWVQRLLMPVMALFFVMQLSGCGDSDKEQQKAFIDYLQN
FT                   TVMRGSVTIPTLSEAQKQQLGHYAGDYALLVTFSQNFNHAMEGSMTPLFNTLQQIRTPQ
FT                   EYLTQRDRLQRELGALNMLGQQIQSAKALADSTYATLKQPEEVKAVFDKAFTKIVTGPS
FT                   NAVMPMIPQAEAVAKTLVQVGDFLQNLGPQVHFDNQGVQLQTQAQVDQYNQLMRDLSVK
FT                   YQALMAAQQQNAGLLQN"
FT   gene            complement(12472..14541)
FT                   /locus_tag="NT01EI_0014"
FT   CDS_pept        complement(12472..14541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0014"
FT                   /product="glycyl-tRNA synthetase, beta subunit, putative"
FT                   /EC_number="6.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67275"
FT                   /db_xref="GOA:C5B995"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5B995"
FT                   /protein_id="ACR67275.1"
FT                   /translation="MTQQTFLVEIGTEELPPKALRSLAQAFADNFRTELDNAGLAHGDI
FT                   EWFAAPRRLALKVAALNAAQPDREIEKRGPAIAQAFDAEGKPTKAAEGWARGCGISVDQ
FT                   AERLSTDKGEWLLYRALQKGQRAQDLLPALVASALSRLPIPKLMRWGDSDTQFVRPVHT
FT                   VTLLLGSESIPATILGVPSDRVIRGHRFMGEAEFTLDSADQYPQILLERGKVIADYDAR
FT                   KALIKRDAEAAAARIGGVADLSDSLLEEVTSLVEWPVVLTARFEEKFLAVPAEALVYTM
FT                   KGDQKYFPVYDAAGKLLPNFIFVANIDSKDAQQIIAGNEKVVRPRLADAEFFFKTDRKQ
FT                   RLEDNLPRLESVLFQQQLGSLRDKTDRITALAGWIAQQIGADVNMATRAGLLSKCDLMT
FT                   NMVFEFTDTQGVMGMHYARHDGEAEEVAVALNEQYMPRFAGDALPTSLVACAVAIADKM
FT                   DTLAGIFGIGQHPKGDKDPFALRRAALGVLRIVVEKKLPLDLLTLTQEAVRLYGDKLGN
FT                   ASVVDDVVEFMLGRFRAWYQEEGHAVDTIQAVLARRPTRPADFDARVRAVSHFRTLPEA
FT                   ATLAAANKRVSNILAKSGDVLAEQVQAVLLKEPAEIRLAANLITLQEKLAPLFADGRYQ
FT                   EALVELATLRQPVDDFFEQVMVMADDEQVRINRLTLLNKLRDLFLQVADISVLQ"
FT   gene            complement(14551..15459)
FT                   /locus_tag="NT01EI_0015"
FT   CDS_pept        complement(14551..15459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0015"
FT                   /product="glycyl-tRNA synthetase, alpha subunit, putative"
FT                   /EC_number="6.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67276"
FT                   /db_xref="GOA:C5B996"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5B996"
FT                   /protein_id="ACR67276.1"
FT                   /translation="MQKFDIKTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTC
FT                   LRALGPEPMATAYVQPSRRPTDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYLGSLKA
FT                   LGLDPTVHDIRFVEDNWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEI
FT                   TYGLERLAMYIQGVDSVYDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEYADVDFLFAC
FT                   FEQYEKEARMLLELEHPLPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRTLTK
FT                   MVAEAYYASREALGFPMCKKD"
FT   gene            complement(15505..15630)
FT                   /locus_tag="NT01EI_0016"
FT   CDS_pept        complement(15505..15630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0016"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67277"
FT                   /db_xref="UniProtKB/TrEMBL:C5B997"
FT                   /protein_id="ACR67277.1"
FT                   /translation="MRPRPALMRYFARKIRNSGACGLKKRALSHYCCISYAQAVY"
FT   gene            15673..16272
FT                   /locus_tag="NT01EI_0017"
FT   CDS_pept        15673..16272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0017"
FT                   /product="DNA-3-methyladenine glycosylase 1, putative"
FT                   /EC_number="3.2.2.20"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67278"
FT                   /db_xref="GOA:C5B998"
FT                   /db_xref="InterPro:IPR004597"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:C5B998"
FT                   /protein_id="ACR67278.1"
FT                   /translation="MDDHMPQRCAWVSADPLYLAYHDHEWGRPLYDGRALFELLCLEGQ
FT                   QAGLSWLTVLKKRQRYRQAFHSFDPAKVAAMTAEDVAGLLLDKELIRNRRKLEAIVTNA
FT                   RALLAMAQRGEDFSAFVWSFVGGAPLASPEGAWQMLTHTSTSDALARALKQRGFTFVGT
FT                   TICYAFMQACGMVSDHMPGCYLYPDASPASASGQTR"
FT   gene            16235..16738
FT                   /locus_tag="NT01EI_0018"
FT   CDS_pept        16235..16738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0018"
FT                   /product="acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67279"
FT                   /db_xref="GOA:C5B999"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C5B999"
FT                   /protein_id="ACR67279.1"
FT                   /translation="MRPLHLRPARPADASALLALWLKLTIQAHPDIPPGYWRASLPWVR
FT                   DAYLPGGQTWLATDRGRIGGFVCILPGHLLGALFVAQRYRGRGMAQRLMRHAKRHHPWL
FT                   LLEAYCANRRALAFYRRQGFLCIDRQIQAQTGRAVVTLLWQRGAVLEKRGHLDYTARSS
FT                   VMGE"
FT   gene            16934..17458
FT                   /locus_tag="NT01EI_0020"
FT   CDS_pept        16934..17458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0020"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67280"
FT                   /db_xref="GOA:C5B9A0"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniProtKB/TrEMBL:C5B9A0"
FT                   /protein_id="ACR67280.1"
FT                   /translation="MSSVALAEIGDKTQLLTLLLVARFGKPVLILLAIILATLVNHYFA
FT                   ALIGELVTQFLSPQIMRWMVAAGFLVMAVWVLFPDKNDGEIRGGHPFWTSLAVFFLAEI
FT                   GDKTQIATVLLGAHYQHITWVVLGSTLGMVLANAPMLWFGARLQPYLKSGWGRRLSSLL
FT                   FFILGVVTLIL"
FT   gene            17604..18263
FT                   /locus_tag="NT01EI_0021"
FT   CDS_pept        17604..18263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0021"
FT                   /product="OmpA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67281"
FT                   /db_xref="GOA:C5B9A1"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR006690"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR039567"
FT                   /db_xref="UniProtKB/TrEMBL:C5B9A1"
FT                   /protein_id="ACR67281.1"
FT                   /translation="MKKSRFCIAGLISAALILSGCTTNPYTGESQAGKSGIGAGLGALL
FT                   GAGVGVLSSSKSDRGKGALIGAAAGAALGGGIGYYMDVQEAKLRDKMRGTGVSVTRQGD
FT                   NIVLNMPNNVTFDSNSSNLKPAGANTLTGVAMVLKEYQKTAVNVVGYTDSTGSRDLNMR
FT                   LSQQRADSVASALIVQGVSAGRIRTIGMGPANPIATNSTAAGKAQNRRVEITLSPL"
FT   gene            complement(18303..18551)
FT                   /locus_tag="NT01EI_0022"
FT   CDS_pept        complement(18303..18551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0022"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67282"
FT                   /db_xref="GOA:C5B9A2"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR022931"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5B9A2"
FT                   /protein_id="ACR67282.1"
FT                   /translation="MTDLFANPDKTLDALGLRCPEPVMMVRKTVRHMVAGETLLIIADD
FT                   PATTRDIPGFCRFMEHTLLAQEIEQTPYRYLLRKGGA"
FT   gene            18770..19429
FT                   /locus_tag="NT01EI_0023"
FT   CDS_pept        18770..19429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0023"
FT                   /product="conserved hypothetical integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67283"
FT                   /db_xref="GOA:C5B9A3"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:C5B9A3"
FT                   /protein_id="ACR67283.1"
FT                   /translation="MFSFTPQQRFTALCWLSLFHILIITSSNYLVQLPITVFGFHTTWG
FT                   AFTFPFIFLATDLTVRIFGAPLARRIILAVMVPALLISYCVSALFFQGQWQGFAALGSV
FT                   NLMVARIACASFMAYVLGQILDVHVFNRLRQTQAWWVAPTASTLFGNISDTLSFFFIAF
FT                   YRSSDAFMATHWIEIALVDYAFKLLISMVFFLPMYGVMLNMLLKRIAFRQQQVSPA"
FT   gene            19839..20009
FT                   /locus_tag="NT01EI_0024"
FT   CDS_pept        19839..20009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0024"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67284"
FT                   /db_xref="UniProtKB/TrEMBL:C5B9A4"
FT                   /protein_id="ACR67284.1"
FT                   /translation="MFRDCFNPQGRIPFVLPNRAQAAVYPVSGALGIFPDSAFSGFYAM
FT                   LSFYLPTEGTR"
FT   gene            20166..20303
FT                   /locus_tag="NT01EI_0025"
FT   CDS_pept        20166..20303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0025"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67285"
FT                   /db_xref="UniProtKB/TrEMBL:C5B9A5"
FT                   /protein_id="ACR67285.1"
FT                   /translation="MGYVLDEQTFYSWLAAFTRLAAEMNRSNFIACAADVGIKSRASAY
FT                   "
FT   gene            20521..21096
FT                   /locus_tag="NT01EI_0026"
FT   CDS_pept        20521..21096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0026"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67286"
FT                   /db_xref="InterPro:IPR014894"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="UniProtKB/TrEMBL:C5B9A6"
FT                   /protein_id="ACR67286.1"
FT                   /translation="MGNLVKLIGVGLLVTGLAACDGSSTAETNAPVQGANATQPSVPEG
FT                   AKVSLLDGKIGFTLPAGLSDQTSKLGSQTNNMSVYANKTGQQAVIVILAPMPQDNLNAL
FT                   STRLIDQQKSRDASLQLLSSESVKLGGKEVEKVVSMQQANGHAIYSSIILAQVGDQLMT
FT                   MQISLPGDNRQEAANIANGVLDTLSFAR"
FT   gene            complement(21121..22815)
FT                   /locus_tag="NT01EI_0027"
FT   CDS_pept        complement(21121..22815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0027"
FT                   /product="AsmA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67287"
FT                   /db_xref="InterPro:IPR007844"
FT                   /db_xref="UniProtKB/TrEMBL:C5B9A7"
FT                   /protein_id="ACR67287.1"
FT                   /translation="MKVIGKLLLTLCVLLLLALAAVYFIGQSRWGARQISDWVNQHTNY
FT                   RITLSALQHTLRQPTVVQVNGFSLARAGQPPLLQSATLRLTFGWQQLSAPRHFSAIGLS
FT                   GGKLTLTQDGIPPLPISAAALRLHDMQILWPHADWPLQASDVDGGIVPLRPGSAKADFQ
FT                   FSATALSIGDIPAKNVLVQGEYRDRQLWLNNLGADVANGQMTAQALRQTDGTWRIDNLR
FT                   LSQIHWQSSQALQPFLHALQILPPLTLVRLDLLGANLEGKGWALGGLDATLRNVSLANG
FT                   HWRSQKGSLTLNATDIVLGAMHLSDPLLSADLTPQGVTLRQFNTRWSNALIRTHGDWQR
FT                   DNGHLTLNDLAVIGLEYTLPNAWRTLWLHPLPTWLQEITLQRFSLSRTLLVDINPDFPF
FT                   QMTALNGFGSHVTLARQRRWGFWQGQMQFNASEATFNKVDLRRPSATLQADNGTVRVSD
FT                   LSAISQKGLLEASATLNQIDSRLTLALHGRGVPVGQLDTWGWPALSTLQGDITLQLTLR
FT                   APLQADTPFRQGVEATLQAQDAHGHTLHQRMVSGQLVAEASPIAAED"
FT   gene            complement(22996..24441)
FT                   /locus_tag="NT01EI_0028"
FT   CDS_pept        complement(22996..24441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0028"
FT                   /product="uracil-xanthine permease"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67288"
FT                   /db_xref="GOA:C5B9A8"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:C5B9A8"
FT                   /protein_id="ACR67288.1"
FT                   /translation="MRPSLIPDAALMTTQTTDPDPIAQPATSSELIYRLDDCPPLAQTL
FT                   FAACQHLLAMFVAVITPALLICQALGLPVQDTQHIISMSLFASGLASLLQIKTWGPVGS
FT                   GLLSIQGTSFNFVTPLIMGGMTLKNGGVDIPTMMATLFGTLMLASCTEIILSRFLHLAR
FT                   CIITPLVSGIVVMIIGLSLIQVGLISIGGGYSAMHDHSFGAPQNLLLAGAVLLVIILLN
FT                   RQRNPYLRVASLVIAMAAGYGLAWLMGMLPESAAQPNTAPLVTIPTPLYYGLGLDWNLL
FT                   IPLMLVFMVTSLETIGDITATSDVSEQPVSGPLYMKRLKGGVLANGLNSMLSAIFNTFP
FT                   NSCFGQNNGVIQLTGVASRKVGFVVALMLLLLGLFPAVAGFVQHIPEPVLGGATIVMFG
FT                   TIAASGVRIVSREPLNRRAIMIMALSLAVGLGVSQQPEILQFAPQWLKTLLSSGIAAGG
FT                   ITAIVLNLILPARDSPLIPATRA"
FT   gene            24641..25855
FT                   /locus_tag="NT01EI_0029"
FT   CDS_pept        24641..25855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0029"
FT                   /product="sodium/glutamate symporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67289"
FT                   /db_xref="GOA:C5B9A9"
FT                   /db_xref="InterPro:IPR004445"
FT                   /db_xref="UniProtKB/TrEMBL:C5B9A9"
FT                   /protein_id="ACR67289.1"
FT                   /translation="MYHLDIYGTLVSATLVLLLGRQMVQKIPLLTKYTIPEPVAGGLLV
FT                   ALALLILKKSIGFEVDFDMSLKDPLMLAFFATIGLNANLASLRAGGKALSIFLFVVVGL
FT                   LIVQNAIGISMAKLMGLDPLMGLLAGSITLSGGHGTGAAWSKLFIERYGFQNATEVAMA
FT                   CATFGLVLGGLIGGPVARYLVKHSSTPDGTPDDNAVPSAFEKPQSGRMITSLVLIETLA
FT                   LIVICLTVGQLIAGWLRGSALELPTFVCVLFVGVILSNTLSKIGFYQVFERAVSVLGNV
FT                   SLSLFLAMALMSLKLWELASLALPMLTILAVQTLVMALYAIFVTYRVMGKNYDAAVLAA
FT                   GHCGFGLGATPTAIANMQAITERFGPSHLAFLVVPMVGAFFIDIANAIIIKLYLMLPLF
FT                   APAIG"
FT   gene            complement(25872..27953)
FT                   /locus_tag="NT01EI_0030"
FT   CDS_pept        complement(25872..27953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0030"
FT                   /product="ATP-dependent DNA helicase RecG, putative"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67290"
FT                   /db_xref="GOA:C5B9B0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:C5B9B0"
FT                   /protein_id="ACR67290.1"
FT                   /translation="MQGRLLDAVPLTSLSGVGASQAGKLAKLGLVTIQDLLLHLPLRYE
FT                   DRTRLYRIGELQPGITVTVEGEVLRTDVAFGRRRMLTSQISDGSGLLTLRFFNFSAAMK
FT                   NSLAPGKRVLAYGEIKRGHHGAEIIHPEYRIQGDDAAPALQEALTPVYPTTEGVRQATL
FT                   RKLSDQALALLDITPIPELLPESLGQGLISLPEALHTLHRPPPDIHQEDLAQGRHPAQR
FT                   RLILEELLAHHLSMLAVRADNQRHRALALATDDHLKHRFLAALPFTPTTAQRRVLDDIE
FT                   KDMAKSVPMMRLVQGDVGCGKTLVAALAALRAIAHGHQVALMAPTELLAEQHATNFRQW
FT                   FAPLGLSVGWLAGKQKGKARQTQMAAIAAGEVDMVVGTHALFQEQVQFADLALVIIDEQ
FT                   HRFGVHQRLALWEKGEAQGFHPHQLIMTATPIPRTLAMTAYADLDTSVIDELPPGRTPV
FT                   TTVAIADTRRQQILDRVRHACLEEKRQAYWVCTLIEESDLLEAQAAEVTAETLIQQLPE
FT                   LRIALVHGRMKATDKQRVMAQFKAGEVDLLVATTVIEVGVDVPNASLMIIENPERLGLA
FT                   QLHQLRGRVGRGAIASHCVLLYKSPLSQTAQRRLQVLRDSNDGFVIAQRDLEIRGPGEM
FT                   LGTRQTGNAEFRVADLLRDQALIPEVQRIARHLHSAYPQHARALIERWLPAGSRYSNA"
FT   gene            complement(27955..28647)
FT                   /locus_tag="NT01EI_0031"
FT   CDS_pept        complement(27955..28647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0031"
FT                   /product="RNA methyltransferase, TrmH family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67291"
FT                   /db_xref="GOA:C5B9B1"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR022724"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR033671"
FT                   /db_xref="UniProtKB/TrEMBL:C5B9B1"
FT                   /protein_id="ACR67291.1"
FT                   /translation="MTPQRYARICQMMAARQPDLTVCMEQVHKPHNVSAVIRTADAVGV
FT                   HQVHAVWPGKSMRTLVSTAAGSNSWVSVKTHRDIAAAVGELKGQGMQILATNLSATAVD
FT                   FREIDYTRPTCILMGQEKRGISAEALQLADRDIIIPMVGMVQSLNVSVASALILYEAQR
FT                   QRQQAGMYGRSQPSLNEEQQQRLLWEGGYPVLASVARRKGLARPHIANDGQIDAPQAWW
FT                   DAMQAARS"
FT   gene            complement(28653..30746)
FT                   /locus_tag="NT01EI_0032"
FT   CDS_pept        complement(28653..30746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0032"
FT                   /product="(p)ppGpp synthetase, RelA/SpoT family , putative"
FT                   /EC_number="2.7.6.5"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67292"
FT                   /db_xref="GOA:C5B9B2"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:C5B9B2"
FT                   /protein_id="ACR67292.1"
FT                   /translation="MYLFESLNLLIQKYLPEEQIKRLKQAYLVARDAHEGQTRSSGEPY
FT                   ITHPVAVACILAEMRLDYETLMAALLHDVIEDTPATYQDMEQLFGKSVAELVEGVSKLD
FT                   KLKFRDKKEAQAENFRKMIMAMVQDIRVILIKLADRTHNMRTLGSLRPDKRRRIARETL
FT                   EIYSPLAHRLGIHHLKTELEELGFEALYPNRYRVIKEVVKAARGNRKEMIQKILAEIDG
FT                   RLSEAGMACQVNGREKHLYSIYRKMHLKEQRFHSIMDIYAFRVIVKDVDTCYRVLGQAH
FT                   SLYKPRPGRVKDYIAIPKANGYQSLHTSLIGPHGVPVEVQIRTEDMDQMAEMGVAAHWA
FT                   YKEGESSTTAQIRAQRWMQSLLELQQSAGNSFEFIESVKSDLFPDEIYVFTPEGRIVEL
FT                   PAGATPVDFAYAVHTDIGHACVGARVDRQPYPLSQALSSGQTIEVITAPGARPNAAWLN
FT                   FVVSSKARAKIRQMLKNLKRDDSVSLGRRLLNHALGNGRKLASIPAPNIQRELERMKLQ
FT                   SLDDLLAEIGLGNAMSVVVARNLLGEQDTPPGGRKLPIKGADGVLLTFAKCCRPIPGDP
FT                   IIAHVSPGKGLVIHHESCRNIRGYQKEPEKFMPVEWDKDIDQEFIAEIKVDMFNHQGAL
FT                   ANLTAAINATASNIQSMNTEEKDGRVYSVYIRLTTRDRVHLANIMRKIRIMPDVIKVTR
FT                   NRN"
FT   gene            complement(30766..31041)
FT                   /locus_tag="NT01EI_0033"
FT   CDS_pept        complement(30766..31041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0033"
FT                   /product="DNA-directed RNA polymerase, omega subunit,
FT                   putative"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67293"
FT                   /db_xref="GOA:C5B9B3"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5B9B3"
FT                   /protein_id="ACR67293.1"
FT                   /translation="MARVTVQDAVEKIGNRFDLVLVAARRARQMQTGGKEPLVPEENDK
FT                   TTVLALREIEEGLINNQILDVRERQEQQEQEAAELQAVTAIAEGRR"
FT   gene            complement(31096..31719)
FT                   /locus_tag="NT01EI_0034"
FT   CDS_pept        complement(31096..31719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0034"
FT                   /product="guanylate kinase, putative"
FT                   /EC_number="2.7.4.8"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67294"
FT                   /db_xref="GOA:C5B9B4"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5B9B4"
FT                   /protein_id="ACR67294.1"
FT                   /translation="MVQGTLYIVSAPSGAGKSSLIQTLLKTQPTYDSRVSVSHTTRASR
FT                   PGEQHGEHYYFVSVDEFKAMIARDDFLEHAEVFGNYYGTSRQAIEKVLAQGIDVFLDID
FT                   WQGARQVRSKMPQARSIFILPPSREELARRLHGRGQDSDDVIAGRMAKAVSEISHYSEY
FT                   DYLIINDDFDVALQDLRTIIRAERLRRERQQLRHDALISKLLAD"
FT   gene            complement(31840..32460)
FT                   /locus_tag="NT01EI_0035"
FT   CDS_pept        complement(31840..32460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0035"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67295"
FT                   /db_xref="GOA:C5B9B5"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:C5B9B5"
FT                   /protein_id="ACR67295.1"
FT                   /translation="MLLSILYIVGITAEAMTGALAAGRRQMDTFGVIIIASATAIGGGS
FT                   VRDMLLGHYPLSWVKHPENIMIVACAAVLTTWLAPLMSHLRRLFLLLDAVGLMVFSIIG
FT                   AQVALEMGHGPIIAVVAAVITGVFGGVLRDLFCNQIPLVFQKELYAGISFAAAWLYLGL
FT                   LYLQVPQDLTVIITLVAGFTARLLALRFHLSLPVFDYKQPERE"
FT   gene            32463..32636
FT                   /locus_tag="NT01EI_0036"
FT   CDS_pept        32463..32636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0036"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67296"
FT                   /db_xref="GOA:C5B9B6"
FT                   /db_xref="UniProtKB/TrEMBL:C5B9B6"
FT                   /protein_id="ACR67296.1"
FT                   /translation="MGMLVRKAREGIEKGQDSQPGQAVRLSFSKVCCFELLLIMYIFII
FT                   CGILFYFLIIMD"
FT   gene            33024..33146
FT                   /locus_tag="NT01EI_0038"
FT   CDS_pept        33024..33146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0038"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67298"
FT                   /db_xref="UniProtKB/TrEMBL:C5B9B7"
FT                   /protein_id="ACR67298.1"
FT                   /translation="MSLTFGLGIILSLITAKRFVRHVHKAFPAMQNRFNPSFCV"
FT   gene            complement(33124..33384)
FT                   /locus_tag="NT01EI_0037"
FT   CDS_pept        complement(33124..33384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0037"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67297"
FT                   /db_xref="UniProtKB/TrEMBL:C5B9B8"
FT                   /protein_id="ACR67297.1"
FT                   /translation="MSGIPAPENILAAISIQQTDFFNNQILFGTVFHEKGDAKRNPPTR
FT                   NTAKNWISPAPHVFVPDHRQRHRLAERRGTLRYRIIRRMMD"
FT   gene            33501..33755
FT                   /locus_tag="NT01EI_0039"
FT   CDS_pept        33501..33755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0039"
FT                   /product="transposase A"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67299"
FT                   /db_xref="GOA:C5B9B9"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="UniProtKB/TrEMBL:C5B9B9"
FT                   /protein_id="ACR67299.1"
FT                   /translation="MRKARFTKYRITAVLKSVAAGRTVKDVYRGAGIYEVCDDGWKIKY
FT                   GAMEACDIKTNKKLEDGNRRLKLMFSNLILESGTLQDVY"
FT   gene            complement(33952..34089)
FT                   /locus_tag="NT01EI_0040"
FT   CDS_pept        complement(33952..34089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67300"
FT                   /db_xref="UniProtKB/TrEMBL:C5B9C0"
FT                   /protein_id="ACR67300.1"
FT                   /translation="MAPDISAQPFLKLAWKNKDVFIIHKIYLYKSKKTGKDTWFFPCAP
FT                   "
FT   gene            34182..34766
FT                   /locus_tag="NT01EI_0041"
FT   CDS_pept        34182..34766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0041"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67301"
FT                   /db_xref="UniProtKB/TrEMBL:C5B9C1"
FT                   /protein_id="ACR67301.1"
FT                   /translation="MTKQKILIIESRSALDIYDERCEGNTLRQVLELQGVAAKCTEVIN
FT                   KGMLLKALKIAQREHIKYVHISAHGSSDGFTLTDGDSISWKDFDKIAWPILKGKCICFS
FT                   SCSVGRGAEQLFDFHKSFCNAIVGPIRDITWGEGLVAYSAFYHRAQSYEKSSFQDVRVM
FT                   NNIVGAGTFRFIASPYISSTYTIDGSLKQGC"
FT   gene            35203..35634
FT                   /locus_tag="NT01EI_0042"
FT   CDS_pept        35203..35634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0042"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67302"
FT                   /db_xref="InterPro:IPR029464"
FT                   /db_xref="UniProtKB/TrEMBL:C5B9C2"
FT                   /protein_id="ACR67302.1"
FT                   /translation="MAEINKATLTEADIISKYLLPAIKAAGWDDLTQIRQEVKLRDGKV
FT                   VVRGQMAARKKVKSADIVLYHKMGLPLAVIEAKANKHEIGKGMQQGLDYARLLDVPFVF
FT                   SSNGDGFVFHDKTNPATLESEIALEDFPSPGQLWDKLCT"
FT   gene            35773..37653
FT                   /locus_tag="NT01EI_0043"
FT   CDS_pept        35773..37653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0043"
FT                   /product="type III restriction enzyme, res subunit,
FT                   premature stop"
FT                   /EC_number="3.1.21.3"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67303"
FT                   /db_xref="GOA:C5B9C3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR013670"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5B9C3"
FT                   /protein_id="ACR67303.1"
FT                   /translation="MLVMATGTGKTYTAFQIIWRLWKAGAKKRILFLADRNILVDQAKI
FT                   NDFQPFGPAMTKVSGRTIDPAYEIHLALYQALTGPEESQKAFKQVSPDFFDLIVVDECH
FT                   RGSAAEDSAWREILEYFSSATQIGLTATPKETETVSSTDYFGDPVYTYSLKEGIEDGFL
FT                   APYKVVRVDIDVDLQGWRPTKGQRDKQGNLIEDRIYNQKDFDHTLVIDERTQLVAETIT
FT                   NYLRKTDPMAKTIVFCNDIDHADRMRRALVNLNPEQMAKDERYVMKITGDDDLGKAQLD
FT                   NFINPKKPYPVIATTSELMTTGVDAKTCKLVVLDQNIQSMTKFKQIIGRGTRIDDKYGK
FT                   LWFTILDFKKATELFADPRFDGEPERVMVVTPADINNPDDGLGDIIDGADPLPADESGD
FT                   HGDPFAPGVDEQPGSYTTVNGAGGQGTGPLGGPEPGVSRYYVNGVAVSVIAERVQYYDA
FT                   DGKLVTESFKDYTKKTLLKEFATLDAFTKRWQGAERKQAIMDELAQAGVLWEVLEQEVG
FT                   KELDPFDLICHVVYDQPPLTRRERANNVKKRNYFTKYNDTAQQVLTSLLDKYADQGVTE
FT                   IETKDALKVAPFTELGRPLELAKKGFGGPKQFEQAITELEQEIYREQQSA"
FT   gene            37774..39261
FT                   /locus_tag="NT01EI_0044"
FT   CDS_pept        37774..39261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0044"
FT                   /product="type I restriction-modification system, M
FT                   subunit"
FT                   /EC_number="2.1.1.72"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67304"
FT                   /db_xref="GOA:C5B9C4"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:C5B9C4"
FT                   /protein_id="ACR67304.1"
FT                   /translation="MSSISSVIKSIQDIMRKDAGIDGDAQRLGQLSWLLFLKVFDAQEE
FT                   ELEFEQDNYRCPIPERFLWRNWAADSEGLTGDALLDFVNNDLFDSLKNQPANIDLNPRG
FT                   YVVKEAFSDAFNYMKNGTLLKQVINKLNEIDFTDSSERHLFGDIYEQILRDLQSAGNAG
FT                   EFYTPRAVTRFMVNRIDPKLGERVMDPACGTGGFLACAFDHVKEHYVETAADHQTLQQQ
FT                   ILGVEKKQLPHLLCTTNMLLHGIEVPVQIRHGNTLDKPLSSWDSDIDVILTNPPFGGTE
FT                   EDGIEQNFPADLRTRETADLFLQLIIEALKKGGRAAVVLPDGTLFGEGVKTKIKQLLTS
FT                   ECNLHTIVRLPNGVFAPYTGIKTNILFFTKGQPTQDVWFYQHPYPAGVKSYSKTKPMKF
FT                   EEFEAEIAWWGDEADGFAARVENEQAWKVSIETIIERNFNLDIKNPHVGEQISHDPDEL
FT                   LARYATEQAEIQILRDQLKTILGDALGKGTAKQEGQA"
FT   gene            39261..41018
FT                   /locus_tag="NT01EI_0045"
FT   CDS_pept        39261..41018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0045"
FT                   /product="type I restriction-modification system, S
FT                   subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67305"
FT                   /db_xref="GOA:C5B9C5"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:C5B9C5"
FT                   /protein_id="ACR67305.1"
FT                   /translation="MAIENLITDHLDLWTAAVRPKSSAGRGASSKLELTGIKKLRELIL
FT                   ELAVRGKLVSQDPCDEPASVLLERIAAEKARLVKEGKLKKPKALPEISEEEQPFDLPEG
FT                   WAWGSIGYITEFVNGYAFKSSDFASEGVGIVKIGDIQDGEIVVDNMSRVSQHVVDGLNE
FT                   NLQVKSGDMLIAMSGATTGKLGFNKTDEIFYLNQRVGKFITYLVDKEFLYYPLATKIAE
FT                   NLAKAMGSAIPNISTKQINEITIALPPLAEQHRIVAKVDELMALCDQLEQCSESQLAAH
FT                   QTLVEALLATLTDSSDTEELAQNWARLNTHFDTLFTTEASIDALKQTILQLAVMGKLVQ
FT                   QDPSDEPASALLARIAAEKAQLIKEKKIKKEKPLPAISEDEKPFSLPKGWDFAYMQDLC
FT                   YLITDGTHQTPKYTDDGRPFISAQCVKPFRFMPEFCRYVSEEHYQLYIKNRRPEFGDIL
FT                   LSRVGAGIGEAAVIDSCLEFAIYVSTGLLKPNRGAVYSKYLELWLNSPIGRGFSERNTL
FT                   GKGVSQGNLNLSLIRSFIVSLPPKKEQKLIVAKVGEMITLCDQLKSCLQTSQQTQLALA
FT                   ESLVEGAIA"
FT   gene            41120..42328
FT                   /locus_tag="NT01EI_0046"
FT   CDS_pept        41120..42328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0046"
FT                   /product="transposase, Mutator family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67306"
FT                   /db_xref="GOA:C5B789"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:C5B789"
FT                   /protein_id="ACR67306.2"
FT                   /translation="MNEKQLQALANELAKNLKTPDDLSQFDRLLKKISVEAALNAEMSH
FT                   HLGYDKNQPKPGANSRNGYSTKTVTTGDGPLELRTPRDRDGSFEPQLVKKNQTRITGMD
FT                   NQILSLYAKGMTTREIAAAFKELYDADVSPALVSKVTDAVMEQVTEWQNRPLDAVYPIV
FT                   YLDCIVLKVRQDSRVINKSVFLALGINLEGQKELLGMWLAENEGAKFWLNVLTELKNRG
FT                   LNDILIACVDGLKGFPDAINTVYPEARIQLCIVHMVRNSLRFVSWKDYKAVTRDLKAIY
FT                   QAPTEDAGQHALEAFASAWDNRYPQISRSWQTNWANLATFFAYPADIRKVIYTTNAIES
FT                   LNSVIRHAIKKRKVFPTDEAVKKVVWLAIQAASQKWTMPLRDWRMAMSRFIIEFGDRLD
FT                   GHF"
FT   gene            42432..43418
FT                   /locus_tag="NT01EI_0047"
FT   CDS_pept        42432..43418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0047"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67307"
FT                   /db_xref="GOA:C5B9C7"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:C5B9C7"
FT                   /protein_id="ACR67307.1"
FT                   /translation="MTLFHIANQQLTPLTQTTFAAEGLQERQDLQEALKRNIAVIAPDC
FT                   LVIADEFSDWEDSRRRIDLLAIDRNANLVVIELKRNEVGAHMELQALRYAAMITNMTFD
FT                   KACEYFAAYIEQEGLQIDARNTLLEFVDLDENQLDDFGNEVRIVLASADFGKELTTSVL
FT                   WLRDKGIDIRCVRLTPFRYQGEVLINAAQIIPLEEAESYQIQFREKRAEQRASQQGTRD
FT                   YSKYRFNGGVYNKRHFALAVLSHWIKDRQLADLAEITAYLAQFDLPRKVTPVDQIPEKN
FT                   LNRWHLGEGNLIELPSGEQIAISNQWGTDTERLLQGMTQLGYQIEKI"
FT   gene            complement(44070..44933)
FT                   /locus_tag="NT01EI_0048"
FT   CDS_pept        complement(44070..44933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0048"
FT                   /product="conserved hypothetical protein TIGR00255"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67308"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniProtKB/TrEMBL:C5B9C8"
FT                   /protein_id="ACR67308.1"
FT                   /translation="MIRSMTAYARREVKGNWGSAAWELRSVNQRYLETYIRLPEQFRSL
FT                   EPVIRERLRTRLTRGKVECNLRFELDPSAQSALILNESLAKQLVDAANWVKLQSDEGEI
FT                   NPLDVLRWPGVMAAAEQDLDAISSELLGALDSTIDDFIDAREREGSALKQLIEQRLEAV
FT                   STEVAKVRSRMPEILQWQRERLLSKLEEAQVQLENNRLEQELVLMAQRIDVAEELDRLD
FT                   AHVKETYVILKKKEAVGRRLDFMMQEFNRESNTLASKSINADITASAIELKVLIEQMRE
FT                   QIQNIE"
FT   gene            45066..45782
FT                   /locus_tag="NT01EI_0049"
FT   CDS_pept        45066..45782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0049"
FT                   /product="ribonuclease PH, putative"
FT                   /EC_number="2.7.7.56"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67309"
FT                   /db_xref="GOA:C5B9C9"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5B9C9"
FT                   /protein_id="ACR67309.1"
FT                   /translation="MRPEGRAAGQIRPLRLTRHYTKHAEGSVLVEFGDTKVLCTASVDE
FT                   GVPRFLKGQGQGWVTAEYGMLPRSTHSRMAREAAKGKQGGRTMEIQRLIARSLRAAVDL
FT                   KKLGEFTITLDCDVIQADGGTRTASITGACVALADALGALVAAGKLKESPLKGMVAAVS
FT                   VGIVAGGAVCDLEYVEDSAAETDMNVVMMEDGRMIEVQGTAEGEPFSHEELLTLLALAR
FT                   DGIGQIIQAQKTALEQ"
FT   gene            45866..46507
FT                   /locus_tag="NT01EI_0050"
FT   CDS_pept        45866..46507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0050"
FT                   /product="orotate phosphoribosyltransferase, putative"
FT                   /EC_number="2.4.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67310"
FT                   /db_xref="GOA:C5B9D0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5B9D0"
FT                   /protein_id="ACR67310.1"
FT                   /translation="MKAYQRRFIEFALGKQVLKFGEFTLKSGRTSPYFFNAGLFNTGRD
FT                   LALLGRFYAEALVESGIAFDVLFGPAYKGIPIATTTAVALAEHHDRDMPYCFNRKEAKD
FT                   HGEGGTLVGSALAGRVMLVDDVITAGTAIRESMSIIQANGAALAGVLISLDRQERGRGE
FT                   LSAIQEVERDYGCRVISIITLGDLIHYLEEQPEMAQHLAAVKAYRARYGV"
FT   gene            complement(46546..47142)
FT                   /locus_tag="NT01EI_0051"
FT   CDS_pept        complement(46546..47142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0051"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67311"
FT                   /db_xref="GOA:C5B9D1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023769"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5B9D1"
FT                   /protein_id="ACR67311.1"
FT                   /translation="MAEKENTKRNRREEILQALAQMLESSDGSQRITTAKLAANVGVSE
FT                   AALYRHFPSKTRMFDSLIEFIEDTLTSRINLILQDEKDTFHRLRLILLLILGFAERNPG
FT                   LTRIMTGHALMFEQDRLQGRINQLFERIEAQLRQVLKERRLREGSGFDHDETLLASQLL
FT                   AFCEGMLSRFVRSEFRYRPTQEFETRWPLLACQLQ"
FT   gene            complement(47248..47706)
FT                   /locus_tag="NT01EI_0052"
FT   CDS_pept        complement(47248..47706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0052"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /EC_number="3.6.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67312"
FT                   /db_xref="GOA:C5B9D2"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:C5B9D2"
FT                   /protein_id="ACR67312.1"
FT                   /translation="MKKKIDVKILDARIGQQFPLPTYATPGSAGLDLRACLDSAVVLAP
FT                   GETTLLPTGLAIHIADPSLAAVILPRSGLGHKHGIVLGNLVGLIDSDYQGQLMISAWNR
FT                   GQTPFTIEPGERIAQLVLVPVVQADFNLVESFEDSARGDGGFGHSGRH"
FT   gene            complement(47684..48901)
FT                   /locus_tag="NT01EI_0053"
FT   CDS_pept        complement(47684..48901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0053"
FT                   /product="bifunctional phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate-cysteine ligase,
FT                   putative"
FT                   /EC_number="4.1.1.36"
FT                   /EC_number="6.3.2.5"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67313"
FT                   /db_xref="GOA:C5B9D3"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:C5B9D3"
FT                   /protein_id="ACR67313.1"
FT                   /translation="MTVLRGKRILLGISGGIAAYKCPEIVRRLRERGAEVRVVMTKGAQ
FT                   AFITPLTLQAVSGHPVADDLFDPAAEASMGHIELGKWADLVLLAPATADLMARLAAGMA
FT                   DDLLATLCLASGAPIAIAPAMNQQMFRAAATQDNLATLTRRGALIWGPDSGEQACGDVG
FT                   PGRMLDPLTLVSLTEQHFSQSQDLAAYRMIITAGPTREALDPVRFISNHSSGKMGFAIA
FT                   EAAARRGAQVTLISGPVALPTPPGVARVDVQSALEMQAAVAQRARDCDIFIACAAVADY
FT                   RAQQIAPEKMKKQRSDTLTLTLVKNPDIVAGVAAMTEARPFVVGFAAETQNVEEYARQK
FT                   LARKGLDLICANDVSQDGQGFNSDTNALHLFWPQGDTRLPLSSKSRLGCTLINEIVRHY
FT                   EEKNRR"
FT   gene            48928..49047
FT                   /locus_tag="NT01EI_0054"
FT   CDS_pept        48928..49047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0054"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67314"
FT                   /db_xref="UniProtKB/TrEMBL:C5B9D4"
FT                   /protein_id="ACR67314.1"
FT                   /translation="MTRFYHNPFPIADFATTTESLRKAAQFLFPWFDAVYLYS"
FT   gene            49089..49775
FT                   /locus_tag="NT01EI_0055"
FT   CDS_pept        49089..49775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0055"
FT                   /product="DNA repair protein RadC, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67315"
FT                   /db_xref="GOA:C5B9D5"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR022820"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:C5B9D5"
FT                   /protein_id="ACR67315.1"
FT                   /translation="MAQGKVEGGWPQGAPPREKLLALGAAALSDRELLALFLRTGLPGV
FT                   HVIQLAERLLLRFGSLQGVLRADVDTFCASQGLGIAKFAQLQAVIELSRRVLRHRIGEE
FT                   SAITSPDLTALYLQNLFVSLEREIFVVLFLDNQHRVIRSEQMFSGTINCVDVYPREIVR
FT                   EALKLNAVALILAHNHPSGNPEPSVADRLLTDRVAKACALVDIQVLDHMVIGHGQRVSF
FT                   AERGWI"
FT   gene            50014..50250
FT                   /locus_tag="NT01EI_0056"
FT   CDS_pept        50014..50250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0056"
FT                   /product="50S ribosomal protein L28, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67316"
FT                   /db_xref="GOA:C5B9D6"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5B9D6"
FT                   /protein_id="ACR67316.1"
FT                   /translation="MSRVCQVTGKRPVTGNNRSHALNATKRRFLPNLHSHRFWVEGEKR
FT                   FVTLRVSAKGMRVIDKKGIEAVLADLRARGEKY"
FT   gene            50262..50429
FT                   /locus_tag="NT01EI_0057"
FT   CDS_pept        50262..50429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0057"
FT                   /product="50S ribosomal protein L33, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67317"
FT                   /db_xref="GOA:C5B9D7"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5B9D7"
FT                   /protein_id="ACR67317.1"
FT                   /translation="MAKGIREKIKLVSSAGTGHYYTTTKNKRTKPEKLELKKFDPVVRQ
FT                   HVIYKEAKIK"
FT   gene            50523..51332
FT                   /locus_tag="NT01EI_0059"
FT   CDS_pept        50523..51332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0059"
FT                   /product="formamidopyrimidine-DNA glycosylase, putative"
FT                   /EC_number="3.2.2.23"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67319"
FT                   /db_xref="GOA:C5B9D8"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5B9D8"
FT                   /protein_id="ACR67319.1"
FT                   /translation="MPELPEVETSRRGIAPFLQGKTLSHLTVRQPRLRWPVSETLLTLR
FT                   DRPILSVQRRAKYLLLELPEGWIVIHLGMSGSVRILPALTPPQKHDHIDLLLTDGMMLR
FT                   YTDPRRFGAWLWYDSLATASVLAHLGPEPLSEAFSAEYLLEKARGRRTAVKPWLMDNTL
FT                   VVGVGNIYASESLFSAQIHPDRLAGSLSADEAHLLVQTIKAVLQRSIDQGGTTLRDFLQ
FT                   ADGKPGYFAQQLQVYGRAGEACLTCGTTIKRSKHGQRTTFYCPHCQR"
FT   gene            complement(51329..51814)
FT                   /locus_tag="NT01EI_0058"
FT   CDS_pept        complement(51329..51814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0058"
FT                   /product="pantetheine-phosphate adenylyltransferase,
FT                   putative"
FT                   /EC_number="2.7.7.3"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67318"
FT                   /db_xref="GOA:C5B9D9"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5B9D9"
FT                   /protein_id="ACR67318.1"
FT                   /translation="MSRTAIYPGTFDPLTNGHLDIVTRAAHMFDSVILAIAASPGKQPL
FT                   FTLEERVAMAREVTAHLTNVEVHGFSELMAHFAQRQGANILVRGLRAVSDFEYELQLAN
FT                   MNRHLMPTLESVFLMPAEAWSFISSSLVKEVARHGGDVDAFLPEQVARALMTRLRDA"
FT   gene            complement(51811..52587)
FT                   /locus_tag="NT01EI_0060"
FT   CDS_pept        complement(51811..52587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0060"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67320"
FT                   /db_xref="GOA:C5B9E0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C5B9E0"
FT                   /protein_id="ACR67320.1"
FT                   /translation="MPARLSVVLICKNAAELLPECLASVAWADEIIVLDSGSSDETQRI
FT                   AQAAGAKVYENHDWQGFGIQRQRAQQYASGDYILMIDSDERVTPALKEAIVQVLTQPVA
FT                   DRVYSIARRNLFLGRFMRHSGWYPDRVIRLYPRQRYGYNASQVHESLACSGASVTPLQG
FT                   DLLHLTCRDFAGFQQKQLCYATAWAHERHASGKKTSILGIFSHTVGALLKTLLLRGGVL
FT                   DGKQGWLLAIVNAQYTFNKYAELWALQHGYTEKTPL"
FT   gene            complement(52590..53864)
FT                   /locus_tag="NT01EI_0061"
FT   CDS_pept        complement(52590..53864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0061"
FT                   /product="3-deoxy-D-manno-octulosonic-acid transferase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67321"
FT                   /db_xref="GOA:C5BB86"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:C5BB86"
FT                   /protein_id="ACR67321.1"
FT                   /translation="MESLYTVLLYIIQPLIWLRLLLRSRRAPAYRKRWGERYGFCRNKV
FT                   APGGILLHSVSVGETLAAVPLVRALRHRYPTLPITVTTMTPTGSERVMSAFGNDVHHVY
FT                   LPYDLPGAMRRFLNTVRPKLVIVMETELWPNMISALHQRKIPLVIANARLSARSAKGYG
FT                   KLGGFMRRLLRKVTLIAAQNQEDGERFIALGLKRSQLAITGSIKFDISVTPELAARAIT
FT                   LRRQWAPRRKVWIAASTHQGEEAIILQTHRRLLAQFPDLLLILVPRHPERFKETELLAQ
FT                   KEGFTYLMRSSGEIPTPHTQVVIGDSMGELMLLYGIADLAFVGGSLIERGGHNPLEPAA
FT                   HAIPVLMGPHTFNFKDICAKLHQADGLISVADGEALANEVSTLLTDEDYRLWYGRHAVE
FT                   VLHQNQGALQRLLQLLLPYLPLRSH"
FT   gene            complement(54038..55132)
FT                   /locus_tag="NT01EI_0062"
FT   CDS_pept        complement(54038..55132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0062"
FT                   /product="lipopolysaccharide glycosyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67322"
FT                   /db_xref="GOA:C5BB87"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:C5BB87"
FT                   /protein_id="ACR67322.2"
FT                   /translation="MRILMIIDGLPGGGAEKVVLTLAQYFLAQGDSVSLFSLRDVCHYP
FT                   LPDGLDYRVIRDTCRAPWRKLSELSRRARQLDETIALAEQKERYDLVLSNLHKTDRIVA
FT                   RSNILRDHNLWFCLHGVFSASYLGHRHGFSRWLKREKIRRIYQGRQIVAVSHAVGEDLC
FT                   QQFKVTPAQLQAIPNPFDLAAIRRAADAPCPLEGQDYLIHVGRFHPAKRHDRLLEAYAQ
FT                   SGLSAPLVLLGQGSPEQEHMLRALAKTLNVAERVHFAGFQANPYPWIHHARLLVVSSDS
FT                   EGFGNVLVEALTLGTAVVSTRCPGGPAEIMMGDLARGLCHPDAASLAQALQDIYRNPPA
FT                   IDDTLLQQYDVAAVCTRYRQLGKT"
FT   gene            complement(55136..56263)
FT                   /locus_tag="NT01EI_0064"
FT   CDS_pept        complement(55136..56263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0064"
FT                   /product="glucuronic acid transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67324"
FT                   /db_xref="GOA:C5BB89"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:C5BB89"
FT                   /protein_id="ACR67324.1"
FT                   /translation="MTQFRLALVRQKYRPDGGAERFVSRALEALDSHDIELNVITRQWQ
FT                   GPVKPAWHIHQCNPWKWGRISREHGFARAARTLWQQQRFDLVQSHERIPGCDLYRAGDG
FT                   VHRRWLTQRARILPGWKIHMLWHDRYHRYVMNAEQAMYQAPELRAVICNADMIKQEIIA
FT                   DFGVPESKIHVIYNAIDHHRFLPPDEAQRAALRRRWQIPQSASCLIYVGSGFERKGLRA
FT                   AIEAIAPTGHYLLVVGKDKEEARYRALANTLGCAQRVRFLGMQPETLPFYQMADGLLLP
FT                   TLYDPFPNVILEAMACGLPVITSTGCGGAEFIRSGDNGYVCDALDIAALREAVMALPTQ
FT                   ALGSHAGRLARERVMECTAERLSAQLIGLYRQLVK"
FT   gene            complement(56260..57336)
FT                   /locus_tag="NT01EI_0065"
FT   CDS_pept        complement(56260..57336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0065"
FT                   /product="lipopolysaccharide heptosyltransferase III,
FT                   putative"
FT                   /EC_number="2.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67325"
FT                   /db_xref="GOA:C5BB90"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011916"
FT                   /db_xref="UniProtKB/TrEMBL:C5BB90"
FT                   /protein_id="ACR67325.1"
FT                   /translation="MVSNPTLPAAFSPQRILVIKLRHHGDMLLVTPVISTLKRHYPSAQ
FT                   IDVLLYAETRDMLSANQDIHQLYCIDRQWKKQGARHQLSQEWRLLRTLQAQRYDLVVNL
FT                   ADQWRSAIVTALSSAPVRIGFDFTKRRHPLWRASHTHLASTAKHGKQHTVEQNLSILAP
FT                   LGLDDDDSRVTMGYSEQDWQSASALIPTAWQAGYIVIQPTSRWFFKCWQETRMSEVINA
FT                   LSQAGYPILLTSGPDVRERAMIDAIMQGCPTAQVASLAGQLTLRQLAAIIDHARLFIGV
FT                   DSVPMHMAAALQTPLVALFGPSKLVFWRPWQARGDVIWAGDFGDLPDPDTIDTQTAERY
FT                   LDLIPSSAVIAAATRLLE"
FT   gene            57470..58441
FT                   /locus_tag="NT01EI_0066"
FT   CDS_pept        57470..58441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0066"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67326"
FT                   /db_xref="GOA:C5BB91"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:C5BB91"
FT                   /protein_id="ACR67326.1"
FT                   /translation="MSHPGFIITIDTEGDNLWQNHDRITTENARYLPRFQLLCEKYGFK
FT                   PVYLTNYEMASDPVYVEFARDVIARGCGEVGMHLHAWNSPPEIPLTDNDWANKPYLIEY
FT                   PAEVIRQKVDYMTHLLEDTFQTKMVSHRAGRWAMNAFYLQLLLEHGYQIDCSVTPRVDW
FT                   RGARGAPQGNGGSDYSGYPDHAYFVDAADLRREGSTALLEVPMSTRLKHDPLFNHLRGA
FT                   YDRLRGKRRPPSVQWLRPRGGNLQEMQRVAEYHLSLGRDYVEFMLHSSEFMPGGSPTFR
FT                   SGQDIERLYHDLEALFDWLAPQVKGQTLAEYYQIKRGQRPAR"
FT   gene            complement(58527..58916)
FT                   /locus_tag="NT01EI_0067"
FT   CDS_pept        complement(58527..58916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0067"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67327"
FT                   /db_xref="UniProtKB/TrEMBL:C5BB92"
FT                   /protein_id="ACR67327.1"
FT                   /translation="MLTTLAAGTYGIPTITSNINGLPETVRHQQIGFCLTPTLSVEQYA
FT                   NISAASIDFSPQVYDPVQDRLTPPLILSPEQLADSIESLYRNPETYRRLSDGAREYAAV
FT                   SRCFNDLAQTLCQRLLTRADPRPHG"
FT   gene            complement(59394..60548)
FT                   /locus_tag="NT01EI_0068"
FT   CDS_pept        complement(59394..60548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0068"
FT                   /product="glycosyl transferase, group 1 family protein"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67328"
FT                   /db_xref="GOA:C5BB93"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:C5BB93"
FT                   /protein_id="ACR67328.1"
FT                   /translation="MTEKSIVHLVNLRDFGGVERLILDYVINGKEHNWVIINTANSLSE
FT                   KLNDHANSIIFCNRVIQSSPIQIPSFIRKKALWNKIKKINPSHVVIWNQIIPLEYKPES
FT                   IKAIYYDHGAVWEIDKNKKTIAFFQKIDGCICVSQASKKMLENKFKHHCDISVILNRTN
FT                   IKSRDSIADDKKKTFTIGCAARLSPLKALGLIPLIAEETALQGFNFNFIIAGTGEEESA
FT                   LASLIEKKNLNKSVKTIGFLNNLNDFYKHLDIYISTSAHETCSLSCIEAMSFGIPIISA
FT                   NIDGQPEIISNDHTGFCITPTMSMEDYCKKTGMSLPFKKNIYYPENDQIAPPRLLNPKD
FT                   AANKIIEIYLHGVDDYKKNSIHRAKELFDDKNFEESLIKTIRSF"
FT   gene            complement(60550..61683)
FT                   /locus_tag="NT01EI_0069"
FT   CDS_pept        complement(60550..61683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0069"
FT                   /product="O-antigen ligase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67329"
FT                   /db_xref="GOA:C5BB94"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:C5BB94"
FT                   /protein_id="ACR67329.1"
FT                   /translation="MKTNFINKLPIYISALFCVFVSLLSISDDNNLVSNIYYVSFALFI
FT                   VWCVCERKNIFNKTSLLLGVFLLFSAISTYWSDHSKDTSRYIQHAIYIFIFSSMIYELR
FT                   STLFFKNILFKSYVATCSIFVVVNGFIFYSKYSLYDRFYPILGPSNTIDYAGILCLAII
FT                   FCCYLYQHEKNKSPYIIAGIVLLAGVILSQSRTPIIALAISLMAIFIKRKRSAIISLVS
FT                   ILAIILLVHTVYPSIFTRDAVDGAPTPRIFTWLYTIQQVSEHHPWLGFGYSDTFAHYFK
FT                   PRNFTYNNAHSVFMSMLYYSGIIGVILFFSYILNIFSVAIKIFNKNRYPIAFILISLIF
FT                   SSTQGYIYIYHPREIWLVLWLPLFLAIPMSKRSSEQL"
FT   gene            complement(61673..62638)
FT                   /locus_tag="NT01EI_0070"
FT   CDS_pept        complement(61673..62638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0070"
FT                   /product="lipopolysaccharide heptosyltransferase I,
FT                   putative"
FT                   /EC_number="2.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67330"
FT                   /db_xref="GOA:C5BB95"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011908"
FT                   /db_xref="UniProtKB/TrEMBL:C5BB95"
FT                   /protein_id="ACR67330.1"
FT                   /translation="MRILMVKTSSMGDVIHTLPALTDAQQAIPGLCVDWVVEEGFAQIP
FT                   SWHSAVDRVIPIAIRRWRKNLLSAQTRQEWRSFKQRLHQERYDAVIDAQGLLKSALLVA
FT                   RNAHGIRHGFDRRSAREPLASLFYDRRHRIARDQHAVERTRQLVAQSLGYPLPVQRGDY
FT                   AIARHFTQQLPMDAGQYMVFLHATTRDEKHWPEAHWRELIAWVGSHTTQRIKLPWGAEH
FT                   EHQRALRLAEGFPHVEVLPKMALSDVATVLAGASQVISVDTGLSHLAAALDRPNITLYG
FT                   PTDPGLIGGYGKNQLEIIEPTHSLDALPSLAVVEYLKNEN"
FT   gene            complement(62626..63687)
FT                   /locus_tag="NT01EI_0071"
FT   CDS_pept        complement(62626..63687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0071"
FT                   /product="lipopolysaccharide heptosyltransferase II,
FT                   putative"
FT                   /EC_number="2.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67331"
FT                   /db_xref="GOA:C5BB96"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011910"
FT                   /db_xref="UniProtKB/TrEMBL:C5BB96"
FT                   /protein_id="ACR67331.1"
FT                   /translation="MKILVIGPSWVGDMMMSQSLYRTLKATYPEAEIDVMAPNWCRPLL
FT                   ERMPEVHQAIPMPLGHGTLGLGERYRLGRQLREREYDRAYVLPNSFKSALIPFFARIPV
FT                   RTGWKGEMRYGLLNDLRQLDKSAFPLMVERYAALAYPATQIRRAADLPQPLLWPALQVR
FT                   DEEIAETAAAFNLTDHRPVIGFCPGAEFGPAKRWPHYHYATLAQRLIGQGYQIALFGSA
FT                   KDVDAGEEIRRTLDEESREYCLNLAGHTSLDQAVALIAACQAIVSNDSGLMHIAAALDK
FT                   PLVALYGPSSPDFTPPLSRHARVIRLITGYHKVRRGEGETGYHQSLIDITPDRVEQTLQ
FT                   ALLHNEKESRCVS"
FT   gene            complement(63711..64640)
FT                   /locus_tag="NT01EI_0072"
FT   CDS_pept        complement(63711..64640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0072"
FT                   /product="ADP-glyceromanno-heptose 6-epimerase, putative"
FT                   /EC_number="5.1.3.20"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67332"
FT                   /db_xref="GOA:C5BB97"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR011912"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BB97"
FT                   /protein_id="ACR67332.1"
FT                   /translation="MIIVTGGAGMIGSNIVKALNDKGYTDILVVDNLKDGTKFVNLVDL
FT                   DITDYMDKEDFIAGIVAGDDFGDIDAVFHEGACSSTTEWDGKYVMDNNYQYSKELLHFC
FT                   LERQIPFLYASSAATYGMTDKFVEDRHYEGPLNVYGYSKFLFDQYVRRILPHAKSQICG
FT                   FRYFNVYGPREGHKGGMASVAFHLNTQINNGEQPKLFEGSENFRRDFIYVGDVADVNLW
FT                   FWENGVSGIFNCGTGNAESFQAVADAVVAYHQKGSVTYIPFPDKLKGRYQAFTQADTTQ
FT                   LRAAGYSRPFKTVAQGVREYMEWLNRKP"
FT   gene            64931..66127
FT                   /locus_tag="NT01EI_0073"
FT   CDS_pept        64931..66127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0073"
FT                   /product="2-amino-3-ketobutyrate coenzyme A ligase,
FT                   putative"
FT                   /EC_number="2.3.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67333"
FT                   /db_xref="GOA:C5BB98"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR011282"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C5BB98"
FT                   /protein_id="ACR67333.1"
FT                   /translation="MSADFYQQLAQQLVATRAEGLYKTERIITSAQQAEIAVADGSRVL
FT                   NFCANNYLGLADHPALIAAAKEGMESHGFGMASVRFICGTQDSHKALEQQLAAFLGMED
FT                   AILYSSCFDANGGLFETLLGPEDAIISDALNHASIIDGVRLCKARRYRYANNDMAELKA
FT                   RLELARAEGARHIMIATDGVFSMDGVIADLRSICDLADEYDALVMVDDSHAVGFVGGHG
FT                   RGTPEYCGVVGRVDIMTGTLGKALGGASGGYTAARKEVVEWLRQRSRPYLFSNSLAPAI
FT                   VAASSRVLTLLAQGDDLRARLWDNARLFREKMTAAGFTLAGADHAIIPVMLGEAKLAQH
FT                   FADLLLQEGIYVTGFFYPVVPQGQARIRTQMSAAHTPAQIEQAVAAFIRVGKQLGVIA"
FT   gene            66137..67162
FT                   /locus_tag="NT01EI_0074"
FT   CDS_pept        66137..67162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0074"
FT                   /product="L-threonine 3-dehydrogenase, putative"
FT                   /EC_number="1.1.1.103"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67334"
FT                   /db_xref="GOA:C5BB99"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR004627"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BB99"
FT                   /protein_id="ACR67334.1"
FT                   /translation="MKALSKLKAEEGIWMTDVPLPALGHNDIMIKIRKAAICGTDVHIY
FT                   NWDTWSQKTIPVPMVVGHEYVGEVVAVGQEVRGFRIGDRVSGEGHITCGHCRNCRAGRT
FT                   HLCRNTIGVGVNRQGAFAEYLVIPAFNAFKIPDNIPDALAAIFDPFGNAVHTALSFDLV
FT                   GEDVLVSGAGPIGIMAAAVCRHVGARHVVITDVNDYRLDLARKMGVTRAVNVSRESLPE
FT                   VMQALGMSEGFDVGLEMSGAPPAFHTMLDTMNHGGKIAMLGIPPGDMAIDWNQVIFKGL
FT                   LIKGIYGREMFETWYKMAALIQSGLDLTPIITHQYAIDDFQKGFDVMRSGHSGKVILNW
FT                   S"
FT   gene            complement(67220..68740)
FT                   /locus_tag="NT01EI_0075"
FT   CDS_pept        complement(67220..68740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0075"
FT                   /product="Mg chelatase-like protein"
FT                   /note="Mg chelatase homolog"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67335"
FT                   /db_xref="GOA:C5BBA0"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5BBA0"
FT                   /protein_id="ACR67335.1"
FT                   /translation="MTLATVYTRAALGIQAPEVRIEAHIGNGLPGFTLVGLPETAVREA
FT                   KDRVRCAMLNSGFQFPPKRITLNLAPADLPKEGGRYDLPMALALLLASGQLAPHVSVCN
FT                   YEFIGELALSGDLRPVQGALPAALSAAHAKRTLIAPSDNAAELGLLAAPRPPIAPSLLA
FT                   VCAFLSGQASLEAAPAGEMTSGGTDTGDMADIIGQAQARRALEIAAAGGHNLLLIGPPG
FT                   TGKTMLACRLPGLLPPMTPDEALEQAAISSLAYPGTMPPRYGVRPFRAPHHSASMAALI
FT                   GGGPLPKPGEISLAHHGVLFLDELAEFDRRTLDALREPLESGVVHLSRARIKVSFPARV
FT                   QLVAAMNPSSGGHADGRDRRAAAAQVLRYLSRLSGPLLDRFDLSIDVPPLSPGLLARQR
FT                   ADGEDSATLRRRVCAARVRQYARGGRLNAHLEGAARDRDCRLAPDDALYLEQALTRLAL
FT                   SVRAWHRLLKVARTLADLEGCDNIARRHLAEALSYRAMDRLLLTLQRG"
FT   gene            69028..70263
FT                   /locus_tag="NT01EI_0076"
FT   CDS_pept        69028..70263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0076"
FT                   /product="transporter, major facilitator family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67336"
FT                   /db_xref="GOA:C5BBA1"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5BBA1"
FT                   /protein_id="ACR67336.1"
FT                   /translation="MLGWSARQRNVAIASFLSWTLDSFDFFILVFLLSDIARTFHVGVE
FT                   QVTLAILLTLAVRPIGALIFGRAAEKYGRRPILMLNIICFSLFELLSAAAPSLMIFLLL
FT                   RALYGVAMGGIWGVASSLTMETIPDRSRGLMSGIFQAGYPFGYLLAAVIYGLCAQALGW
FT                   RGMFIIGAVPIVLLPFIYFCVPESPVWLAARAQNQSVALLPVLRRHWKLCVYLVALMAA
FT                   FNFFSHGTQDLYPTFLGMQHGFSANIISIIAVAYNIASIIGGVFFGTLSERIGRKRAIM
FT                   LAALLALPVIPLWAFSSGSLMLGVGAFLMQFMVQGAWGVIPTYLNELVPANARAVLPGF
FT                   VYQLGNLIASVNATMQASIAADHGQNYALVMAITAACVALTIVVLIAFGRDTRGVPMAE
FT                   KICHQDQSIKIS"
FT   gene            70627..72276
FT                   /locus_tag="NT01EI_0077"
FT   CDS_pept        70627..72276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0077"
FT                   /product="acetolactate synthase isozyme II, large subunit,
FT                   putative"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67337"
FT                   /db_xref="GOA:C5BBA2"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:C5BBA2"
FT                   /protein_id="ACR67337.1"
FT                   /translation="MNGAQWVVQALRAQGVNQVFGYPGGAIMPLYDALYDGGVAHLLCR
FT                   HEQGAVMAAIGYARASGRVGVCIATSGPGATNLITGLADAMMDSVPLVAITGQVASALI
FT                   GTDAFQEMDVLGLSLACTKHSFMVTSLAELPEVMDRAFAIAVQGRPGPVLIDIPKDIQL
FT                   AQGDLATPLCSVAQVQPSCPPAALAQARAMLTQAQRPVLYVGGGVGMAGAVPSLRSLVS
FT                   RSGMPVAATLKGLGAADDRHPAYLGMLGMHGCKAANLAVQQCDLLIAVGARFDDRVTGR
FT                   LDAFAPQAQVIHLDIDPAELGKVRQAHVSLCGDLNLLLSALTMRLEIAPWLQQVAALKA
FT                   QHAWRYDHPGEAIYAPLFLRQLSGCKPPQAVVTTDVGQHQMWSAQHMRFSLPQDFITSS
FT                   GLGTMGFGIPAAVGAQVARPDDCVICVSGDGSFMMNVQELGTIKRARLPLKIVLLDNQR
FT                   LGMVRQWQQLFFDARYSETDLSDNPDFLTLAQAFGIPGQRISRKAQVAEALEALFSTPG
FT                   PYLLQVAIDEFENVWPLVPPGAGNESMLENVS"
FT   gene            72273..72563
FT                   /locus_tag="NT01EI_0078"
FT   CDS_pept        72273..72563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0078"
FT                   /product="acetolactate synthase isozyme II, small subunit,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67338"
FT                   /db_xref="UniProtKB/TrEMBL:C5BBA3"
FT                   /protein_id="ACR67338.1"
FT                   /translation="MMQSPSFQHHLAIQARRRPEILERVLRVVRHRGFEIHAMNMAQDG
FT                   DCDSVNIELTVASTRPVTLLSSQLIKLLDVARVDVSAPRSLRMLPRRQVLG"
FT   gene            72617..73546
FT                   /locus_tag="NT01EI_0079"
FT   CDS_pept        72617..73546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0079"
FT                   /product="branched-chain amino acid aminotransferase,
FT                   putative"
FT                   /EC_number="2.6.1.42"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67339"
FT                   /db_xref="GOA:C5BBA4"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:C5BBA4"
FT                   /protein_id="ACR67339.1"
FT                   /translation="MTTKKADYIWFNGDMVPWGEARVHVMSHALHYGTSVFEGVRCYET
FT                   HRGPAVFRHREHMQRLHDSARIYRMPLAYSVEELMAACRETLRRNQLSSAYIRPLVFIG
FT                   DVGMGVNPPAGYGTDVILAAFPWGAYLGEEALEQGIDAMVSSWHRAAPNTIPTAAKAGG
FT                   NYLSSLLVGSEARRHGYQEGIALDVHGYVSEGAGENLFMVKNGVIFTPPFTSAALPGIT
FT                   RDAIITLAQAQGLEVREQVLSREALYLADEIFMSGTAAEITPVRSVDGIQVGIGRCGPI
FT                   TKRVQQAFFGLFNGQTEDRFGWLDPVNP"
FT   gene            73648..75498
FT                   /locus_tag="NT01EI_0080"
FT   CDS_pept        73648..75498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0080"
FT                   /product="dihydroxy-acid dehydratase, putative"
FT                   /EC_number="4.2.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67340"
FT                   /db_xref="GOA:C5BBA5"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BBA5"
FT                   /protein_id="ACR67340.1"
FT                   /translation="MPKYRSATTTHGRNMAGARALWRATGMTDADFGKPIIAVVNSFTQ
FT                   FVPGHVHLRDLGRLVAAQIEATGGVAKEFNTIAVDDGIAMGHGGMLYSLPSRELIADSV
FT                   EYMVNAHCADAMVCISNCDKITPGMMMAALRLNIPVIFVSGGPMEAGKTKLSDRLIKLD
FT                   LVDAMIQGANPQVSDAQSEQIERAACPTCGSCSGMFTANSMNCLTEALGLALPGNGSLL
FT                   ATHADRRALFEEAGQRIVALTRRYYEQDDVSVLPRSIACKAAFENAMTLDIAMGGSTNT
FT                   VLHLLAAAQEGEIDFTLADIDRLSRQVPHLCKVAPSTPDYHMEDVHRAGGVMGILGELD
FT                   RAGLLNRGVANVLGLGLSETLARYDIMRSDDDALQRLYRAGPAGLRTVEPFAQSCRWDA
FT                   LDRDRQQGCIRAREHAYSQDGGLAVLSGNLAQDGCIVKTAGVDPDSLVFRGPARVFESQ
FT                   EEAVEAILGGRIHPGDVLVIRYEGPKGGPGMQEMLYPTAYLKSMGLGKQCALITDGRFS
FT                   GGTSGLSIGHVSPEAASGGAIALVRDGDPIEIDIPVRHIRLAIAESELALRRQQELARG
FT                   TQAWTPRDRRRKVSLALRAYASLATSADRGAVRDRAKLGG"
FT   gene            75501..77045
FT                   /locus_tag="NT01EI_0081"
FT   CDS_pept        75501..77045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0081"
FT                   /product="threonine ammonia-lyase, biosynthetic, putative"
FT                   /EC_number="4.3.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67341"
FT                   /db_xref="GOA:C5BBA6"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005787"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:C5BBA6"
FT                   /protein_id="ACR67341.1"
FT                   /translation="MTSNPFISSAPDGAEYLRAVLRSPVYEVAQVTPLQMMEKLSGRLG
FT                   NHILVKREDRQPVHSFKLRGAYAMIAGLNETQRACGVITASAGNHAQGVALSASRLGIA
FT                   ATIVMPRATAEIKVEAVRGFGGRVLLYGANFDEAKAHAIQMAQETGMTFIPPFDHPAVI
FT                   AGQGTLALELLQQDAHLDRIFVPVGGGGLAAGVAVLIKQLMPQIKVIGVEAEDSACLRA
FT                   ALDAGRPVDLPRVGLFAEGVAVKRIGDETFRLCQRYLDDVITVDSDAICAAVKDLFEDV
FT                   RAVAEPSGALALAGLKQYVQRHALRGERLAHVLSGANLNFHGLRYVSERCELGEQREAL
FT                   LAVTIPERKGSFLTFCQLLGGRSVTEFNYRYADADSACIFVGVRLTGGRGEREEIIASL
FT                   RGGGYQVVDLSDDEMAKLHVRYMVGGRPSKPLQERLYSFEFPEAPGALLKFLHTLGTHW
FT                   NISLFHYRSHGTDFGRVLAAFERPDSDASFEARLKELGYECHDETGNPAFRFFLQG"
FT   gene            complement(77049..77945)
FT                   /locus_tag="NT01EI_0082"
FT   CDS_pept        complement(77049..77945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0082"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67342"
FT                   /db_xref="GOA:C5BBA7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037404"
FT                   /db_xref="UniProtKB/TrEMBL:C5BBA7"
FT                   /protein_id="ACR67342.1"
FT                   /translation="MDIRDLKLFLHLSESRHFGRTAAAVHVSPSTLSRQIQRLEEELGQ
FT                   PLLLRDNRDVRLTAAGEQLQDFARQTLLHYRQLRSGLDSHGTALCGELHLFCSVTAAYS
FT                   HLPPILDRFRAHHPQVDIRLTTGDAADAVSKVQGGTADLAIAGRPQSLPTSVAFYPIGE
FT                   IPLRLIAPAQPCPVRHQAQRPRPDWAQIPFILPQHGPTRQRIDQWFRRRRIPAPRIYAT
FT                   VAGHEAIVSMVALGCGIALLPGVVIDNSPDSVRARLVTLDNDVAIAPFELGVCVQHKRL
FT                   REPPIAAFWSLLAHAAP"
FT   gene            78144..79622
FT                   /locus_tag="NT01EI_0083"
FT   CDS_pept        78144..79622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0083"
FT                   /product="ketol-acid reductoisomerase , putative"
FT                   /EC_number="1.1.1.86"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67343"
FT                   /db_xref="GOA:C5BBA8"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BBA8"
FT                   /protein_id="ACR67343.1"
FT                   /translation="MSNYFNTLNLRQQLAQLGKCRFMARTEFADGVNALRGKKVVIVGC
FT                   GAQGLNQGLNMRDSGLDVAYALRAEAIAERRDSYRRATEHGFCVGDYQALIPQADLVIN
FT                   LTPDKQHAAVVSAVQPLMKPGAALGYSHGFNIVEVGQQIRPDITVVMVAPKCPGTEVRE
FT                   EYKRGFGVPTLIAVHPENDPRGAGMAIAKAWASATGGDRAGVLESSFVAEVKSDLMGEQ
FT                   TILCGMLQTGSLLCYERLVAEGADPAWAGKLIQFGWETITEALKQGGITLMMDRLSNPA
FT                   KLRAYTLAGQLKTLMAPLFAKHMDDILSGAFSQGMMADWAADDAHLLTWRAETGESAFE
FT                   KAPPFEGKIDEQTYFDRGVLLVAMVKAGVELAFETMVASGIVAESAYYESLHELPLIAN
FT                   TIARRRLYEMNVVISDTAEYGNYLFANAAVPLLRQGFMETLQPGDLGQPLPAEAVDNAA
FT                   LREVNQAIRQHPIETVGERLRGYMTDMKRVAVAG"
FT   gene            complement(79763..79900)
FT                   /locus_tag="NT01EI_0084"
FT   CDS_pept        complement(79763..79900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0084"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67344"
FT                   /db_xref="GOA:C5BBA9"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="UniProtKB/TrEMBL:C5BBA9"
FT                   /protein_id="ACR67344.1"
FT                   /translation="MARRAAALHILVESQSEAESLLQKLKRGASFQTLARRHSRCPSKR
FT                   "
FT   gene            80115..82142
FT                   /locus_tag="NT01EI_0085"
FT   CDS_pept        80115..82142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0085"
FT                   /product="ATP-dependent DNA helicase Rep, putative"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67345"
FT                   /db_xref="GOA:C5BBB0"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005752"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:C5BBB0"
FT                   /protein_id="ACR67345.2"
FT                   /translation="MRLNPGQQQAVEFVTGPCLVLAGAGSGKTRVITNKIAHLIRVCGY
FT                   QARHIAAVTFTNKAAREMKERVAQTLGRKEARGLMISTFHTLGLEIIKREYKALGMKSN
FT                   FSLFDDQDQLALLTDLTERWLEKDKTQLQQLIATISNWKNDLIDPAQAAAQARSARERL
FT                   FADCYGLYDTQLKSCNVLDFDDLILLPTLLLRRDPEVRERWQQRIRYLLVDEYQDTNTS
FT                   QYELVKLLVGSRARFTVVGDDDQSIYSWRGARPQNLVLLKEDFPALQVVKLEQNYRSSQ
FT                   RILKAANILIANNPHVFEKRLFSELGYGEPLKVITANNEDHEAERVVGELIAHHFIHKT
FT                   AYSDYAILYRGNHQSRVFEKMLMQNRIPYKISGGTSFFSRAEIKDLLSYLRVLTNPDDD
FT                   SAFLRIVNTPRREIGPSTLQKLGAWANQRGISLFRASFDVGLEQTLSGRGLASLQHFTR
FT                   WMDELSRLCERDATAAVRDLIHGIDYESWLCETSASPRAAEMRMKNVNQLFGWMTDMLQ
FT                   GSDLDEPMTLTQVVNRFTLRDMMERGESEEEADQVQLMTLHASKGLEFPYVYLVGMEEG
FT                   LLPHQSSIDEDNVDEERRLAYVGITRAQKALVFTLCRERRQYGELMRPEPSRFLLELPQ
FT                   DDLSWESARKVVSPQERMQRGQSHLANLKAQLARAKSAQD"
FT   gene            complement(82211..83713)
FT                   /locus_tag="NT01EI_0086"
FT   CDS_pept        complement(82211..83713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0086"
FT                   /product="Ppx/GppA phosphatase family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67346"
FT                   /db_xref="GOA:C5BBB1"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="InterPro:IPR023709"
FT                   /db_xref="InterPro:IPR030673"
FT                   /db_xref="UniProtKB/TrEMBL:C5BBB1"
FT                   /protein_id="ACR67346.1"
FT                   /translation="MGKNAALYAAIDLGSNSFHMLVVREMAGGIQTLARIKRKVRLAAG
FT                   LDADNTLSPDAMQRGWQCLRLFAERLQDIPIDHIRVVATATLRIARNADAFIERAQEIL
FT                   GRPVRIISGEEEARLIYQGVAHTTGGARRRLVVDIGGGSTELACGESAKADVLFSLQMG
FT                   CVTWLERYFSDRHLTQANFARAGDAAHAMIAPVHDTLLRHGWQACVGASGTVQALQEIM
FT                   VAQGMDERITLDKLCQLRDRAIECGKLEELEIEGLTLERALVFPSGLAILIALFEALHI
FT                   DSMTLSGGALREGLVYGMLALPGGCDVRTRTLHNIQRRFLIDEGQAERVWRLADSLSRQ
FT                   LTTPWPQDSSANMLLHAACLLHELGLSVDVRQAPQHTAYLIRHLDLPGFTPAQKKLLAT
FT                   LLANQSGPLNLALFGQQNAVPLHTAQRLCRLLRLAIIFASQRNDGTLPSLLTQVCEENT
FT                   LRLILPTGWLAAHPLRAESLQQESLWQGYAHWPLQIVEATSD"
FT   gene            complement(83719..85008)
FT                   /locus_tag="NT01EI_0087"
FT   CDS_pept        complement(83719..85008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0087"
FT                   /product="DEAD/DEAH box helicase"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67347"
FT                   /db_xref="GOA:C5BBB2"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR023554"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5BBB2"
FT                   /protein_id="ACR67347.2"
FT                   /translation="MSKTHLTEQKFADFALHPMVIKALESKGFHSCTPIQALALPLAIA
FT                   GRDVAGQAQTGTGKTLAFLASTFHYLLTHPAIAERKTNQPRALIMAPTRELAVQIHSDA
FT                   EPLAQETGLRLGLAYGGDGYDKQLRVLEQGVDILIGTTGRLIDYAKQGHVDLGAIQVVV
FT                   LDEADRMFDLGFIKDIRWLFRRMPPTAQRLNMLFSATLSYRVRELAFEHMNNAEYVEVE
FT                   PEQKTGHRIQEELFYPSNEEKMRLLQTLLEEEWPDRCIIFANTKHRCEDIWGHLAADGH
FT                   RVGLLTGDVPQKKRLRILEDFTKGHIDILVATDVAARGLHIPAVTHVFNYDLPDDCEDY
FT                   VHRIGRTGRAGASGNSISLACEEYVLNLPAIESYIGHSIPVSKYNGDALLKDLPAPKRL
FT                   SRSRNGTGARRPGSPRRGSGAPRPNRKRSG"
FT   gene            85154..85480
FT                   /locus_tag="NT01EI_0088"
FT   CDS_pept        85154..85480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0088"
FT                   /product="thioredoxin, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67348"
FT                   /db_xref="GOA:C5BBB3"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C5BBB3"
FT                   /protein_id="ACR67348.1"
FT                   /translation="MSDKIVHLSDSGFEADVLKAEGPILVDFWAEWCGPCKMIAPILDE
FT                   IAAEYAGKLTIAKLNIDENPATAPKYGIRGIPTLLLFKNGAVAATKVGALSKTQLKEFL
FT                   DANL"
FT   gene            85916..87175
FT                   /locus_tag="NT01EI_0089"
FT   CDS_pept        85916..87175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0089"
FT                   /product="transcription termination factor Rho, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67349"
FT                   /db_xref="GOA:C5BBB4"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:C5BBB4"
FT                   /protein_id="ACR67349.1"
FT                   /translation="MNLTELKNTPVSELITLGESMGLENLARMRKQDIIFAILKQHAKS
FT                   GEDIFGDGVLEILQDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPP
FT                   KEGERYFALLKVNEVNYDKPENARSKILFENLTPLHANSRLRMERGNGSTEDLTARVLD
FT                   LASPIGRGQRGLIVAPPKAGKTMLLQNIAQSIAYNHPDCVLMVLLIDERPEEVTEMQRL
FT                   VKGEVVASTFDEPASRHVQVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPAS
FT                   GKVLTGGVDANALHRPKRFFGAARNVEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGN
FT                   MELHLSRKIAEKRVFPAIDYNRSGTRKEELLTTPEELQKMWILRKIIHPMGEIDAMEFL
FT                   INKLAMTKTNDEFFDMMKRS"
FT   gene            87454..88542
FT                   /locus_tag="NT01EI_0090"
FT   CDS_pept        87454..88542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0090"
FT                   /product="undecaprenyl-phosphate alpha-N-acetylglucosaminyl
FT                   1-phosphatetransferase, putative"
FT                   /EC_number="2.7.8.-"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67350"
FT                   /db_xref="GOA:C5BBB5"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR012750"
FT                   /db_xref="UniProtKB/TrEMBL:C5BBB5"
FT                   /protein_id="ACR67350.1"
FT                   /translation="MNLLTLSSKFFLIFLFSMAFLLVARRVAKKIGLVDKPNYRKRHQG
FT                   LIPLVGGISVYAGICFTFLFFKPYIPHATLYLICAGILVLVGALDDRFDISVKFRATVQ
FT                   ALIAIAMMVAGGLYLRSLGFVLGPWELILGPFGYLVTLFAVWAAINAFNMVDGIDGLLG
FT                   GLSCVTFAAMGILLQWDGQPDLALWCFAIIAATLPYILLNLGVVGPRFKVFMGDAGSTL
FT                   IGFTVIWILLESTQGRGHPMNPVTALWVIAIPLMDMIAIMYRRLRKGMSPFSPDRQHIH
FT                   HLIMRAGFTSRQAFVLITLAAVLLAAIGVLGEIWLPEYAMMALFLLAFALYGYCIKRAW
FT                   RVARMVKRFKRRLRRKSTGIHV"
FT   gene            88573..89610
FT                   /locus_tag="NT01EI_0091"
FT   CDS_pept        88573..89610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0091"
FT                   /product="lipopolysaccharide biosynthesis protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67351"
FT                   /db_xref="GOA:C5BBB6"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR032895"
FT                   /db_xref="UniProtKB/TrEMBL:C5BBB6"
FT                   /protein_id="ACR67351.1"
FT                   /translation="MVSQNPMPVENELDVRGLCRALWHGKPWVVGTAALFAALALGVSL
FT                   LMPQKWSAAAITASPGVNRLGSYYSQQQFLRNLAQLSAPSGAAAQGSIADEAYAEFTTQ
FT                   LASYDTRREFWLRSPYYQRHKEGSAQADAALLDELINQIVFTPGEATKHSDDSIRLTAD
FT                   GAAQANQLLRQYVAFAAHRASANLNASLQGAWAARSTFLKAQVKRQEAVAQAIYQRELN
FT                   GLEQGLKIAAQQGITRSMATTAQADLPYAELFMLGQPMLRARLEALRAVGPSYDIDYDR
FT                   NRAMLTTLSVGPVLDAAFQPYRYLRTPEEPVKRDSPRRLFMMVMWGAIGALLGAGIALS
FT                   RRARI"
FT   gene            89694..90824
FT                   /locus_tag="NT01EI_0092"
FT   CDS_pept        89694..90824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0092"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase, putative"
FT                   /EC_number="5.1.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67352"
FT                   /db_xref="GOA:C5BBB7"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="InterPro:IPR032892"
FT                   /db_xref="UniProtKB/TrEMBL:C5BBB7"
FT                   /protein_id="ACR67352.2"
FT                   /translation="MKVLTVFGTRPEAIKMAPLVHALAADAAFDARVCVTAQHREMLDQ
FT                   VLGLFQIEPDYDLNIMRPGQDLSDITCRILEGLKPILAEFRPDVVLVHGDTTTTLAASL
FT                   AAFYQRIPVGHVEAGLRTGDLYSPWPEEANRTLTGHLASLHFAPTLTARANLLREGIGE
FT                   QTIHLTGNSVVDALLWVRDRICADTALQAHLAAAYPFLDADKPLLLVTGHRRESFGGGF
FT                   ERICGALAQIARSHPQVQVVYPVHLNPNVSEPVNRILRDIENVFLIPPQDYLPFVYLMG
FT                   RAQLILTDSGGIQEEAPSLGKPVLVMRETTERPEAVQAGTVRLVGTDTATIVAQVSLLL
FT                   ENEQQYRAMSHATNPYGDGYACQRILSALKNYRATL"
FT   gene            90821..92083
FT                   /locus_tag="NT01EI_0093"
FT   CDS_pept        90821..92083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0093"
FT                   /product="UDP-N-acetyl-D-mannosamine dehydrogenase,
FT                   putative"
FT                   /EC_number="1.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67353"
FT                   /db_xref="GOA:C5BBB8"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR032891"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5BBB8"
FT                   /protein_id="ACR67353.1"
FT                   /translation="MSFDTISVIGLGYIGLPTAVAFAGCRKQVIGVDVSQHAVETINRG
FT                   EIHIVEPDLDRAVKRAVEGGFLRAVMRPEPADAFLIAVPTPFKGEHEPDLTYVEAAARS
FT                   IAPVLKKGDLVILESTSPVGATEQMCAWLAECRADLRFPHQDGEQADIRVAYCPERVLP
FT                   GKIMVELLRNDRVIGGMTPTCSAQASALYRLFLEGECVETNARTAEMCKLTENSFRDVN
FT                   IAFANELSLICDAQGIDVWQLIALANRHPRVNILQPGPGVGGHCIAVDPWFIVAQNPQL
FT                   ARLIHTARLVNDGKPLWVVDRVKAALADCLAAEDKRASEATIACFGLAFKPDIDDLRES
FT                   PAMEITEMVAQWHSGTTLVVEPNIHQLPVRLAGMAQLTDCTTALAQADVVVLLVDHQPF
FT                   RALAPQAVTQRFVVDTKGVWR"
FT   gene            92080..93144
FT                   /locus_tag="NT01EI_0094"
FT   CDS_pept        92080..93144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0094"
FT                   /product="dTDP-glucose 4,6-dehydratase, putative"
FT                   /EC_number="4.2.1.46"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67354"
FT                   /db_xref="GOA:C5BBB9"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5BBB9"
FT                   /protein_id="ACR67354.2"
FT                   /translation="MRRILVTGGAGFIGSAVVRHIIMDTTDSVVVVDKLTYAGNLASLA
FT                   PVADSDRYAFERADIGDRAAMDRILAQYRPDAIMHLAAESHVDRSIDGPADFIQTNIVG
FT                   TYTLLEATRGYWSALPVALRAAFRFHHISTDEVYGDLHDPQALFREDTPYAPSSPYSTS
FT                   KAASDHLVRAWLRTYGLPTLITNCSNNYGPYHFPEKLIPLTIINALAAKPLPVYGNGLQ
FT                   VRDWLYVEDHACALYRVLTTGQVGETYNIGGHNERRNIDVVTTLCALLQEMVPEKPVGV
FT                   RHFADLITYVADRPGHDVRYAIDAAKIERELGWRPQETFESGIRKTVAWYLANERWWRA
FT                   VMDGSYAGERLGLA"
FT   gene            93177..94058
FT                   /locus_tag="NT01EI_0095"
FT   CDS_pept        93177..94058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0095"
FT                   /product="glucose-1-phosphate thymidylyltransferase,
FT                   putative"
FT                   /EC_number="2.7.7.24"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67355"
FT                   /db_xref="GOA:C5BBC0"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C5BBC0"
FT                   /protein_id="ACR67355.1"
FT                   /translation="MKGIILAGGSGTRLYPITRGVSKQLLPIYDKPMIYYPLSVLMLAG
FT                   IRDILLISTPQDLPAFQRLLGDGGDIGVRLQYAEQPRPEGLAQAFLIGESFLDGDSCCL
FT                   VLGDNIFFGQGFSPKLRQVAQRGGGATVFGYQVMDPERFGVVEFDDDFRALSIEEKPQR
FT                   PRSNWAVTGLYFYDAQVVDFARRVTPSVRGELEITSINQMYLQRGELNVELLGRGFAWL
FT                   DTGTHDSLLEASAFVQTVEKRQGFKIACLEEIAWRNGWLDDHGVARAAASLDKTAYGAY
FT                   LRELLHVRPRQY"
FT   gene            94036..94731
FT                   /locus_tag="NT01EI_0096"
FT   CDS_pept        94036..94731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0096"
FT                   /product="TDP-D-fucosamine acetyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67356"
FT                   /db_xref="GOA:C5BBC1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR012752"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C5BBC1"
FT                   /protein_id="ACR67356.1"
FT                   /translation="MSVHASIEPLAWESAFFALRSGRLMFDDRAPPLLASACDAYQLLQ
FT                   AKVDARDLARCDALQALGFRLAEGEADFILPISSASASGGQRQAQAQDCLWLRALARDA
FT                   FALSRFRAPWYRDGESARFYAEWVEKAVYGTFDHACLLALDNEGNPQGFVTLRRQVDGS
FT                   ARIGLLAVDGASFRGGVGRRLVTQAQAWCHAQRLSRLHVATQIGNLAAQRLYLGCGAQL
FT                   TATAYWLYR"
FT   gene            94757..95887
FT                   /locus_tag="NT01EI_0097"
FT   CDS_pept        94757..95887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0097"
FT                   /product="TDP-4-keto-6-deoxy-D-glucose transaminase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67357"
FT                   /db_xref="GOA:C5BBC2"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR012749"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR032894"
FT                   /db_xref="UniProtKB/TrEMBL:C5BBC2"
FT                   /protein_id="ACR67357.1"
FT                   /translation="MIPFNAPPVTGSESDYMQAAMASGKLCGDGGFTRRCQQWMEQRFG
FT                   SAKVLLTPSCTASLEMAALLLDIQPGDEVIMPSFTFVSTANAFVLRGARIVFVDVRPDT
FT                   MNIDETLIEAAITEKTRAIVPVHYAGVACEMDTIMALAQQYGLYVVEDAAQGVMATYKG
FT                   RALGTIGHIGCYSFHETKNYTAGGEGGATLINDAALIERAEIIREKGTNRSQFFRGQVD
FT                   KYTWRDIGSSYLMSDLQAAYLWAQLEVADRINQRRLQLWRQYHEALAPLAGAGRLALPT
FT                   MPTHCGHNAHMFYLKLRDMRERSAFIDFLKEAEIMAVFHYIPLHCSPAGARFGRFVGED
FT                   RYTTRESERLVRLPLFYNLPDVNQRTVINSIQSFFR"
FT   gene            95887..97137
FT                   /locus_tag="NT01EI_0098"
FT   CDS_pept        95887..97137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0098"
FT                   /product="polysaccharide biosynthesis family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67358"
FT                   /db_xref="GOA:C5BBC3"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR032896"
FT                   /db_xref="UniProtKB/TrEMBL:C5BBC3"
FT                   /protein_id="ACR67358.1"
FT                   /translation="MSLARASLWTAGSTLIKIGAGLVVVKLLAVAFGPVGVGQAANFRQ
FT                   VITVLGVLSGAGIFNGITKYVAEYRQQPLRLRALLGTASTMILGFSLLLALIFTLGAAP
FT                   ISVALFGHDDYQAVIRLVALLQMGIACANYCLAVIKGYRDARGNALAVALGSLLGVAAY
FT                   TLSYFWGGYRGALAGLALVPAVATLPALWVLWRQRHIPWRYFRPSWDRPLAAGLGKFTL
FT                   MAVMTAVTMPVAYVMMRNQLAALDGWEAVGIWQGVSGISDAYLQFITASFSVYLLPTLA
FT                   GLRSRQAVGQEILRALRFVLPAVAAVSFMVWLLRDLVIWLLLSGKFSAMRDLFAWQLTG
FT                   DVFKVGAYVFGYLVIAKASLRFYLLCEISQFILLTLLSRFLIPQHGALGAAQAYMATYI
FT                   IYFLLCGSVFWIYRNRA"
FT   gene            97134..98210
FT                   /locus_tag="NT01EI_0099"
FT   CDS_pept        97134..98210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0099"
FT                   /product="TDP-Fuc4NAc:lipid II Fuc4Nac transferase,
FT                   putative"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67359"
FT                   /db_xref="GOA:C5BBC4"
FT                   /db_xref="InterPro:IPR009993"
FT                   /db_xref="UniProtKB/TrEMBL:C5BBC4"
FT                   /protein_id="ACR67359.1"
FT                   /translation="MTTLIHVLGADIPHHNLTLLRFFDGVLSQRAATAPRRRFMVVARD
FT                   AAPFAALTTLDIEVWPDKRALARALLARARADRTLRFFLHGQFNPWLWLALLCGRLRPQ
FT                   QVLWHVWGADLYEEARGWKYRLYYGLRRLAQGRVGHVFATQGDLDYYRQRHPRVATSTL
FT                   YFPTRMDPALTCNQRVRETSGALTVLVGNSGDRSNRHLVALQRLHDTFGPQTRVIVPLG
FT                   YPANNQAYIAQVRERAESLFGHNATLLTQQVAFTDYLALLARCDLGYFIFERQQGIGTL
FT                   CLLLQQGIPPVLSRQNPFWRDMAAQQLPVLFDDDAPDDVAVRAAQRQLALRDLSQIAFF
FT                   DPNYIDGWLQALALGERP"
FT   gene            98207..99595
FT                   /locus_tag="NT01EI_0100"
FT   CDS_pept        98207..99595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0100"
FT                   /product="ECA biosynthesis protein WzyE, putative"
FT                   /note="ECA biosynthesis protein WzyE, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67360"
FT                   /db_xref="GOA:C5BBC5"
FT                   /db_xref="InterPro:IPR010691"
FT                   /db_xref="UniProtKB/TrEMBL:C5BBC5"
FT                   /protein_id="ACR67360.1"
FT                   /translation="MTLMQFAGLTLVYFFSLLFVAFLTYKEFRRVRFNFNVFFSLLFLL
FT                   TFYFGFPLTCTLVFRFDVATVPAEEMLYALLSATAFYALYYVTYKTRLRSATSAPGSGS
FT                   AWLQLNRVEAQLTWILLALVALVTVTIFFLNNGFLLFKLHSYSQIFSSGVSGVALKRFF
FT                   YFFIPAMLVVYFLRQTQAAWLFFLVSTVIFGLLTYVIVGGTRANIIIAFALFLFIGIQR
FT                   GWITLWMLALAGVVGVVGMFWLALKRYGLAVSGDEAFYTFLYLTRDTFSPWENLALLLQ
FT                   HYTQIDFQGLAPIARDFYVFIPGWMWPDRPHLVLNSANYFTWQVLDNHSGLAISPTLIG
FT                   SLVVMGGAAFIPLGAIAVGLIIKWFDWLYTRGCTASNRYRGAVIQAFCFGAVFNMIVLA
FT                   REGLDAFVSRVVFFCIIFGCCLLLAKLLYWLFDAAGLIRARTAIAAPSVGEGSPTHKDR
FT                   NDGE"
FT   gene            99585..100325
FT                   /locus_tag="NT01EI_0101"
FT   CDS_pept        99585..100325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0101"
FT                   /product="glycosyl transferase, WecB/TagA/CpsF family"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67361"
FT                   /db_xref="GOA:C5BBC6"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="InterPro:IPR023085"
FT                   /db_xref="UniProtKB/TrEMBL:C5BBC6"
FT                   /protein_id="ACR67361.1"
FT                   /translation="MESNGSIPHYAIRGIDIWGFRDSEQFLRHLLMESAVRPGTLVAMN
FT                   AEKVMTAEDDAALRTLIAAAEYKYADGISIVRAIRRKYPGAQVSRIAGADLWEALMQRA
FT                   GELGIPVFLVGGQSDVLAQTEAVLRCRWGVNVVGAQDGYFPSDQRDALFERIRASGAQI
FT                   VTVAMGSPRQEILMRDCQAYYPQALYMGVGGTYDVFTGRVRRAPLLWRRFGLEWLYRLL
FT                   SQPTRWRRQVKLLRFVAYYYAGKL"
FT   gene            100500..100576
FT                   /locus_tag="NT01EI_T0001"
FT   tRNA            100500..100576
FT                   /locus_tag="NT01EI_T0001"
FT                   /product="tRNA-Arg"
FT                   /note="putative tRNA-Arg"
FT   gene            100638..100715
FT                   /locus_tag="NT01EI_T0002"
FT   tRNA            100638..100715
FT                   /locus_tag="NT01EI_T0002"
FT                   /product="tRNA-His"
FT                   /note="putative tRNA-His"
FT   gene            100728..100816
FT                   /locus_tag="NT01EI_T0003"
FT   tRNA            100728..100816
FT                   /locus_tag="NT01EI_T0003"
FT                   /product="tRNA-Leu"
FT                   /note="putative tRNA-Leu"
FT   gene            100839..100917
FT                   /locus_tag="NT01EI_T0004"
FT   tRNA            100839..100917
FT                   /locus_tag="NT01EI_T0004"
FT                   /product="tRNA-Pro"
FT                   /note="putative tRNA-Pro"
FT   gene            complement(101525..102724)
FT                   /locus_tag="NT01EI_0107"
FT   CDS_pept        complement(101525..102724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0107"
FT                   /product="HemY protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67362"
FT                   /db_xref="GOA:C5BBC7"
FT                   /db_xref="InterPro:IPR005254"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C5BBC7"
FT                   /protein_id="ACR67362.1"
FT                   /translation="MLKVLLLFIILIAGIVLGPMLAGHQGYVLIQTDSYNIETSVTSLV
FT                   IMLILLMLALFALEWLLRRLLRTGARTRGWFIGRKRTRARRQTCAGLLKLTEGDYGQVE
FT                   KLLARNADHADQPLVNYLLAAEAAQQRGDELRANQYLERAAEVAGSDPLPVDITRVRLQ
FT                   LARGENHAARHGVDALLNYAPRHPEVLRLAEQAYLRTDAFGPLLEILPALAKQGLHSDD
FT                   DIEKLQIRAYIGLMDQAMANGGSEELKQWWKAQRRTTRHETVLQVALAEHLIECDDHGA
FT                   AQQIVVDGLKRRFDERLVQLMPQLKSGNPEQLEKLLQQQIRQHGASALLNSTLGQLLMR
FT                   HGEWQQAAEVLRAALKQRPDPYDYAWLADTLDKLHRPEEAAQMRRDGLLLTLHQDQPTA
FT                   "
FT   gene            complement(102727..103875)
FT                   /locus_tag="NT01EI_0108"
FT   CDS_pept        complement(102727..103875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0108"
FT                   /product="Protein of unknown function (DUF513), HemX"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67363"
FT                   /db_xref="GOA:C5BBC8"
FT                   /db_xref="InterPro:IPR007470"
FT                   /db_xref="UniProtKB/TrEMBL:C5BBC8"
FT                   /protein_id="ACR67363.1"
FT                   /translation="MTEPTTPPDKAAAAETATKQAQPLERAHKQDKQLVKKSAASGPAL
FT                   GAIAIVLVIALGAGLYYHGHQQAQMQQATEQSLQEQLSALHTAQAQEKLRMEALLNKQA
FT                   KALDVATQLQASQSQQLKELEQKVAAISGNDANTWKLAQADFMVKLAERKLWSDQDVTT
FT                   AIALLKSADATLAGLGDPSLLGVRRALTEDIATLSALNQIDFDGIILQLNQLANQVDDL
FT                   RLADNDSDEAPMDQDDGELSASLSQWRQNLAKSWHSFISEFITIRRRDSSAEPLLAPSQ
FT                   DVYLRENIRSRLLIAAQAIPRHQNQIYQQSLESVSAWVRAYFDVNDPSTKAFLNQIDAL
FT                   SQQSVSMILPDALKSQPLLDKLLHARSHALTAAPTAPATQGE"
FT   gene            complement(103894..104640)
FT                   /locus_tag="NT01EI_0109"
FT   CDS_pept        complement(103894..104640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0109"
FT                   /product="uroporphyrinogen-III synthase, putative"
FT                   /EC_number="4.2.1.75"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67364"
FT                   /db_xref="GOA:C5BBC9"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:C5BBC9"
FT                   /protein_id="ACR67364.1"
FT                   /translation="MSILVTRPSPDGEQLVDRLQALGMEAWHTPLINFAPGRQLAQLPE
FT                   AAAALQRGDLLLAVSRHAVLHAAESLRQAGREWPTAPRYAAIGHSTAQSLRAACRQPVI
FT                   FPSAPETSEALLALPAIQQLQSRRALLLCGNGGRELIANALHARGVSVTLCECYRRVAI
FT                   AHPGDELYARWRQQKVSTLVVTSGEMLQQLYDLVPEYDRRRWLLGCRLIVVSERLAQRA
FT                   RDLGWQEIRVAESANNDALLRTLQIN"
FT   gene            complement(104647..105600)
FT                   /locus_tag="NT01EI_0110"
FT   CDS_pept        complement(104647..105600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0110"
FT                   /product="porphobilinogen deaminase, putative"
FT                   /EC_number="2.5.1.61"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67365"
FT                   /db_xref="GOA:C5BBD0"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/TrEMBL:C5BBD0"
FT                   /protein_id="ACR67365.1"
FT                   /translation="MQSMTTATQPTLRIATRQSPLALWQAHYVRDQLLAQWPQLTIELV
FT                   PMVTRGDVLLDTPLAKVGGKGLFVKELELALLEGRADIAVHSMKDVPVAFPDGLGLVTI
FT                   CQREDPRDAFVSPRFASLEQLPPGSVVGTSSLRRQCQLRAARPDLQIRDLRGNVGTRLA
FT                   KLDAGDYDAIILAAAGLKRLQLEDRIRTPLTPEQSLPAVGQGAVGIECRLADDATRRLL
FT                   APLNHAETALRVCAERAMNTRLEGGCQVPIGSYAEIDGDRLWLRALVGAPDGSLMICGE
FT                   RRGPLAQAEAMGTALADELLARGARAILDAVYCQKA"
FT   gene            105902..108457
FT                   /locus_tag="NT01EI_0111"
FT   CDS_pept        105902..108457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0111"
FT                   /product="adenylate cyclase, class I"
FT                   /EC_number="4.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67366"
FT                   /db_xref="GOA:C5BBD1"
FT                   /db_xref="InterPro:IPR000274"
FT                   /db_xref="InterPro:IPR024685"
FT                   /db_xref="InterPro:IPR024686"
FT                   /db_xref="UniProtKB/TrEMBL:C5BBD1"
FT                   /protein_id="ACR67366.1"
FT                   /translation="MYLYIETLKQRLDAINQLRVERALSAMGPAFQQVYTLLPTLLHFH
FT                   HPLMPGYLEGNVPHGICFFTPDEPQQNYLLHLEQRAPGSLPPVTGSDQMPITGLYTMGS
FT                   TSSIGQSCSSDLDIWVCHHSWLDASERSQLQQKCTLLEEWAASLGVEVSFFLIDENRFR
FT                   HNESGSLGGEDCGSTQHILLLDEFYRTAVRLAGKRILWSMVPCEEEEHYDEYVLSLYAQ
FT                   GALTPNEWLDLGGLSSLSAEEYFGASLWQLYKSIDSPYKAVLKTLLLEAYSWEYPNTEL
FT                   LAMDIKQRLHKGEIVSFGLDPYCMMLDRVTHYLEQIGDHARLDLARRCFYLKVCEKMSR
FT                   ARACVGWRREILSQLVAHWGWDEALIRSLDNRANWKIGQVREAHNELLDAMMQSYRNLI
FT                   RFARRNNLSVSASPQDIGVLTRKLYAAFEALPGKVTLVNPQISPDLSERDLTFIYVPVG
FT                   RANRSGWYLYNQAPTIDSIVSHQPLEYNRYLNKLVAWAYFNGLLTEETRLHIKANSSQC
FT                   DLNKLRELVRDVSSHFPLRLSAPTPKALYSPCEIRHLAIIVNLEHDPTATFNNQVVHFD
FT                   FRQLDVFSFGEQQQCLVGSVDLLYRNSWNEVRTLHFSGEQAVLEALKTILGKMHQDAAP
FT                   PEAVEVFCYSRHLRGLIRTRLQQLVSECIDLRLSSSRQEAGRFKAVRVAGQTWGLFFER
FT                   LSVSVQKLENAVEFYGAISNNKLHGLSMQVETDQAHLPAVVDGYASEGIIQFFFEDGEC
FT                   DGFNIYILDESNRVEVYHHCEGSKEELVRDVSRFYSSSHDRFTYGSSFINFNLPQFYQI
FT                   VTVEGRAQVIPFRSKAVASPGAETEGDGDAAPRQQFKVY"
FT   gene            complement(108465..108788)
FT                   /locus_tag="NT01EI_0112"
FT   CDS_pept        complement(108465..108788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0112"
FT                   /product="iron donor protein CyaY, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67367"
FT                   /db_xref="GOA:C5BBD2"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR020895"
FT                   /db_xref="InterPro:IPR036524"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BBD2"
FT                   /protein_id="ACR67367.1"
FT                   /translation="MNDSEFHLLADGLMQALEEALDACQSDADIDCETNGGVMTLSFEN
FT                   GSKIVINRQEPLHQIWLATRAGGYHFDYRNGQWRCSRSGVPLPQVLNEACSAQAGIPVT
FT                   LDL"
FT   gene            108866..109093
FT                   /locus_tag="NT01EI_0113"
FT   CDS_pept        108866..109093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0113"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67368"
FT                   /db_xref="InterPro:IPR032831"
FT                   /db_xref="UniProtKB/TrEMBL:C5BBD3"
FT                   /protein_id="ACR67368.1"
FT                   /translation="MNRQFRSALLVLCAATLGGCGLKGPLYFPPAQQAPVAQKAPDAYG
FT                   VQAPSHEPVAQTPNPQTPNTAPAAEAGKAR"
FT   gene            109151..109975
FT                   /locus_tag="NT01EI_0114"
FT   CDS_pept        109151..109975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0114"
FT                   /product="diaminopimelate epimerase, putative"
FT                   /EC_number="5.1.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67369"
FT                   /db_xref="GOA:C5BBD4"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BBD4"
FT                   /protein_id="ACR67369.1"
FT                   /translation="MQFAKMHGLGNDFMVVDAVTQNVYFSPELIRRLADRHTGVGFDQL
FT                   LVVEPPYDPDLDFHYRIFNADGSEVAQCGNGARCFARFVRIKGLTNRRDIRVSTQNSRM
FT                   TLHVGEDDRVTVNMGEPQFEPGRIPFKAAKAEKTYILRVAQQTVLCGAVSMGNPHCVLQ
FT                   VEDISRAQVELLGPSLESHERFPERVNVGFMQVVERSHIRLRVYERGAGETQACGSGAC
FT                   AAVAVGIQQGLLDEQVQVDLPGGTLHIRWPGPGTPLLMTGPAAHVYDGFIHL"
FT   gene            109989..110693
FT                   /locus_tag="NT01EI_0115"
FT   CDS_pept        109989..110693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0115"
FT                   /product="Protein of unknown function, DUF484"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67370"
FT                   /db_xref="InterPro:IPR007435"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:C5BBD5"
FT                   /protein_id="ACR67370.1"
FT                   /translation="MSERDSRDRLQPSLADDQVVAYLQQHPDFFIRNARLVEQMMIPHP
FT                   VRGAVSLLEWQLGRQRRQIAVLDQEIEQLITLARDNERLFGSLLALQGHLASAQDVDDF
FT                   LQRLQRWARSLGLSGAYIRLFSDRWRLGAPSRFSHLAIARSDVELLRIQRLGDASHYLG
FT                   SLNGQELLLLLPQARHVGSVALSLMGDFADLGLLVFTSADVQHYQQGMGTALLEQLARL
FT                   IPPMLTRWIERQ"
FT   gene            110699..111601
FT                   /locus_tag="NT01EI_0116"
FT   CDS_pept        110699..111601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0116"
FT                   /product="tyrosine recombinase XerC, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67371"
FT                   /db_xref="GOA:C5BBD6"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011931"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:C5BBD6"
FT                   /protein_id="ACR67371.1"
FT                   /translation="MPESLSTPVVAFLQMMRVERQLSPRTVETYRRQLAASVALLLEGG
FT                   LCDWTALDTVRVRSLVARSRRQGLEPASLALRLSALRSFLDWQVSRGALTANPAKGVSA
FT                   PRQGRHLPKNLDVDDVNRLLDIDEGDTLAVRDRAMLEVMYGGGLRLSELVGLDCRHADL
FT                   TTGEVWVLGKGSKERRLPVGREAVRWLQKWLSLRLSLQPQDDALFVSRLGGRISPRSVQ
FT                   KRFAEWGVKQGVTSHIHPHKLRHSFATHMLESSGDLRAVQELLGHANLSTTQIYTHLDF
FT                   QHLATVYDAAHPRAKRGKT"
FT   gene            111601..112317
FT                   /locus_tag="NT01EI_0117"
FT   CDS_pept        111601..112317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0117"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67372"
FT                   /db_xref="GOA:C5BBD7"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C5BBD7"
FT                   /protein_id="ACR67372.1"
FT                   /translation="MHFYRRLQRPAALTFDLDDTLYDNHPVIVRSEQAALDFLRRRFPA
FT                   LQDFRSADWQRLRAELRASDPEIYHDVTQWRWRTVYEALWRAGLSPAYCHDGADEAMAH
FT                   FAQWRSRITVPSGTHQTLKALAARLPLAAITNGNADPARCGLGEYFRFVLRAGPAGRAK
FT                   PYSDMYLAAAQRFGLAPAQILHVGDDLTTDVAGAVRSGMQACWVNDRGRSLLCAAEGRL
FT                   LPHVEISRLDSLLALI"
FT   gene            112394..114553
FT                   /locus_tag="NT01EI_0118"
FT   CDS_pept        112394..114553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0118"
FT                   /product="DNA helicase II, putative"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67373"
FT                   /db_xref="GOA:C5BBD8"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005753"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:C5BBD8"
FT                   /protein_id="ACR67373.1"
FT                   /translation="MDVSDLLDSLNDKQREAVAAPRSNLLVLAGAGSGKTRVLVHRIAW
FT                   LLAVENCSPFSIMAVTFTNKAAAEMRHRIEALIGTSQGGMWIGTFHGLAHRLLRAHHLD
FT                   AGLPQDFQILDSEDQLRLLKRLIKAMNLDEKQWPARQGMWYINGKKDDGLRPQHIESYG
FT                   NPVEQTWLRIYQAYQEACDRAGLVDFAELLLRAHELWLHKPQILEHYRARFNNILVDEF
FT                   QDTNRIQYAWIRMLAGDSGRVMIVGDDDQSIYGWRGAQVENIQKFLDDFPGAQTIRLEQ
FT                   NYRSSGNILRAANALIENNDGRLGKKLWTEDGEGEPISLYCAFNELDEARFVVNRIKAW
FT                   QDNGGALKECAILYRSNAQSRVLEEALLQAATPYRIYGGMRFFERQEIKDALAYLRLLS
FT                   NRNDDAAFERVVNTPVRGIGDRTLDVVRQTARDRQLTLWQATRALLQEQVFPGRAANAL
FT                   RRFLELIEALAQDSDDLPLHVQTDRVIRDSGLRQMYEQEKGEKGQTRIENLEELVTATR
FT                   QFSYEDDDELSPLQAFLSHAALESGEGQADAYQDAVQLMTLHSAKGLEFPQVFIVGMEE
FT                   GMFPSQMSLDEGGRLEEERRLAYVGVTRAMRKLTLTYAESRRLYGKEVYHRPSRFVGEL
FT                   PETCVEEVRLRASVTRPVSHARMGTPLSQSDSGYRLGQRVAHAKFGEGTIINLEGSGEH
FT                   TRLQIAFKGEGIKWLVAAYARLEVL"
FT   gene            114858..115808
FT                   /locus_tag="NT01EI_0119"
FT   CDS_pept        114858..115808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0119"
FT                   /product="magnesium and cobalt transport protein CorA,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67374"
FT                   /db_xref="GOA:C5BBD9"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="InterPro:IPR004488"
FT                   /db_xref="UniProtKB/TrEMBL:C5BBD9"
FT                   /protein_id="ACR67374.2"
FT                   /translation="MLSAFRLDHGRLSRMELDDTDHLTASLWVDLVEPEEDERQRVQSE
FT                   LGQSLATRPELDDIEASARFFEDEDGLHIHSFFYYEDAEDHAGNSTVAFTIREGRLFTL
FT                   RERELPAFRLYRMRARNQMLVDGNAYELLLDLFETKIEQLADEIENIYSDLEKLSRVIM
FT                   EGQQGDEYDEALSTLAELEDIGWKVRLCLMDTQRALNFLVRKARLPASQLEQAREVLRD
FT                   IESLLPHNESLFQKVNFLMQAAMGFINIEQNRIIKIFSVVSVVFLPPTLVASSYGMNFE
FT                   FMPELKWSFGYPGAILLMILAGLAPYLYFKRKKWL"
FT   gene            115919..116974
FT                   /locus_tag="NT01EI_0120"
FT   CDS_pept        115919..116974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0120"
FT                   /product="ammonia monooxygenase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67375"
FT                   /db_xref="GOA:C5BBE0"
FT                   /db_xref="InterPro:IPR007820"
FT                   /db_xref="InterPro:IPR017516"
FT                   /db_xref="UniProtKB/TrEMBL:C5BBE0"
FT                   /protein_id="ACR67375.1"
FT                   /translation="MERLAHGEQWSILVALSLGLGGLFLWLHLPAALLLGPMLAAVAMG
FT                   LRGATIRMHRLAMPMAQAILGCMIARALSLALLSPLLDDWPIVLLVLLCTQLCSAITGW
FT                   LLVRMSDLPGPTGAWGASPGGASAMVAMAGEFGADVRLVAFMQYLRVLFVAAAAALVVR
FT                   MGLGDAPQGAPSDLPWFPALGWEFVATLLLAGGGAWMGRRLRIPAGALLLPMLIGALCN
FT                   STGVMTPQTPEWLLAIAYTLIGWQVGLLFTRAIFVLALRALPQIILSIVALMLFCALMA
FT                   WGLTQVLPIDPLSAYLATSPGGLDTIAIVAVGSQANLAFVMALQMLRLFTILLMGPTVA
FT                   RWISRHALSAP"
FT   gene            118081..118995
FT                   /locus_tag="NT01EI_0121"
FT   CDS_pept        118081..118995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0121"
FT                   /product="phospholipase protein family"
FT                   /EC_number="3.1.1.32"
FT                   /EC_number="3.1.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67376"
FT                   /db_xref="GOA:C5BBE1"
FT                   /db_xref="InterPro:IPR003187"
FT                   /db_xref="InterPro:IPR036541"
FT                   /db_xref="UniProtKB/TrEMBL:C5BBE1"
FT                   /protein_id="ACR67376.1"
FT                   /translation="MSDVVMKELKKQRISGRTWMAAGLVLLPLTAQADGESGATQALQH
FT                   NEGVIANMLRHYDNPFTLYPYATNYVLYTQTSDINKEAISSYDWGDQAKKNEIKFQISL
FT                   AFPIWRGIAGDNSVLGAAYTQQSWWQAFNRSESSPFRETNYEPRLFLGWATDYPLFGGW
FT                   VLRDIEAGGVHQSNGRADPTSRSWNRVYTRFLAQNGNFQVQLMPWYRIPESPSKDDNPD
FT                   ITKYMGYYEAEMGYRLGESVFSLRGRYNWNSGYGAAELGWSYPLTRHVRFYTQLFSGYG
FT                   ESLIDYNFRQTRFGVGVMLNDIL"
FT   gene            119064..120893
FT                   /locus_tag="NT01EI_0122"
FT   CDS_pept        119064..120893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0122"
FT                   /product="ATP-dependent DNA helicase RecQ, putative"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67377"
FT                   /db_xref="GOA:C5BBE2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C5BBE2"
FT                   /protein_id="ACR67377.1"
FT                   /translation="MATAAVINTERLAEGVLKDTFGYQQFRPGQQAIVEAAIAGRDCLV
FT                   VMPTGGGKSLCYQIPALVRDGLTIVVSPLISLMKDQVDQLQANGVNAACLNSTLSREQQ
FT                   QAVYAGCRSGEIRLLYIAPERLMMDNLLDTLPQWNPTLLAVDEAHCISQWGHDFRPEYS
FT                   ALGQIKHRFPQMPVIALTATADDATRQDILRLLDLRDPLVQVSSFDRPNIRYTLIEKFK
FT                   PLDQLWHFVQSQRGKSGIIYCNSRAKVEDTAARLQSRGLSVGAYHAGLDNGRRAEVQEA
FT                   FQRDDLQIVVATVAFGMGINKPNVRFVVHFDIPRNIESYYQETGRAGRDGLPAEALLFY
FT                   DPADMAWLRRCLEEKPEGAQKEIERHKLNAMNAFAEAQTCRRLVLLNYFGEGRQESCDN
FT                   CDICLDPPKRYDGLLDAQKALSTVARVGQRFGIGYVVEVLRGANSARIREWGHDKLSVY
FT                   GIGREHSTEHWVSILRQLIHLGLVTQNIALHSALQLTEAARPVLRGEVALQLAVPRVIN
FT                   LKARSSAQKSYGGNYDRKLFAKLRKLRKAIADEENIPPYVVFNDATLLEMAEQMPLRAG
FT                   DLLSINGVGQRKLERFGAPFMTLIREHLDEGQE"
FT   gene            121053..121175
FT                   /locus_tag="NT01EI_0123"
FT   CDS_pept        121053..121175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0123"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67378"
FT                   /db_xref="UniProtKB/TrEMBL:C5BC87"
FT                   /protein_id="ACR67378.1"
FT                   /translation="MASVFALPVMRRGYRHMARWIDRAAVMLLTAARSAPDPEP"
FT   gene            complement(121250..122587)
FT                   /locus_tag="NT01EI_0124"
FT   CDS_pept        complement(121250..122587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0124"
FT                   /product="transporter, gluconate:H+ symporter (GntP)
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67379"
FT                   /db_xref="GOA:C5BC88"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:C5BC88"
FT                   /protein_id="ACR67379.1"
FT                   /translation="MSTLTLVMTAVGSVLLLLFLVMKARMHAFVALMLVSIGAGIFSGM
FT                   PIDKIAQTMQNGMGGTLGFLSIVVALGAMFGKILHETGALDQIAARLLKSFGEKHAHYA
FT                   LGIAGLVCALPLFFDVAIVLLIGVVFAVARRTGGNVVKLAIPLFAGVAGAAAFLLPGPT
FT                   PMLLASQMGADYGWMILIGLCAAIPGMILAGPLYGNFISKHVTLALPKDIQEPSLGKGQ
FT                   LPSFSFSLALVLFPLVLVGMKTIGARFVEQGSELYKWLEFIGHPFTAILLACLVATYGL
FT                   AIRRGMSKEKVMDICSAAIQPAGIILLVTGAGGVFKQVLVDSGVGPALGNSLIGAGLPI
FT                   AVACFVLAAAVRVIQGSATVACLTTVGLVLPVIGELGYSGAQLAALSVCIAGGSIVLSH
FT                   VNDSGFWLYGKFTGATEAQTLKTWSAMETILGTTGAVVGMLFFMAL"
FT   gene            complement(122599..123129)
FT                   /locus_tag="NT01EI_0125"
FT   CDS_pept        complement(122599..123129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0125"
FT                   /product="carbohydrate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67380"
FT                   /db_xref="GOA:C5BC89"
FT                   /db_xref="InterPro:IPR006001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:C5BC89"
FT                   /protein_id="ACR67380.1"
FT                   /translation="MSESQQQKHVFVLMGVSGSGKSAVANAVAQRLGAAFLDGDFLHPR
FT                   ANISKMADGHALNDDDRTPWLQALNDAVFAMQRTNGVSLIVCSALKKRYRDMLRDGNTN
FT                   LSFIYLQGDFALIESRLLARKGHFFKPQMLVSQFAALEEPTTEERDVFAIDISQPLDNV
FT                   VADTLNTIKSIIA"
FT   gene            complement(123349..124347)
FT                   /locus_tag="NT01EI_0126"
FT   CDS_pept        complement(123349..124347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0126"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67381"
FT                   /db_xref="GOA:C5BC90"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C5BC90"
FT                   /protein_id="ACR67381.2"
FT                   /translation="MKKKRPVLQDIADRVGVTKMTVSRYLRNPELVSLPLRGKIAAALD
FT                   ELGYIPNRAPDILSNATSRAIGVLLPSLTNQVFAEVLRGIESVTDQHHYQTMLAHYGYH
FT                   KEKEEERLTSLLSYNIDGLILAERDHTPRTLKMIEVAGIPVVELMDSISPCLDMAVGFD
FT                   NVEAARAMTQVIIARGHRRTVYFGARLDERTVMKQQGYEAAMYAAGLTPRSVMIPRSSS
FT                   YSVGGELLREALKRYPDMDSIFCTNDDLAVGAAFECQRLGLRIPQDMAIAGFHGHDIGQ
FT                   VMEPQLASVLTPRQRMGQLAAERLLARLRGERRAESAAIDVGFTLLYGGSI"
FT   gene            124570..126876
FT                   /locus_tag="NT01EI_0127"
FT   CDS_pept        124570..126876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0127"
FT                   /product="cadmium-translocating P-type ATPase, putative"
FT                   /EC_number="3.6.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67382"
FT                   /db_xref="GOA:C5BC91"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C5BC91"
FT                   /protein_id="ACR67382.1"
FT                   /translation="MTHKHIHSGGADPACGCGHQHAVTQHGCSRPAPGALKISMASPLT
FT                   PAIDGTCCMAIHDHDSVEEDADPHPLPPLASGRQRFSWRVEGMDCPSCARKIETAVAQI
FT                   NGVERAAVLFATQKLVVDAQQDLSPDIDRAVRQAGFSLQAVGAKRAESAALRWHEVMPL
FT                   IALALLMLLSYGLTLVDPSLGRVAFIATTVVGLAPIMLKAMRLMRSGSYFAIETLMSIA
FT                   ALGALFIGATQEAAMVLLLFMLGERLESYAANRARKGVSALMALVPDEAVVIEQERRRT
FT                   LAVSALRPGMEIEVAPGGRLPADAELLLESVSFDESALTGESLPVDRPPGARIPAGALV
FT                   VDRVCRLRVISQPGQNAIDRILQLIEEAEERRAPIERFLDRFSRYYTPAIMALALLVIL
FT                   IPPLAFAQPWDTWIYRGLTLLLIGCPCALVISTPAAITSGLAAASRHGALIKGGAALEQ
FT                   LGRVRTIAFDKTGTLTQGTPQVSGVFSVDGVSAERLLTLAAAVEVGSHHPLAKAVILAC
FT                   EQRDLPVVEAKARQAQAGIGVTGEVDGVAVRVAAPSRLAPETLPESLLAQIAAWEERGQ
FT                   TVVAVLLDGVAIGAIAMSDTLRPDAAEALDALRALGVEAVMLTGDNPRAAAAIAGSLGI
FT                   DFRAGLLPQDKVHQVEALSCLADTAMVGDGINDAPAMKAASIGIAMGGGTDVALETADA
FT                   ALTHNRLTGLAQMIALSRATHANIRQNITLALGLKGVFLITSLLGITGLWLAVLADSGA
FT                   TALVTANALRLLRRR"
FT   gene            126933..128090
FT                   /locus_tag="NT01EI_0128"
FT   CDS_pept        126933..128090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0128"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67383"
FT                   /db_xref="UniProtKB/TrEMBL:C5BC92"
FT                   /protein_id="ACR67383.1"
FT                   /translation="MLHEVTLNYCYTPHPAFISTHFITLNNMNNRALLSCLSGVLMSGV
FT                   AHAATSGNTTELSSTLPSYYGLPQSQAHAVDSVSTAQTPVPEVQKESILPIWGNEARAR
FT                   GYDLPEPFGINVNYMNMRQNIVVDSIGFSGLGWDSYSLPTDLFNIKVGNTRQRSVTQTI
FT                   KLDAWVLPFMNVYSIVGKTRGSSLSKVSVDADPSHYTPGSMDWIIATVVQGMNKSGQLR
FT                   DLDFRLNFKGTTYGAGTVLAGGYGNWFGLVDMNYTQTRFDILDGSIDAFTLSPRVGYRF
FT                   TTPGIDAVGLPDGKLSLWVGSMYQDVQQEFKGTLSDLSMPGGLSALMEIANKQGQGRFD
FT                   VHQHLSSPWNVLIGAQYEITRNFNLTTEVGFAERNSFFISGEYRF"
FT   gene            128090..129223
FT                   /locus_tag="NT01EI_0129"
FT   CDS_pept        128090..129223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0129"
FT                   /product="outer membrane protein, OMP85 family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67384"
FT                   /db_xref="GOA:C5BC93"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:C5BC93"
FT                   /protein_id="ACR67384.1"
FT                   /translation="MRRHLMALALVCTLSPLEGQADLLPTRAQIDEWLGHLGGDDRFDP
FT                   DKGIDWGVLPGPFFNPELGLGVGTAVAGLYRPDPSDTVSQNSSITLSGYLSSTGAFGLG
FT                   VRSYSFFDNDRWRIFVTGGLSDTPTYYWGQGFRAGADDDGRQKYTAQSLRLQPDVLYRV
FT                   ASQTYLGVGWSLSAMHAADVKQTDRLAQIRDGRTVFSSGPSLSLQYDSRDFVPNPHRGM
FT                   LASLRYTHYTPEAGSDTRFDNLMTRFSTYHALDATRVLAWEIDGEFTQGAVPWNMLPSL
FT                   GGDQRMRGYYQGRYRDRNLISSQLEYRQKLSWRHGVVAWAGAGTMGPNVRELGSSRWLP
FT                   TVGVGYRFAFKPGINIRLDYGIGRGSSGFYFQVGEAF"
FT   gene            129223..130356
FT                   /locus_tag="NT01EI_0130"
FT   CDS_pept        129223..130356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0130"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67385"
FT                   /db_xref="InterPro:IPR025130"
FT                   /db_xref="UniProtKB/TrEMBL:C5BC94"
FT                   /protein_id="ACR67385.1"
FT                   /translation="MTAVRGLCAVLLTWCGVAGAFGLPMSLDLAPLQLQQAAHVWPVSA
FT                   PLLPPDGLRPCCAFGYDLNAEALGIPIPFYRLNNVVEADALGAHRYNDSLFGALASLAG
FT                   LGSERNGLIYTRRGGFLDLAHVRDSADMTVYIFSHLYPRLGQAFRLELGDELARRQLVL
FT                   SAFTPPHEARERYTLAAYLAARLAFEVAAWHEIAQWYGYESIPGFSEGVSAFSPEDLYS
FT                   NLLGTRLALTLILNGYTASLGQYSAALTTLLPQALCQLQAQPAVLTRFQFDMLDGKWWD
FT                   SHQAVPQKFLVLKRNYDTHADRLPTPIPGELTPPLRLMLPGQVYHYDLARLAELRLLPG
FT                   ASMKRLPAPPRYYTWRDFSHLAAFARTQDALQLSRKR"
FT   gene            130476..131375
FT                   /locus_tag="NT01EI_0131"
FT   CDS_pept        130476..131375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0131"
FT                   /product="Carboxylate/Amino Acid/Amine Transporter"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67386"
FT                   /db_xref="GOA:C5BC95"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004779"
FT                   /db_xref="UniProtKB/TrEMBL:C5BC95"
FT                   /protein_id="ACR67386.1"
FT                   /translation="MFLLLATTLLWAFSFSLIGVYLAGQVDSWFAVLVRIALATLVFLP
FT                   FLRWRGVRPRQALAYMLVGAFQLGLMYLFYYPAFLYLTVPEVLLFTILTPLYVTLIYDL
FT                   LQGRRLRPGYLGSALLAVLGALIIRYNPLSSQFLLGFSLIQGANLCFALGQVGYKRLME
FT                   VMPLPQYRAFSWFYLGALTVALPAWWLYGNPQMLPTTSLQWGILLWLGVGASGLGYFMW
FT                   NYGATQVDAGTLAIMNNALIPAGLLVNLAIWQQHPDWFRLTLGGTVIALSLWVHRRWIV
FT                   PHPGRMAGHRRRGGAPAE"
FT   gene            132340..134616
FT                   /locus_tag="NT01EI_0132"
FT   CDS_pept        132340..134616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0132"
FT                   /product="5-methyltetrahydropteroyltriglutamate--homocysteine
FT                   S-methyltransferase, putative"
FT                   /EC_number="2.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67387"
FT                   /db_xref="GOA:C5BC96"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR006276"
FT                   /db_xref="InterPro:IPR013215"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:C5BC96"
FT                   /protein_id="ACR67387.1"
FT                   /translation="MQAISHTLGFPRIGLQRELKKALEAYWSGSAPQSALLACGAELRA
FT                   RHWRQQHKAGIDLLPVGDFAWYDHVLATSLMLGNVPARHRRADGVIDLDTLFGIARGQA
FT                   PGGKPAAAAEMTKWFNTNYHYIVPEFTRGQRFSLGWHQLLDEVDEALAQGYRVKPVLLG
FT                   PLTYLWLGKVKGAPFDRLSLLEEILAVYRQVLAALAERGVEWVQVDEPALVLTLPPAWR
FT                   DAYQNAYQALQGPVKLLLTTYFGDIGHHLPTICALPVQGLHVDLVQGAGDALALHRQLP
FT                   ADWVLSLGAISGRNVWRADLADWQTRLQPLVGQRPIWLGSSCSLLHTPIDLSAETQLDE
FT                   EVKSWFAFALQKCDELALLTQALNDPVPRREALLSYSTPLYLRRRSGRVHNPAVAGRLA
FT                   ALTDADTQRPSGYPQRAQRQRQRFALPLWPTTTIGSFPQTQAIRALRLDFRRGQLTPEH
FT                   YRQGIADHIRQAIGEQELLGLDVLVHGEAERNDMVEYFGEQLEGFVFTRNGWVQSYGSR
FT                   CVKPPVIVGDISRPAPLTVEWTTFAQAQTARPVKGMLTGPITMLCWSFAREDVPREVIA
FT                   RQLALALRDEVDDLQRAGIGIIQIDEPALREGLPLRQDEWQAYLAWAVAAFRLTAAVAY
FT                   DDTQIHTHMCYCEFNDIMAAIAALDADVITIETARSDMELLEAFSRFDYPNEIGPGVYD
FT                   IHSPNVPTQAAMVELLRRAAQHIPAERLWVNPDCGLKTRGWEETRRALSNMVAAARLLR
FT                   AQTQE"
FT   gene            complement(134664..135431)
FT                   /locus_tag="NT01EI_0133"
FT   CDS_pept        complement(134664..135431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0133"
FT                   /product="uridine phosphorylase, putative"
FT                   /EC_number="2.4.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67388"
FT                   /db_xref="GOA:C5BC97"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010058"
FT                   /db_xref="InterPro:IPR018016"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:C5BC97"
FT                   /protein_id="ACR67388.1"
FT                   /translation="MSKPEVFHLGLAKSDLHGATLAIVPGDPERVEKIAKLMENPVKLA
FT                   SHREFTSWRAELDGKAIIVCSTGIGGPSTSIAVEELAQLGVRTFLRVGTTGAIQPHISV
FT                   GDVLVTTASVRLDGASLHFAPMEFPAVADFACTTALVDAAHAVGAATHVGITASSDTFY
FT                   PGQERYDTFSGRVTRRFRGSMKEWQEMGVMNFEMESATLLTMCSSQGLRAGMVAGVIVN
FT                   RTQQEIPNAETMKQTESHAVKIVVDAARRLLQD"
FT   gene            135787..136917
FT                   /pseudo
FT                   /locus_tag="NT01EI_0134"
FT                   /note="carbon starvation protein A, genuine frameshifts"
FT   gene            136914..137063
FT                   /locus_tag="NT01EI_0137"
FT   CDS_pept        136914..137063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0137"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67392"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCA1"
FT                   /protein_id="ACR67392.1"
FT                   /translation="MKRGDELAAAPTATATACSRVVIRFPITTNGRFNGRWFFIGVTTG
FT                   KLDA"
FT   gene            137086..137613
FT                   /locus_tag="NT01EI_0138"
FT   CDS_pept        137086..137613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0138"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67393"
FT                   /db_xref="GOA:C5BCA2"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCA2"
FT                   /protein_id="ACR67393.1"
FT                   /translation="MLDSLIQGTIEFVRLHQDWAVPLVFFLAFGESLAFISLLLPATVI
FT                   LFALSALLGEGGVPFVPVWLAAACGAFLGDWISYWLGYHYQHQIGHIWPLSRNPQILQR
FT                   GHRYFERWGFWGVFFGRFLGPLRAAVPLVAGICAMRQRYFQLANLLSALIWGAGILAPG
FT                   MLGIRWLGQWIG"
FT   gene            137716..139125
FT                   /locus_tag="NT01EI_0139"
FT   CDS_pept        137716..139125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0139"
FT                   /product="RmuC domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67394"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCA3"
FT                   /protein_id="ACR67394.1"
FT                   /translation="MENVTLWILAASLAGMVIGWLAAALRTQQARVAHEQALGALDSQL
FT                   AAAQERIAQQQLWHEECERLNQELRAQRDVNSAQEAELREVTIRLEETRMGAEEKQRLL
FT                   LNAEQRLNVQFENLANRIFEHSGRRVEEQNRQSLDALLMPLREQLDGFRRQINDSFGQE
FT                   ARERHTLTHEIRSLQQMNAQMAREALNLTRALKGDNKMQGNWGEVVLSRVLESSGLREG
FT                   HEYHSQVSVQTEESGRMQPDVVVHLPQGKDVVVDAKMSLVAYERFFNAEDEHERELALQ
FT                   QHILSLRAHIRQLGRKDYQQLPGLRTLDYVLMFIPLEPAFLAAIERDSELISEALRHNI
FT                   MLVSPTTLLVALRTINNLWRYEYQSQNAQKIADRAAKLYDKVRLFVDDMSTLGQSLERA
FT                   QSSYRQAMNKLSHGRGNLIGQVESFRGLGVEVKRPISPALVQEACQPLQDGDPAVVSGE
FT                   VVAHHGTPSVQ"
FT   gene            139247..140002
FT                   /locus_tag="NT01EI_0140"
FT   CDS_pept        139247..140002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0140"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67395"
FT                   /db_xref="GOA:C5BCA4"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BCA4"
FT                   /protein_id="ACR67395.1"
FT                   /translation="MVDQTPETTHFGYKTVAAADKAGKVAQVFHSVAGKYDLMNDLMSF
FT                   GIHRLWKRFTIDCSGVRQGQRVLDLAGGTGDLAARFSRMVGEQGEVILADINDSMLKIG
FT                   REKLRNMGIVGNLNYVQANAEALPFPENYFDCITIAFGLRNVTDKDKALRSMFRVLKPG
FT                   GRLLVLEFSRPQFVALSKAYDAYSFHILPRIGEMVAHDGDSYRYLAESIRMHPDQETLK
FT                   GMMAAAGFENTTYDNLTGGIVALHRGYKF"
FT   gene            140018..140623
FT                   /locus_tag="NT01EI_0141"
FT   CDS_pept        140018..140623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0141"
FT                   /product="SCP-2 sterol transfer family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67396"
FT                   /db_xref="GOA:C5BCA5"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR038989"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCA5"
FT                   /protein_id="ACR67396.1"
FT                   /translation="MLTPLCTAMLETALNAALYRDRALQSGRQRLAGRVLQISLAELED
FT                   PFFLIFSQRQVDVLALWEGAIDCQVTMRLSVLPQLHQRRQLAALMQRGELRVDGDIQVV
FT                   QQLVALLDLAEWAPAELLAPYTGDIVAQGLCSAAQRGGRALLGSLRRQRHYVHDTLIEE
FT                   WRLAPGTLELAWFQEEIAALQRQASALEQRLARLEKCV"
FT   gene            140620..142251
FT                   /locus_tag="NT01EI_0142"
FT   CDS_pept        140620..142251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0142"
FT                   /product="2-polyprenylphenol 6-hydroxylase, putative"
FT                   /EC_number="1.14.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67397"
FT                   /db_xref="GOA:C5BCA6"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BCA6"
FT                   /protein_id="ACR67397.1"
FT                   /translation="MTPSELRRLCLIIRVFLAYGLDELIPLMRITLPLRIGRRCLFWMR
FT                   NRHGDKPLGERLRLALQTLGPVWIKFGQMLSTRRDLFAPAIADQLALLQDRVAPFDGAL
FT                   ARRQIEASLGGPLEQWFDDFDSQALASASIAQVHTATLRENGREVVLKVIRPDIQPIIR
FT                   ADVRLMYRLAGWVPKLLPDGRRLRPREVVREYEKTLLDELNLLREAANAIQLRRNFDAS
FT                   PMLYIPEVFSDYCRESVLVMERIYGVPVSDIAALRAQNTNMKLLAERGVQVFFTQVFRD
FT                   SFFHADMHPGNIFVSYEHPQDPQYIGIDCGIVGSLNKADKRYLAENFIAFFNRDYRKVA
FT                   ELHVDSGWVPPDTNIEEFEFAIRTVCEPIFEKPLDQISFGHVLLNLFNTARRFNMEVQP
FT                   QLVLLQKTLLYVEGLGRQLYPQLDLWTTAKPFLENWLHDQVGLPALMRALKAKAPYWSE
FT                   KLPELPELLYDSLQQQRRLQHSMDSMTHRLGQQGSRQGRARYLFGIGATLLLSGTILTM
FT                   VNIALWPIGLYVAGGVIWLAGWRYTR"
FT   gene            142364..142633
FT                   /locus_tag="NT01EI_0143"
FT   CDS_pept        142364..142633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0143"
FT                   /product="twin arginine-targeting protein translocase,
FT                   TatA/E family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67398"
FT                   /db_xref="GOA:C5BCA7"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCA7"
FT                   /protein_id="ACR67398.1"
FT                   /translation="MGGISIWQLLIIAVIVVLLFGTNKLRTLGSDLGASIKGFKKAIGD
FT                   DEKTPPSNTANSSAAPQDADFKSIVEQQPEVKKEESKSQNKEQV"
FT   gene            142637..143167
FT                   /locus_tag="NT01EI_0144"
FT   CDS_pept        142637..143167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0144"
FT                   /product="twin arginine-targeting protein translocase TatB,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67399"
FT                   /db_xref="GOA:C5BCA8"
FT                   /db_xref="InterPro:IPR018448"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCA8"
FT                   /protein_id="ACR67399.1"
FT                   /translation="MFDIGFSELLLVMVIGLVVLGPERLPVAVRTVAGWIRALRSLATS
FT                   VQNELSQELKLQELQDSLKKAETAGLQNLTPELKASMDELKQAAESMKRSYHSEITGSD
FT                   TEKEPSAAETIPHADMMTKPEADVALAPRQSAVQDAPPVVQAVPSTHADAMTASAQPAS
FT                   SPSTSHDSSQHGR"
FT   gene            143157..143945
FT                   /locus_tag="NT01EI_0145"
FT   CDS_pept        143157..143945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0145"
FT                   /product="twin arginine-targeting protein translocase TatC,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67400"
FT                   /db_xref="GOA:C5BCA9"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCA9"
FT                   /protein_id="ACR67400.1"
FT                   /translation="MAVEDTQPLISHLIELRKRLLNAIICILVVFLALVYFANDIYHLV
FT                   SAPLINQLPHGASMIATDVASPFFTPIKLTMIVSVFVSAPFILYQVWAFVAPALYKHER
FT                   RMLTPLLVSSTLLFYIGMAFAYFVVFPLAFGFFAKTAPAGVTIATDINNYLDFVMALFM
FT                   AFGVSFEVPVAIILLCWTGVTTPAELKKKRPYVIVGAFVVGMLLTPPDVFSQTLLAIPM
FT                   CLLFEVGVFFARFYVGKRRRDPEEEDEDEALHDEEQPKAG"
FT   gene            144110..144892
FT                   /locus_tag="NT01EI_0146"
FT   CDS_pept        144110..144892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0146"
FT                   /product="hydrolase, TatD family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67401"
FT                   /db_xref="GOA:C5BCB0"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR024918"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCB0"
FT                   /protein_id="ACR67401.1"
FT                   /translation="MLDIGVNLTNSQFAGDVPQVIARARQAGLNGMIITGTNLTESAQA
FT                   LCLAQAYPDFCWATAGVHPHDAHRWNENSTAALEPLLHSPTVVAVGECGLDFARNFSTP
FT                   AQQEAAFEAQLTLAARIGKPVFLHCREAHARFIALLRPWLSSLPGAVLHCFTGTRDELD
FT                   ACLSLGLYIGITGWICDERRGMPQRALLPHIPAERLLLETDAPYLLPRNIQPKPKSRRN
FT                   EPCFLPHIAEQVARWRQQDASWLRQVTENNARQLFRLA"
FT   gene            144909..145931
FT                   /locus_tag="NT01EI_0147"
FT   CDS_pept        144909..145931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0147"
FT                   /product="delta-aminolevulinic acid dehydratase, putative"
FT                   /EC_number="4.2.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67402"
FT                   /db_xref="GOA:C5BCB1"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCB1"
FT                   /protein_id="ACR67402.1"
FT                   /translation="MSYAFPGAFPGRRLRRLRRHDFSRRLCAENVLTVDDLIYPVFVME
FT                   GNNHQEAVSSMPGVQRMTIDVLVREAEAIAKLGVPVLSLFPVVGTDKKSLYAEEAYSSD
FT                   GLVQRAVRALKDAVPELGILTDVALDPYTTHGQDGVIDEDGYVVNDITKEILVRQALSH
FT                   AEAGADIVAPSDMMDGRIGAIRSMLEDQKLVNTQIMAYSAKYASCYYGPFRDALGSSGN
FT                   LKGGNKKTYQMDPANGDEALQEVAQDLQEGADMVMVKPGMPYLDVLRRVKDTFGVPTFA
FT                   YQVSGEYAMHMAAIQNGWLQEKPAIMESLICFKRAGADGVLTYFAKRVAQWLHDAEMNR
FT                   "
FT   gene            complement(146002..146493)
FT                   /locus_tag="NT01EI_0148"
FT   CDS_pept        complement(146002..146493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0148"
FT                   /product="transcriptional activator RfaH, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67403"
FT                   /db_xref="GOA:C5BCB2"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR010215"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCB2"
FT                   /protein_id="ACR67403.1"
FT                   /translation="MESWYLLYCKRGQLTRAREHLTRQEIPCVIPMITLEKVVRGKRTQ
FT                   VQEPMFPNYMFIELDPERIHTTTVQSTRGVSHFIRFGKLPAIVPFSIVKPLMMTPALTA
FT                   IAPQTPIPGDRVRITQGAFNGIEAIYRESDGEKRAILLLSLLNQEVSHTLSNSAFEKIL
FT                   "
FT   gene            146743..147468
FT                   /locus_tag="NT01EI_0149"
FT   CDS_pept        146743..147468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0149"
FT                   /product="peptidase E, putative"
FT                   /EC_number="3.4.13.21"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67404"
FT                   /db_xref="GOA:C5BCB3"
FT                   /db_xref="InterPro:IPR005320"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCB3"
FT                   /protein_id="ACR67404.1"
FT                   /translation="MELFLLSNGKVSGESELLGYAKGMIQSMLLEKKIRRALLIPYALI
FT                   RSSYDARAAELEHSLGITVESIHHHADPVKALEEAECILISGGNTWVLNQMLHENGLIV
FT                   PIQRAVRERGIPYIGWSAGCNVATPSIRTTNDMPVRNSVVLPSLGLFPVQINPHYIDAH
FT                   LSGHMGETRDERIAEFCAVNPSESVIALREGSLLHVSGETLQYYSAKAQGYKVFRHGEE
FT                   TREYHDTQALAALVPFHCR"
FT   gene            147587..149074
FT                   /locus_tag="NT01EI_0150"
FT   CDS_pept        147587..149074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0150"
FT                   /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67405"
FT                   /db_xref="GOA:C5BCB4"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR023677"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BCB4"
FT                   /protein_id="ACR67405.1"
FT                   /translation="MKYRDLREFIALLEQRGELKRIQQSIDPYLEMTEIADRTLRVGGP
FT                   ALLFENPKGYDIPVLCNLFGTPQRVALGMGQEEVGALRDVGKLLAFLKEPDPPKGFRDL
FT                   VEKLPQFKQILNMPTKRLSKAPCQEQVLQGDDVDLATLPVMHCWPQDVAPLVSWGLTVT
FT                   RGPCKSRQNLGIYRQQVLGKNKLIMRWLSHRGGALDFQDWCQAHPGERFPVAVALGADP
FT                   ATLLAAVTPVPDSLSEYAFAGLLRGHKSEVVKCLSCDLEVPASAEIVLEGYIEPGETAP
FT                   EGPYGDHTGYYNEVERFPVFTVTHLTQRDRPIYHSTYTGRPPDEPAVLGLALNEVFVPL
FT                   LQKQFPEIVDFYLPPEGCSYRMAVVTMKKQYPGHAKRVMMGVWSFLRQFMYTKFVIVCD
FT                   DDINARDWQDVIWALTTRMDPARDTLLIENTPIDYLDFASPVSGLGSKMGLDATNKWPG
FT                   ETQREWGHPIVMDEAVRARVDTLWNELDIFANDKDAQ"
FT   gene            149113..149814
FT                   /locus_tag="NT01EI_0151"
FT   CDS_pept        149113..149814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0151"
FT                   /product="oxidoreductase, FAD/NAD(P)-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67406"
FT                   /db_xref="GOA:C5BCB5"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCB5"
FT                   /protein_id="ACR67406.1"
FT                   /translation="MTTLSCKVTSVDAITDTVYRVRLVPERAVDFRAGQYLMVVMDERD
FT                   KRPFSMASTPLQSDCIELHIGASELNLYAMAVMDRILQDRTLCVDMPHGDAWLREDSLR
FT                   PLVLIAGGTGFSYTRSILLMALSQQPQREISLYWGGRELKHLYDLNELYALSARYPQLK
FT                   IIPTVEQPDADWQGRSGTVISAVMQDFGSLAQHDIYIAGRFEMAKIARERFCAEREANP
FT                   EHIYGDAFAFI"
FT   gene            149957..151288
FT                   /locus_tag="NT01EI_0152"
FT   CDS_pept        149957..151288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0152"
FT                   /product="peptidase, M24 family"
FT                   /EC_number="3.4.13.9"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67407"
FT                   /db_xref="GOA:C5BCB6"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR022846"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BCB6"
FT                   /protein_id="ACR67407.1"
FT                   /translation="MDTLASLYTKHLATLQQRARTILERHQLDGLLIHSGEPIARFLDD
FT                   QDYPFKINPYFKAWVPVTQVPNCWLWIDGVNKPKLWFYSPLDYWHSVSPLPQAFWTEQV
FT                   EMTAQRHADDIAALLPAARGNVAYIGPNAERARSLGIDEAHQNPQAVLNFLHYHRAYKS
FT                   EYEQACMREAQKIAVDGHQAALEAFRAGMSEFDINLAYLSATGQGENDVPYDNIIALNR
FT                   HAAVLHYTHLERRAPSEMHSFLIDAGAEFHGYAADLTRTYAANGQSDFAALVAEVNQAQ
FT                   QALIATLQTGVRYTDYNLQFHQRLAAILRHHHILTGISDEAAVAQGLTTPFLPHGLGHP
FT                   LGLQVHDVAGFMQDELGTQMAAPDRYPYLRCTRIMEPGMVMTIEPGLYFIDTLLAPWLE
FT                   GEFGQHFNRGRIDALRPYGGIRIEDNVIFHAHGVENMTRDLHLA"
FT   gene            151288..151902
FT                   /locus_tag="NT01EI_0153"
FT   CDS_pept        151288..151902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0153"
FT                   /product="conserved hypothetical protein TIGR00257"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67408"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR015796"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCB7"
FT                   /protein_id="ACR67408.1"
FT                   /translation="MPHPYPVPAQPVSVCEEIKKSRFITLLAHTPGVDAAKAFVQETRR
FT                   AHPDARHHCWAFVAGAPEDTQRLGFSDDGEPSGTAGKPMLAQLMGSGVGEVCAVVVRYY
FT                   GGIKLGTGGLVRAYGSGVQQALQALVRRQKVPMAAYTLCCDYAQLTLVEGIVAQAGGSV
FT                   LDSAFSAQVMLRLSLPLGRQDDVDEKLRNASRGTLQLQATS"
FT   gene            151955..153406
FT                   /locus_tag="NT01EI_0154"
FT   CDS_pept        151955..153406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0154"
FT                   /product="potassium uptake protein, TrkH family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67409"
FT                   /db_xref="GOA:C5BCB8"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCB8"
FT                   /protein_id="ACR67409.1"
FT                   /translation="MHFRAIIRIVGLLVILFSGTMFVPGLVALIYRDGAGRAFVETFFV
FT                   ALGIGMLLWWPQRKQKHELKPREGFLIVVLFWTVLGSVGALPFLFSERPNLSVTDAFFE
FT                   SFSGLTTTGATTLVGLDALPKAILFYRQMLQWLGGMGIIVLAVAILPILGVGGLQLYRA
FT                   EMPGPLKDNKMRPRIAETAKTLWLIYVMLTIACAIALWGAGMDVFDAISHSFSTIAIGG
FT                   FSTHDASIGYFNSPTINTIIAVFLLISGCNFSLHFAFLSGRSPRVYWRDPEFRMFIAVQ
FT                   LTLVSVCTLVLWLHNVYASGWQTFNQAFFQVVSMATTAGFTTDSIAKWPLFLPVLLLCS
FT                   AFIGGCAGSTGGGLKVIRILLLFLQGSRELKRLVHPNAVYTIKLGNRALPERILEAVWG
FT                   FFSAYALVFIISMLAIIATGVDDFSAFAAVVATLNNLGPGLGVVADNFTSMNDVAKWIL
FT                   VVTMLFGRLEVFTLLVLFTPTFWRN"
FT   gene            153424..153972
FT                   /locus_tag="NT01EI_0155"
FT   CDS_pept        153424..153972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0155"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67410"
FT                   /db_xref="GOA:C5BCB9"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR026816"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCB9"
FT                   /protein_id="ACR67410.1"
FT                   /translation="MKTLVLYSSHDGQTKAIATAIATAISETLDCELRDLEQAGDIDLN
FT                   AYQAVAIGAAVRYGHFPRALHRFASDHTPRLNTMPSAFFAINLTARKPEKRTPQTNGYT
FT                   RKFLLSTPWKPAQCVVFAGALRYPRYSWLDRTMIKMIMKMTGGETDTTKEVEYTDWQQV
FT                   DRFARDFARFVSTLAKKTP"
FT   gene            154357..155888
FT                   /locus_tag="NT01EI_R00010"
FT   rRNA            154357..155888
FT                   /locus_tag="NT01EI_R00010"
FT                   /product="16S ribosomal RNA"
FT   gene            155976..156053
FT                   /locus_tag="NT01EI_T0005"
FT   tRNA            155976..156053
FT                   /locus_tag="NT01EI_T0005"
FT                   /product="tRNA-Glu"
FT                   /note="putative tRNA-Glu"
FT   gene            156246..159235
FT                   /locus_tag="NT01EI_R00018"
FT   rRNA            156246..159235
FT                   /locus_tag="NT01EI_R00018"
FT                   /product="23S ribosomal RNA"
FT   gene            159327..159441
FT                   /locus_tag="NT01EI_R0003"
FT   rRNA            159327..159441
FT                   /locus_tag="NT01EI_R0003"
FT                   /product="5S ribosomal RNA"
FT   gene            159664..160701
FT                   /locus_tag="NT01EI_0160"
FT   CDS_pept        159664..160701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0160"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase,
FT                   putative"
FT                   /EC_number="1.3.1.98"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67412"
FT                   /db_xref="GOA:C5BCC1"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCC1"
FT                   /protein_id="ACR67412.1"
FT                   /translation="MSKHLTSLTEFTTFGLPARAEQILTADSAAVLLSHWQAAKARRQP
FT                   VLILGGGSNVLFMEDFAGSVILNRIPGIQVDEDEVSWHLHVGAGENWHDLVCYTLDHGM
FT                   AGLENLALIPGCVGSAPIQNIGAYGVELQHVCDYVDALDLRNGTLQRLPATACGFGYRE
FT                   SIFKHRYRDGYAIVAVGLRLSKRWQPMLSYGDLTCLDAETATPRAVFDSVCHMRRTKLP
FT                   DPAQHGNAGSFFKNPVVSAEAAEAIRAHYPQAPCYPQDNGEMKLAAGWLIDRCELKGYQ
FT                   IGGAAVHRQQALVLINQHHASAQNVIALARYVRRRVGEVFSVWLEPEVRFIAAQGEVNA
FT                   VEVLS"
FT   gene            160698..161657
FT                   /locus_tag="NT01EI_0161"
FT   CDS_pept        160698..161657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0161"
FT                   /product="bifunctional protein BirA , putative"
FT                   /EC_number="6.3.4.15"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67413"
FT                   /db_xref="GOA:C5BCC2"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR004409"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR030855"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCC2"
FT                   /protein_id="ACR67413.1"
FT                   /translation="MKDITVPLKLISQLADGDFHSGEHLGESLGMSRAGINKHIQTLRD
FT                   WGIDVFTVPGKGYCLPTPMQLLNTETIGALLPQGRVTVLPVVDSTNQYLLERIGELASG
FT                   DACVAEYQQAGRGRRGRHWFSPFGANLYLSMYWRLEQGPAAAMGLSLVIGIVMAEVLQA
FT                   LGAAGVKVKWPNDLYLNDRKLAGILVELTGKTGDAANIVVGAGINLMMRNPDTSVVDQQ
FT                   WINLQEAGVNIDRNQLVACLLSRLRSTLADFEVRGLSPFISRWRVLDNFVDRPVRLIIG
FT                   EQVIHGIARGIDAQGALLLERDGVITPFIGGEISLRAG"
FT   gene            complement(161732..162679)
FT                   /locus_tag="NT01EI_0162"
FT   CDS_pept        complement(161732..162679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0162"
FT                   /product="pantothenate kinase, putative"
FT                   /EC_number="2.7.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67414"
FT                   /db_xref="GOA:C5BCC3"
FT                   /db_xref="InterPro:IPR004566"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCC3"
FT                   /protein_id="ACR67414.1"
FT                   /translation="MKKEQSLATPYLQFDRHQWAALRNSVPLTLTEEEIARLKGINEDL
FT                   SLDEVAQIYLPLSRLLNFYFSSSVSRQVVLEKFLGTHSPRIPYIIGIAGSVAVGKSTTA
FT                   RVLQALLSRWPEHRRVELITTDGFLHPNKILQERGLMKKKGFPQSYDMHHLVKFVSDIK
FT                   SGVSQVTAPQYSHLIYDVLPDSRKLIEQPDILILEGLNVLQSGMDYPHDPHRVFVSDFV
FT                   DFSIYVDADEHQLQAWYINRFLKFREGAFSNPDSYFHHYSQLPESEAIAIATGLWNEIN
FT                   GLNLRQNILPTRERASLIMTKGSNHAIESVRLRK"
FT   gene            163109..163186
FT                   /locus_tag="NT01EI_T0006"
FT   tRNA            163109..163186
FT                   /locus_tag="NT01EI_T0006"
FT                   /product="tRNA-Thr"
FT                   /note="putative tRNA-Thr"
FT   gene            163206..163292
FT                   /locus_tag="NT01EI_T0007"
FT   tRNA            163206..163292
FT                   /locus_tag="NT01EI_T0007"
FT                   /product="tRNA-Tyr"
FT                   /note="putative tRNA-Tyr"
FT   gene            163416..163490
FT                   /locus_tag="NT01EI_T0008"
FT   tRNA            163416..163490
FT                   /locus_tag="NT01EI_T0008"
FT                   /product="tRNA-Gly"
FT                   /note="putative tRNA-Gly"
FT   gene            163497..163574
FT                   /locus_tag="NT01EI_T0009"
FT   tRNA            163497..163574
FT                   /locus_tag="NT01EI_T0009"
FT                   /product="tRNA-Thr"
FT                   /note="putative tRNA-Thr"
FT   gene            163701..164885
FT                   /locus_tag="NT01EI_0167"
FT   CDS_pept        163701..164885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0167"
FT                   /product="translation elongation factor Tu, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67415"
FT                   /db_xref="GOA:C5BGM7"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:C5BGM7"
FT                   /protein_id="ACR67415.1"
FT                   /translation="MSKEKFERSKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGSAR
FT                   AFDQIDNAPEEKARGITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVAATDGPMPQTREHILLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDF
FT                   PGDDTPVIRGSALKALEGEAEWEAKIIELAETLDSYIPEPERDIDKPFLLPIEDVFSIS
FT                   GRGTVVTGRVERGIIKVGDEVEIVGIKATTKTTCTGVEMFRKLLDEGRAGENVGVLLRG
FT                   TKRDEIERGQVLAKPGSITPHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTG
FT                   TIELPEGVEMVMPGDNIKMVVTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVIE"
FT   gene            165181..165564
FT                   /locus_tag="NT01EI_0168"
FT   CDS_pept        165181..165564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0168"
FT                   /product="preprotein translocase, SecE subunit , putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67416"
FT                   /db_xref="GOA:C5BHD8"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHD8"
FT                   /protein_id="ACR67416.2"
FT                   /translation="MSANTDAQGSGRGLEVMKWLVVAVLLIVAIVGNYIYRDVSLPLRA
FT                   LAVVVIIAAAGGIALMTTQGKATVAFAREARTEMRKVIWPTRQEALHTTLIVAAVTAVM
FT                   ALILWGLDGVLVRLVSFITGLRF"
FT   gene            165567..166112
FT                   /locus_tag="NT01EI_0169"
FT   CDS_pept        165567..166112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0169"
FT                   /product="transcription termination/antitermination factor
FT                   NusG, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67417"
FT                   /db_xref="GOA:C5BHD9"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHD9"
FT                   /protein_id="ACR67417.1"
FT                   /translation="MSEAPKKRWYVVQAFSGFEGRVAQSLREHIKLHNMEELFGEVMVP
FT                   TEEVVEIRGGQRRKSERKFFPGYVLVQMVMNDASWHLVRSVPRVMGFIGGTSDRPAPIS
FT                   DKEVDAIMNRLQQIGDKPRPKTLFEPGEMVRVNEGPFADFNGVVEEVDYEKSRLKVSVS
FT                   IFGRATPVELDFSQVEKA"
FT   gene            166276..166704
FT                   /locus_tag="NT01EI_0170"
FT   CDS_pept        166276..166704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0170"
FT                   /product="50S ribosomal protein L11, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67418"
FT                   /db_xref="GOA:C5BHE0"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BHE0"
FT                   /protein_id="ACR67418.1"
FT                   /translation="MAKKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAK
FT                   TDSIEKGLPIPVVITVYSDRSFTFVTKTPPAAVLLKKAAGVKSGSGKPNKDKVGKVTRA
FT                   QVREIAETKAADMTGADVEAMARSIEGTARSMGLVVED"
FT   gene            166708..167412
FT                   /locus_tag="NT01EI_0171"
FT   CDS_pept        166708..167412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0171"
FT                   /product="50S ribosomal protein L1, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67419"
FT                   /db_xref="GOA:C5BHE1"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BHE1"
FT                   /protein_id="ACR67419.1"
FT                   /translation="MAKLTKRMRVIREKVDATKQYDINEAVALLQELATAKFVESVDVA
FT                   VNLGIDARKSDQNVRGATVLPHGTGRTVRVAVFTQGPNAEAAKAAGADLVGMEDLADQI
FT                   KKGEMNFDVVIASPDAMRVVGQLGQILGPRGLMPNPKVGTVTPNVAEAVKNAKAGQVRY
FT                   RNDKNGIIHSTIGKASFSAEQLKENLEALMVALKKAKPATAKGVYIKKVCLSTTMGAGV
FT                   TIDQATLSAVAN"
FT   gene            167729..168226
FT                   /locus_tag="NT01EI_0172"
FT   CDS_pept        167729..168226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0172"
FT                   /product="ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67420"
FT                   /db_xref="GOA:C5BHE2"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BHE2"
FT                   /protein_id="ACR67420.1"
FT                   /translation="MALNLQDKQAIVAEVTEVAKGALSAVVADSRGVTVDKMTELRKAG
FT                   REAGVYMRVVRNTLMRRVVEGSQFECLKDTFVGPTLIAFSMEHPGAAARLFKAFAKDNA
FT                   KFEVKAAAFEGELIPAAQIDRLATLPTYEEAIARLMATMKEAAAGKLVRTLAALRDQKE
FT                   AA"
FT   gene            168993..173021
FT                   /locus_tag="NT01EI_0174"
FT   CDS_pept        168993..173021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0174"
FT                   /product="DNA-directed RNA polymerase, beta subunit,
FT                   putative"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67421"
FT                   /db_xref="GOA:C5BHE3"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BHE3"
FT                   /protein_id="ACR67421.1"
FT                   /translation="MVYSYTEKKRIRKDFGKRPQVLDVPYLLSIQLDSFQKFIEQDPEG
FT                   QYGLEAAFRSVFPIQSYSGNSELQYVSYRLGEPVFDVKECQIRGVTYSAPLRVKLRLVI
FT                   YEREAPEGTVKDIKEQEVYMGEIPLMTENGTFVINGTERVIVSQLHRSPGVFFDSDKGK
FT                   THSSGKVLYNARIIPYRGSWLDFEFDPKDNLFVRIDRRRKLPATIILRALDFTTEQILD
FT                   LFFDKVIFEIRDNKLQMELVPERLRGETASFDIEANGKVYVEKGRRITARHIRQLEKDD
FT                   VTLIEVPVEYIVGKVAAKDYIDESTGELICAANMELSLDLLAKLSQSGYKRIDTLFTND
FT                   LDHGPYMSETLRVDPTNDRLSALVEIYRMMRPGEPPTREAAENLFENLFFSEDRYDLSA
FT                   VGRMKFNRSLMRDEIEGSGILSKNDIIEVMKKLIDIRNGKGEVDDIDHLGNRRIRSVGE
FT                   MAENQFRVGLVRVERAVKERLSLGDLDMLMPQDMINAKPISAAVKEFFGSSQLSQFMDQ
FT                   NNPLSEITHKRRISALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLINSLS
FT                   VYAQTNEYGFLETPYRRVRDGIVTDEIHYLSAIEEGNFVIAQANSNLDDEGRFVEDLVT
FT                   CRSKGESSLFSRDQVDYMDVSTQQVVSVGASLIPFLEHDDANRALMGANMQRQAVPTLR
FT                   ADKPLVGTGMERAVAVDSGVTSVAKRGGMVQYVDASRIVIKVNEDEMFPGEAGIDIYNL
FT                   TKYTRSNQNTCISQMPCVSLGEPIERGDVLADGPSTDLGELALGQNMRVAFMPWNGYNF
FT                   EDSILVSERVVQEDRFTSIHIQELACVSRDTKLGPEEITADIPNVGEAALSKLDESGIV
FT                   YIGAEVKGGDILVGKVTPKGETQLTPEEKLLRAIFGEKASDVKDSSLRVPNSVSGTVID
FT                   VQVFTRDGVEKDKRALEIEEMQLKQAKKDLTEELQILEAGLFARIHDVLVAGGVEAEKL
FT                   EKLPRDRWLELGLADEAKQNQLEQLAEQYDELKAEFEKKLEAKRRKITQGDDLAPGVLK
FT                   IVKVYLAVKRQIQPGDKMAGRHGNKGVISKINPIEDMPYDENGTPVDIVLNPLGVPSRM
FT                   NIGQILETHLGMAAKGIGDKINAMLKQQQEVAKLREFIQRAYDLGDNTRQQVDLNTFSD
FT                   DEVLRLAENLKKGLPVATPVFDGAKEREIKGLLELGGIPTSGQITLYDGRTGERFERQV
FT                   TVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAA
FT                   YTLQEMLTVKSDDVNGRTKMYKNIVDGSHQMEPGMPESFNVLLKEIRSLGINIELEDE"
FT   gene            173101..177321
FT                   /locus_tag="NT01EI_0175"
FT   CDS_pept        173101..177321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0175"
FT                   /product="DNA-directed RNA polymerase, beta' subunit,
FT                   putative"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67422"
FT                   /db_xref="GOA:C5BHE4"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHE4"
FT                   /protein_id="ACR67422.1"
FT                   /translation="MKDLLKFLKAQTKTEEFDAIKIALASPDMIRSWSFGEVKKPETIN
FT                   YRTFKPERDGLFCARIFGPVKDYECLCGKYKRLKHRGVICEKCGVEVTQTKVRRERMGH
FT                   IELASPTAHIWFLKSLPSRIGLLLDMPLRDIERVLYFESYVVVEGGMTNLERRQILTEE
FT                   QYLDALEEFGDEFDAKMGAEAIQALLKGMDLEAECEQLREELGETNSETKRKKLTKRIK
FT                   LLEAFILSGNKPEWMILTVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKR
FT                   LLDLAAPDIIVRNEKRMLQEAVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQ
FT                   NLLGKRVDYSGRSVITVGPYLRLHQCGLPKKMALELFKPFIYGKLELRGLATTIKAAKK
FT                   MVEREEAVVWDILDEVIREHPVMLNRAPTLHRLGIQAFEPLLIEGKAIQLHPLVCAAYN
FT                   ADFDGDQMAVHVPLTLEAQLEARALMMSTNNILSPANGDPIIVPSQDVVLGLYYMTRDC
FT                   VNAKGEGMVLSGPKEAERIYRAGLASLHARVKVRITQYSKSADGEMVPNTGLIDTTVGR
FT                   AILWMIVPKGLPYSIVNQPLGKKAISKMLNACYRALGLKPTVIFADQIMYTGFAYAARS
FT                   GASVGIDDMVIPEKKAGIIAEAEAEVAEIQEQFQSGLVTAGERYNKVIDIWAAANERVA
FT                   KAMMENLSSETVINRDGEEERQVSFNSIFMMADSGARGSAAQIRQLAGMRGLMAKPDGS
FT                   IIETPITANFREGLNVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVAQDLVVIED
FT                   DCGTHNGIVMTPVIEGGDVKEPLRDRVLGRVTAEEVLKPGTADILVPRNTLLNEKWCDL
FT                   LEEHSVDSVKVRSVVSCETDFGVCAHCYGRDLARGHLVNKGEAIGVIAAQSIGEPGTQL
FT                   TMRTFHIGGAASRAAAESSIQVKNKGNLKLSNAKFVVNSDGKLVITSRNTELKLIDEFG
FT                   RTKESYKVPYGATLAKGDSAEVNGGETVANWDPHTMPVITEVSGFIRFADMIDGQTVTR
FT                   QTDELTGLSSQVVLDSAERTGSGKDLRPALKIVDANGDDVLLPGTDMPAQYFLPGKAIV
FT                   QLEDGIAISAGDTLARIPQESGGTKDITGGLPRVADLFEARRPKEPAILAEISGVVSFG
FT                   KETKGKRRLVITPLDGSDTYEEMIPKWRQLNVFEGERVERGDVISDGPESPHDILRLRG
FT                   VNAVTRYIVNEVQDVYRLQGVKINDKHIEVIVRQMLRKATIANAGSSEFLEGEQVEVSR
FT                   VKIANRLLESDGKIAATYMRDLLGITKASLATESFISAASFQETTRVLTEAAVAGKRDE
FT                   LRGLKENVIVGRLIPAGTGYAYHQDRMRRRSTDTSSAPQVSAEEASANLAELLNAGLLG
FT                   GNDE"
FT   gene            complement(177429..178073)
FT                   /locus_tag="NT01EI_0176"
FT   CDS_pept        complement(177429..178073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0176"
FT                   /product="thiamine-phosphate pyrophosphorylase, putative"
FT                   /EC_number="2.5.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67423"
FT                   /db_xref="GOA:C5BHE5"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHE5"
FT                   /protein_id="ACR67423.1"
FT                   /translation="MAQPVFAPVPMRLGLYPIVDSVEWIERLLRAGVRTLQLRIKDCRE
FT                   DQIGDEIAQAIALGRHYQARLFINDYWRPAIRLGAYGVHLGQEDLDQADLAAIRRAGLR
FT                   LGLSTHDDAEMDRALAEGPSYVALGHVFPTDSKLMDTAPQGLSDLRRQMTRLDTYPSVA
FT                   IGGISIARVPDVLACGVGSIALVSAITRAPDWLAATDTLLQLIEGRRANDV"
FT   gene            complement(178073..180004)
FT                   /locus_tag="NT01EI_0177"
FT   CDS_pept        complement(178073..180004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0177"
FT                   /product="thiamine biosynthesis protein ThiC, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67424"
FT                   /db_xref="GOA:C5BHE6"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR025747"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHE6"
FT                   /protein_id="ACR67424.1"
FT                   /translation="MSTLTHSDAPRRQRRAQAQAFIDNLQAQAFPSSQRIYLQGSRADI
FT                   RVPLREITLSPTLIGGTPEQPQWRDNEAIAVYDTSGAYGDQQAEIDLRRGLPGIRCAWI
FT                   AERNDSEILPGRSSDYTRRRQADQDLETLRFELRSPARRARPGHRVTQLHYARQGIITP
FT                   EMEFIALRENMGRERIRSAILRQQHPGIAFGAHLPDNITPAFVRDEVAAGRAIIPANIN
FT                   HPESEPMIIGRNFLVKVNANIGSSSVTSSIEEEVEKLVWATRWGADTVMDLSTGRYIHE
FT                   TREWILRNSPVPIGTVPIYQALEKVNGIAENLDWPLVRDTLLEQAEQGVDYFTLHAGLL
FT                   LRFIPMTAERLTGIVSRGGAIMAKWCLSHHQENFLYTHFREICEICSAYDIALSLGDGL
FT                   RPGSIQDANDQAQFAELHTLGELTQIAWEYDVQVMIEGPGHVPMHMIQRNMEEELNHCH
FT                   EAPFYTLGPLTTDIAPGYDHFTSGIGAAMIGWFGCALLCYVTPKEHLGLPDKDDVKQGL
FT                   ITYKIAAHAADLAKGHPGAQIRDNAMSKARFEFRWEDQFNLALDPVTARAYHDATLPQA
FT                   SGKLAHFCSMCGPKFCSMKISREVREHAARQQEAEPGMAQMAQQFREQGGDIYLTNIAD
FT                   NAPLHKEP"
FT   gene            180398..181171
FT                   /locus_tag="NT01EI_0179"
FT   CDS_pept        180398..181171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0179"
FT                   /product="NADH pyrophosphatase, putative"
FT                   /EC_number="3.6.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67425"
FT                   /db_xref="GOA:C5BHE7"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015376"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR022925"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BHE7"
FT                   /protein_id="ACR67425.1"
FT                   /translation="MAQQLSESDSGWWVVSDRGRIWLPEGELPYGSAAQWHLVGKMAYR
FT                   IGEWQGMPVWLLCLTYPQDMASVRQLIDADRGLFQLAGRGVQLAEFFQSHRFCGYCGHP
FT                   MHAGQQEWVRLCAHCQQRYYPQIAPCIIVAIRRDDHILLARHNRHRNGIYTVLAGFVEV
FT                   GETLEQAAAREIFEESRLQVKNLRYVTSQPWPFPHSLMMAFLADYAAGDLCHDPKELQE
FT                   ADWYRYDRLPQLPPVGTVARRLIEDTVALCRVQHE"
FT   gene            181219..182283
FT                   /locus_tag="NT01EI_0180"
FT   CDS_pept        181219..182283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0180"
FT                   /product="uroporphyrinogen decarboxylase, putative"
FT                   /EC_number="4.1.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67426"
FT                   /db_xref="GOA:C5BHE8"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BHE8"
FT                   /protein_id="ACR67426.1"
FT                   /translation="MTELKNDRYLRALLRQPVDVTPVWMMRQAGRYLPEYNATRAQAGN
FT                   FIALCKNAELACEVTLQPLRRFPLDAAILFSDILTVPDAMGLGLYFETGEGPRFTHSVT
FT                   CHADIQRLPIPDPEQELGYVMDAVRTIRRSLRGDVPLIGFSGSPWTLATYMVEGGSSKA
FT                   FTKIKKVMFSDPAALHLLLDKLAQSVILYLNAQIRAGAQAVMIFDTWGGVLTGRDYREF
FT                   SLRYMHQIVDGLQRESEGRRVPVTLFTKGGGQWLEAMADTGCDALGLDWTCDIADARRR
FT                   VGGRVALQGNMDPSLLYAPPARIEQEVETILAGFGQGEGHICNLGHGIHPDVPPKHAGV
FT                   FVDAVHRLSVPYHR"
FT   gene            182299..182985
FT                   /locus_tag="NT01EI_0181"
FT   CDS_pept        182299..182985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0181"
FT                   /product="endonuclease V"
FT                   /EC_number="3.1.21.7"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67427"
FT                   /db_xref="GOA:C5BHE9"
FT                   /db_xref="InterPro:IPR007581"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHE9"
FT                   /protein_id="ACR67427.1"
FT                   /translation="MDLPALRSEQRARAVQVEQVDRWETPAFIAGADVGFEQDGLVTRA
FT                   ALAVLRYPELTLVEYQVARIETQMPYIPGFLSFREYPALLQAWGLLQHRPQLVMVDGHG
FT                   IAHPRRLGIASHFGLLADVPTIGIAKRRLCGQSAPLDETPGSAVALMDGTEQLGWVLRS
FT                   KARCHPLFISGGHRVSTDSALTWVQRCLRGYRLPEPTRWADAIASRRPAFLRWQAAQPR
FT                   SAIALE"
FT   gene            183091..183681
FT                   /locus_tag="NT01EI_0182"
FT   CDS_pept        183091..183681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0182"
FT                   /product="hypothetical protein"
FT                   /note="Protein of unknown function, DUF"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67428"
FT                   /db_xref="InterPro:IPR007338"
FT                   /db_xref="InterPro:IPR023381"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHF0"
FT                   /protein_id="ACR67428.1"
FT                   /translation="MLRNPIHKRLEKLESWQQLTFMACLTERMYPNYQAFCQQSAFGEA
FT                   AVYRRILDLVWELLTVKDVKINFDSQLEKLEAAIPDADTYDMYGVYPAIDACVALSEIL
FT                   HAQLGGEMLAHAIAVSETSLHTVGMLEMTQSGWEMSDDELKTLPAIQDELDIQWEIYRL
FT                   LSEAEERDLELIKGLRADLREAGVSNIGIELAQ"
FT   gene            183871..184143
FT                   /locus_tag="NT01EI_0183"
FT   CDS_pept        183871..184143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0183"
FT                   /product="DNA-binding protein HU-alpha, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67429"
FT                   /db_xref="GOA:C5BHF1"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHF1"
FT                   /protein_id="ACR67429.1"
FT                   /translation="MNKTQLIDVIADKADLSKAQAKAALESTLAAITESLKAGDAVQLV
FT                   GFGTFKVNHRNERTGRNPQTGKEIKIAAANVPAFVSGKALKDAVK"
FT   gene            184187..184861
FT                   /locus_tag="NT01EI_0184"
FT   CDS_pept        184187..184861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0184"
FT                   /product="Protein of unknown function (DUF1481)"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67430"
FT                   /db_xref="InterPro:IPR010858"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHF2"
FT                   /protein_id="ACR67430.2"
FT                   /translation="MTPLLSMCHRVRGLLPVALLLTGCHSAVPVAPFTATGYIADGGIV
FT                   RLWRLEGAGHQPQAMMRVFTPLDGTETQIDRYTYRAGYLYQILQQTGQGNDDVLQLRFD
FT                   MQGALSYMQRLRNGSKEMPGSDEVAKAQYQARHAQEMAATLVAGGVNLIQGRWQGGIFT
FT                   RCDGQVSPLPLSGWQAAQLARREANSRGPLWVAWLSAPEGAQLLQVANHNICAWAPTEK
FT                   TV"
FT   gene            complement(184896..186173)
FT                   /locus_tag="NT01EI_0185"
FT   CDS_pept        complement(184896..186173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0185"
FT                   /product="phosphoribosylamine-glycine ligase, putative"
FT                   /EC_number="6.3.4.13"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67431"
FT                   /db_xref="GOA:C5BHF3"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHF3"
FT                   /protein_id="ACR67431.1"
FT                   /translation="MNILIIGSGGREHALAWKAAQSPLAERVFVAPGNAGTAQEPALEN
FT                   INIPATDIDALVAFALHHQVGLTIVGPEAPLVLGVVDAFRAAGLTIFGPSQSAARLEGS
FT                   KAFSKDFLVRQRIPTAAYRNFTEIEPALAYVREQGVPIVIKADGLAAGKGVIVAMTLEE
FT                   AEAAVHDMLAGNAFGDAGHRIVVEAFLEGEEASFIVMVDGEHVLPMATSQDHKRVGDGD
FT                   SGPNTGGMGAYSPAPVVSDAVHQRVMEQVIWPTVRGMAQEGAPYTGFLYAGLMISADGE
FT                   PKVIEFNCRFGDPETQPIMMRMQSDLVALCLAGANGTLDRQSSVWDPRPALGVVLAAGG
FT                   YPGDYRQGDLIHGLTPGCAQAKVFHAGTRLNAQGEVETCGGRVLCATALGEDIAEAQRN
FT                   AYRLADGLSWEGGFCRRDIGYRALQR"
FT   gene            complement(186215..187804)
FT                   /locus_tag="NT01EI_0186"
FT   CDS_pept        complement(186215..187804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0186"
FT                   /product="bifunctional purine biosynthesis protein,
FT                   putative"
FT                   /EC_number="2.1.2.3"
FT                   /EC_number="3.5.4.10"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67432"
FT                   /db_xref="GOA:C5BHF4"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHF4"
FT                   /protein_id="ACR67432.1"
FT                   /translation="MQHSRPVRRALLSVSDKSGIVEFAQALHLRGVELLSTGGTARLLS
FT                   QAGLPVTEVSDYTGFPEMMDGRVKTLHPKVHGGILGRRDRDAAVMQQHGIQPIDMVVVN
FT                   LYPFAQTVARPDCSQEDAVENIDIGGPTMVRSAAKNHNDVAIVVNNGDFENIIAEMDAH
FT                   HGALTQATRFDLAIKAFEHTAAYDSMIANYFGSLVAPYHGDIHSPSGRFPRTLNLNLVK
FT                   KQDMRYGENGHQQAAFYIEEPQVEACIATAQQLQGKALSYNNIADTDAALECVKSFTEP
FT                   ACVIVKHANPCGVALGDDLFDAYERAYQTDPTSAFGGIIAFNRTLDAKTAQAIITRQFV
FT                   EVIIAPHVTEDALDLLSAKQNVRVLACDEWDVRVPGLDFKRVNGGLLVQDRDLDMVDAA
FT                   DLRVVTERQPSEQELRDALFCWKVAKFVKSNAIVYARDNMTVGIGAGQMSRVYSAKIAG
FT                   IKAADEGLQIAGSVMASDAFFPFRDGIDAAAAVGIRCVIQPGGSIRDDEVIAAANEHDI
FT                   AMIFTGMRHFRH"
FT   gene            188375..189906
FT                   /locus_tag="NT01EI_R00012"
FT   rRNA            188375..189906
FT                   /locus_tag="NT01EI_R00012"
FT                   /product="16S ribosomal RNA"
FT   gene            189994..190071
FT                   /locus_tag="NT01EI_T00010"
FT   tRNA            189994..190071
FT                   /locus_tag="NT01EI_T00010"
FT                   /product="tRNA-Glu"
FT                   /note="putative tRNA-Glu"
FT   gene            190262..193252
FT                   /locus_tag="NT01EI_R00019"
FT   rRNA            190262..193252
FT                   /locus_tag="NT01EI_R00019"
FT                   /product="23S ribosomal RNA"
FT   gene            193344..193458
FT                   /locus_tag="NT01EI_R0001"
FT   rRNA            193344..193458
FT                   /locus_tag="NT01EI_R0001"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(193651..195312)
FT                   /locus_tag="NT01EI_0191"
FT   CDS_pept        complement(193651..195312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0191"
FT                   /product="cation/acetate symporter ActP, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67434"
FT                   /db_xref="GOA:C5BHF6"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR014083"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHF6"
FT                   /protein_id="ACR67434.1"
FT                   /translation="MKRLCSALSAAALLSLPGLAHADAIAGEVHRQPLNIQAIVMFILF
FT                   VGATLYITYWASKRTRSRRDYYTAGGRITGLQNGLAIAGDFMSAASFLGISALVYTSGY
FT                   DGLIYSIGFLIGWPIILFLIAERLRNLGRYTFADVASYRLQQKPIRTLSACGSLVVVAL
FT                   YLIAQMVGAGKLIQLLFGLNYHVAVILVGILMVLYVLFGGMLATTWVQIIKAVLLLAGA
FT                   SFMALMVMKSVNFDFNTLFAEAVKVHPKGIAIMSPGGLVSDPISALSLGLALMFGTAGL
FT                   PHILMRFFTVSDATEARKSVFYATGFIGYFYILTFIIGFGAILLVSANPAFKDATGALL
FT                   GGTNMAAVHLANAVGGNFFLGFISAVAFATILAVVAGLTLAGASAVSHDLYASVMKNGK
FT                   ATERDELKVSKITVVVLGLVAIALGILFEKQNIAFMVGLAFSIAASCNFPIIILSMYWS
FT                   RLTTRGAMIGGWLGLLTAVVLMILGPTIWVQILGHEKPIYPYEYPALFSMIVAFVGTWL
FT                   FSITDSSLAGQQERERFRAQFIRSQTGLSISQGSSH"
FT   gene            complement(195309..195620)
FT                   /locus_tag="NT01EI_0192"
FT   CDS_pept        complement(195309..195620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0192"
FT                   /product="Protein of unknown function, DUF485"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67435"
FT                   /db_xref="GOA:C5BHF7"
FT                   /db_xref="InterPro:IPR007436"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHF7"
FT                   /protein_id="ACR67435.1"
FT                   /translation="MNDTIYQEIEENPRFKELVRKRGRFVWLLSLITLALYVGFILLIA
FT                   FDPQWLGTPIAAGSTITRGIPVGVGLIVISFILTGIYVFRANGEFDRLTAEILSEVKQ"
FT   gene            complement(195712..197670)
FT                   /locus_tag="NT01EI_0193"
FT   CDS_pept        complement(195712..197670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0193"
FT                   /product="acetate-CoA ligase, putative"
FT                   /EC_number="6.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67436"
FT                   /db_xref="GOA:C5BHF8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHF8"
FT                   /protein_id="ACR67436.1"
FT                   /translation="MSQIHTYPIPADIAQHAFINAEMYREMYQASVEAPEAFWAEQGQI
FT                   ISWITPYSRVKNTSFDPGHINIRWFDDGTLNLAANCLDRHLAERGEQTAIIWEGDDPQE
FT                   SRRVTYRQLHSEVCRFANVLKSLQVEKGDVVAIYMPMVVEAAVAMLACARIGAIHSVIF
FT                   GGFSPEAVAGRIIDSGAKLVITADEGIRAGRTIPLKRNVDEALQHPQVNSVRHVVVFRR
FT                   TGGAGEWDSDRDRWWHELMALADEYCPPVEMNSEDPLFILYTSGSTGKPKGVLHTTGGY
FT                   LVYAATTFKYVFDYHPGDIYWCTADVGWVTGHSYLLYGPLANGAITLMFEGVPNYPGIN
FT                   RLSQIVDKHQVNILYTAPTAIRALMAEGKRAIADTHRTSLRIMGSVGEPINPEAWEWYY
FT                   HTIGNSHCPIMDTWWQTETGGFMITPLPGATVLKAGSATRPFFGVQPALVDNSGEILEG
FT                   ASEGNLVILDSWPGQARTLFGAHERFEQTYFSTFKGMYFSGDGARRDEDGYYWITGRVD
FT                   DVLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHSIKGQAIYAYITLNVGEEPSPALY
FT                   AEVRDWVRKEIGPIATPDILHWTDALPKTRSGKIMRRILRKIASGDISNLGDTSTLADP
FT                   AVVDKLLEEKQSMKVPS"
FT   gene            197894..198007
FT                   /locus_tag="NT01EI_0194"
FT   CDS_pept        197894..198007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0194"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67437"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHF9"
FT                   /protein_id="ACR67437.1"
FT                   /translation="MLADFIGCRNIAKFASGFINCQFIDHTTEYYCLIICV"
FT   gene            complement(198008..198136)
FT                   /locus_tag="NT01EI_0195"
FT   CDS_pept        complement(198008..198136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67438"
FT                   /db_xref="GOA:C5B6X6"
FT                   /db_xref="UniProtKB/TrEMBL:C5B6X6"
FT                   /protein_id="ACR67438.1"
FT                   /translation="MGAATPFFISCHFPSAIIRYNLSAVRHSLGFIIIIYAIKRDI"
FT   gene            198271..198768
FT                   /locus_tag="NT01EI_0196"
FT   CDS_pept        198271..198768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0196"
FT                   /product="glutamate/aspartate symporter family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67439"
FT                   /db_xref="GOA:C5B6X7"
FT                   /db_xref="UniProtKB/TrEMBL:C5B6X7"
FT                   /protein_id="ACR67439.1"
FT                   /translation="MLGSAGDIFIRLIKMIAISVLIVEIVEIVEIVEIVEIVEIVGIVG
FT                   IVGIGTVSLRIMEKREAYARRRQSPDLWYRRAVHLIWMARRDAISNHCGDFYRQAVRYP
FT                   VIAHSGVHPGSDSDGDLEGHRRRPRHLVCGDVATLGSVGMEGLIFIAGVDRILDMAWST
FT                   RR"
FT   gene            complement(198871..200304)
FT                   /locus_tag="NT01EI_0197"
FT   CDS_pept        complement(198871..200304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0197"
FT                   /product="type I secretion outer membrane protein, TolC
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67440"
FT                   /db_xref="GOA:C5B6X8"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010130"
FT                   /db_xref="UniProtKB/TrEMBL:C5B6X8"
FT                   /protein_id="ACR67440.2"
FT                   /translation="MQMKKLLPLLIGLSLSGFSALSQAENLMQVYQQAKESNPDLRQAA
FT                   ANRDAAFEKINESRSPLLPQLGLGADYTYTNGFRDSSGLNSNNYGATLALTQTIFDMSK
FT                   WRQLSLTEKQAGIQDVSYQSSEQTLMLNTATAYFNVLRAIDQLTYTEANKQAIYNQLDQ
FT                   TTQRFKVGLVAITDVQNARAQYDQVLAQEVSARNNLDNSLEALRQITGQYYPQLSALNI
FT                   DRFSTKRPDDVKALLQEAEKRNLQLLSARLSQDLARQQIKYAETGYMPTLNLTASTGVS
FT                   NTDYNSLSNAQKETLRGGNGSSYQGQNTVGLSFNLPLYSGGATNSQVKQAQYNFVGASE
FT                   ALDSAHRGVVQNVRSSFNNISAAISSVSAYKQAVVSAQSSLDATQAGYQVGTRTIVDVL
FT                   NATTALYNAKQNLANARYDYLISQLNIKYALGTLNQNDLLMLNGDLSKTVPTAADSIAP
FT                   DDAAQAAKANGPIPGGGVR"
FT   gene            200515..201144
FT                   /locus_tag="NT01EI_0198"
FT   CDS_pept        200515..201144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0198"
FT                   /product="nudix hydrolase, YffH family"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67441"
FT                   /db_xref="GOA:C5B6X9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR004385"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:C5B6X9"
FT                   /protein_id="ACR67441.1"
FT                   /translation="MCVDKPSPVNFGKDDVEIIARETCYRGFFSLDRYRFRHRLFNGEM
FT                   SGEVVREVFERGHAAVLLPYDPRRDEVVLIEQLRMPAYTSSHTPWLLEMVAGMIEMGES
FT                   VEQVARREAQEEAGITVGRCQPVLSYLASPGGTSERLSIVVGEVDATTAFGVHGLAEEH
FT                   EDIRVHVVSRAQAYRWVEQGVIDNAASVIALQWLALNHRRLRAQWA"
FT   gene            201311..201493
FT                   /locus_tag="NT01EI_0199"
FT   CDS_pept        201311..201493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0199"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67442"
FT                   /db_xref="InterPro:IPR009659"
FT                   /db_xref="UniProtKB/TrEMBL:C5B6Y0"
FT                   /protein_id="ACR67442.1"
FT                   /translation="MELCAIQQISQFKARYDNPNKKLHQCDEKHQINWISANGCSAGLA
FT                   QMQGVFLTVHFDLSV"
FT   gene            201541..202368
FT                   /locus_tag="NT01EI_0200"
FT   CDS_pept        201541..202368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0200"
FT                   /product="Calcineurin-like phosphoesterase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67443"
FT                   /db_xref="GOA:C5B6Y1"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR013622"
FT                   /db_xref="InterPro:IPR026575"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C5B6Y1"
FT                   /protein_id="ACR67443.1"
FT                   /translation="MESLFHLAVASGAPVRLLQITDTHLFAGQQETLLGVNTYRSYQAV
FT                   LAAIRAEAHPFDLIVATGDLAQDHSAAAYRHFAAGVAELHRPCLWLPGNHDFQPAMVDA
FT                   LAQAGVHANKRALLGECWQIVLLDSQVVGVPHGELSDYQLEWLELTLASEPQRHTMLLL
FT                   HHHPQPSGCTWLDQHSLRNAHALDEILRRYPQVNTLVCGHIHQELDLDWNGRRLLATPS
FT                   TCVQFKPLCTNFTIDTISPGWRYLTLYPDGRVTTAVHRLASSEFRPDLDADGY"
FT   gene            202371..202952
FT                   /locus_tag="NT01EI_0201"
FT   CDS_pept        202371..202952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0201"
FT                   /product="Uncharacterized protein family (UPF0227)"
FT                   /note="Uncharacterised protein family (UPF0227)"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67444"
FT                   /db_xref="InterPro:IPR008886"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C5B6Y2"
FT                   /protein_id="ACR67444.1"
FT                   /translation="MPTLLYLHGFNSSPRSAKAMALQCWLAEHHPQITMLIPQLPPYPA
FT                   DAAQMLEELVMERAGRPLGLVGSSLGGYYATWLSQCFTLPAVVINPAVKPFELLLDFLG
FT                   QNENPYTGQQYVLESRHVFDLKVMQVDPLESPDLIWLLQQTGDEVLDYRQAVTYYTPCR
FT                   QTIEEGGNHAFAGIERFFPQIIDFLGLSAE"
FT   gene            203059..204954
FT                   /locus_tag="NT01EI_0202"
FT   CDS_pept        203059..204954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0202"
FT                   /product="DNA topoisomerase IV, B subunit, putative"
FT                   /EC_number="5.99.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67445"
FT                   /db_xref="GOA:C5B6Y3"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005737"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C5B6Y3"
FT                   /protein_id="ACR67445.1"
FT                   /translation="MTQSSYNADAIEVLSGLEPVRRRPGMYTDTTRPNHLGQEVIDNSV
FT                   DEALAGHATRIEVILHPDQSLEVIDNGRGMPVDIHPEEGVPAIELILCRLHAGGKFSNK
FT                   NYQFSGGLHGVGISVVNALSRRVEVSVRRDGQIYQMAFENGEKVEDLHVSGTVGRRNTG
FT                   TSVHFWPDAQFFDSARFSVSRLTHLLKAKAVLCPGVEILFRDLVNGSEQRWCYQDGLTD
FT                   YLMESVNGLVTLPEQPFTGTFASDTEAVDWALLWLPEGGELLTESYVNLIPTPQGGTHV
FT                   NGLRQGLLDAMREFCEFRNLLPRGVKLTADDIWERCAYVLSVKMQDPQFAGQTKERLSS
FT                   RQCAAFVSGVVKDAFSLWLNQNVQSAELLAELAINSAQRRMRAAKKVVRKKLTSGPALP
FT                   GKLADCSAQDLNRTELFLVEGDSAGGSAKQARDREYQAIMPLKGKILNTWEVSSDEVLA
FT                   SQEVHDISVAIGIDPDSDDLSQLRYGKVCILADADSDGLHIATLLCALFVRHFRPLVQA
FT                   GHVYVAMPPLYRIDLGKEVFYALSEEEKAGVLEQLKRKKGKPNVQRFKGLGEMNPLQLR
FT                   ETTLDPNTRRLVQLAIEDEDMERTVAVMDMLLAKKRAEDRRNWLQENGNLAELDV"
FT   gene            205140..207422
FT                   /locus_tag="NT01EI_0203"
FT   CDS_pept        205140..207422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0203"
FT                   /product="DNA topoisomerase IV, A subunit, putative"
FT                   /EC_number="5.99.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67446"
FT                   /db_xref="GOA:C5B6Y4"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005742"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:C5B6Y4"
FT                   /protein_id="ACR67446.1"
FT                   /translation="MSDLTHDNSERVALHAFTEDAYLQYSMYVIMDRALPFIGDGLKPV
FT                   QRRIVYAMSELGLSASAKFKKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLV
FT                   DGQGNWGAPDDPKSFAAMRYTESRLSRYAEILLSELGQGTVDYVANFDGTLQEPKFLPA
FT                   RLPNILLNGTTGIAVGMATDIPPHNAREVAAALVALLDNPQSSLDDLLTHIQGPDFPTE
FT                   AEIITPRDEIHKIYRTGRGSVRMRAVWRKEEGEIVISALPHQTSGAKVLEQIASQMRAK
FT                   KLPMVDDLRDESDHENPTRLVIVPRSNRVDLDQLMNHLFATTDLEKSYRINMNMIGLDR
FT                   RPAVKDLREILSEWLSYRRETVRRRLNYRLEKVLKRLHILDGLLCAFLNIDEVIHIIRS
FT                   EDEPKPVLVARFGLSDTQAEAILELKLRHLARLEEVKIRGEQDELAQERDRLQTLLASE
FT                   RKLGTLIKKEIMADAETYGDARRSPLQERSEARAMSEHDFVPNEPVTIVLSEGGWVRSA
FT                   KGHDIDPSGLNYKAGDAFRAAARGKSNQPVVFIDSSGRSYALDPLTLPSARGQGEPLTG
FT                   KLTPPPGATIEHVLMAADDQKLLMASDAGYGFVCTFSDLVARNRAGKAMLTLPENANVL
FT                   TPLEINGDDDMLLAITEAGRMLMFPVHDLPQLSKGKGNKIVSIPAAQAAAGEDTLKWLL
FT                   VLAPQTSLTLHIGKRKLVMKPQDLQKFRAERGRKGTLLPRGLQRIERVDVDAPLSLRLD
FT                   ADAEGDA"
FT   gene            207513..208256
FT                   /locus_tag="NT01EI_0204"
FT   CDS_pept        207513..208256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0204"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase,
FT                   putative"
FT                   /EC_number="2.3.1.51"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67447"
FT                   /db_xref="GOA:C5B6Y5"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR004552"
FT                   /db_xref="UniProtKB/TrEMBL:C5B6Y5"
FT                   /protein_id="ACR67447.1"
FT                   /translation="MLFIFRVILITLLCLVICIVGSLYCLFSPRNPRHVARFGHWFGRL
FT                   SPLFGLKVETRLPPDAATYGNAIYIANHQNNYDMVTASNAVQPNTVTVGKKSLAWIPFF
FT                   GQLYWLTGNLLIDRKNRTKAHNTIAAVVEQFRTRRISFWMFPEGTRSRGRGLMPFKTGA
FT                   FHAALAAGVPIVPICVSSTHDKVKLNRWNNGVVIVEMLPPIDTSRWGKDQVRDLAEHCR
FT                   TLMAEKIGQLDAEVAAREAQAGKRA"
FT   gene            208305..209723
FT                   /locus_tag="NT01EI_0205"
FT   CDS_pept        208305..209723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0205"
FT                   /product="SufI protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67448"
FT                   /db_xref="GOA:C5B6Y6"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR026589"
FT                   /db_xref="UniProtKB/TrEMBL:C5B6Y6"
FT                   /protein_id="ACR67448.1"
FT                   /translation="MSLSRRRFIQASGLALCAGGLPLQARASGTQAVLPVPPLLESRRG
FT                   QPLFLSLERTHWAFMGGRKVGTWGVNGVYLGPTVRVHSGDDVKLIYSNRLSESVAMEVA
FT                   GLLVPGPLVGGPARQMSPGIDWSPVLPVRQAAATLWYHADTPRHMAPQVYSGLAGLWLV
FT                   EDQYSKNTPLPNHYGVDDFPLILQDKRLDNFGVPEYDPPASGGFLGDTLLVNGVQDPYV
FT                   EVSRGWVRLRLLNASNARRYLLQLSDRRPFFVIASDQGLLPAPLQVDTLPLAPGERREV
FT                   LIDMSKGEEVSITAGEAAGIMDRLRGLFEPSSMLVSTRVLTLRPTGLLPLMTDSLPARL
FT                   AADPLPEGDIVNNRSIMLGSASSPGINGMLWEPGRIDVQARQGTWERWTVRADTPQSFY
FT                   IQGAQFLVKSVNHAPPLVEDRGWKDSVWVDGEVSLLVYFPQPSYEHFPFLFYSGTLELA
FT                   DRGSVGQMVVQPAQ"
FT   gene            209989..213672
FT                   /locus_tag="NT01EI_0206"
FT   CDS_pept        209989..213672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0206"
FT                   /product="methionine synthase, putative"
FT                   /EC_number="2.1.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67449"
FT                   /db_xref="GOA:C5B6Y7"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR033706"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:C5B6Y7"
FT                   /protein_id="ACR67449.1"
FT                   /translation="MNTTCERLRRRLDKRILVLDGGMGTMIQRYGLSEQDFRAERFVDW
FT                   PCDLKGNNDLLALTRPDIISAIHYAYLEAGADILETNTFNATRIAMADYRMEALAPEIN
FT                   YRAASLARACADEWTARTPHQPRFVAGVLGPTNRTASISPEVNDPACRNITFDQLVAAY
FT                   RESARALIEGGVDLLMIETVFDTLNAKAAVYALECEFAALGVTLPVMISGTITDASGRT
FT                   LSGQTTEAFYNALRHARPLSFGLNCALGPEDLRQYVAELSRVAECHVSAHPNAGLPNAF
FT                   GEYDLSPQAMAQQIAEWARAGYLNIVGGCCGTTPEHIAAISRAVQGIAPRALPALPVAC
FT                   RLSGLEPLTIDETSLFVNVGERTNVTGSAKFKRLIKENKYDDALDVARQQVASGAQIID
FT                   INMDEGMLDAEAAMVRFLNLIAGEPDIARVPLMIDSSRWSVIEAGLKCIQGKGVVNSLS
FT                   LKEGEANFLQHARQVRRFGAALVVMAFDEQGQADTLARKVAICRRAYQLLTERIGFPPE
FT                   DIIFDPNIFAVATGIEEHSNYAVDFIAACAEIKAQLPHALISGGVSNVSFSFRGNEAVR
FT                   EAIHAVFLYHAIRHGMDMGIVNAGQLAIYDDLPDDLRTAAEAVILNQGSDATDRLLALA
FT                   ERYRDSQGSTQAEGQQAEWRSWPVAQRLEYALVKGIGEFIAQDTEAARLEADRPIAVIE
FT                   GPLMAGMNRVGDLFGDGKMFLPQVVKSARVMKQAVAYLSPFIEASKQRGSSAGKVLLAT
FT                   VKGDVHDIGKNIVGVVLQCNNYEIIDLGVMVPAERILRVAREERVDIIGLSGLITPSLD
FT                   EMVNVASEMERQGFTLPLLIGGATTSKAHTAVKIAPAYGGPTVYVQNASRTVGVVAALL
FT                   SEAQRGPFIERTRREYEAARAQHGRQTPRTPPVTLAQARANGVVTDWSACPPPVPQRLG
FT                   VQTMQPGIARLRDYIDWTPFFLTWSLAGKYPRILQDKVVGEEARRLLADANGLLDRLEA
FT                   SGSLTPRGVFGLFAANRRGDDVLIYRDESRREVLAVSHHLRQQSDKSAGPNYCLADFIA
FT                   AADEGIADYIGAFAVTGGLEEEALAQAFDAQHDDYHKIMVKALADRLAEAFAEYLHQQV
FT                   RKVHWGYAADEALDNEQLIRENYRGIRPAPGYPACPEHSEKATLWRLLDVERHTGMRLT
FT                   ESYAMWPGASVSGWYFSHPHSKYFTVARVQRDQVADYAARKGIPLAEAERWLAPNLGYE
FT                   VE"
FT   gene            complement(213721..215070)
FT                   /locus_tag="NT01EI_0208"
FT   CDS_pept        complement(213721..215070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0208"
FT                   /product="lysine-sensitive aspartokinase 3"
FT                   /EC_number="2.7.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67451"
FT                   /db_xref="GOA:C5B6Y9"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:C5B6Y9"
FT                   /protein_id="ACR67451.2"
FT                   /translation="MQQTIIAKFGGTSVADADAMLRCADIILSNPAVRVVVLSAAAGVT
FT                   NHLITLAEGQGAAERLRLIGEVRRIHDAILAALPDGAAIRSEIERMLENIAMLAEAAAL
FT                   ATSAALTDELVSHGELMSTLLFSELLRVRGVSVEWFDIRRIMRTDDRFGKAEPDREQLQ
FT                   ARAQQSLAPRLAKQLIITQGFIGSESKGRTTTLGRGGSDYTAALLAEALDAARVDIWTD
FT                   VPGIYTTDPRIVPAARRIDEIAFSEAAEMATFGAKVLHPATLLPAVRCDIPVFVGSSRD
FT                   PDAGGTLVCNKSAQPPLFRALALRRSQTLLTLHSLNMLHARGFLAEVFGILARHSISVD
FT                   LITTSEVSIALTLDTTGSCTGGASLLTSALLTELSALCRVEVEEDLALVALIGNQLSSA
FT                   CGVGRRIFGAMEPFNIRMICYGASSHNLCFLVPGNDADAVVRTLHAQLFE"
FT   gene            215358..215558
FT                   /locus_tag="NT01EI_0209"
FT   CDS_pept        215358..215558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0209"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67452"
FT                   /db_xref="UniProtKB/TrEMBL:C5B6Z0"
FT                   /protein_id="ACR67452.1"
FT                   /translation="MFLEITAYAGCVNGIGMSDFQFDLRSITVTDYCFYHIEIYEIKLI
FT                   SWSLVRASLRRIDIVFANLAA"
FT   gene            215893..217542
FT                   /locus_tag="NT01EI_0210"
FT   CDS_pept        215893..217542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0210"
FT                   /product="glucose-6-phosphate isomerase, putative"
FT                   /EC_number="5.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67453"
FT                   /db_xref="GOA:C5B6Z1"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5B6Z1"
FT                   /protein_id="ACR67453.1"
FT                   /translation="MKNINPTRTAAWQALQQHFGQMKSVHMRDLFAADADRFSKFSATF
FT                   DDQMLVDYSKNRINAETLEKLQALARETDLQGAIAAMFAGEKINRTEDRAVLHIALRNR
FT                   SNTPICVDGKDVMPEVNAVLAKMKQFCVRVIDGEWRGYTGKAITDVVNIGIGGSDLGPY
FT                   MVTEALRPYKNHLTMHFVSNVDGTHIAETLQRLNPETTLFLVASKTFTTQETMTNAHSA
FT                   RDWFLQAAGDERHVARHFAALSTNVQAVAAFGIDTANMFEFWDWVGGRYSLWSAIGLSI
FT                   ALSIGYDNFEQLLAGAHAMDRHFASAPLPQNLPVLLALIGIWYNNFFGAETEAILPYDQ
FT                   YMHRFPAYFQQGNMESNGKYVDRDGQVVDYQTGPIIWGEPGTNGQHAFYQLIHQGTKLI
FT                   PCDFIAPAISHNPLGDHHGKLLSNFFAQTEALAFGKSREAVEEEFAKAGKSAAEVQHIV
FT                   PFKVFEGNRPTNSILLREITPYSLGMLIALYEHKIFTQGVILNIFSFDQWGVELGKQLA
FT                   NRILPELEDAQPVRSHDSSTNALINRFKAWRA"
FT   gene            complement(217612..218859)
FT                   /locus_tag="NT01EI_0211"
FT   CDS_pept        complement(217612..218859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0211"
FT                   /product="Dicarboxylate/amino acid:cation (Na+ or H+)
FT                   symporter (DAACS) family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67454"
FT                   /db_xref="GOA:C5B6Z2"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:C5B6Z2"
FT                   /protein_id="ACR67454.1"
FT                   /translation="MHILRHYTFTLCLLLGIILGGLAGVLFGERATLVQPIGELFLNLM
FT                   FVVIVPLVFLSIASSIADMRQMSRLGKIMGTVFSVFIATALFAALIGFVATHLFNPFHN
FT                   VDTRSLIAHLPPTPQGQGKGVGEVIVSTFTVPDFLQLFTKSNLLPLIVFSILFGLATAF
FT                   SGEQGRPVAQFLRAGTAVILRMVKIIMYAAPLGLGCYFAATVGTLGPQIIHGYLNAFLL
FT                   YVVLTVIYFFGANTLYAFIAGGRPAVRIFWGNVFTPAITAIATASSAACIPVNLVASKK
FT                   MGVPADIAETVIPLGANTHKDGSVIGGIIKIVFLFTLFGRDMSDPMSIAAIISVAFLVG
FT                   AVMGAIPSGGMTGELMICAVFGFSPELVGTIMIISTIIDIPATLLNSTGNTVCAMLVTR
FT                   FVEGKAWLQRRWETAE"
FT   gene            218916..219056
FT                   /locus_tag="NT01EI_0212"
FT   CDS_pept        218916..219056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0212"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67455"
FT                   /db_xref="UniProtKB/TrEMBL:C5B6Z3"
FT                   /protein_id="ACR67455.1"
FT                   /translation="MILADDVNYLPLSPQAPNLCDAYRAARGIGGFLAQGDRRQNGNIV
FT                   N"
FT   gene            219093..219500
FT                   /locus_tag="NT01EI_0213"
FT   CDS_pept        219093..219500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0213"
FT                   /product="protein PsiE"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67456"
FT                   /db_xref="GOA:C5B6Z4"
FT                   /db_xref="InterPro:IPR009315"
FT                   /db_xref="InterPro:IPR020948"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5B6Z4"
FT                   /protein_id="ACR67456.1"
FT                   /translation="MPGTERANRVATVLQWILNIGLMALAAILVIFLAKETFTLAGVLF
FT                   DANQNASTYMLVEGIVIYFLYFEFIALIVKYFQSGYHFPLRYFIYIGITAIIRLIIVDH
FT                   ESPNDTLIYSFAILVLVIALYLANTDRLKRE"
FT   gene            complement(219589..220479)
FT                   /locus_tag="NT01EI_0214"
FT   CDS_pept        complement(219589..220479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0214"
FT                   /product="maltose transport system permease protein MalG,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67457"
FT                   /db_xref="GOA:C5B6Z5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5B6Z5"
FT                   /protein_id="ACR67457.1"
FT                   /translation="MAMVQPQSLRYRLWLTHLLMILFIALIMFPLLMVIAISLRTGNFA
FT                   TGSLIPDQISWEHWKLALGISVTAPDGRVTPPPFPVLLWLWNSLKVAVTTALGILTLST
FT                   TCAYAFARMRFRGKSSLLKGMLIFQMFPAVLSLVALYALFDRIGQYIPFLGLNTLGGVI
FT                   FAYMGGIALHVWTIKGYFETIDGSLEEAAALDGASPWQAFRLVLLPLSVPILAVVFILS
FT                   FIAAITEVPVASLLLRDVNTYTLAVGMQQYLNPQNYLWGDFAAAAVLSALPITAVFLLA
FT                   QRWLVGGLTAGGVKG"
FT   gene            complement(220494..222065)
FT                   /locus_tag="NT01EI_0215"
FT   CDS_pept        complement(220494..222065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0215"
FT                   /product="maltose transport system permease protein MalF,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67458"
FT                   /db_xref="GOA:C5B6Z6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR029345"
FT                   /db_xref="InterPro:IPR030156"
FT                   /db_xref="InterPro:IPR035277"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5B6Z6"
FT                   /protein_id="ACR67458.1"
FT                   /translation="MSLSQTEYPASEPRQLYPRTGLKWLAVSLLTLLTGYLTIVMYAQG
FT                   EYLFAMLTLILLGGGLYIFANRRAYAWRYVYPGLAGMGLFVLFPLICTIAIAFTNYSST
FT                   NQLSQERAQSVLLQRLFTSGQTYTFSLYPDGGQWRLQLTDAQSGQRYLSGPFNLSQPDL
FT                   QISMAVADSASQGSAATLRTVTQHRQTLNSLVALLPDGTALRMSSLRQFAASRPLYTLG
FT                   DDGRTLTDNQSGIAYRPNMQSGFYQAVNADGNWRSERLSPGFTVTTGWKNFLRVLNDEG
FT                   IRQPFISIFIWTLLFSVLTVIFTVAVGMVLACVVQWEALRGRAAYRVLLILPYAVPAFI
FT                   SILIFKGLFNQSFGEINMMLSQLFGIRPAWFSDPLTAKCMILIVNTWLGYPYMMILCMG
FT                   LLKAIPEDLYEASAMDGAGPLQNFFRITLPMLIKPLTPLMIASFAFNFNNFVLIQLLTN
FT                   GGPDMLGTSTPAGYTDLLVSYTYRIAFEGGGGQDFGLAAAIATLIFLLVGALAILNLKA
FT                   SKMNFD"
FT   gene            complement(222203..223396)
FT                   /locus_tag="NT01EI_0216"
FT   CDS_pept        complement(222203..223396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0216"
FT                   /product="maltose-binding periplasmic protein precursor,
FT                   MalE, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67459"
FT                   /db_xref="GOA:C5B6Z7"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006060"
FT                   /db_xref="UniProtKB/TrEMBL:C5B6Z7"
FT                   /protein_id="ACR67459.1"
FT                   /translation="MTKTSTIKTIALSALAALVIAAPALAKIEEGKLVIWINGDKGYNG
FT                   LADVGKKFEQETGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAE
FT                   VHPSKAFQEKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPTPPRSWEEIPALDS
FT                   KLRAQGKSAIMWNLQEPYFTWPLIAADGGYAFKYVNGRYETNNVGVDNAGSRAGLQFLV
FT                   DMVKNKHINADTDYSIAEAAFNKGQTAMTINGPWAWSNIDKSGINYGITLLPTFKGQPS
FT                   KPFVGVLSAGINAASPNKELATEFIENYLLTDSGLAMVNRDKPLGAVALKSYQEILEKD
FT                   PRIAATMQNSQNGEIMPNIPQMSAFWYAERAAIINAINGRQSVTQALESAKERILKK"
FT   gene            223478..223633
FT                   /locus_tag="NT01EI_0217"
FT   CDS_pept        223478..223633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0217"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67460"
FT                   /db_xref="GOA:C5B6Z8"
FT                   /db_xref="UniProtKB/TrEMBL:C5B6Z8"
FT                   /protein_id="ACR67460.1"
FT                   /translation="MGLSPCSGHSPGAEAPMLCHSPRDPPDSHPPPLYALWGFLVICLT
FT                   QLGNMW"
FT   gene            complement(223720..223833)
FT                   /locus_tag="NT01EI_0218"
FT   CDS_pept        complement(223720..223833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0218"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67461"
FT                   /db_xref="UniProtKB/TrEMBL:C5B6Z9"
FT                   /protein_id="ACR67461.1"
FT                   /translation="MVGKGRCVSMNGDDGARKTRTRGSSISAFLLAEKAGG"
FT   gene            223882..224991
FT                   /locus_tag="NT01EI_0219"
FT   CDS_pept        223882..224991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0219"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67462"
FT                   /db_xref="GOA:C5B700"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR015855"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5B700"
FT                   /protein_id="ACR67462.1"
FT                   /translation="MANVSLRNVYKAYGEAVISRDINLDIEDGEFVVFVGPSGCGKSTL
FT                   LRMIAGLEDITSGELQIAGVRMNEVPPAKRGIGMVFQSYALYPHLSVADNMSFGLKLAG
FT                   VSKAEIQQRVNQVAETLQLAHLLDRRPKALSGGQRQRVAIGRTLVAEPDVFLLDEPLSN
FT                   LDAALRVQMRIEISRLHKRLQRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLALY
FT                   HYPADRFVAGFIGSPKMNFLPVKVSEAQPQRVQVELPNGQHIWLPVAGEGLRPGSNLSL
FT                   GIRPEHLVPSAAADVTLSGEVQVVEQLGNETQIHIQIPALRQNLVYRQNDVVLVDEGAT
FT                   LAIGLPAERCHLFREDGSACQRLYQEPGV"
FT   gene            225057..226337
FT                   /locus_tag="NT01EI_0220"
FT   CDS_pept        225057..226337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0220"
FT                   /product="maltoporin precursor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67463"
FT                   /db_xref="GOA:C5B701"
FT                   /db_xref="InterPro:IPR003192"
FT                   /db_xref="InterPro:IPR036998"
FT                   /db_xref="UniProtKB/TrEMBL:C5B701"
FT                   /protein_id="ACR67463.2"
FT                   /translation="MMMNMRKLPLALAVASVVLSAQAMAVDFHGYARSGIGWSSQGGDQ
FT                   KCFQADGAGSKYRLGNECDTYAELKLGQELWKSGDQSFYLDTNVAYGIDQANDWESTSP
FT                   AFREINVQGKNVITWLPGSTLWAGKRYYQRHDVHMIDFYYWDISGPGAGLENIDLGFGK
FT                   LSLAVTRNTESGGSYSYFVNQSNEKSIRNTANDVYDIRLSGLQTNPGGSLELGFDYGRA
FT                   NLDDGYHLAPGATKDGYMFTAEHTQSLWGGFNKFVVQYAADAMSNTNNAGHSSGSSVNN
FT                   DGHLIRVLNHGAMDFNDQWGLMYVAMYQDTDHDVQNGSTWYTAGVRPMYKWTPTMSTLF
FT                   EAGYDNVKSQKTGARNELYKLTLAQQWQAGDSVWSRPAIRIFATYANGKNNWNTDQDGI
FT                   QVNTQPGDIRAEGVPGWSFGAQMEAWW"
FT   gene            226437..227333
FT                   /locus_tag="NT01EI_0221"
FT   CDS_pept        226437..227333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0221"
FT                   /product="maltose transport periplasmic protein family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67464"
FT                   /db_xref="GOA:C5B702"
FT                   /db_xref="InterPro:IPR010794"
FT                   /db_xref="UniProtKB/TrEMBL:C5B702"
FT                   /protein_id="ACR67464.1"
FT                   /translation="MKIALNRLSRGVLLACALCCTPQAFADTLLPTDVAAAPELSHAAL
FT                   QALHWQPLTPPVDTTFTLGAESQTLAQGDIQGAVAALTLPANRGSLEITLSSRLHNKRL
FT                   YVPNVLVLDQHLRPAAYYPGSYFTYRQPGVMSGDRLEGTLKLTPVLGQQQIYLLIYTTR
FT                   QDLATTTRMVNPAKAYAAGVGNAVPDIPDPQAMHAPQGVLNIQARVERQSGNVMIGGLL
FT                   PTGDTPVDVAVGSPASTVAAPAAPMLDDTAAYFDRSIRSAVRQGDIDKALRLMNEAQRL
FT                   GSTTARETFIRSVKGKG"
FT   gene            227597..228103
FT                   /locus_tag="NT01EI_0222"
FT   CDS_pept        227597..228103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0222"
FT                   /product="chorismate-pyruvate lyase, putative"
FT                   /EC_number="4.1.3.40"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67465"
FT                   /db_xref="GOA:C5B703"
FT                   /db_xref="InterPro:IPR007440"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/TrEMBL:C5B703"
FT                   /protein_id="ACR67465.1"
FT                   /translation="MAEYSAALANIDWRPLADATPPADYCSWLAEQGSMTRRLEQQCDR
FT                   LQVTVLREGAVDPTQLSDDECRQLSPSVQYWLREVILLGDGIPWLFGRTLTPSSTLEGE
FT                   GEALRRLGSTPLGRYLFSGVALERESLRVGCLGLLWARRSRLRVAGQPLLLTELFLADA
FT                   PIYGR"
FT   gene            228129..228992
FT                   /locus_tag="NT01EI_0223"
FT   CDS_pept        228129..228992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0223"
FT                   /product="4-hydroxybenzoate polyprenyl transferase,
FT                   putative"
FT                   /EC_number="2.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67466"
FT                   /db_xref="GOA:C5B704"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5B704"
FT                   /protein_id="ACR67466.1"
FT                   /translation="MEGCVAQSKWLAYCRLMRIDKPIGSLLLLWPTYWALWLAGGTAPG
FT                   GKLLLVFTCGVFFMRAAGCVINDFADRHFDGHVKRTCQRPLPCGALSEREAKALFVLLV
FT                   GLSFALVLTLNAMTIWLSVAALTLAWLYPFIKRFSHLPQVILGMAFGWSIPMAYAAVGE
FT                   SLPLSCWLLFAANICWTVAYDTQYAMVDRDDDLRIGIKSTAILFGRYDRLVIGLLQLAT
FT                   LLLLLWVGDLNQLQGAYYWGVLLAAVLFVYQQQLITRRARTSCFRAFMNNNYVGLILFL
FT                   GILLAL"
FT   gene            229281..230957
FT                   /locus_tag="NT01EI_0224"
FT   CDS_pept        229281..230957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0224"
FT                   /product="transporter, major facilitator family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67467"
FT                   /db_xref="GOA:C5B705"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5B705"
FT                   /protein_id="ACR67467.1"
FT                   /translation="MSVDNSVPTPRGDERRAADVRPGFFSKARIIARPGFNRWLVPPAA
FT                   LAIHLCIGMAYGFSVFWLPLSQALGGGAAQACPAQMSAWQELFTTRCDWRISMLGWTYT
FT                   LFFIFLGCSAALWGSWLEKAGPRKVGVVAACCWCGGLMFSALGVYLHQLWMLWLGSGVI
FT                   GGIGLGLGYISPVSTLIRWFPDRRGMATGLAIMGFGGGAMVGAPLANSLMHFYTAAGGV
FT                   GVWQTFLTLALIYWVFMLAGALAYRIPPIGWRPQGMAAATETPAAQGFTHVEVHVSVAC
FT                   RTPQFWLLWAVLCLNVSAGIGIIGMASPLLQEVFAGRLLGGTQSFAELSSAQLAQIAAI
FT                   AAGFTGLLSLFNIGGRFFWASLSDRIGRNRTFFLFFALGMVLYGLLPTLGALGSVTLFA
FT                   LAFCLIVSMYGGGFATVPAYLADLFGTQMVGAIHGRLLTAWSAAGILGPVLVNYLREYQ
FT                   LSRGIARAQAYSETLYILAGLLLVGLVCNLLIRPVDRRHTMSEAQLAQARSLYKVDPNA
FT                   QLSWSADAGSRLWVALSWLAVGLPLLWGCWITLLQAGQLFG"
FT   gene            complement(231014..233470)
FT                   /locus_tag="NT01EI_0225"
FT   CDS_pept        complement(231014..233470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0225"
FT                   /product="glycerol-3-phosphate acyltransferase, putative"
FT                   /EC_number="2.3.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67468"
FT                   /db_xref="GOA:C5B706"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR022284"
FT                   /db_xref="InterPro:IPR028354"
FT                   /db_xref="InterPro:IPR041728"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5B706"
FT                   /protein_id="ACR67468.1"
FT                   /translation="MSGWRKIYYKLLNLILKLLVKSKVIPTDPVAELRLDTTRPVFYVL
FT                   PYNSKVDLLTLRDRCLALDLPDPLDDNEIDGVILPRYVFIDDGPRVFRYYAPKQASVKL
FT                   FLDYLDLHRGNPSLDIQMIPVSVMFGRAPGREDHKGAPQLRLLNGIQKFFAVLWLGRDS
FT                   FVRFSNTVSLRYMADEHGTDKTIAQKLARVARMHFSRLRLAAVGPRLPDRQALFNKLLG
FT                   SKAIEKAVEDEARSKKISREKAQQNAVALMEEIAADFTYEAVRLSDRVLSWTWNRLYQG
FT                   INVHNAERVRQLAQDGHEIVYVPCHRSHMDYLLLSYVLYHQGLVPPHIAAGINLNFWPA
FT                   GPIFRRLGAFFIRRTFKGNKLYSTVFREYLGELFSRGYSVEYFMEGGRSRTGRLLEPKT
FT                   GTLAMTLQAMLRGGKRPITLVPVYIGYEHVMEVATYAKELRGATKEKESLPQMVRGLRK
FT                   LRNLGQGYVNFGEPISLNVWLNQHVPEWREAIDPIEAQRPHWLPASVNSIAGEVMVNIN
FT                   KAAAANAMNLCATALLASRQRALTREQLLEQLECYLQLLQNVPYAPDATLPQRTPQELL
FT                   DHALQMNKFEVEKDNIGDLIILPREQAVLMTYYRNNIQHMLVLPALVASMVIHHRQISR
FT                   DELLRQAAVIYPMLKQELFMHYVPETLPQVLSPIIDELCRQQLISLQDDTLIINPPRIR
FT                   SLQLLAAGVRETLQRYAITFSLLSANPSISRGALEKESRILAQRLSLLHGINAPEFFDK
FT                   AVFATLVATLRAEGYINDVGDAVREQTLEIYNLLADLLTPEIRLTIESVSIAALEDTGG
FT                   ADGGTA"
FT   gene            233595..233957
FT                   /locus_tag="NT01EI_0226"
FT   CDS_pept        233595..233957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0226"
FT                   /product="diacylglycerol kinase, putative"
FT                   /EC_number="2.7.1.107"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67469"
FT                   /db_xref="GOA:C5B707"
FT                   /db_xref="InterPro:IPR000829"
FT                   /db_xref="InterPro:IPR033718"
FT                   /db_xref="InterPro:IPR036945"
FT                   /db_xref="UniProtKB/TrEMBL:C5B707"
FT                   /protein_id="ACR67469.2"
FT                   /translation="MNSTTGLTRIIKAAGYSIKGLQAAWRHEAAFRQESLLLVVAVMLA
FT                   CWLDVTAVERILLIGSVTLVVILEILNSAIEAVVDRIGSERHELSGRAKDMGSAAVFVA
FT                   LWLALFVWVSILWTHL"
FT   gene            complement(234048..235505)
FT                   /locus_tag="NT01EI_0227"
FT   CDS_pept        complement(234048..235505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0227"
FT                   /product="citrate carrier/transporter"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67470"
FT                   /db_xref="GOA:C5B708"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="InterPro:IPR030676"
FT                   /db_xref="UniProtKB/TrEMBL:C5B708"
FT                   /protein_id="ACR67470.1"
FT                   /translation="MSKEKIGKLLAPLVVMGIMFMLPVPDGMPPQAWHYFAVFVAMIVG
FT                   MILEPIPATAISFIAVTIVVIGNQFLLFNPSELADPAFNASKQALKWGLAGFSSTTVWL
FT                   VFGAFIFALGYEVSGLGRRIALLLVKFMGKRTLTLGYAIVIIDILLAPFTPSNTARTGG
FT                   TVFPVIKNLPPLFDSHPNDPSSRRIGSYLMWMMVISTSISSSMFVTGAAPNVLGLEFVS
FT                   KIAGIQISWMQWFLGFLPVGLLLLVVAPWLSYVLYKPTVTHSEQVATWAGSALKEMGAL
FT                   TRREITLICLVLLSLALWVFGDDFINATAVALLAVALMLALHVVPWKDVTKYSGAWNTL
FT                   VNLSTLVVMANGLTRSGFIEWFAKTMGAHLADFSPTATVIALVLVFYFAHYLFASLTAH
FT                   TATMLPVILAVGQSIPGVPMDQLCLLLVLSIGLMGCLTPYATGPGIIIYGCGYVKSKDY
FT                   WRLGAIFGVIYITALLAIGWPIMALWY"
FT   gene            complement(235535..236446)
FT                   /locus_tag="NT01EI_0228"
FT   CDS_pept        complement(235535..236446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0228"
FT                   /product="triphosphoribosyl-dephospho-CoA synthase CitG,
FT                   putative"
FT                   /EC_number="2.4.2.52"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67471"
FT                   /db_xref="GOA:C5B709"
FT                   /db_xref="InterPro:IPR002736"
FT                   /db_xref="InterPro:IPR017551"
FT                   /db_xref="UniProtKB/TrEMBL:C5B709"
FT                   /protein_id="ACR67471.1"
FT                   /translation="MPNPITRNPYPGTLEQVCGHYAILGWRAMLAEVNLTPKPGLVDRH
FT                   NSGAHRDMAHSDFVRSADAIAPWLARFVEYGADSAALDGSSVLPGLRALGIACEADMFR
FT                   ATAGVNTHKGSIFSLGLLCAAAGRSHQRGQPVTPARLCGYAAQFCRGLVARELAPLRPA
FT                   QASTAGQRLFMTLGITGARGEAEAGYPLVLNLALPHYQQALAAGRDPELALLDTLVQLM
FT                   AHNQDTNVAARGGESGLRWMQLSAAALLATGGIRTPADLQALRRFDAECINRHLSPGGS
FT                   ADLLILTWFLAHLCYPILHAEH"
FT   gene            complement(236424..236972)
FT                   /locus_tag="NT01EI_0229"
FT   CDS_pept        complement(236424..236972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0229"
FT                   /product="apo-citrate lyase phosphoribosyl-dephospho-CoA
FT                   transferase, putative"
FT                   /EC_number="2.7.7.61"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67472"
FT                   /db_xref="GOA:C5B710"
FT                   /db_xref="InterPro:IPR005551"
FT                   /db_xref="UniProtKB/TrEMBL:C5B710"
FT                   /protein_id="ACR67472.2"
FT                   /translation="MPLLPHLAASHTVTLPELLLSRECRQSRQTAWLARHTCTLISFTV
FT                   VSPGPVKDSPLTRRIFNAGIAALNQLAQRQEWSIREQRSLDFATGPEGLMAIDASAERV
FT                   KRATIALEQSHPLGRLWDMDVVASDGQILSRGDHQLPARRCLICQRPAVLCARERRHDV
FT                   AQLLAHMEALLHDAESDNA"
FT   gene            complement(236979..237779)
FT                   /locus_tag="NT01EI_0230"
FT   CDS_pept        complement(236979..237779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0230"
FT                   /product="citrate lyase, alpha chain, premature stop"
FT                   /EC_number="2.8.3.10"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67473"
FT                   /db_xref="GOA:C5B711"
FT                   /db_xref="InterPro:IPR006472"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C5B711"
FT                   /protein_id="ACR67473.1"
FT                   /translation="MTSNPRELLIARSAAEVIAHSGYFNEGFSLQTGTGGASLAVTRFL
FT                   EDKMRRANIRADFALGGITSTIVDLHEKGYIRKLLDVQSFDRAAAGSLVRNPNHIEISA
FT                   NQYANWSSKGAAVDRLDVVVLSALEVDTHFNVNVLTGSDGVLRGASGGHCDTAIGSALS
FT                   IIVAPLVRGRIPTIVDNVLTCVTPGSSVDILVTDHGIAVNPARPELAQRLRDAGLPLVS
FT                   IGWLRDRALSLTGEPKPIAFTDKVVAVVRYRDGSVIDVVRQVKE"
FT   gene            complement(237828..238499)
FT                   /locus_tag="NT01EI_0231"
FT   CDS_pept        complement(237828..238499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0231"
FT                   /product="citrate lyase alpha chain"
FT                   /EC_number="4.1.3.6"
FT                   /EC_number="2.8.3.10"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67474"
FT                   /db_xref="GOA:C5B712"
FT                   /db_xref="InterPro:IPR006472"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C5B712"
FT                   /protein_id="ACR67474.1"
FT                   /translation="MTQDTQRNARVAAFSQRDSALPAFNDVSKAQYHDDRARDRKLCAS
FT                   LEEAIRRSGLRDGMTISFHHAFRGGDLTLNQVMDAIAAMGFKDLTLASSSLSDCHAPLV
FT                   GHIRNGVVRKIYTSGLRGPLADAISHGLLDEPVQIHSHGGRVHLINSGELNIDVAFLGV
FT                   PACDAFGNANGYTGNACCGSLGYARADAEAANNVVLLTEEILSYPHNPASLTQDQVDLI
FT                   V"
FT   gene            complement(238510..239406)
FT                   /locus_tag="NT01EI_0232"
FT   CDS_pept        complement(238510..239406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0232"
FT                   /product="citrate (pro-3S)-lyase, beta subunit, putative"
FT                   /EC_number="4.1.3.6"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67475"
FT                   /db_xref="GOA:C5B713"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR006475"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C5B713"
FT                   /protein_id="ACR67475.1"
FT                   /translation="MTPQQKTRTRRSMLFVPGANAAMLSNAFIYKADALMFDLEDSVVL
FT                   REKDAARRLVYHALQHPLYHDIETIVRVNALDSAYGVADLEAVVRAGVDVVRLPKTDSA
FT                   DDVIAIENEIARIERACGRDVGSTGLLAAIESAQGITQAVAIAHASPRLIGIALGAEDY
FT                   VRNLRTERSPEGIELLFARCSILQAARSAGIQAFDTVYSDANNDEGFLREASHIKQLGF
FT                   DGKSLINPRQIELLHNLYAPTQKEVDHARLVVDAAEASAREGRGVVSLNGKMVDSPVIE
FT                   RARLVLSRAALSGIREE"
FT   gene            complement(239403..239702)
FT                   /locus_tag="NT01EI_0233"
FT   CDS_pept        complement(239403..239702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0233"
FT                   /product="citrate lyase acyl carrier protein, putative"
FT                   /EC_number="4.1.3.6"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67476"
FT                   /db_xref="GOA:C5B714"
FT                   /db_xref="InterPro:IPR006495"
FT                   /db_xref="InterPro:IPR023439"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5B714"
FT                   /protein_id="ACR67476.1"
FT                   /translation="MKINHAAVAGTLESSDVMVRIAPIEDDQALDLQISSSVEKQFGDA
FT                   IRATVLDVLNRYQVRGIQLIVDDKGALDCVLRARLETLLARAADLVSLPWEDRA"
FT   gene            complement(239699..240775)
FT                   /locus_tag="NT01EI_0234"
FT   CDS_pept        complement(239699..240775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0234"
FT                   /product="citrate (pro-3S)-lyase ligase, putative"
FT                   /EC_number="6.2.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67477"
FT                   /db_xref="GOA:C5B715"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005216"
FT                   /db_xref="InterPro:IPR013166"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C5B715"
FT                   /protein_id="ACR67477.1"
FT                   /translation="MFSNTVFTQIKRSEQKRIADITHFLRENGLNIDTSVEIFICAQRD
FT                   NKIIACGGIAGDIIKCVAISAAARGEGLALTLATELVNLAYELGRNNLFIYTKEENEGM
FT                   FHQCGFSTITRVPGIMVLMENSKVRLQRYAETLVTLRHPGKKIGAIVMNANPFTNGHRY
FT                   LVRQAASQCDWLHLFLVREDTSRFPYEDRLALVRSGVSDIANLTLHPGSEYIISRATFP
FT                   CYFIKEQGVADNCYTEIDIKIFRQYLAPALGITHRFVGTEPFCPVTAKYNQDMRYWLET
FT                   PALPYPPIHLVEVARLTYHNTPISASWVRKLLVRKDIPAITPLVPNATRAYLARLIASI
FT                   PAGVERRSQESVLVTGDK"
FT   gene            241163..242806
FT                   /locus_tag="NT01EI_0235"
FT   CDS_pept        241163..242806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0235"
FT                   /product="sensor kinase DpiB, putative"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67478"
FT                   /db_xref="GOA:C5B716"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR016120"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039506"
FT                   /db_xref="UniProtKB/TrEMBL:C5B716"
FT                   /protein_id="ACR67478.1"
FT                   /translation="MVRMPNNSAVNFFRRMAFPLRIFLLLLLVSCCLFAALGKYLSASF
FT                   EDYMMRQVHDMAMNQAKIIASMDSVVEGVKARDTHRLALIADRLGTGTDFDYVVIGDRN
FT                   SVRLYHPNPAKIGHKMQFTKPGAMEKGESYFISGKGSLGQALRAKTPIFDHQGQVIGVV
FT                   SLGYLVSKIDSWRLDFLLPMAGVFVCVLLLLLLLSWLFAAHIRRQMMGMEPRQIARVVR
FT                   QMEALFGAVFEGLIAVDPDGQITAINRNARKMLGLSAPGRQWLGQPISQVVSPSDFFTD
FT                   RINEDRRDAILTFNGLNVIANRATIRSGDGDTLLGAIISFRSKDDINTLNAQLTQIRQY
FT                   VDSLRTVRHEHLNWMSTLSGLLQMKEYDRALEMVRGASQAQQQLIDRLRDAFSDKVVAG
FT                   LLFGKVHRARELGLTLTIVDGSQLHALPAGLDNTEFAAVLGNLLDNAFDASLKNPQGGG
FT                   GVEVYLSDEGREVIIEVADQGCGVPDTLKDNIFEQGVSTKAEDPGEHGIGLYLIARYVG
FT                   RCGGTITLEDNQPYGTLFSVFIPKVKREHE"
FT   gene            242799..243485
FT                   /locus_tag="NT01EI_0236"
FT   CDS_pept        242799..243485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0236"
FT                   /product="transcriptional regulatory protein DpiA,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67479"
FT                   /db_xref="GOA:C5B717"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR024187"
FT                   /db_xref="InterPro:IPR028141"
FT                   /db_xref="UniProtKB/TrEMBL:C5B717"
FT                   /protein_id="ACR67479.1"
FT                   /translation="MNKINILIVEDETPLAEMHAEFIRNHPCCGQLWLAGNLAQARAMI
FT                   KHFHPDLVLLDNYLPDGVGVHLLHELTQQRYPGGVVLTTAASDMDTVSEAVRSGAFDYL
FT                   IKPIAYERLGQTLDRYQQRNSMLSGHQNASQRQIDSMYNAYARGDSKEDLPVGIDALTL
FT                   EKVQGLFVDDTVRHTAESVAQSLMLSRTTARRYLEFCAARQQIVAEIVYGKVGRPQRIY
FT                   RAQGKI"
FT   gene            243606..244214
FT                   /locus_tag="NT01EI_0237"
FT   CDS_pept        243606..244214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0237"
FT                   /product="repressor LexA, putative"
FT                   /EC_number="3.4.21.88"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67480"
FT                   /db_xref="GOA:C5B718"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR006199"
FT                   /db_xref="InterPro:IPR006200"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5B718"
FT                   /protein_id="ACR67480.1"
FT                   /translation="MKALTARQQQVYDLIRDHIEQTGMPPTRAEIAQRLGFRSPNAAEE
FT                   HLKALQRKGVIEIVSGASRGIRLLMEDETGLPLVGQVAAGEPLLAQQHIEGFYQIDPSL
FT                   FKPGADFLLRVNGMSMRDIGILDGDLLAVHKTQDVRNGQVVVARIEDEVTVKRLKKQGN
FT                   MVQLLPENCDFQPIVVDLREQSFTIEGLAVGVIRNGDWI"
FT   gene            244368..245699
FT                   /locus_tag="NT01EI_0238"
FT   CDS_pept        244368..245699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0238"
FT                   /product="MATE efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67481"
FT                   /db_xref="GOA:C5B719"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:C5B719"
FT                   /protein_id="ACR67481.1"
FT                   /translation="MRGVFREDKALWRLALPMILSNVSVPLLGVVDTAVIGHLDSPVYL
FT                   GGVAVGSMATTFLFMLLLFLRMSTTGLCAQAFGAADRPALARALLQPLIMALLAGVGII
FT                   LLRQPLSALMLQIVGAGAAIQAQAQLFMHIRWLSAPATLANLVILGWLLGVQYARAPVL
FT                   LLIVGNVVNIALDLWLVVGLGWKVAGAAWATVIADYVTLLMGAALLLHVMRLRGLRRAH
FT                   FRHAWRGNLRRLMALNRDIMLRSLLLQLCFASLTVIGARLGADIVAVNAVLMNLLTFTA
FT                   YALDGFAYAVEAYSGQAFGARDAPVLRRVWRAACRQAGAVALLFALAYSLFGRDIVNLL
FT                   TSLPQVQTLALDYLPWQVVLPLLGVWCYLLDGMFIGATRGADMRNSMAVAALGYGMTLL
FT                   SIPWLGNHGLWLALAVFLMLRGLSLWLIWRRRWRTQRWFPTGAA"
FT   gene            complement(245718..246191)
FT                   /locus_tag="NT01EI_0239"
FT   CDS_pept        complement(245718..246191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0239"
FT                   /product="zinc uptake regulator, Fur family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67482"
FT                   /db_xref="GOA:C5B720"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5B720"
FT                   /protein_id="ACR67482.1"
FT                   /translation="MTTPTLQRLLAQAEQLCQQRNVRLTPQRMEVLRLMAAQQGAISAY
FT                   DLLDLLRVSEPRAKPPTIYRALDFLLEQGFIHKVESTNSYVMCHHLDKPCHTSALFICH
FT                   RCSQVHERSADLLQQQLETLAQQDGFTLQHCVIEAHGLCHACAQEPDGETPAR"
FT   gene            246630..247280
FT                   /locus_tag="NT01EI_0240"
FT   CDS_pept        246630..247280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67483"
FT                   /db_xref="UniProtKB/TrEMBL:C5B721"
FT                   /protein_id="ACR67483.1"
FT                   /translation="MDLILAIEHWPLRQAIVELYRRQFTIISLPDAVPFSPRILSALHR
FT                   AGSLLVTDRQRHNLLQTVERVRRHSLIPVIIINRQDNYLTQLIARFFNGAHALSYDSFY
FT                   RHIQRRTFHPLDLYFLPYSRGAQDACWSTGETVYARLNAFGLMTLYQRGVTLREAAVLL
FT                   SLSYHNSTAMTARLLGIHEQAVVYCKRTLGSKLGLDHHRPDFISHIFLSPDAR"
FT   gene            247463..248512
FT                   /locus_tag="NT01EI_0241"
FT   CDS_pept        247463..248512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0241"
FT                   /product="Dihydrouridine synthase (Dus)"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67484"
FT                   /db_xref="GOA:C5B722"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004653"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:C5B722"
FT                   /protein_id="ACR67484.1"
FT                   /translation="MTQAAHQAVHIEQATGARGRDQAGAFSSQRFSIAPMLDWTDRHCR
FT                   YFHRLLSRQTLLYTEMVTTGAIIHGKGDYLAYCEEEHPLALQLGGSNPADLARCARLAE
FT                   TRGYDEINLNVGCPSDRVQNGRFGACLMGEAQLVADCVKAMRDVVSIPVTVKTRIGIDE
FT                   QDSYPFLCDFIGTVAGQGECDTFIVHARKAWLSGLSPRENREVPPLDYPRVYRLKQDFP
FT                   HLTIALNGGVKRLDEARAHLQHVDGVMVGREAYHNPGILAQVDSQLFDADAAVPDSVAV
FT                   VRALYPYIGRELAQGTYLGHITRHILGLFQGIPGARQWRRHLSENAHRPGAGIDVVEQA
FT                   LRFVDRRAE"
FT   gene            248676..248894
FT                   /locus_tag="NT01EI_0242"
FT   CDS_pept        248676..248894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0242"
FT                   /product="phage shock protein G, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67485"
FT                   /db_xref="GOA:C5B723"
FT                   /db_xref="InterPro:IPR014318"
FT                   /db_xref="UniProtKB/TrEMBL:C5B723"
FT                   /protein_id="ACR67485.1"
FT                   /translation="MLEVMFVLAFFMMLLLTGISLLGVIAALAVAALLLVFGGLFVLVI
FT                   KLLPWLALAIVVVWLYRALQKKQPRRY"
FT   gene            249035..250447
FT                   /locus_tag="NT01EI_0243"
FT   CDS_pept        249035..250447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0243"
FT                   /product="replicative DNA helicase, putative"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67486"
FT                   /db_xref="GOA:C5B724"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:C5B724"
FT                   /protein_id="ACR67486.1"
FT                   /translation="MAGNNPSSKSREAPRDRQMEGLKLPPHSLEAEQSVLGGLMLDNER
FT                   WDHVAERVVSNDFYSRPHRLIFGEMQRLLELGRPIDLITLSESLEQLGHLESVGGFAYL
FT                   AELSKNTPSAANINAYADIVRERAVVREMITVANEIADAGYDPQGRSSEDLLDLAESRV
FT                   FQIAENRASKDEGPKSIDRILEDTVSRIEQLYQRPHDGVTGVSTGYQDLDKKTAGLQKS
FT                   DLIIVAARPSMGKTTFAMNLCENAAMTQDKPVLIFSLEMPGEQIMMRMLASLSRVDQTR
FT                   IRTGQLDDEDWARISSTMGLLLEKRNMYIDDSSGLTPTEVRSRARRIFREHDGLSLIMI
FT                   DYLQLMRVPSLSDNRTLEIAEISRSLKALAKELQVPVVALSQLNRSLEQRADKRPVNSD
FT                   LRESGSIEQDADLIMFIYRDEVYHENSDLKGVAEIILGKQRNGPIGTVRLTFNGQWSRF
FT                   DNYAGPAYSDED"
FT   gene            complement(250519..250632)
FT                   /locus_tag="NT01EI_0244"
FT   CDS_pept        complement(250519..250632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0244"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67487"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCC4"
FT                   /protein_id="ACR67487.1"
FT                   /translation="MSQSAAINDGGCRFHVASLVPLMSLVGYRVGRPAPGS"
FT   gene            250588..251679
FT                   /locus_tag="NT01EI_0245"
FT   CDS_pept        250588..251679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0245"
FT                   /product="alanine racemase, putative"
FT                   /EC_number="5.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67488"
FT                   /db_xref="GOA:C5BCC5"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BCC5"
FT                   /protein_id="ACR67488.1"
FT                   /translation="MKAATAIIDRRALRHNFQQIRKFAPHSRLIAVVKANAYGHGLLET
FT                   AKILNQADCYGVARIGEALMLRSGGIVKPILLLEGFFSASDLPVLVANNIETAVHSEEQ
FT                   LQALENAGLERPIRVWMKLDTGMHRLGVRPEQAEAFYRRLCACPNVAQPVNFMSHFSCA
FT                   DEPDSGRTEVQLACFDDFVRGKTGEQSIAASGGILLWPQSHRDMVRPGIIMYGVSPQAD
FT                   LSLAADHYGLQPAMTLQSSLIAVREHKAGEPVGYGGAWVAQRDTRLGVVAIGYGDGYPR
FT                   SAPSGTPVLINGREVPIVGRVSMDMISVDLGPQAADRVGDNVIMWGPGLPVEKVAACTG
FT                   ISAYELITKLTSRVAMEYIGEEA"
FT   gene            complement(251750..252907)
FT                   /locus_tag="NT01EI_0246"
FT   CDS_pept        complement(251750..252907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0246"
FT                   /product="iron-containing alcohol dehydrogenase, putative"
FT                   /EC_number="1.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67489"
FT                   /db_xref="GOA:C5BCC6"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCC6"
FT                   /protein_id="ACR67489.1"
FT                   /translation="MENFVLHTPTKILFGQDQIASLRDEIPPQARVLITYGGGSIKRNG
FT                   VLDQVLTALHGRHVFEFGGIEPNPHYETLMQAVEMVHNEKIDYLLAVGGGSVIDGTKFI
FT                   AAAADYVGDPWHIMETVGSDVTRAIPMGVVLTLPATGSEMNMGAVITRSATGDKLHFMS
FT                   PCVMPRFAVLDPQVTYTLPPRQIANGVVDAFVHIVEQYLTYPVDARVQDRFAEGLLQTL
FT                   IEEGPLALQEPENYGVRANIMWCATMALNGLIGAGVPQDWSTHMLGHELTAMHGLDHAQ
FT                   TLAIVLPNVLQLKRDKKHAKLLQYAERVWHIHSGSDEQRIDAAIAATRAFFEQMGVKTR
FT                   LGDYGLDGSSIPALLDKLQEHRMTALGEHGDITPEQSRQIYQAAR"
FT   gene            253117..254028
FT                   /locus_tag="NT01EI_0247"
FT   CDS_pept        253117..254028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0247"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67490"
FT                   /db_xref="GOA:C5BCC7"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR009594"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCC7"
FT                   /protein_id="ACR67490.1"
FT                   /translation="MVIDDRWKQLAAQVQRLHQQPGVKPSPVGHVNLIYVNAHQPRTPV
FT                   MYQPSLIIILQGRKVGYLGERVFHYDPSNYLLMTLPLPCECETFASPQEPLIGLALRVD
FT                   VQMLQDLLMDIGDGMRTAVRPHADGVRSVALDDAMLCACERLVEAMEDSLHARVLGPQI
FT                   VREMLFHALCGAGGDALLALASRHSHFSQIAKALRLIEQNYASSLNVDRLAQSVNMSIS
FT                   SFHHNFKAVTATSPLQYIKSYRLHKARMMILHDGLKASTAASRVGYESPSQFSREYKRF
FT                   FGNTPSDQASRYRSGGLRIAEL"
FT   gene            254087..255376
FT                   /locus_tag="NT01EI_0248"
FT   CDS_pept        254087..255376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0248"
FT                   /product="hydrolase, alpha/beta fold family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67491"
FT                   /db_xref="GOA:C5BCC8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCC8"
FT                   /protein_id="ACR67491.1"
FT                   /translation="MIERAFLVPGMAVREFRTEVPLNWRDPSDGRRLTLFARELCAPGR
FT                   EADEMPCLLFLQGGPGGKCPRPISRSGWLAEALRDYRVILMDQRGTGNSSRIEASALRD
FT                   LTPQQMADYLSHFRADAIVRDAEHLRLRHFGGRRWTTLGQSYGGFITLTYLSQAPQGLH
FT                   ACYITGGLPAIAPGATRLYEATYNLVAQRNQIFFTRYPQVREQLDRIVALLREQAVYLP
FT                   DGDLLSVERLLTLGLDMGMSEGYERLLWLLDEAFNQEGELSDTFLNQVMQRSGFADNPL
FT                   YAVLHESIYADDASGATHWAAQRVRDGLPAFSSERSSPLLTGEMIYPWMFDQMQSLRPF
FT                   RAAAELLARREVWPALYDAARLRDNGIPVMAAVYYHDMYVDVGLSLESAAQIGNLQTWI
FT                   TSEYDHNGLRVAPVFRRLREMMAERGVMAE"
FT   gene            complement(255423..256055)
FT                   /locus_tag="NT01EI_0249"
FT   CDS_pept        complement(255423..256055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0249"
FT                   /product="Opacity family porin protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67492"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCC9"
FT                   /protein_id="ACR67492.1"
FT                   /translation="MKAFTKLALFVGLVSGATLANAAGTNNTGYYAGAKMGISAEHLFD
FT                   QKDVNGNGMSNDNKGVGNAGLVFGYNFENQFSLPVRAELDYTFRAHATSSHTNDAAETN
FT                   NSRLGLQTLMVNGYYDIKTGTPFTPYIGAGIGYANVSLKNDMNGDNVQSNSNNFAWSVG
FT                   TGVIYNVNERLDLDLGYKYLDAGKANAGNSQAKVATHDFTLGVNYYF"
FT   gene            256800..257654
FT                   /locus_tag="NT01EI_0250"
FT   CDS_pept        256800..257654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0250"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67493"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCD0"
FT                   /protein_id="ACR67493.1"
FT                   /translation="MIHLFNSMNIYPGIPIPDIPAENSSPEPDAVAAVLDSRHNYERIL
FT                   CHGPLSGVKSIEAGGNTTLLKFIERLMQERQFIDTLNEKNNQSYNSMYALEQIISEIGV
FT                   NSEEEIKISSALKQAVSDINHSIADVNRLSNQTNLPAMETAHVSAQGCGFSFIVKVIKS
FT                   RASEVKQHAAQIALLSNTISARAGQVCESVSAIHALITRISQEMASTSETLEQVIERSG
FT                   HMQKIIHHIAIQQFLNMVKRVHIIWKYQVCHYLFIRDRQAVMNVHHSCRLGHRYYTGEG
FT                   VMI"
FT   gene            257690..257803
FT                   /locus_tag="NT01EI_0251"
FT   CDS_pept        257690..257803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0251"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67494"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCD1"
FT                   /protein_id="ACR67494.1"
FT                   /translation="MPKCITLAVFGFEDYEAMEKEQEQMEEISCCRYSGDR"
FT   gene            257957..258484
FT                   /locus_tag="NT01EI_0252"
FT   CDS_pept        257957..258484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0252"
FT                   /product="copper/zinc superoxide dismutase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67495"
FT                   /db_xref="GOA:C5BCD2"
FT                   /db_xref="InterPro:IPR001424"
FT                   /db_xref="InterPro:IPR018152"
FT                   /db_xref="InterPro:IPR024134"
FT                   /db_xref="InterPro:IPR036423"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCD2"
FT                   /protein_id="ACR67495.1"
FT                   /translation="MKKMKVLVLATMLLSGAAYSASESVTLYEALPSGVGPAIGEVTIS
FT                   ETPYGLLFTPSLRTLPPGIHGFHVHENASCLPGAKEGKPVPALMAGGHWDPEKRDKHMG
FT                   PYSDAGHLGDLPGLVVNADGTADYAVLAPRLKSLAQLKGHALMVHAGGDNYDDHPHALG
FT                   GGGARMACGVIQ"
FT   gene            complement(258541..259221)
FT                   /locus_tag="NT01EI_0253"
FT   CDS_pept        complement(258541..259221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0253"
FT                   /product="respiratory nitrate reductase, gamma subunit,
FT                   putative"
FT                   /EC_number="1.7.99.4"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67496"
FT                   /db_xref="GOA:C5BCD3"
FT                   /db_xref="InterPro:IPR003816"
FT                   /db_xref="InterPro:IPR023234"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCD3"
FT                   /protein_id="ACR67496.1"
FT                   /translation="MSALSYFLFNIYPYIAITVLLLGCLYRFDYGQYTWKSGSSLLMAN
FT                   GRYSRYALNLFHVGMLGVFFGHVAGLLTPRSWYDAYISSQTHQILELIAGSLFGTLLLI
FT                   GALMLLARRLFCARVAATSSFSDKMILILLTIQICLGMLTIPVDLLHPSGATLQNLISW
FT                   SQGIVTFRPDPAQYLQEVNWLFKVHMVLGLTIFLIFPFTRLVHICSLPLGYLLRRRQVV
FT                   KTLR"
FT   gene            complement(259232..259885)
FT                   /locus_tag="NT01EI_0254"
FT   CDS_pept        complement(259232..259885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0254"
FT                   /product="nitrate reductase molybdenum cofactor assembly
FT                   chaperone, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67497"
FT                   /db_xref="GOA:C5BCD4"
FT                   /db_xref="InterPro:IPR003765"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="InterPro:IPR042290"
FT                   /db_xref="InterPro:IPR042291"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCD4"
FT                   /protein_id="ACR67497.1"
FT                   /translation="MLSLLILARLLDYPDEALWQARGELEAALPQCREMTAVQQGRLEA
FT                   FISHYWEAPLATRQSDYIAQFDHTRRCALYLCEHQLAESKNRGQAMVNILSHYRQATLE
FT                   PAPRELPDYLPMVLEFAYLRSQRQPEEGRRILTQIAEVAEILYRRTHDGIYGVLFQLLL
FT                   QLAGRETDGLTPEPDGAPTTIDAEWDRAHAPARVELPDMPRGRSAPVHYLDLER"
FT   gene            complement(259889..261409)
FT                   /locus_tag="NT01EI_0255"
FT   CDS_pept        complement(259889..261409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0255"
FT                   /product="nitrate reductase, beta subunit, putative"
FT                   /EC_number="1.7.99.4"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67498"
FT                   /db_xref="GOA:C5BCD5"
FT                   /db_xref="InterPro:IPR006547"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR029263"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCD5"
FT                   /protein_id="ACR67498.1"
FT                   /translation="MKIRAQVSMVLNLDKCIGCHTCSVVCKNVWTSREGIEYGWFNNVE
FT                   TKPGRGFPRDWEDQDKWHGGWQRVNGQLTPRMGGKLSLLAKIFANPHMPAIGDYYEPYS
FT                   FDYAHLHNAPAGARHQPTARPYSLLTGKTLEKIEGSANWEDDLGGEARVRQGDRNLDGL
FT                   DKQRYAQFEQTFMMYLPRLCEHCLNPACVASCPSGAIYKRAEDGVVLINQDQCRGWRMC
FT                   VSACPYKKIYYNWKSGKSEKCIFCYPRIEAGLPTLCSESCVGRIRYIGVMLYDAEAIPT
FT                   AAAEADPQALYEAQMKIFLDPGDPDVIAQARRDGISDEILEHAQRSPVYRLIKEWRLAL
FT                   PLHPEFRTLPMVWYVPPLSPIRFDDAGLAEPHDIHLAELAQMRIPIDYLANLLCAGNRK
FT                   PVEAALTRLSALRHYRRSLLSPQAPQWLQQANLSAPQAEAMYHLLALAPYHERFVIPTG
FT                   MHRPGGDREYIEHGSCGFSFNSPHDTDGANLTGYRPDDRLVISTHSKE"
FT   gene            complement(261436..265107)
FT                   /locus_tag="NT01EI_0256"
FT   CDS_pept        complement(261436..265107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0256"
FT                   /product="nitrate reductase, alpha subunit, putative"
FT                   /EC_number="1.7.99.4"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67499"
FT                   /db_xref="GOA:C5BCD6"
FT                   /db_xref="InterPro:IPR006468"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR028189"
FT                   /db_xref="InterPro:IPR037943"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCD6"
FT                   /protein_id="ACR67499.1"
FT                   /translation="MSTFLKKIRYFTAGKPMAANAHELYLQDSVGWEQSYRSRWQYDKV
FT                   VRSTHGVNCTGSCSWKIYVKSGLITWETQYTDYPETPIDLPNHEPRGCPRGASYSWYIY
FT                   SANRIKYPLMRSALRDLWREQKALHPDAVDAWLAILDNPELSQCYKRERGMGGLVRVSW
FT                   QEANELIAASNIATVKRFGPDRVAGFSPIPAHAMLSFASGSRYLSLIGGTCLSFYDWYC
FT                   DLPPSSPQTWGEQTDVPESADWYNAQYLVMWGSNVPQTRTPDAHFMTEARYNGTKVVAI
FT                   SADYAENCKFADEWLAPRAGTDSALALALGQVILQQFYLRQPCDYFVRYAKRFTDFPML
FT                   VMLSPCSGQENTYQSGRYLRAADLAAWREQPLAQWKTLAFDQGSRQIVIPRGSAGFRWD
FT                   QGGQWNTVQQDALSGAAIDPLLSLQALDEGEVCVVQPDFSHDNANDRYTYGQVPVHWIT
FT                   TASGECVAVATVFDLMLAHYGLRPRTGEIPAEDAPCSPAWAEAITGVPRQQIIRLAQEF
FT                   ANNARLTHGRSLIIVGAGINHWFHSDMTYRSIINVLMMCGTIGVNGGGWAHYVGQEKLR
FT                   PLAGWAPVALAGDWQSPARLMNGTSFFYNHTSQWRYENVDAHTLLSPLAERDRFPHSLI
FT                   DFNVIAERLGWLPSSPQLDRNPLTLAAGAAEGDVRAGVAQALKQGSLRIASEDPDAPGN
FT                   YPRILFVWRANLLGSSSKGHEYFLKHLLGTRHGVMEQDLQQKGLPLPQQVTWRDSVEGK
FT                   LDLLVTLDFRMSTTCLYSDVILPSATWYEKEDLSSTDMHPYIHPFTRAIDPMWEARPDW
FT                   DIFKGIARQFSALCEGHLGKERDVVLTPLLHDSPAELGQACGVSDWKNDPQTFVAGKTA
FT                   PAIAVVARDYPQTYFKYTHLGPALAAHGNGGKGVHWDTRPEIDSLYARHGSETLDGVGP
FT                   CANMQDATQALETILTLAPETNGQVADRAWRDLAAKTGQQEIAGLAADKKGVHYRFADI
FT                   QRQPGRVIASPLWSGIDSDRHAYTAGSLNITHAVPWRTLTGRQQAYQDHAWMQAFGEGF
FT                   ACYKPPLDTQSCRSVREHTANGQPELVLNFGTAHQKWGIHSTYTDNQIMQTLSRGGPLI
FT                   WISEHDAQRGAIADNDWVELFNGNGAMVARAVVSQRIPAGLALMYHAQERTLNMPLSEV
FT                   TGKRGGIHNSITRICPNPIHMIGGYAHLSWGYNYYGTIGSNRDETVIIRRLNRVEWD"
FT   gene            complement(265126..266499)
FT                   /locus_tag="NT01EI_0257"
FT   CDS_pept        complement(265126..266499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0257"
FT                   /product="transporter, major facilitator family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67500"
FT                   /db_xref="GOA:C5BCD7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCD7"
FT                   /protein_id="ACR67500.1"
FT                   /translation="MSNQPLENQNARVLKNWDPEDEIFWKATGNSIAKRNLWVSVFCLV
FT                   LAFCIWMVFSSVVIKLNHIGFNFTTNQLFWLAALPSISGAILRIPFSFVVPIFGGRRWT
FT                   TISTALLLIPSVWLGCAIQDPQTSFYSFACIAILCGIGGGNFASSMANISFFFPKRLQG
FT                   YGLGINGGLGDGGIGVVQLCVPLVIGIGLFGSLGGAPQQVDHNAMIWLQNAAFLWAPFI
FT                   IIACLLSWFMMNDIAGMQSSLSSQFVILGKKDTWITSLIYLATFGSFVGFSAGFALLTK
FT                   TQFPDIDIIDYAFVGPLLGAIARPIGGRLSDQFSGYRITQVAFFFMIIFSLLIVPTLPS
FT                   ERSSGSFILFYIVFMGLFIFTNLGSGSSFQLISQIFHQKSAQEAQQQGMQGKHVEQYAD
FT                   VMSSAALGFTSAIGGFIIPKTFGSAITLTHSVLLPLVCFSVFYLLCMGVTWLSYGRHH"
FT   gene            complement(266808..266945)
FT                   /locus_tag="NT01EI_0258"
FT   CDS_pept        complement(266808..266945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0258"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67501"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCD8"
FT                   /protein_id="ACR67501.1"
FT                   /translation="MFYSASLYDTILINLCGKKICHIALYYIDISHLIKKAFTLLIRRQ
FT                   "
FT   gene            complement(267214..267336)
FT                   /locus_tag="NT01EI_0259"
FT   CDS_pept        complement(267214..267336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0259"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67502"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCD9"
FT                   /protein_id="ACR67502.1"
FT                   /translation="MIQRTSDLLGYDSAEINKIVFPCVKTIKCELSERHYIVIC"
FT   gene            267516..268970
FT                   /locus_tag="NT01EI_0260"
FT   CDS_pept        267516..268970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0260"
FT                   /product="transporter, divalent anion:Na+ symporter (DASS)
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67503"
FT                   /db_xref="GOA:C5BCE0"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="InterPro:IPR030676"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCE0"
FT                   /protein_id="ACR67503.1"
FT                   /translation="MKQGYSILIPFIVGGALACLPAPAGLSHHAWLYFSIFIGSIVGLI
FT                   IEPLPGAVIGLIAIVIIAGLGRWVLFSPEQLTQPHFHATSAAFKWAVSGFSNSTVWLIF
FT                   SAFMFALGYEKTGLGRRISLLLVKSLGRRSLTLGYAIAIADLVLAPFTPSNTARSAGTI
FT                   YPVISNLPPLYDSKPNDPSARRIGSYLMWVSISITCVTSSMFLSALAPNLLSSALINQM
FT                   TGLQISWGSWFIAFLPCGIVLWLLTPLLGYWLYTPEVKINDEVPKWARQELENLGGLSR
FT                   REKLLLLFVALALLLWVFGGGFINSAIAALLVIALMLITNVISWDDVISNKAAWNTLFW
FT                   FGTLVSLASGLSTVGFVHWFGIVISDYLNGMSVMVASVSLLLCFYLLHYFFASTTAHAT
FT                   ALIPVMIAAAMDIHGINMMEFSLAISLSLGIMGIITPYGTGPSPIYFGSGYLPSKDFWR
FT                   LGAIFGMVNLLAYLFICLPWINYLYR"
FT   gene            complement(269590..269742)
FT                   /locus_tag="NT01EI_0261"
FT   CDS_pept        complement(269590..269742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0261"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67504"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCE1"
FT                   /protein_id="ACR67504.1"
FT                   /translation="MSPSARYREKLGILFLITSKYFIKADSDIVIANYIIYISTTVHAI
FT                   TQERL"
FT   gene            complement(270156..270293)
FT                   /locus_tag="NT01EI_0262"
FT   CDS_pept        complement(270156..270293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0262"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67505"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCE2"
FT                   /protein_id="ACR67505.1"
FT                   /translation="MRQHLRSTDVAGMLDSIAHRRPLPQVLKADNGSEFAGEILDRGGE
FT                   "
FT   gene            complement(270306..270542)
FT                   /locus_tag="NT01EI_0263"
FT   CDS_pept        complement(270306..270542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0263"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67506"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCE3"
FT                   /protein_id="ACR67506.1"
FT                   /translation="MLQREGWHDNRTWIYRLYCEQGLSLRLNGHATINQPSGGSCSLMA
FT                   CLQTRFGAWILSLIRGLTVTAAPIDDFDLYTRE"
FT   gene            complement(270878..271000)
FT                   /locus_tag="NT01EI_0264"
FT   CDS_pept        complement(270878..271000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0264"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67507"
FT                   /db_xref="GOA:C5BCE4"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCE4"
FT                   /protein_id="ACR67507.1"
FT                   /translation="MKKSRFTEEQIAFALKQTELDTPMPDVCCKLGISDATFYT"
FT   gene            complement(270978..272165)
FT                   /locus_tag="NT01EI_0265"
FT   CDS_pept        complement(270978..272165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0265"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67508"
FT                   /db_xref="InterPro:IPR003507"
FT                   /db_xref="InterPro:IPR027461"
FT                   /db_xref="InterPro:IPR027478"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR040449"
FT                   /db_xref="InterPro:IPR040921"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCE5"
FT                   /protein_id="ACR67508.1"
FT                   /translation="MIKIKIRVSKEIIITALLLFLSGCATTSPPKTAVKKIAPPPVTHE
FT                   RKGYSVQKGTIFLISSSSQYDENVIPEIEMAFSRQCYSVDKRYLNQQPTRLGYVNTDEK
FT                   RAQTLINALSDRNVRYLWFIRGGSGAFNLYPALHAERQHISKSTPKIIIGFSDVTAIHS
FT                   FVNHELNWSSVHGVLASSNKEMHDIDKSKKASMNNSLSEVFETLSHGSHYTGIEPMNSQ
FT                   AVKKVSGKLDGGNMTLVQSLFSTIYEGSYSDKIMMLEDIGVTEKQLDRTLHQIAFSRKF
FT                   HPRAVIFGQFYGQDASDEEKSLYRYVIQQFANLVSYPVYYYPEFGHAETNQPFILNHQV
FT                   NILCSSKYRLCSLTQAPALFMSDPAPKSCAIQKQNSGMRNTPLGGGGTDEKVTIH"
FT   gene            complement(272552..272851)
FT                   /locus_tag="NT01EI_0266"
FT   CDS_pept        complement(272552..272851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0266"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67509"
FT                   /db_xref="GOA:C5BCE6"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCE6"
FT                   /protein_id="ACR67509.2"
FT                   /translation="MIWVSDPYTKHKVTLMLHTTNPVIKHKTGFPNLAEELSNMEKSYK
FT                   IMDVSRDTFYRSRELADEGGVDALINRSRRAPNSVIRTAIKKRKYSRRIARCVR"
FT   gene            complement(272963..274663)
FT                   /locus_tag="NT01EI_0267"
FT   CDS_pept        complement(272963..274663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0267"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67510"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCE7"
FT                   /protein_id="ACR67510.1"
FT                   /translation="MRDTSVNTYARAFSPDKNIKKPVVDEKSSMPTQIAKVVLGILNPG
FT                   IDHEAICLIDKHINRDPKTIGFMDNVRTIHDALSDAVVSDIKEVDVSFSDEFEALTFKE
FT                   KKDDTGNPIVTITYGNHDDNIKGTLASIVRKLEDDFNASPDLYKIGSSYRSLDARLELT
FT                   EIKDMKSEMAMIPAPEIYADDPKNLKAYKISPSTALLMAIKDFPQKNSEISSFLFTGRT
FT                   SENYVSFDKLIVEFCKLHPEYHVATGSTFINRDPVRNYFETQFSFNYLINNLHAIDEGE
FT                   LDALICENMKLLNEDDDILSRTLSGNAIDRDDLIHKEYSDAIANIKVGVGYGGIPLEER
FT                   GKLEKIVKLSFLSVAVAWIKCLPIDIYNTGVYDDDIKGKTIKSNQSHVTSAHMGMMKSY
FT                   HPLPRDDIAYRDKATTFIRPVDQASFSEYAPLVVNVNSKLVHARSNGISGTMLCQARVL
FT                   QYLKEIEAFCFNKTNPLVYIHVLASAMLFNSGGHSYNEFLSPFTLKRVNTRLSSVFDVV
FT                   GEGYRMDSIVSNVGINPSVVDKTLSYFNHLEMKQKLHNELMAKRARVYG"
FT   gene            complement(275397..275474)
FT                   /locus_tag="NT01EI_T00011"
FT   tRNA            complement(275397..275474)
FT                   /locus_tag="NT01EI_T00011"
FT                   /product="tRNA-Phe"
FT                   /note="putative tRNA-Phe"
FT   gene            275786..276223
FT                   /locus_tag="NT01EI_0269"
FT   CDS_pept        275786..276223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0269"
FT                   /product="nickel-responsive transcriptional regulator NikR,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67511"
FT                   /db_xref="GOA:C5BCE8"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR014160"
FT                   /db_xref="InterPro:IPR014864"
FT                   /db_xref="InterPro:IPR022988"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BCE8"
FT                   /protein_id="ACR67511.1"
FT                   /translation="MQRVTLSLDDDLMAEIDAIIRAGNYQNRSEVIRDLARAGLQSMAQ
FT                   APSPSACCVAALFYVYDHESRELSKRLTRTFHDHHDLSLASLHVHLDHGSCLEVSLLKG
FT                   AGGEVTRFAERVIAERGVRHGKLVVVPGDEGVAPPHPHSHD"
FT   gene            complement(276239..277318)
FT                   /locus_tag="NT01EI_0270"
FT   CDS_pept        complement(276239..277318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0270"
FT                   /product="transglycosylase SLT domain protein"
FT                   /EC_number="3.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67512"
FT                   /db_xref="GOA:C5BCE9"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR023664"
FT                   /db_xref="InterPro:IPR024570"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BCE9"
FT                   /protein_id="ACR67512.1"
FT                   /translation="MKKVLALALIAPLLISCSGKKPDSNGEEYIKDTNGFDILMGQFAH
FT                   NIENIWGINEVLIAGPKDYVKYSDRYLTRSHINFETGQITIETIATLNPAETLRQAIVT
FT                   TLLMGDDPSSIDLYSDANDIKPSREPFLYGQVLDNTGQPIRWSGRANSFADYLLQNKLM
FT                   KRTSGLHVIYSVTIQLVPNHLDKRAHKYLDMVRRASERYGVDESLILAIMQTESSFNPY
FT                   AVSRSDALGLMQVMQHTAGKDVFVSKGKWGTPSRSYLFDPEKNIDTGTAYLAILQNTYL
FT                   GGIQNTTSRRYAVITAYNGGAGSVLRIFSSDKGQAVNIINQMSPGDVYEALTQRHPSAE
FT                   SRRYLYKVNNTQKNYRRIR"
FT   gene            complement(277366..277638)
FT                   /locus_tag="NT01EI_0271"
FT   CDS_pept        complement(277366..277638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0271"
FT                   /product="Protein of unknown function (DUF495)"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67513"
FT                   /db_xref="GOA:C5BCF0"
FT                   /db_xref="InterPro:IPR007457"
FT                   /db_xref="InterPro:IPR036766"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BCF0"
FT                   /protein_id="ACR67513.1"
FT                   /translation="MSRTVFCTFLNREAEGLDFQSYPGDLGKRIYDHISKEAWGQWMAK
FT                   QTMLINEKKLNMMNPDDRSLLAREMEKFLFEGHDVHIEGYTPPNQ"
FT   gene            complement(277641..278729)
FT                   /locus_tag="NT01EI_0272"
FT   CDS_pept        complement(277641..278729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0272"
FT                   /product="A/G-specific adenine glycosylase, putative"
FT                   /EC_number="3.2.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67514"
FT                   /db_xref="GOA:C5BCF1"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCF1"
FT                   /protein_id="ACR67514.1"
FT                   /translation="MMQAQQFAHAVLAWYARFGRKTLPWQHPKTPYRVWLSEVMLQQTQ
FT                   VATVLPYFQRFTQRFPDVQTLASAPLDEVLHLWTGLGYYARARNLHKAAQLIVSRHHGE
FT                   FPHDFEQVAALPGIGRSTAGAILSLSLGQHHPILDGNVKRVLARCYAVPGWPGRKDVET
FT                   RLWQLSGEVTPADGVSQFNQAMMDLGALVCTRSRPKCELCPLNAGCLAYADGNWADFPG
FT                   KKPRQTLPERQAYLLLLQHGETVWLQQRPASGLWGGLFCFPQYDSEAALHTRLRHLGQD
FT                   PTAAQTLTAFRHTFSHFHLDIIPVWSTYTTASACMDEGDGLWYNLAQPPSVGLAAPTER
FT                   LLQQLRRQPPASAATGDATEKE"
FT   gene            279019..279735
FT                   /locus_tag="NT01EI_0273"
FT   CDS_pept        279019..279735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0273"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase, putative"
FT                   /EC_number="2.1.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67515"
FT                   /db_xref="GOA:C5BCF2"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BCF2"
FT                   /protein_id="ACR67515.1"
FT                   /translation="MNDVITAEFDENGRAIRRIRSFVRRQGRLTKGQQLALDEYWPLMG
FT                   VEFTPEALDLPTLFGREAPVVLEIGFGMGASLVAMAQQHPERDFLGIEVHSPGVGACLS
FT                   SAHEAGVNNLRVMCHDAVEVLERMIPDASLDMVQLFFPDPWHKARHHKRRIVQSAFAGR
FT                   IRGKLKISGVFHMATDWENYAEHMLEVMNHAPGYRNLSDDNTYVPRPDSRPVTKFELRG
FT                   QRLGHGNWDLMFERVE"
FT   gene            279735..280061
FT                   /locus_tag="NT01EI_0274"
FT   CDS_pept        279735..280061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0274"
FT                   /product="Protein with unknown function (DUF469)"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67516"
FT                   /db_xref="InterPro:IPR007416"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCR0"
FT                   /protein_id="ACR67516.1"
FT                   /translation="MAKNRSRRLRKKLHIDEFQEVGFSASWRFAEGTPVETVDALLDRL
FT                   IDEVIEPNGLAFDGSGYLRWEGLICLQQIGRCTDEQRQLVKGWLESQGMLDVVVSDLFD
FT                   VWWE"
FT   gene            280260..281186
FT                   /locus_tag="NT01EI_0275"
FT   CDS_pept        280260..281186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0275"
FT                   /product="glutaminase, putative"
FT                   /EC_number="3.5.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67517"
FT                   /db_xref="GOA:C5BCR1"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCR1"
FT                   /protein_id="ACR67517.1"
FT                   /translation="MQTELSDQLLGEILEQVRPLLGQGRVADYIPALAGVAPDRLGIAV
FT                   CTVDGRMFSAGDAAERFSIQSISKVLSLTLAMHRYSEAEIWQRVGKEPSGQPFNSLVQL
FT                   ELEQGKPRNPFINAGALVVCDMLQSRLSAPRQRMLEVVRALSGSADICYDSPVARSEFE
FT                   HSDRNAAIAYLMKSFGNFDNDVITVLHNYFHYCALRMNCMELARTFVYLANRGRALALD
FT                   EPVIGERQARQINALMVTSGLYDGAGEFAYRVGMPGKSGVGGGVVAVVPQEMIIAVWSP
FT                   QLDSCGNSLAGIAALELLAQRIGRSIF"
FT   gene            281197..281925
FT                   /locus_tag="NT01EI_0276"
FT   CDS_pept        281197..281925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0276"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67518"
FT                   /db_xref="InterPro:IPR021307"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCR2"
FT                   /protein_id="ACR67518.1"
FT                   /translation="MGKWGCSLLLLLATAQVQAAWQCQVKPQDDIIISAQQVQIVGASG
FT                   NLQISRDGAVTRDGHPLALSADARRQAETLQRDLRRDVPWIDQGVQTRLDRARGALDNI
FT                   IVEQLGSDSNVRNRLSTLDTQLKAQMNRVLEKRSDGYAFHHQAIAQVEKEGQTLVNQTL
FT                   GGVLQDSINEMGAKGLLKAGQSENPLQAVLGNLGGLQQSIRSEWDKQDNDLRAFGQQAC
FT                   ERVQALDSQRKALLKALPAS"
FT   gene            282053..283672
FT                   /locus_tag="NT01EI_0278"
FT   CDS_pept        282053..283672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0278"
FT                   /product="periplasmic oligopeptide-binding protein
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67520"
FT                   /db_xref="GOA:C5BCR3"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCR3"
FT                   /protein_id="ACR67520.1"
FT                   /translation="MNIKYNLFLGYGLFMLIFGMGPSGGALAASVAPGVTLAAGQTLTR
FT                   NNGSEPASLDPHKSESDVEFNIINDFFEGLVTMGPDGHIRPGLAERWENSEDGRIWRLY
FT                   LRPGLQWSNGEPLTARDVVFSWQRQVDPATASPYGSYLANMHLENAIQIQAGQQPPEAL
FT                   GIRAVDDVTLQITLTRPLSTFLSMLVHPSLMTVNPRVIARFGDKWTQPGNFVSSGAYTL
FT                   QRWVVNERLEGVRNPRYWDNAHTVINQVTYLPIVSETADVNRYKAGEIDITASVPSPQF
FT                   AALRRELGEQVHIAPKLATYYYYFNTRKPPFDDPRVRLALNLGLDKDVIADKVLGQGQR
FT                   PAWLFSAGKIGGMTLLPPEYAAWPREQRLARARALLTEAGFGPDSPLHFTLLYNTSEGH
FT                   QRIAIAASSMWKKNLGVEAALNNQEWKTMLDTMRSGNFDLVRSGWVADYDDPSAFLNTF
FT                   RSADSNNTPQYVNPRYDALLAGAADSQDPEKRQQLFQQAETILAAEVPAIPLYHYVSVR
FT                   LVKPHVGGFRAANKTVQQSASR"
FT   gene            complement(283638..284039)
FT                   /locus_tag="NT01EI_0277"
FT   CDS_pept        complement(283638..284039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0277"
FT                   /product="transposase, IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67519"
FT                   /db_xref="GOA:C5BG24"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:C5BG24"
FT                   /protein_id="ACR67519.2"
FT                   /translation="MERQGIPLAVLVSGANRHDSIMFEPLLDALPALAGKRGRPRYRPD
FT                   KLHADKGYDFRRCRDYLRRRGIKARIARRGIDSNDRLGRYRWVVERTHGWLAGFGKLRI
FT                   RFERRLDTHLALLTLACAVICLRFVERFC"
FT   gene            complement(284606..285736)
FT                   /locus_tag="NT01EI_0279"
FT   CDS_pept        complement(284606..285736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0279"
FT                   /product="oxygen-independent coproporphyrinogen III
FT                   oxidase, putative"
FT                   /EC_number="1.3.99.22"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67521"
FT                   /db_xref="GOA:C5BCR5"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCR5"
FT                   /protein_id="ACR67521.1"
FT                   /translation="MLKLPPLSLYIHIPWCVQKCPYCDFNSHAQKGEIPQQAYVDHLLA
FT                   DLDQELPRVAGRTISTLFIGGGTPSLLSGEALQHLLDGVRARLPLAADAEITMEANPGT
FT                   VEAERFSAYQRAGVNRISIGVQSFSADKLQRLGRIHGPQEAIAAARLARTLGLRSFNLD
FT                   LMHGLPQQSREEALDDLRQAIALNPPHLSWYQLTIEPNTLFGSRPPRLPDDDALWEIFE
FT                   QGDRLLRESGYQQYETSAYALPGRQCQHNLNYWRFGDYLGIGCGAHGKLTFADGRIERH
FT                   AKTRHPRGYMQGNYLDQRQQVAMAERPFEFFMNRFRLLEPAPRADFSAYTGVDQATIRP
FT                   QLEAALTQGYIRETPSHWQVTPHGKLFLNSLLELFL"
FT   gene            complement(285729..286322)
FT                   /locus_tag="NT01EI_0280"
FT   CDS_pept        complement(285729..286322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0280"
FT                   /product="non-canonical purine NTP pyrophosphatase,
FT                   RdgB/HAM1 family, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67522"
FT                   /db_xref="GOA:C5BCR6"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCR6"
FT                   /protein_id="ACR67522.1"
FT                   /translation="MQHVVLATGNAGKVRELASLLTDFGLDIVAQSTLGIDGAEETGLT
FT                   FIENAILKARHAARLSGLPAIADDSGLAVDALGGAPGIYSARYAGEDASDRTNMEKLLA
FT                   ALQDVPADQRQARFHCVLVYLRHADDPTPLVCHGVWEGEIADAPSGDGGFGYDPIFFVP
FT                   AQGCTAAQLSREQKRTISHRGQALQQLLDRIRHA"
FT   gene            complement(286404..286694)
FT                   /locus_tag="NT01EI_0281"
FT   CDS_pept        complement(286404..286694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0281"
FT                   /product="conserved hypothetical protein TIGR00251"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67523"
FT                   /db_xref="InterPro:IPR003746"
FT                   /db_xref="InterPro:IPR005228"
FT                   /db_xref="InterPro:IPR036591"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BCR7"
FT                   /protein_id="ACR67523.1"
FT                   /translation="MSAVSREGDDWILRLYIQPKASRDLIIGLHGDELKVAITAPPVDG
FT                   QANAHLLKFIAKQFRVAKSRITLEKGELGRHKQLRISQPQQIPDAVAAALG"
FT   gene            complement(286691..287245)
FT                   /locus_tag="NT01EI_0282"
FT   CDS_pept        complement(286691..287245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0282"
FT                   /product="YGGT family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67524"
FT                   /db_xref="GOA:C5BCR8"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCR8"
FT                   /protein_id="ACR67524.1"
FT                   /translation="MLTLTFLVKTLLDLYVMVLLLRIWMQWARSDFYNPLSQFIVKLTQ
FT                   PVVAPLRRILPPLGPIDSASLLLAFILMTVKYPLLLLIQSGSLSLSPYNLLFGLISVVK
FT                   SAGYLVFWVIIIRSIMSWISQGRSPMDYVLYQLSEPLMAPIRRIIPAMGGLDFSAMVVI
FT                   LVLYLLNYLGIDLFGQLWFLL"
FT   gene            complement(287351..288061)
FT                   /locus_tag="NT01EI_0283"
FT   CDS_pept        complement(287351..288061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0283"
FT                   /product="alanine racemase, N-terminal domain protein"
FT                   /note="alanine racemase, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67525"
FT                   /db_xref="GOA:C5BCR9"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCR9"
FT                   /protein_id="ACR67525.1"
FT                   /translation="MNTTIKHNLDAVRQHIARAAEQCGRHPRDITLLAVSKTKPIEDID
FT                   AAIAAGQRAFGENYVQEGVSKIQHYRQQPQGDALEWHFIGPLQSNKSRPVAEHFDWIHT
FT                   VDRVKIAQRLNEQRPAQLKPLNVLIQVNISDEQSKSGITLEQIDALADAISQLPRLRLR
FT                   GLMAIPAPEDDPARQLAVCTRMAQALSALQRRYPQLDTLSLGMTHDMEAAITAGSTLVR
FT                   IGTAIFGARDYGTA"
FT   gene            complement(288246..288668)
FT                   /locus_tag="NT01EI_0284"
FT   CDS_pept        complement(288246..288668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0284"
FT                   /product="conserved hypothetical protein TIGR00250"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67526"
FT                   /db_xref="GOA:C5BCS0"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BCS0"
FT                   /protein_id="ACR67526.1"
FT                   /translation="MNPRTILAFDFGTRSIGCAIGQELTGSARPLQSFKANDGVPDWQQ
FT                   IEKVLREWQPDLVVVGLPLNMDGSEQPLTQQARKFANRLHGRFGVQIALQDERLSTVEA
FT                   RAHLFAGGGYRALEKGRVDAASAALILESWFENQYR"
FT   gene            complement(288668..289201)
FT                   /locus_tag="NT01EI_0285"
FT   CDS_pept        complement(288668..289201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0285"
FT                   /product="hypothetical protein"
FT                   /note="Uncharacterized ACR, COG1678"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67527"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCS1"
FT                   /protein_id="ACR67527.1"
FT                   /translation="MPAMQDSRFKRTVIYVCEHNEDGAMGMIINKPLEQLTLSSLLEKL
FT                   DITPSPRDATIRLDKPVLAGGPLAEDRGFVLHSPTDTFGSSADIGPGCMLTTSRDVLET
FT                   LGTDRQPQEILVTLGYCSWSKGQLEQELLDNTWLTVEADSQILFHTPLAERWIGAAKKL
FT                   GVDIRNMPCNAGHA"
FT   gene            complement(289462..290412)
FT                   /locus_tag="NT01EI_0286"
FT   CDS_pept        complement(289462..290412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0286"
FT                   /product="glutathione synthase, putative"
FT                   /EC_number="6.3.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67528"
FT                   /db_xref="GOA:C5BCS2"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCS2"
FT                   /protein_id="ACR67528.1"
FT                   /translation="MIKLGIVMDPIASINIKKDTSFAMLLEAQHRDYQLHYMEMSDLYL
FT                   QQGEARAQTRLLSVSDDKTSWYRFDGEQDIALADLDVILMRKDPPFDTEFIYATYILER
FT                   AEARGTLIVNKPQSLRDCNEKLFTAWFADLTPDTLVTRSAAHLRDFHARHGDIILKPLD
FT                   GMGGASIFRIQQDDPNLSVIIETLTEHGKRFCMAQNYLPAIVDGDKRVLVVDGEPVPYC
FT                   LARIPKSGETRGNLAAGGRGEARPLSESDWAIARKVAPMLKEKGLIFVGLDIIGDRLTE
FT                   INVTSPTCAREIEAAFPVSITGMLMDAIEARLAAR"
FT   gene            complement(290446..291177)
FT                   /locus_tag="NT01EI_0287"
FT   CDS_pept        complement(290446..291177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0287"
FT                   /product="conserved hypothetical protein TIGR00046"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67529"
FT                   /db_xref="GOA:C5BCS3"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCS3"
FT                   /protein_id="ACR67529.1"
FT                   /translation="MRIPRIYHPQPLSIPGEVSLCDDAANHVGRVLRMGPGQALQLFDG
FT                   SNRVFDAEIVSADKKNVRVRLDGVREEDSESPLHLHLGQVMSRGEKMEFTIQKSIELGV
FT                   SVITPLISERCGVRLDAERMAKKQQQWQKIAIAACEQCGRNRIPQIRPIMTLEAWCAEP
FT                   DDGLRLNLHPRASASINTLPLPQHRIRLLIGPEGGLSADEIAMTANHRFTDILLGPRVL
FT                   RTETTALTAITALQVRFGDLG"
FT   gene            complement(291285..291995)
FT                   /locus_tag="NT01EI_0288"
FT   CDS_pept        complement(291285..291995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0288"
FT                   /product="endonuclease-1, putative"
FT                   /EC_number="3.1.21.1"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67530"
FT                   /db_xref="GOA:C5BCS4"
FT                   /db_xref="InterPro:IPR007346"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCS4"
FT                   /protein_id="ACR67530.1"
FT                   /translation="MFPKSFIALSALLGCLLLPVAHAEHPHNFSQAKTVAAKINHDAPG
FT                   TFYCGCRIDWQGKKGTPDLASCGYQVRKNAHRAGRIEWEHVMPAWQFGHQMLCWQEGGR
FT                   KNCAKNPDYVRIETDLHNLQPAIGEVNGDRNNFAFSQWRGGEGQYGQCTMKVDFKNRQA
FT                   EPPERARGAIARTYFYMRDRYHIRLSPQQTRLFDVWNRQYPVTAWECEREARINKVQGN
FT                   PNPYVQQACAARKG"
FT   gene            complement(292113..292640)
FT                   /locus_tag="NT01EI_0289"
FT   CDS_pept        complement(292113..292640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0289"
FT                   /product="metallopeptidase, SprT family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67531"
FT                   /db_xref="GOA:C5BCS5"
FT                   /db_xref="InterPro:IPR006640"
FT                   /db_xref="InterPro:IPR023483"
FT                   /db_xref="InterPro:IPR035240"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCS5"
FT                   /protein_id="ACR67531.1"
FT                   /translation="MLAAMNTPRLPIALQQAVMLTLRRCLGQAEQRLNQTLPQPQIDYC
FT                   QRGTIAGTAWPQQWKIRLNPVLLQENGQTFIDSVIPHELAHLLVYRRFGRVAPHGREWR
FT                   WMMAEILGVAPLRTHRFSVDSVRGRTFTYRCACQLHQLTLRRHNRVQRGGSSYRCRQCG
FT                   AALSFTPDATSE"
FT   gene            293003..294322
FT                   /locus_tag="NT01EI_0290"
FT   CDS_pept        293003..294322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0290"
FT                   /product="basic amino acid/polyamine antiporter (APA)
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67532"
FT                   /db_xref="GOA:C5BCS6"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004754"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCS6"
FT                   /protein_id="ACR67532.1"
FT                   /translation="MASVKKIGLIACTGVVAGNMMGSGIALLPANLASLGSIAVWGWLI
FT                   ALVGAVSLAYVYARLATKNPQEGGPVAYAGEVGAAFGFQTGVLYYHANWIGNLAIGITA
FT                   ISYLSTFFPVLNSPVPAGIACIAIVWIFTFVNMLGGAWVSRLTTLGLVLVLIPVIGTGI
FT                   AGWFWFEPATYMANWNTSGGTDYHAVIKSILLCLWAFIGVESASVSTGMVKDPQRNVPL
FT                   ATMMGTFLAGIVYIAATQAIAGMYPAHQMAASGAPFAISASTMVGSWAGPVVSAFTAFA
FT                   CLTSLGSWMMLVSQAGARAAHDGNFPKIYGELDKNGLPKKGLFLAAIKMTILMVLITVM
FT                   NASGDKASDLFGELTGIAVLLTMLPYFYSCIDLIRFDGANIKNVLSLLASILGCVFCFI
FT                   ALMGANSIELSGTFIVSLIILMFYSRKLGSTQDKDNAPRN"
FT   gene            294395..296545
FT                   /locus_tag="NT01EI_0291"
FT   CDS_pept        294395..296545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0291"
FT                   /product="Orn/Lys/Arg decarboxylase family, putative"
FT                   /EC_number="4.1.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67533"
FT                   /db_xref="GOA:C5BCS7"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR005308"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR011193"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCS7"
FT                   /protein_id="ACR67533.1"
FT                   /translation="MNIIAIMNDISAYFKEEPLRELQQELERAGFRLVYPRDRGDLLKL
FT                   IENNARLCGVIFDWDKYNLALCDEISALNKMLPIYAFANTSSTLDVSMSELRLNVRFFE
FT                   YTLGSAQDIALKIRQSTDQYIDAIMPPLTKALFKYVHEEKYTFCTPGHMGGTAFEKSPV
FT                   GALFYDFYGENTLRSDISISVTELGSLLDHSGPHREAEEYIARTFNAERSYIVTNGTST
FT                   ANKIVGMYSSPAGASILIDRNCHKSLTHLMMMSSVVPLYLRPTRNAYGILGGIPRQEFT
FT                   REAIEEKVRNTPNASWPVHAVVTNSTYDGLFYNTGYIKQTLDVKSIHFDSAWVPYTNFH
FT                   PIYQGKAGMSGERVAGKVIYETQSTHKLLAAFSQASMIHVKGIINEETFNEAYMMHTST
FT                   SPHYGIVASAEMSAAMMKGNTGKRLIANSIERAIRFRKEIKHLRTESEGWFFDVWQPDN
FT                   IDEVACWPLNSRNDWHGFKNIDDDHMYLDPIKVTLLTPGMKADGTMDNWGIPASIVSKY
FT                   LDEHGIIVEKTGPYNLLFLFSIGIDKTKALSLLRALTDFKRVYDLNLRVKNVLPSLYRE
FT                   APEFYQNMRIQELAQGIHTLTGESRLPDLMYSAFDVLPTLILTPHDAFQEEVRGNIEIC
FT                   PLQQMIGRVSANMILPYPPGVPLIMPGEMITEASKPVLDFLQLLCDIGAHYPGFETDIH
FT                   GVRCNGKGEYEVVVLKHHGVQG"
FT   gene            complement(296619..297779)
FT                   /locus_tag="NT01EI_0292"
FT   CDS_pept        complement(296619..297779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0292"
FT                   /product="glutathionylspermidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67534"
FT                   /db_xref="InterPro:IPR005494"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCS8"
FT                   /protein_id="ACR67534.1"
FT                   /translation="MKRIAISERPDWRAKASEFGFQFHTMHGEPYWCEDAYYQFSMAQV
FT                   EALEETTAELHQMCLQAVEKVVDSEALLSRFQIPKHTWDFVRASWRSGQPSLYSRLDLA
FT                   YDGQGPAKLLENNADTPTSLYESAFFQWIWLEDQVRAGKLPAVADQFNSLQEQLIARFA
FT                   ELKTNHGFQLLHMACCQDSDEDRGTVQYLQDCAAEAGLATEFLYMDEIGLGEKGQFTDP
FT                   QDQVISNLFKLYPWEFMLREIFSTKLEDAGVRWLEPAWKSILSNKALLPMLWEMFPNHP
FT                   NLLPAYFADGSQPPLDRYVVKPLFSREGANIRIVENGQEIERVDGPYGEEGMIVQQYHP
FT                   LPRFGDSYTLIGSWLVNDSPAGIGLREDRSRITQDLSRYYPHIILD"
FT   gene            complement(297783..298460)
FT                   /locus_tag="NT01EI_0293"
FT   CDS_pept        complement(297783..298460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0293"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67535"
FT                   /db_xref="InterPro:IPR009576"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCS9"
FT                   /protein_id="ACR67535.1"
FT                   /translation="MKRTKHINRSAFRKRWQMAPLALAVSAVFLLAGCEKSDETVSLYQ
FT                   NADDCSKANPSMSAQCKASYDDALKEAAKTAPKYATREDCIAEFGEGQCTQTPAQAGMA
FT                   PTTGNTNAEAAQSSGSFWMPLMAGYMMGRLMGGGFNQQPLFTPRGAASPANGQFVDASG
FT                   KSYGPATAGGRTMNVPKTAMAPKPATTTTVTRGGFGETVAKQSSLQRSSASGTGTSSRS
FT                   MGG"
FT   gene            298443..298727
FT                   /locus_tag="NT01EI_0294"
FT   CDS_pept        298443..298727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0294"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67536"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCT0"
FT                   /protein_id="ACR67536.1"
FT                   /translation="MFGPFHDEVPRCGPSKSRARLSQIADSIGESWLHLKRAGAAVAGF
FT                   TYAEAVMCHSSLFRPLTRVTKPLDNARLAGICTGGNPRSAMLREIGLAY"
FT   gene            complement(298789..299358)
FT                   /locus_tag="NT01EI_0295"
FT   CDS_pept        complement(298789..299358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0295"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67537"
FT                   /db_xref="GOA:C5BCT1"
FT                   /db_xref="InterPro:IPR005325"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCT1"
FT                   /protein_id="ACR67537.1"
FT                   /translation="MIYFDRNRLLQLDPRFLKQQRVSLLILSLLLLLGGLFCLFRPLTS
FT                   GDALSAMVGILLLLSGIGLIIGMIANRANNFWPMIGGILMGAAYLVMGFIFIRNPEVGL
FT                   FTVAVLVATLFALGGIARLMAGVKLKGAHGGWLQIIIGLLDLLIAWMLISAGPQGSILL
FT                   VTMIVGIEMLFSSFSLFQVAQLLKQR"
FT   gene            complement(299469..299612)
FT                   /locus_tag="NT01EI_0296"
FT   CDS_pept        complement(299469..299612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0296"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67538"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCT2"
FT                   /protein_id="ACR67538.1"
FT                   /translation="MREKTPYCLYSRQKILSFHNYALEVTVARTFRLRLHSFFAAWPIM
FT                   DY"
FT   gene            299761..300678
FT                   /locus_tag="NT01EI_0297"
FT   CDS_pept        299761..300678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0297"
FT                   /product="Uncharacterized protein family (UPF0187)"
FT                   /note="Uncharacterised protein family (UPF0187)"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67539"
FT                   /db_xref="GOA:C5BCT3"
FT                   /db_xref="InterPro:IPR021134"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCT3"
FT                   /protein_id="ACR67539.1"
FT                   /translation="MIVRPPQHWFRRLFVWHGSVLPNILFRLSLNFMVSCLAVMCYLWH
FT                   EDFNVNLTLGPFSLLGVAIAIFLGFRNNASYARFIEARVLWGSLLITTRSLMRQAISLM
FT                   PHPDGEHRRFAMLLTAFSYALKHHLRHEPMAMELTRLLPSQDKAAVLGSCSPCNRLLQL
FT                   MGQWLGEQRQRGYLSDIDFQTIDTNLNQLSVILGGCERISNTPIPFAYSLIVHRTVYVF
FT                   CALLPFALVSDLHYMTPLVSVFISYTFIALDALAEELEDPFGIEANDLPLNAMAHTIEA
FT                   NLRDMINDHTHLARICPDSHCRLD"
FT   gene            complement(300779..301417)
FT                   /locus_tag="NT01EI_0298"
FT   CDS_pept        complement(300779..301417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0298"
FT                   /product="chaperone protein TorD, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67540"
FT                   /db_xref="GOA:C5BCT4"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR023069"
FT                   /db_xref="InterPro:IPR036386"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCT4"
FT                   /protein_id="ACR67540.1"
FT                   /translation="MSAASPLTAQHYACLYAWLAGLFAHETDDAQLARLRSPDTQAWFA
FT                   LLRQLAPLRPALQCLQEALVALEARPDARLELAADFAGLFLLSQKRAALPYASCYQGET
FT                   PRFRQAPCDEVQSLLQRAGMQLNADFHEPEDHLSIFLELLSHLSFASAEQPGQEDVLVP
FT                   LRQRTLALLLEWLPEFNARCLRYDTFGFYAALSQLLLALVRLDANHRAA"
FT   gene            complement(301414..303960)
FT                   /locus_tag="NT01EI_0299"
FT   CDS_pept        complement(301414..303960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0299"
FT                   /product="trimethylamine-N-oxide reductase TorA, putative"
FT                   /EC_number="1.7.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67541"
FT                   /db_xref="GOA:C5BCT5"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006658"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR011887"
FT                   /db_xref="InterPro:IPR041460"
FT                   /db_xref="InterPro:IPR041954"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCT5"
FT                   /protein_id="ACR67541.1"
FT                   /translation="MNKNESVSVSRRRFLSQLGGLTALGMFGPSLLVARDARATTATAA
FT                   SATQEGILTGSHWGAIRATVVDGRFVAAKPFEKDCYPSKMVAGLPDHVHNTARIRYPMV
FT                   RIDWMRKRHLSDTRQRGDNRFVRVSWDEALDLFYQELERVQTSYGPSALLSGSGWQSTG
FT                   MFHNAAGMMGRALALHGNYVGTGGDYSTGAAQVILPRVVGSMEVYEQQTSWPLVLKNSQ
FT                   TVILWGSDLLKNQQANWWCPDHDVYQYYAQLKEKVANGEIQVVSIDTVVSSTHDYLGRD
FT                   KVQHIAVNPQTDVPLQLALAHTLYSEKLYDAHFLDNYTVGFGQFLPYLLGTQDGQPKDA
FT                   GWAAKLTGIDAETIRALARQMAAGRTQIIAGWCVQRMQHGEQWSWMIVVLAAMLGQIGL
FT                   PGGGFGFGWHYNGAGTPSRKGVILSGFSGATNTPPLHNSSDYRGASSTIPIARFIDAML
FT                   EPGKKIDWNGKQVTLPSLKMCVFAGTNPFHRHQQINRMIAGWQTLETVVAIDNQWTSTC
FT                   RFADIVLPATTQFERNDLDQYGNHSNRGILAMKQLVPPQFEARNDFDIFRGLCQRFNRE
FT                   QAFSEGLDEMGWIKRIYQEGARQGKGREIHLPTFDTFWSGSGYIEFGDPQLFVRHQAFR
FT                   DDPDLEPLGTPSGLIEIYSKSIADMHYGDCQGHPMWFEKAERSHGGPGSARFPLHLQSV
FT                   HPDFRLHSQLCESPTLRAHYSVGGREPVFISPQDAEARGIRNGDIVRVFNERGQVLAGA
FT                   VLSDRYVPGVIRIHEGAWYDPDRGGVAGALCKYGNPNVLTLDIGSSRLAQATSAHTAIV
FT                   EVEKYRGPLAPVTAFHGPQEMVAQCQYVPLQTEEKP"
FT   gene            complement(303957..305132)
FT                   /locus_tag="NT01EI_0300"
FT   CDS_pept        complement(303957..305132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0300"
FT                   /product="trimethylamine-N-oxide reductase C-type
FT                   cytochrome TorC, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67542"
FT                   /db_xref="GOA:C5BCT6"
FT                   /db_xref="InterPro:IPR005126"
FT                   /db_xref="InterPro:IPR009154"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="InterPro:IPR038266"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCT6"
FT                   /protein_id="ACR67542.1"
FT                   /translation="MKKLWNRLNRPSTRWSVLALLALGIVIGLALIVLPHVGIKMTSTT
FT                   EFCVSCHSMQPVYQEYKQSVHFKNASGVRAECHDCHIPPDIPGMVKRKLEASNDIYQTF
FT                   IAHSIDTPEKFEAKRAELAEREWKRMKENNSATCRSCHNYDAMDHAKQHPEAARQMAIA
FT                   AKDNQSCIDCHKGIAHQLPDMSSGFRKQFAELRQNASDEGNTLYTLDMKPIYAAKGDKE
FT                   PAGSLLPASEITVQKRDGDWLQVQIEGWTETNGRQRVLSLLPGKRIFVSSIRDQVQQNA
FT                   KTLEKTTVAATGVEWSKLQATAWVQKGDLVNNIKPIWAYADALYNGTCNQCHGAPEKAH
FT                   FDANGWIGTLNGMIGFTSLDKREERTLLKYLQMNASDTGGAAQKHEGRETR"
FT   gene            305270..305959
FT                   /locus_tag="NT01EI_0301"
FT   CDS_pept        305270..305959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0301"
FT                   /product="TorCAD transcriptional regulator, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67543"
FT                   /db_xref="GOA:C5BCT7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCT7"
FT                   /protein_id="ACR67543.1"
FT                   /translation="MTHHIVIVEDEPVTQARLRDYFVQEGYQVSVTASGAGLRELMLLQ
FT                   PVDVILLDINLPDENGLMLTRALRERSTVGIILVTGRCDRIDRIVGLEMGADDYVTKPL
FT                   ELRELVVRVKNLLWRIDLARQAQPAADNCYLFAGYCLNVSRHTLTLDDESIRLTRAEYE
FT                   MLLAFVTNPGAILSRDRLLRMLSSHRVDSPDVRTVDVLIRRLRAKLRPDLFVTQHGEGY
FT                   FLAAEVA"
FT   gene            complement(305967..307001)
FT                   /locus_tag="NT01EI_0302"
FT   CDS_pept        complement(305967..307001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0302"
FT                   /product="TMAO reductase system periplasmic protein TorT ,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67544"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR014301"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCT8"
FT                   /protein_id="ACR67544.1"
FT                   /translation="MSRRRTLFLCLLWLSTATAHADAPLLRWQSDRQSVQLRQPPLHAG
FT                   KRWKLCALYPSLKDAYWLSINDGMIRAADRLGVTLKVFDAGGYRQQATQREQMALCRDW
FT                   GADAILIGSSTARFPALATLAAGIPLIGVVNALHDPNIRTRIGVPWFQMGYQPGHYLAQ
FT                   HLGQRPLKVLLMPGPRDAGGSREMSDGFKAALGGSRLQIVEVAYGDNDIEVQRNLLQDM
FT                   LERHPDIDVVAGTAIAAEVAMGEGRNRATPLTIVSFYLSHQVYRGLKRGRILAAASDQM
FT                   VWQGELAVEQALRSLQGERVPDNISPPILVLTQRNVSSAQVRRSLSPLGFRPVYLYQPA
FT                   LKAG"
FT   gene            307081..309873
FT                   /locus_tag="NT01EI_0303"
FT   CDS_pept        307081..309873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0303"
FT                   /product="TMAO reductase system sensor TorS, putative"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67545"
FT                   /db_xref="GOA:C5BCT9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037952"
FT                   /db_xref="InterPro:IPR038188"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCT9"
FT                   /protein_id="ACR67545.2"
FT                   /translation="MGRPSLTRRLWLAFVLMAALTLGSVLVGWFSLHYVGRVEQANTQA
FT                   LLPTMNMARQLSEAGAYELFSAQSLSSADSEREWLAQGRMLTAQSLKISRLLDELRRQG
FT                   FDIDTIARQETEITRSLGEQGTLVGQRLQLRLRARALSAQVAAAAEQIAELAKGQASNA
FT                   ATAAGATQAGIYDLIEQQRAAAAEQALDRLIDIDLEYLNQMSELRLSALRVQQMVMALE
FT                   SGRGRQALSEQEERLSQALRILQRRQQRVEDPRIRAQIARALGQVAQYRTLVDLYRQDN
FT                   DIYARLQVLSQNNLDLFTRFSAEISRQVSDIELRNATALGHLQQARRLGLTWLMLLGGA
FT                   GLLALCLILWRVVYRSLSQPLAHQTAALQRLLDGDFDSPFPDRAGVRELDTIGRLMEAF
FT                   RTSVRALCHQRQHLADLVQMRTAELQALVVEHRQARAEAENADRAKSAFLAAMSHEIRT
FT                   PLHGILGTAQLLAGQQLSPRCRDYVQAINDSGESLLAVLNDVLDYSAIEAGSHSVALND
FT                   EPFAPRQLLDSALRLAEGRLQQRLLRLDHDYADVLPTWLQGDPCRIRQIVMNLLNNALR
FT                   FTERGVIRVSCGCDETHWWIAVQDSGCGIDPAQQTAIFQPFVQLSARRGGTGLGLAICR
FT                   GLAQAMVGTLEVSSTPGKGSRFCLRLPLRRAVPPPQEASAQAWSLVGRRLLLIEDNPLS
FT                   QRISAEMLQSAGVQVHIVGNAAEALTLLARDTAFDAALVDFDLPDSDGPTLARQMAEAY
FT                   PQLKRIGFSAHVLDEAQHRRIRPLFCGMIQKPVPRAELCRLIAHALTDGERSAAQPSRV
FT                   AQQIATPLDDGQLAEDLAAFGHPRLTEWLTLFRQHSLPLLAEIAVARTAGDGEQVKGLA
FT                   HRLKGSCASLGMRHAADACLALERAPLTAAAVDGPIREGLVALACWLAKVPESDGGNMA
FT                   "
FT   gene            309973..310107
FT                   /locus_tag="NT01EI_0304"
FT   CDS_pept        309973..310107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0304"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67546"
FT                   /db_xref="GOA:C5BCU0"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCU0"
FT                   /protein_id="ACR67546.1"
FT                   /translation="MWQLKRALHKKCPRVNIWLVIVFFLLGGGVALALVLYLIASALA"
FT   gene            complement(310167..311099)
FT                   /locus_tag="NT01EI_0305"
FT   CDS_pept        complement(310167..311099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0305"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67547"
FT                   /db_xref="GOA:C5BCU1"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCU1"
FT                   /protein_id="ACR67547.1"
FT                   /translation="MIMDKSVLDESHPNYIGMYNGHLLNPNVREFVESCDCVLKMGTLM
FT                   SDFNTGAFTARLNHQHCITVLPESVLIGTSEYHHVLMKDVLEAVTQKVRRKARPDLAPK
FT                   PQPLAPVSASGAITAPYLYARWQQMLKPHDILVAETGTCSMGLSFVLMPEGATFHNQTL
FT                   WGAIGWATPAALGAAAAAATQRTILISGEGSHQLTVQEISQFARLELKPLIFILNNNGY
FT                   LIERLLCKDGDISYNDLAQWQYHQLPEAMGCKGWFSARVATCEALDAAIRQAEKCDCGA
FT                   YIEVITGKYDASPLAEKMHQSMGSLYQAD"
FT   gene            complement(311257..311817)
FT                   /pseudo
FT                   /locus_tag="NT01EI_0306"
FT                   /note="thiamine pyrophosphate enzyme with N-terminal TPP
FT                   binding domain, authentic frameshift"
FT   gene            complement(312152..313141)
FT                   /locus_tag="NT01EI_0307"
FT   CDS_pept        complement(312152..313141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0307"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67549"
FT                   /db_xref="GOA:C5BCU3"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCU3"
FT                   /protein_id="ACR67549.1"
FT                   /translation="MPFIPWVKTTPIHTFFTVVAILILTMIANFKGARITGRISSFTVW
FT                   GIIIPVAGLSIIGWFWFDPQIFSAAWNPHHIGTSKAISSGISLTLWAFLGIESAGANSD
FT                   AVENPERNVPLACLFGTGFAAIVYIASTSVIQGIVPNSQLLASDAPFGLVFTVMFNPVV
FT                   GKVITALAVIACIGSLLGWQFTNAQVSKSAAEMHLFPNIFAKISKDDAPIAGMLIMLAV
FT                   ELVLACMTISPNLLKQFDMLLNLAVFINMVPYVLSMTGLQVMLRKNHVTQSQYYLASIV
FT                   GTVAVVYSIYGIYACGDQAVFGGCIITMFGYIFYGFIAGRDVEMHRTV"
FT   gene            313462..314670
FT                   /locus_tag="NT01EI_0308"
FT   CDS_pept        313462..314670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0308"
FT                   /product="transposase, Mutator family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67550"
FT                   /db_xref="GOA:C5B789"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:C5B789"
FT                   /protein_id="ACR67550.2"
FT                   /translation="MNEKQLQALANELAKNLKTPDDLSQFDRLLKKISVEAALNAEMSH
FT                   HLGYDKNQPKPGANSRNGYSTKTVTTGDGPLELRTPRDRDGSFEPQLVKKNQTRITGMD
FT                   NQILSLYAKGMTTREIAAAFKELYDADVSPALVSKVTDAVMEQVTEWQNRPLDAVYPIV
FT                   YLDCIVLKVRQDSRVINKSVFLALGINLEGQKELLGMWLAENEGAKFWLNVLTELKNRG
FT                   LNDILIACVDGLKGFPDAINTVYPEARIQLCIVHMVRNSLRFVSWKDYKAVTRDLKAIY
FT                   QAPTEDAGQHALEAFASAWDNRYPQISRSWQTNWANLATFFAYPADIRKVIYTTNAIES
FT                   LNSVIRHAIKKRKVFPTDEAVKKVVWLAIQAASQKWTMPLRDWRMAMSRFIIEFGDRLD
FT                   GHF"
FT   gene            complement(315129..315242)
FT                   /locus_tag="NT01EI_0309"
FT   CDS_pept        complement(315129..315242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0309"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67551"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCU5"
FT                   /protein_id="ACR67551.1"
FT                   /translation="MPFCEFLPTHHQNHSIFILARIKSTHKKYNKKKQYIL"
FT   gene            315320..315439
FT                   /locus_tag="NT01EI_0310"
FT   CDS_pept        315320..315439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67552"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCU6"
FT                   /protein_id="ACR67552.1"
FT                   /translation="MTFANHQYRELYLLINIRINEYLSNQDIDFICDAIRHEK"
FT   gene            315451..317721
FT                   /locus_tag="NT01EI_0311"
FT   CDS_pept        315451..317721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0311"
FT                   /product="Orn/Lys/Arg decarboxylase family, putative"
FT                   /EC_number="4.1.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67553"
FT                   /db_xref="GOA:C5BCU7"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR005308"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR011193"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCU7"
FT                   /protein_id="ACR67553.1"
FT                   /translation="MCDKKYLIVGNNAVANTTLKASIDKLASSLMNTGECTQFAYSFEH
FT                   AATYATSTAAIDCVMIEWAPEQKENIVEFLQQLRIRHEKVPVFLLVSSPADNAAVTPDV
FT                   MSQVSETFLILDDTTDFIVGRLQAAVARYERLITPPLMTAMMKYAKEKEYSWSAPGHQG
FT                   GIGFCKTPIGRKFFDFYGENIFRTDMGIERASLGSMLDHTGAFGESEKYIAKVFGADRS
FT                   YSLVVGTSGANRTIMQACCTENDIAICDRNSHKSIEQGLILTGTRPVYMTPSRNAYGII
FT                   GPIAKRWMQPQAIAESIATNTFARQAPNPKPMYSIVTNCTYDGLIYNGDTIQFLLGQSC
FT                   DRIHYDEAWFGYSRFNPIYRGFHAMRGDNLQHTADQPTIFATHSTHKLLNALSQASYIH
FT                   VREGRGNVKPAQFNQAYMIHATTSPLYSIAASNDVAAAMMDGEQGINLTSEVIEEAVDF
FT                   RQAVAKAHYEAEQNNDWFFKPWNPEVVTDPDTGEHYDFADAPKSLLTKNQSCWILNPQD
FT                   EWHGFNDLDENWVMLDPVKVSLLTPGLNQDGTLQNEGIPATLVTAYLSSLGIVPTRTTD
FT                   FQIMFLFSMGVTKGKWVTLMNSLMAFKKHYDADAALTEVLPNLVASAPDIYTGMTLRQL
FT                   GHQMIDFLKTHTPSEKLNRAYSTLPQMDLLPREAYMQMVHDNVEMVSIFNLAGRTAANS
FT                   VIPYPLGIPMLMSGENFGAEDSSQIGYLKALQAWDETFPGFEHETEGTEKEQGVYHVMC
FT                   VKQ"
FT   gene            317867..318004
FT                   /locus_tag="NT01EI_0312"
FT   CDS_pept        317867..318004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0312"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67554"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCU8"
FT                   /protein_id="ACR67554.1"
FT                   /translation="MSVYAVHEDGEHGPGLKWKIKYSKGVGCYIFIVNHHSCFICFLFG
FT                   "
FT   gene            complement(318296..318754)
FT                   /locus_tag="NT01EI_0313"
FT   CDS_pept        complement(318296..318754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0313"
FT                   /product="transcriptional repressor, ArgR family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67555"
FT                   /db_xref="GOA:C5BCU9"
FT                   /db_xref="InterPro:IPR001669"
FT                   /db_xref="InterPro:IPR020899"
FT                   /db_xref="InterPro:IPR020900"
FT                   /db_xref="InterPro:IPR036251"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCU9"
FT                   /protein_id="ACR67555.2"
FT                   /translation="MSNKKDLNTVFRKILDEKNFGSQNEIVEYLKSQGFEHINQSKISR
FT                   MLANFGAVRSRNAKMEMAYCLPTDSVVPNSSSTLKSSIVKISMNEHMVITHTIPGAAPL
FT                   ISRLLDSCGLADGILGTVAGDDTIFIAPVMGVTSQQVYERIKKILDTH"
FT   gene            319468..320340
FT                   /locus_tag="NT01EI_0314"
FT   CDS_pept        319468..320340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0314"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67556"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCV0"
FT                   /protein_id="ACR67556.1"
FT                   /translation="MKILPVISPKGGEGKSTFAAYLAGFLADAGVKTLLIDADWTQPTV
FT                   SSIFALNKEAPFGLYELLMQTIPDPLQAISQTSIDNLDLIYSNDPDELLPTAMLHAADG
FT                   RIRLRNILQNHEFARYGAIILDSKGATGVMTELSILASTGRVMGVVKPILPDVREFIRG
FT                   SLHMFSRLKTYENYGIHLPDISILVNCFENTLLDREAMDGLSKIISEKLYDSSVLGDRN
FT                   MFSLLDTCIEQLDIFKLGHVKSQPVHRLEYKTRRKGPAAADTMHSLACELFPEWKERFD
FT                   DVLSREVRV"
FT   gene            320556..320693
FT                   /locus_tag="NT01EI_0315"
FT   CDS_pept        320556..320693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0315"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67557"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCV1"
FT                   /protein_id="ACR67557.1"
FT                   /translation="MPAGLPLLESGGGNGEVYYDREPLILVASARLREVLECALREVLA
FT                   "
FT   gene            320690..321487
FT                   /locus_tag="NT01EI_0316"
FT   CDS_pept        320690..321487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0316"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67558"
FT                   /db_xref="GOA:C5BCV2"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCV2"
FT                   /protein_id="ACR67558.1"
FT                   /translation="MSYMTINAILAQRPERQPYIDGPEKACCQWQHGVDDRPNNVIVMY
FT                   DEAHGFTVAPVCCRLHTGKSVWRIKPVQFFFNVIPEPCVAGWQIYRPFLCQRNGHFPER
FT                   QFFDIGWQPAVAPDNGIMQGLHGRASVVLNAPVMGPLQPFTQPHQPEFQLPVFRFFLFS
FT                   LTLETLADVVKFTFTHAQKFARQQFAIGIHIFSLCVMNINVLPAPSDQSRQTSWLEIVL
FT                   SVSGIITLAIVCLAPFTFLHGLLVYSAISTVFWQHFHQEVCHG"
FT   gene            321480..322850
FT                   /locus_tag="NT01EI_0317"
FT   CDS_pept        321480..322850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0317"
FT                   /product="replicative DNA helicase, DnaB family, putative"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67559"
FT                   /db_xref="GOA:C5BCV3"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCV3"
FT                   /protein_id="ACR67559.1"
FT                   /translation="MADIHIPHSAEAEQAVLGGLMLDNDRWDEVVLLLAPDDFFVGWHR
FT                   AIYRAMAELFGASLPLDLITLSDRMENAGLLERVGGFAYLAELSKNTPSAANILAYAGV
FT                   VAEKSRLRKLQSVGNMLVADVQALNARSSDVLEVAENQLFCIAEQGMLQVGTETTVNDA
FT                   MDTLVSRLEAMMALDGLTGTPTGFSQLDEMTCGLQPGDLVLLAARPSMGKTALALATCA
FT                   AAVRGKPDDYVFVYSMEMPEEQLSMRLMSMEGRVELSRLRSASLGDEEWARLSQAMKEI
FT                   ILWNNRLIIDDTSYQTPATLRARTRRYVRKYGNPALIMVDYLQLIRSPEQENRTQEIAE
FT                   ISRSLKAMGKEFGCPVLALSQLNRQVEQRADKRPNNGDLRDSGALEQDADLIMFIYRDE
FT                   VYNPGTMTPGVAEIIIGKQRQGPTGTVKVQFDGRYTLFSEYQEGGYDLGYHRKGGRA"
FT   gene            322847..324511
FT                   /locus_tag="NT01EI_0318"
FT   CDS_pept        322847..324511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0318"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67560"
FT                   /db_xref="InterPro:IPR022304"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCV4"
FT                   /protein_id="ACR67560.2"
FT                   /translation="MSRNRTNIGASMLQPGRRASGSVESTPVVEMPMVLTIEQLAPNPD
FT                   NPRTSRNSRYDEIKASIKARGLDTVPKVTRDPDGDPNKYIFSDGGNTRYQILTELWQET
FT                   GEERFFRIHVLVKPWPGRLQCVIGHLAENEVRGDLSFIEKAQGIHKARTIYEEQLGKSV
FT                   SLRELSTLLTREGLPVHNSTISRMEDALKHLFPWMPELLESGLGAPQIRLLLALRQDAE
FT                   KVWDQFCLLSERSDKCFTEVFGECCRKFNSPELWSPEMFRDEFIGDLLLALPHPELNYD
FT                   RWMMELDPSERNRRYHFGEPEETTSPQGVVPSPFTDGIQDTAPEPDFALPKALTESPPA
FT                   TPAVTEEWPQQDENLRVSPEDNKEAPLSLPRTEVQPDMYGGSPVISGDGMGPGLSPDND
FT                   ETLISMLAPGLEDEGEALHPACHIAGDAIWSVPAYQDDIEHLQNIAFIMAWELGEKLGC
FT                   EDEILPDRASSLSPGYCAAGDSCSAPAAFLLSLAGCCPAQCPTTGMDVVLIGGSAQQDV
FT                   PVLDDENAIKLLRLMRVMRRLRELQRGVTAVEDEHDE"
FT   gene            324504..325226
FT                   /locus_tag="NT01EI_0319"
FT   CDS_pept        324504..325226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0319"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67561"
FT                   /db_xref="InterPro:IPR016868"
FT                   /db_xref="InterPro:IPR024498"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCV5"
FT                   /protein_id="ACR67561.1"
FT                   /translation="MNNDKRQERLVSLVRKLLELSRSNSNAHEAGLALSRAQRLMEKYG
FT                   ISELDATLSSVRDVASQSAPSEAEKVPEWMTRLAWAVGHAFGCRPYFSWRNTSSGDCRQ
FT                   TVTFYGFSERPAVAAYAFDVLTRQLKDATAVYLKTQSKKLKLSTRRNRAELFRAGWVDG
FT                   MRRVITVFRVTERETQLMTRWMDNQNMKAATIRELKSCRGGDIARHRGYEAGKNARLHH
FT                   GVEGENTAAIGHREERTS"
FT   gene            325223..325648
FT                   /locus_tag="NT01EI_0320"
FT   CDS_pept        325223..325648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67562"
FT                   /db_xref="GOA:C5BCV6"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCV6"
FT                   /protein_id="ACR67562.1"
FT                   /translation="MTKHQRVLLSGTSHCLWCGVVLGLLAADMYPGVVPAFSGAVLRGL
FT                   AVASFISVLLWMMVSYLEDISWTYIWGVMFLPPLAALLLCHVGWLGYSFIFWKWDYDFA
FT                   LFIREAVLPVVFLVWGACNFLIVPFIFLFILSPGGVE"
FT   gene            325645..326253
FT                   /locus_tag="NT01EI_0321"
FT   CDS_pept        325645..326253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0321"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67563"
FT                   /db_xref="InterPro:IPR021364"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCV7"
FT                   /protein_id="ACR67563.1"
FT                   /translation="MTNSGGLSQAANGLLMQLVMDLKSGYLRRCESLGIKREEMQMLQG
FT                   LSLEELHYLANSEVSVVSISIDHSNLVSMLQRARMEQKRMQRIDRALALGSSIELMQTF
FT                   FGLSSTDVAARRRIAGIEARSGRGNTLGDEDNAEIWRLWQKSGVEEVESPDGLDVMMLA
FT                   AEQLNIPLTSVWHAVKGWHRTTPRRSVGQSLKPSVRKRA"
FT   gene            326537..327757
FT                   /locus_tag="NT01EI_0322"
FT   CDS_pept        326537..327757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0322"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67564"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCV8"
FT                   /protein_id="ACR67564.1"
FT                   /translation="MMLPADSLIAFTLEKMNARLVANPLRDAGRVRSGLLFTGNVHDAI
FT                   PRRLLLDPRLSPLDKMGWMMIRLYAQNNEGAIFPSYDELQLQLASPGKGKASRETVSRV
FT                   LLMLRITGWLSLCRRVRDDKGRVRGNIYAQHDEPLTFRDAESLDPRFLDVVADACLSKN
FT                   RTVSQTARGVLDEIKTDPTMRHYHSHLSLLENRLGRPQNAGQLATRQHPSLLTPEQGSG
FT                   SELSVNRTINDHHELSTETELSQNQERIIQSSDSELPVKSGDYDRVRKPNHYVRSFTHS
FT                   VNKKTYVDNPVVLPDALKAVVSQEDQVMLIRQLQALPEELALQVLSALQSQMARRQVDN
FT                   PLGWMLAVMKKAREGAFRPVKQPHPVQFETHEQPLFSASPRPAAASEEQVRNYVNTLRE
FT                   QLRQNTR"
FT   gene            327765..328916
FT                   /locus_tag="NT01EI_0323"
FT   CDS_pept        327765..328916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0323"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67565"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCV9"
FT                   /protein_id="ACR67565.1"
FT                   /translation="MCSVASSNSGTKNVRCWHCQQWLKNAQCWHCQQWLKNAQCWHCQQ
FT                   WLKNAQCWRCQQRLKNAQRWHCQQRLKNAQCWHCQQWLKNAQCWHCQQWLKNAQCWHCQ
FT                   QWLKNAQCWHCQQWLKNAQCWHCQQWLKNAQCWHCQQWLKNAQCWHCQQWLKNAQCWRC
FT                   QQRLKNAQCWHCQQRLKNAQCWHCQQWLKNAQCWHCQQWLKNAQCWHCQQWLKNAQCWR
FT                   CQQRLKNAQCWHCQQWLKNAQCWHCQQWLKNAQCWHCQQWLKNAQCWRCQQRLKNAQCW
FT                   HCQQWLKNAQCWHCQQWLKNAQCWRCQQRLKNAQCWHCQQRLKNAQCWHCQQWLKNAQC
FT                   WHCQQRLKNVLCLLAMDKSKFHHLAIWFSIVLLPLAADYLNPD"
FT   gene            328943..329698
FT                   /locus_tag="NT01EI_0324"
FT   CDS_pept        328943..329698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0324"
FT                   /product="Protein of unknown function (DUF1845)"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67566"
FT                   /db_xref="InterPro:IPR014996"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCW0"
FT                   /protein_id="ACR67566.1"
FT                   /translation="MEKGKKNADAKVGNEASSPRAGALQSALSVELHTHYASRLWEGRK
FT                   QSDSDSRSHHEKKRPEIISMPKAIQRAGIASRDSASDNPYADAVLLKLENAINAASTKV
FT                   SKTLNELDAILGGVPNGITLSDIASAHPLNISIYSRSPLGYRCVWLLVGYDQLAMKAFQ
FT                   AFHYGLISRAQRDQYLNRGGHAVRQVYGAIQPYYTVTVNRSDIINLTARGQEALARLGE
FT                   PDPDIFSGKKRSSFSSPLREKPVSQSEKS"
FT   gene            329712..331742
FT                   /locus_tag="NT01EI_0325"
FT   CDS_pept        329712..331742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0325"
FT                   /product="DNA topoisomerase 3 , putative"
FT                   /EC_number="5.99.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67567"
FT                   /db_xref="GOA:C5BCW1"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005738"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR034144"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCW1"
FT                   /protein_id="ACR67567.1"
FT                   /translation="MQLYLCEKPSQAKDIARVLGISKRGQGFISADNITVTWAIGHLLE
FT                   QASPDAYGEQFGKPWRVDVLPVLPDNWKMVVKPQTRDQFTVISKLLKQAGEVIIATDAD
FT                   REGEVIARELLAYCGYRGAVRRLWLSALDEASIREALAGILPGENTAKLYDAGLGRSRA
FT                   DWLIGMNLTRLYTLIARESGVSDVLSVGRVQTPTLAIVVNRDKEIADFVPVPWWQVQVL
FT                   LEKDGVRFRATWQAAAQYCDDEKRCVNKQAANAVGQLCQQQKGATVLEVSQKRDKTPAP
FT                   LCFDLGTLQLVCSRKFGMGAKETLAVAQSLYETHKATTYPRTDCGYLPTSMQKEIPEVM
FT                   GSVAKSDPSVAPVLAQLDRGFVSRVWNDKKITAHHAIIPTRQAFDLSRLSADELKVYQL
FT                   IRQHYFAQFLPLQESDVTDASFNIGGQLFLAKGKVNVITGWTCLFQKEIQEDPPEDDDM
FT                   ALPALNKGDSCIVNGASVGDKVTSPPKPFTEGTLIAAMKNAASFVSDPKLKKVLRDNAG
FT                   LGTEATRAGVLETLFSRHYLEKKGKHIHATLLARELIAALPETLTSPGMTALWEQALDD
FT                   IAQGKMSLDTFIQKQLQWTRHLVDKGRADTVKITAPVTPPCPVCKGLTRKRKGKNGDFW
FT                   GCIRYPECNGIVAGKSGGKGRKIARGKKTVVNTEVELSASQ"
FT   gene            332392..332856
FT                   /locus_tag="NT01EI_0326"
FT   CDS_pept        332392..332856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0326"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67568"
FT                   /db_xref="InterPro:IPR021960"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCW2"
FT                   /protein_id="ACR67568.1"
FT                   /translation="MSANNPASGKTEYFNLTIKGLGYLSNIRQVNLQNGSFLSCVINAL
FT                   SGPTDNPVYVRFDVSVAGKEATSLIGRCQKAVDEDKKVLIGFTLSNPSTDIFTLNKGDH
FT                   AGEQRVSLKARLIKVDWIKIGQDMVYKTEKPDSMPPQNSSAQPEYAENSF"
FT   gene            332934..333137
FT                   /locus_tag="NT01EI_0327"
FT   CDS_pept        332934..333137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0327"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67569"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCW3"
FT                   /protein_id="ACR67569.1"
FT                   /translation="MNNSTGILAAESGFTLPLQVLKSGRGYYIGTANHEGPVSRESEEY
FT                   FNSHKKVVQAFTTVAWTQREWA"
FT   gene            333150..333695
FT                   /pseudo
FT                   /locus_tag="NT01EI_0328"
FT                   /note="single-strand binding protein family, authentic
FT                   premature stop"
FT   gene            333926..334189
FT                   /locus_tag="NT01EI_0329"
FT   CDS_pept        333926..334189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0329"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67571"
FT                   /db_xref="InterPro:IPR018841"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCW5"
FT                   /protein_id="ACR67571.1"
FT                   /translation="MLTLQSENDIRVMNVCIDDDRLTVDLMDGRSISVPVAWFPRLAAG
FT                   TAEQRQNWELCGAGYGIHWPELDEDLSTEGLLRGAKGATPRH"
FT   gene            334331..334927
FT                   /locus_tag="NT01EI_0330"
FT   CDS_pept        334331..334927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0330"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67572"
FT                   /db_xref="InterPro:IPR022260"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCW6"
FT                   /protein_id="ACR67572.1"
FT                   /translation="MKFYTRSKTLTAVLPLLLLAGCSSSPQKLQQRDAAVPTPSVAVTR
FT                   NVQTVAPDEYARMPEVVRYDRYLLVSTDPMAVQRDPLSQIIDIRIPAALHPTVADALRY
FT                   ALKQSGYSLCAMGPANGVLYRQPLPAVQYQLGPMRLRTALQVMAGPAWQLEVDDVQRVA
FT                   CHSLRDGYQLPASQLPPVLTSAKVPAPVKGGFLKK"
FT   gene            335047..335646
FT                   /locus_tag="NT01EI_0331"
FT   CDS_pept        335047..335646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0331"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67573"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCW7"
FT                   /protein_id="ACR67573.1"
FT                   /translation="MLVNGVTDLDTRLSHLEAQDNTAKTTATLSSLQSQISTLQAGLAD
FT                   NQQRVTTLQKEIETRTAPSQALTTLQASAARLQQVQQEMEARLTTLVNQLNTLKTAPAA
FT                   AIPASEKTPTDVKKPLPVKPRTTAAVARHAPFVLTGVERRGAESWAAVAPRGYHSLSQI
FT                   ALIGEGETVSGWTLVRAGYSEATFRVNGRLIALKVE"
FT   gene            335653..336357
FT                   /locus_tag="NT01EI_0332"
FT   CDS_pept        335653..336357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0332"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67574"
FT                   /db_xref="InterPro:IPR022293"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCW8"
FT                   /protein_id="ACR67574.1"
FT                   /translation="MQLQLTFLALIMLSSQALAATDTSVVENSQTTQSQMQALQQKAGE
FT                   WGLSPEDYQRYQQLMDGPRGIQSPGLDPLSALGIEARTPAERRQYAEKWVKEEFARTQK
FT                   ELDFQREINAAWQRLYPDRLPVNLGNVAGVSRDTGGRLALFVKSKDCPTCDARLSAVLS
FT                   DNRPIDIYLVDSEGSDDMLRQWARTHRIPAEKVRSRQITLNHDGGRWLRFGNGMMPVLL
FT                   QQGEDGWHIAAF"
FT   gene            336546..337001
FT                   /locus_tag="NT01EI_0333"
FT   CDS_pept        336546..337001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0333"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67575"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCW9"
FT                   /protein_id="ACR67575.1"
FT                   /translation="MARPWPWTINVAGKEYRYSSRLEAWQALQVFMSRYSLKRIDVGLA
FT                   QVNLGWNGHHFTSTWAAFDPYTNLNAAAAILRECWERKPGSWLDAAGCYHHPAGGQAAV
FT                   RYKTIVKRHLVRISGSIRQSPPPLLPQTIVANAPEPGFIWTEPGSEP"
FT   gene            337001..337513
FT                   /locus_tag="NT01EI_0334"
FT   CDS_pept        337001..337513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0334"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67576"
FT                   /db_xref="InterPro:IPR021300"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCX0"
FT                   /protein_id="ACR67576.1"
FT                   /translation="MKKLLLMICLFLPLMGYAGLNVIADLGGEDASPYFDGINKQPDLL
FT                   EASTATTLPPVSDMAAMFPVSTPEMAPGVVADRPLQLPGIGALFLIGDDVLSRSWLAEN
FT                   AQTLTDRHAVGMIISVDSASAVQSLRSLAPGVPMAPASGSELARRLQLRHYPVLISDTG
FT                   LSRQVRP"
FT   gene            337554..338474
FT                   /locus_tag="NT01EI_0335"
FT   CDS_pept        337554..338474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0335"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67577"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCX1"
FT                   /protein_id="ACR67577.1"
FT                   /translation="MASLAVGGCVYRCNAVFKLSSTGKGLRSSSGAVFVSSGRKIMSDL
FT                   YLVEADNGCSFTDRVNRNLPAWAEHQIKAWDLTAFQQAEDFMTHHYWTDKGSINVFRIV
FT                   GTDHPQYAGMTWSELLQRGKRMDINIPLIEKKPEYYTDASVLHTSMSYVSLDGIHWYIS
FT                   ADGNHRSCLARFYFHLLGHSVTQLHNVSLSQYRADTVFMSACQDVLRLAPALRQKGVYL
FT                   TLTAHRLPVSREDTPGWKLDTFKTQVSVILDNVASDDDIRTFELHSATQAQHLLRQLES
FT                   ELMQPAVASAAPWWKRLLPFRREGV"
FT   gene            338708..340561
FT                   /locus_tag="NT01EI_0336"
FT   CDS_pept        338708..340561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0336"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67578"
FT                   /db_xref="InterPro:IPR022458"
FT                   /db_xref="InterPro:IPR022503"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032689"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCX2"
FT                   /protein_id="ACR67578.1"
FT                   /translation="MSAGQIPVSGQRLFLGRGFRWTQKHTQRLQDTLRPEVAKYLQPGR
FT                   LYLAARWLEMKTEHSAPGLGKLLRTDSPLNPVRPLPPVGGNPVLHGIEPDEQDVWLALL
FT                   ERVGHTIVYGTTRVGKTRLAELLVTQDIRRGEVTIVFDPKGDADLMKRVWAEAHRADRG
FT                   DALYIFHLGWPEISARYNAVGRFGRVSEVASRVAGQLSGEGNSAAFREFAWRFVNIIAR
FT                   ALVALGERPDYTLIMRYVNNIADLYIRYAEKVIREQLPSLQAQIQNNEQVLGDDDVPRN
FT                   MQGQPDAVRIWSIEVALSSEEGKQLYDPILDGLRSAVRYDRTYFDKIVASLLPLLEKLT
FT                   TGKTAELLAPDYLEMSDSRPIFDWEQIIRKKAVVYIGLDALSDSEVASAVGNSMFADLV
FT                   SVAGHIYKHGIHAGLPGEGESKVPVNLHCDEFNELMGDEFIPLINKGGGAGMQVTAYTQ
FT                   TSSDIEARIGNAAKTAQVQGNFNNLIMLRVRENRTAELLTTQLPQVEIYTKTLVSGHQD
FT                   TDISAGQDFTSSTQDRVGTVKVPLLEPADVVTLPKGQAFALLEGGQLWKIRMPLPADDA
FT                   DDTLMPQSIAKIAEEMRRNYHSGEAWWNDAPGIVPAGGVRG"
FT   gene            340554..341309
FT                   /locus_tag="NT01EI_0337"
FT   CDS_pept        340554..341309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0337"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67579"
FT                   /db_xref="GOA:C5BCX3"
FT                   /db_xref="InterPro:IPR022266"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCX3"
FT                   /protein_id="ACR67579.1"
FT                   /translation="MAELQRNGPPQPRPEKPHDLLYNVFWGWPWALIGMLLGSLMLSLL
FT                   IEYTGIAFFWPEAGAAHSEAVMNTELGWLSTEFTRSLLLSEPSVTVSRWVTTAYQWLFV
FT                   DSGFTGWIKQHVLQTGSGNELTRNLSSWSGWLAGYLHEYLTATVWICVITLVRVTILVL
FT                   SVPLFLMVVLVALVEGLGRRDLRRYGAGYESSFVYHHAKKRVKPAIVVPIILYLSWPTA
FT                   VYPNLLLLPAAILLGVAITVTMASFKKYL"
FT   gene            complement(341417..341881)
FT                   /locus_tag="NT01EI_0338"
FT   CDS_pept        complement(341417..341881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0338"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67580"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCX4"
FT                   /protein_id="ACR67580.1"
FT                   /translation="MANIAARARAVVIKGTELAHFENEVFSWHRINNQNGDEILPAVLI
FT                   TNAHPDYFMENSHGYKRETGLYRESKNNELKLILIPLKKFCPTTSDAISLIEKVFSDIK
FT                   EGKDLSDFRIAKKAQKGIGSAIVDSIILEPNIGGIGFKLNQLLSFLRKDK"
FT   gene            342113..342454
FT                   /locus_tag="NT01EI_0339"
FT   CDS_pept        342113..342454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0339"
FT                   /product="conserved hypothetical protein, RAQPRD motiff
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67581"
FT                   /db_xref="InterPro:IPR019110"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCX5"
FT                   /protein_id="ACR67581.1"
FT                   /translation="MNHPHPVRSLSARIPGITGLLLLATLSTTVQAAEKDELASALRQL
FT                   DQVQASLERARVAAAQAAPAEQGRFFFDYRQATSDLNTIRIGIDRYLEPSRSQPRASFV
FT                   SGNYRRERP"
FT   gene            342454..342696
FT                   /locus_tag="NT01EI_0340"
FT   CDS_pept        342454..342696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0340"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67582"
FT                   /db_xref="GOA:C5BCX6"
FT                   /db_xref="InterPro:IPR021676"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCX6"
FT                   /protein_id="ACR67582.1"
FT                   /translation="MGMTSAQSTAFKVASGNVEASILHLVCIGVLLAFLFLWAAWALSD
FT                   VWTGWSNEKVRNAALGRFAIRVVLLLVVSIWMFAS"
FT   gene            342723..343109
FT                   /locus_tag="NT01EI_0341"
FT   CDS_pept        342723..343109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0341"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67583"
FT                   /db_xref="GOA:C5BCX7"
FT                   /db_xref="InterPro:IPR021356"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCX7"
FT                   /protein_id="ACR67583.1"
FT                   /translation="MHHSASVATHLRRDIDHVINRTFTWALLVWLICKPAFADLPTVEA
FT                   PTSNGGSGLMGQIKGYLQDGVVIGGLVVAAIAFINVAIAAVHTFTEVRNEKSTWTKFGS
FT                   IIVVGVVLLVAVLWLLGKSADIIL"
FT   gene            343119..343475
FT                   /locus_tag="NT01EI_0342"
FT   CDS_pept        343119..343475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0342"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67584"
FT                   /db_xref="GOA:C5BCX8"
FT                   /db_xref="InterPro:IPR021877"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCX8"
FT                   /protein_id="ACR67584.1"
FT                   /translation="MQTIRFLPDRLNSEPVVFRGFTTPEMGLASLAGLGVGLLLSLPFI
FT                   PLAGWVIIPTGMLLAPLLVIGFGGRWLSRIKRGKPENYIWQRLEAFKRRHSLGNPTLII
FT                   DARGWSLKRTGREK"
FT   gene            343472..344131
FT                   /locus_tag="NT01EI_0343"
FT   CDS_pept        343472..344131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0343"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67585"
FT                   /db_xref="GOA:C5BCX9"
FT                   /db_xref="InterPro:IPR021548"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCX9"
FT                   /protein_id="ACR67585.1"
FT                   /translation="MSRFRHAVKDRDQHILTLRIVCGVLAFFLLITCAGWMLAPNKLTV
FT                   HNPPDLRAGSTRPWWEVPASSVYSFAFYIFQQLNAWPKNGEVDYPAKIHALSAYLTPGC
FT                   QDYLNTEARKRSNTGQLTDRVRVVYEIPGRGYQSKSVSVISRDNWVVRLDLVADEYFHA
FT                   EPVKRALVRYPLKVVRWEGDAERNPFGLALDCYDGVPQRLEAALPTEIPAKPGVFQ"
FT   gene            344131..345060
FT                   /locus_tag="NT01EI_0344"
FT   CDS_pept        344131..345060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0344"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67586"
FT                   /db_xref="InterPro:IPR021844"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDH0"
FT                   /protein_id="ACR67586.1"
FT                   /translation="MKTRNDIRTGLMVLSLLLLPLVSLVSEPAQADEFMKWERIPLQIP
FT                   LQVGLERVVFVDKNVRVGFPPALNGKLRVQSTGGAVYLKADSTFPQTRVQLQDVESGEV
FT                   ILLDVTAGEKGPSEPVRLVYSGEVNTVSSTTDTRRQAENSDSSIQPGSDVGTQAKRKKV
FT                   SYGAPIPVLLTRYAAQSLYAPLRTVEAVPGIRPVNPHLPKRLTTLYPSEAITATPLAAW
FT                   GVANRVVVAVRLQNTASLRIVLDPRALQGQFVAATFQHRWLGPVGTPEDTTTVYIVTGM
FT                   RPESAFIAEPSVVRKAVRTAKKEISHAD"
FT   gene            345050..346564
FT                   /locus_tag="NT01EI_0345"
FT   CDS_pept        345050..346564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0345"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67587"
FT                   /db_xref="InterPro:IPR021207"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDH1"
FT                   /protein_id="ACR67587.1"
FT                   /translation="MQIKSNAMVKFIVPAVVVAGLVVGLKSCKGERLPENAENASGDVT
FT                   TVLKNLSQDELKALGVEGDTPEDTLRMLIGRLNDVRDRQKTLDKQNTDLLKENEQLRKR
FT                   GTNVSGQVDEAVQGLREEYDKRQQQLQNEQTSLLEKVQTLSEQLKTTVSSSAGAKQASD
FT                   SDIPLGLGLDGLGGRTRGIATRGDDGLMWVTPDDQKDVDPRDAASGKASPQFPTSFLDS
FT                   NPLTRQKAAYEQQVKGHTGEKGAQENAEPVYTLPENSTLVGSRAMTALLGRIPLNGTVT
FT                   DPYPFKVLIGKDNLTANGIELPDVEGAIVSGSASGDWTLSCVRGQVNSITFVFADGTVR
FT                   TVPQPEASGKSTGNGNTQNKTGTDGGIGWISDDDGIPCISGTRKSNASTYLPTIFALSA
FT                   AGAAGEAFGEGQYTTQNNVNGISSTLTGSAGEAALGKALSGGMSETTDWVKQRYGQTFD
FT                   AIYVPPGAKLAVHITRQLAIDYEDNGRRVRYDFTLPGGVSDNGGLD"
FT   gene            346754..346996
FT                   /locus_tag="NT01EI_0346"
FT   CDS_pept        346754..346996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0346"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67588"
FT                   /db_xref="InterPro:IPR022262"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDH2"
FT                   /protein_id="ACR67588.1"
FT                   /translation="MRRPLTDNEQRKGTQDDRSYSRTQESEISQQFSRLPNPDMVMYLY
FT                   SHLAGGNTPVPGYSTVFPFYSQTQYAMPGERTEAL"
FT   gene            346996..349860
FT                   /locus_tag="NT01EI_0347"
FT   CDS_pept        346996..349860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0347"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67589"
FT                   /db_xref="InterPro:IPR022303"
FT                   /db_xref="InterPro:IPR025955"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDH3"
FT                   /protein_id="ACR67589.1"
FT                   /translation="MFSLFGRKNEVKPDGTAGQPEGEVSPLVIHGREPLTRPGRMTRQE
FT                   EAKVYHANPSIIDYLPWVEFLDEDQCLLLEDGISVGAVYDVKPVATEGRTNDRLEQIRD
FT                   TVEDALQDSFDEYDENPWVVQFFCQDEDDAEAYLDHLRGYVKPHAQRTAFTEAWLGEMA
FT                   RHIRSISRPEGLFTDALITGQLWRGQQRRTRMVIYRWSGKSASRDPMPPVAMLNQACER
FT                   VVSALGGAGIRCTRQNGLQVHSWLLRLFNPSPDWVDKSTLYRQAAYADPRDFPAGVAPV
FT                   SNDFAETLWFTPPVSDPENGVWWIDNKLHCALPVERLRTPPEPGTITGEQARGEKKINA
FT                   LMDMFPEGTLLCMTIVVQPQDRLEEQFNRLSKNAVGENTESGRVRQDVKTVKEYLGNRH
FT                   KLYRAGITFLLRGDDMDNLKRKRLDLTTVLLGAGLQPVRSEFEVGPLNTWLRALPMCFN
FT                   PNSDKKHWYTRLTWVQHLAGLLPVTGRETGTGNPGFSFFNRGGDILTFDPLNKYDRTQN
FT                   AHLLLFGPTGAGKSATLCYAFSQLMAVHRPRLFIAEAGNSFGLQADYFESLGLSVNKIS
FT                   VKPGSGVSLPPFADAHKLVEEGLAAHAVDESDLPDIDADSDGEGEDEDKRDILGEMEIS
FT                   ARMMITGGDPKEEAEMKRADRAMIREALLMAAHATYKEGRQMLPSDLQKALYSIAGDDS
FT                   DEGQNVRNAQRKAKAAEMAEALGMFTQEGSFEAELFNREGELWPEADVTLVDLGHLARE
FT                   GYEAQMALTMVSMTNMINNIAERDQYLGRDIVFAVDEAHIVTVNPLLSPYMTKVVKMWR
FT                   KLGAWLWLATQNLKDFPDIAEKMLNMAEWWICLTMPPEEVKDISRFRALTPEQEAVLLS
FT                   ARKLSGCYTEGVVLAKRIEALFRAVPPSLYLALGMTEKEEKAERRALMREHHCSELDAA
FT                   KLIARKLDRLRGLTDAHDEESTAA"
FT   gene            349857..350249
FT                   /locus_tag="NT01EI_0348"
FT   CDS_pept        349857..350249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0348"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67590"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDH4"
FT                   /protein_id="ACR67590.1"
FT                   /translation="MMTLKYPVPCVCGNDSPDNTVFTLPPQGEPGMSVVTQANLQRLSE
FT                   HIRQRLNGPVTVTCHPHRVGLSSCVAVTVEGRLRRAVNILITVSGQGSWPAEEEYEHPR
FT                   WYITVTDAADMVYLVLWLNNGVCQEL"
FT   gene            350357..351568
FT                   /locus_tag="NT01EI_0349"
FT   CDS_pept        350357..351568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0349"
FT                   /product="transposase, Mutator family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67591"
FT                   /db_xref="GOA:C5BDH5"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDH5"
FT                   /protein_id="ACR67591.2"
FT                   /translation="MNEKQLQALANELAKNLKTPDDLSQFDRLLKKISVEAALNAEMSH
FT                   HLGYDKNQPKPGANSRNGYSTKTVTTGDGPLELRTPRDRDGSFEPQLVKKNQTRITGMD
FT                   NQILSLYAKGMTTREIAAAFKELYDADVSPALVSKVTDAVMEQVTEWQNRPLDAVYPIV
FT                   YLDCIVLKVRQDSRVINKSVFLALGINLEGQKELLGMWLAENEGAKFWLNVLTELKNRG
FT                   LNDILIACVDGLKGFPDAINTVYPEARIQLCIVHMVRNSLRFVSWKDYKAVTRDLKAIY
FT                   QAPTEDAGQQALEAFASAWDNRYPQISRSWQTNWANLATFFAYPADIRKVIYTTNAIES
FT                   LNSVIRHAIKKRKVFPTDEAVKKVVWLAIQAASQKWTMPLRDWRMAMSRFIIEFGDRLD
FT                   GACT"
FT   gene            351627..352835
FT                   /locus_tag="NT01EI_0350"
FT   CDS_pept        351627..352835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0350"
FT                   /product="transposase, Mutator family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67592"
FT                   /db_xref="GOA:C5BDH6"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDH6"
FT                   /protein_id="ACR67592.2"
FT                   /translation="MNEKQLQALANELAKNLKTPDDLSQFDRLLKKISVEAALNAEMSH
FT                   HLGYDKNQPKPGANSRNGYSTKTVTTGDGPLELRTPRDRDGSFEPQLVKKNQTRITGMD
FT                   NQILSLYAKGMTTREIAAAFKELYDADVSPALVSKVTDAVMEQVTEWQNRPLDAVYPIV
FT                   YLDCIVLKVRQDSRVINKSVFLALGINLEGQKELLGMWLAENEGAKFWLNVLTELKNRG
FT                   LNDILIACVDGLKGFPDAINTVYPEARIQLCIVHMVRNSLRFVSWKDYKAVTRDLKAIY
FT                   QAPTEDAGQQALEAFASAWDNRYPQISRSWQTNWANLATFFAYPADIRKVIYTTNAIES
FT                   LNSVIRHAVKKRKVFPTDEAVKKVVWLAIQAASQKWTMPLRDWRMAMSRFIIEFGDRLD
FT                   GHF"
FT   gene            complement(353102..355099)
FT                   /locus_tag="NT01EI_0351"
FT   CDS_pept        complement(353102..355099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0351"
FT                   /product="Divergent AAA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67593"
FT                   /db_xref="GOA:C5BDH7"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR038461"
FT                   /db_xref="InterPro:IPR038475"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDH7"
FT                   /protein_id="ACR67593.1"
FT                   /translation="MLQINDLTDLQTLTESVELECKLAQGKDGRGKLPDDFWPTYSAMA
FT                   NCRGGCVILGIKEKKGKFSVAGIQDISVVRKQLFDILSNKNKININLLTDKHISESIIE
FT                   GKNILVINIPPARREQKPIYLNNQPMTESWLRAHDGDHRCTEEQVRRMMAEQVEESRDN
FT                   RILQNFDMNDISQESLQAYRQLLSTSSPTHPALELDNFNFLRSIGGWRKDRQTGNEGMT
FT                   LAGILMFGTWESIQDAAPNYFVDYQERPEAKTERRWIDRLCPDGTWSGNVFDFYRRTYR
FT                   KLIADLKIPFELKDGIRQDDTQIHTALREALVNTLVHADYTGRLSIMVVKRPDLFGFRN
FT                   PGMMRIPPEQAIRGYESDCRNRLIHQMFLMIGAGERSGSGIPKIFSGWRWANWRVPRLY
FT                   EKAEPEQTLLELSIGNLVSEKTAALLYRIFGEQVNKLNELERGIVITTAVEGWIDHERA
FT                   CQLTTQHSREVTLTLPRLVCNGFLIAHGEKRNKSYTLPGHDLPSPEELFTLNPLSSLTS
FT                   KTAEFITDKGEMITDNDSLITDNNDVTTSDSHKRDHVGRFITDKLPAAYIDDFNFLSSS
FT                   LQRQLIDTASPAREKRRLPNDIMDKIILSLCQGHFMPLSVIAMLTKRTPQNIREKQLIP
FT                   LVKQGKLRLAFPHVRRHKKQGYMTVQTPTT"
FT   gene            355278..355673
FT                   /locus_tag="NT01EI_0352"
FT   CDS_pept        355278..355673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0352"
FT                   /product="Protein of unknown function (DUF1525)"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67594"
FT                   /db_xref="InterPro:IPR011090"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDH8"
FT                   /protein_id="ACR67594.1"
FT                   /translation="MKLRDFILLPALLPVSVLAGTVVYTDSQHLPENLSPGVVAVLLDA
FT                   PERLQAKMFGQLSTDPEQAAAQVRLAMSSPQWQQKQQQLVAAYRQVVHAWELGIRKVPA
FT                   VVFDDRDVVYGTTDVAQALRLQAGGDQ"
FT   gene            355670..356662
FT                   /locus_tag="NT01EI_0353"
FT   CDS_pept        355670..356662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0353"
FT                   /product="Protein of unknown function (DUF1527)"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67595"
FT                   /db_xref="InterPro:IPR009649"
FT                   /db_xref="InterPro:IPR026331"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDH9"
FT                   /protein_id="ACR67595.1"
FT                   /translation="MNQPPSWFRRTLCSAAVATVLGTASIPTALAALNTAQIVASAVTQ
FT                   DCISWRVSGICYWLFCSWYGCTVRTSVKVTHFIPQTVVSTYVAPGGNPWTEMAAVSQTA
FT                   GGLENAVTGALSGVTAGGANPADMKNPGQRKSNIRFKYADAIGHPATSLIGGRIPGYSC
FT                   DSAATPLMPYFLSTLDSIAWRTGVPESLYPEALVIGRREIGSQASGNMWGNVYPRSGFV
FT                   SQSDDDKASAVVAQRVADIITRTGQPHVYHELKGPRRDGYWPPGEVTENTGSKNHKWQR
FT                   LAPSMTRSCAVFPDGSHSAASDNNAAFALWQPYSCCKRMGQKFLGSTDF"
FT   gene            356809..358107
FT                   /locus_tag="NT01EI_0354"
FT   CDS_pept        356809..358107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0354"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67596"
FT                   /db_xref="InterPro:IPR021204"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDI0"
FT                   /protein_id="ACR67596.1"
FT                   /translation="MDGAVSDKLFYTLGGGSVISQPATRSNMKKLGMDIGWSSDLMCGN
FT                   FDLKTTVGNQLNGVTDGFKNLMGDVIQGATGAVASLPAMLIQRANPGLYDMLTNGVLQA
FT                   NVSFDKAQLNCQNMAKKMMDFSDTSKWTQAAMAEEYKSLVNNGETDAIRADQKYQDADG
FT                   TSGKKWIGGQIRGGKGQKAIRPTYDLVSAGYNMMNSLNVLSSETVSGASCNGGACSKFS
FT                   NAEEAAQAVVRVLGDRSMRTCSNALQCTSGDTDDQPGLSVAGTGFAPMLEEATKNNTEQ
FT                   LVKLVNGTVKPTATELAKLKTGGLPVTANVIRALQRDPDNTALTVRLASELAMSDAVET
FT                   ALLMRRMLTTGMSEPNAQDQPLALEDGVHRIDALDREIMALKNEMDLKRELARNSVLTI
FT                   IERDNERVGTNPMIQQTDNADSRFQKLDTPDAE"
FT   gene            358121..358474
FT                   /locus_tag="NT01EI_0355"
FT   CDS_pept        358121..358474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0355"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67597"
FT                   /db_xref="GOA:C5BDI1"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDI1"
FT                   /protein_id="ACR67597.1"
FT                   /translation="MKNSHRDLLCKTGKGLKAGLLYLLILALMMAVGLWLADTGMRHPE
FT                   SVASLKRWMHATRYGWLVWRLVIYSAVGWGLWKIWHAPGFRPEYRRSLLRIAGASTLFF
FT                   LVCEYSIFSGVGG"
FT   gene            358481..360016
FT                   /locus_tag="NT01EI_0356"
FT   CDS_pept        358481..360016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0356"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67598"
FT                   /db_xref="GOA:C5BDI2"
FT                   /db_xref="InterPro:IPR012931"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDI2"
FT                   /protein_id="ACR67598.1"
FT                   /translation="MTTNSYLEYFLTLLGWLVNNGLWDVLVSTGLFALPLAFKVASIWL
FT                   KVREEGEDEGNKGMLSLPRIENALYGAFFVMIACCVPLIQVSLSTLEFDKSRGKTCGTW
FT                   TPKAPNETGYSGIISSMDGESAAAPVWWVLVHKLSKGVTQAAVASIPCRPDLRQLRFEV
FT                   QRTFIENRALADELQDFTNDCYSLALYQWKRRDQGQTTDKATLSDLSWIGSSTFLKGDY
FT                   TTLQSKLPRGMFSWSDARDSGRPNTGNGGYPYCSEWWSAADTGLKARVMKQVDDSYWLR
FT                   LSAAMKMIGSSQTDYQEEVIRRLVSPANLTVSHGGEVYNGYGGNAGMTAMNAISRVAGT
FT                   AGASVASLGAFPALDAMRQALPMVQAVILMAIYIMVPLILTFAAYEFKTVITLTLVIFA
FT                   VNFLTFWWELARWLDSWLLTALYSSDTHSRFNMMGFQNTSDDLIMNLVMGTMFLMLPAV
FT                   WIGALSWAGVHLGGAISNSMKTGTDKATQSSEKGGKVAEQAVSSFAGGMMKGK"
FT   gene            complement(360062..360280)
FT                   /locus_tag="NT01EI_0357"
FT   CDS_pept        complement(360062..360280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0357"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67599"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDI3"
FT                   /protein_id="ACR67599.1"
FT                   /translation="MNIFVKKLLNAVLPDPKPNNHTDDGSLLTCFNDEAETLFNDDPLV
FT                   ERTYEGLNAIDDGAPYGESYGTWSDSD"
FT   gene            360499..360996
FT                   /locus_tag="NT01EI_0358"
FT   CDS_pept        360499..360996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0358"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67600"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDI4"
FT                   /protein_id="ACR67600.1"
FT                   /translation="MDELSSVNKKISDFGVSIAGKQSSQNESGMPKLAPKVEADQDSTS
FT                   KDLSVPVDVDTAAARLRRYYKFMTTDELNSIKNRESTSARLTAAAIEEQRPEWSASVGS
FT                   YYKMGRNWGEGKDHITLEVEKNGAGSHVYIQFFSSNPQHLTEAYLGNLFAQVKDVAEGK
FT                   VR"
FT   gene            361195..361818
FT                   /locus_tag="NT01EI_0359"
FT   CDS_pept        361195..361818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0359"
FT                   /product="Uncharacterized protein family (UPF0153)"
FT                   /note="Uncharacterised protein family (UPF0153)"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67601"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDI5"
FT                   /protein_id="ACR67601.1"
FT                   /translation="MVESWHKCSEGVVDRIKNGKSLKSICQKGCSRCCSLHVSLLTPDV
FT                   FFIAENLTKDFSDSKLFFIKKRLKIRADKVEEYIDDSYRMECVFLGKTSGQCIIYKYRP
FT                   EACRRFFTNDEKDCIESNGSPLQDGAVFYSTGILSAYMALAAHNNDLFIDSHEVSKSLY
FT                   MALDRPLLFKKWLRGEPNVFPDVKWEGYHQEIKKMNADMKIKIK"
FT   gene            363211..363765
FT                   /locus_tag="NT01EI_0360"
FT   CDS_pept        363211..363765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0360"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67602"
FT                   /db_xref="GOA:C5BDI6"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR024456"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDI6"
FT                   /protein_id="ACR67602.1"
FT                   /translation="MPLAPDEFYKAFQAVEKKNPGVAAAMQLSYALGLRTKEAVEACKS
FT                   VPSWKRALESGQNSVRVVFGTKGGRPRDTVILDRDSVRAAINYAEKVMEKQNGKLVDRP
FT                   DIRKAIDTYRYQVRQIGLTGKKAPHSMRYHFSQEAKSFYERQGYTEREIFAQVSMDLGH
FT                   GDGRGKYVRQVYFKELPDDNG"
FT   gene            363786..364208
FT                   /locus_tag="NT01EI_0361"
FT   CDS_pept        363786..364208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0361"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67603"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDI7"
FT                   /protein_id="ACR67603.1"
FT                   /translation="MRYDILMKATSVKPVYEIILEGNQCSEIVIAFNCETPLSESDTCA
FT                   MLARYFDNVYFEDNEHDTFTQKGDIFEMTGVIRVPPSEKTVHLNKGEVIIPITTRLTHQ
FT                   LMSQEYNARSEENVNGMVDNWIGDLFNKKGNLIINK"
FT   gene            365204..365323
FT                   /locus_tag="NT01EI_0362"
FT   CDS_pept        365204..365323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0362"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67604"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDI8"
FT                   /protein_id="ACR67604.1"
FT                   /translation="MFIPSCAVMQGLRIITGFWWLPIICNAGQNVFHLTGRCC"
FT   gene            365404..366459
FT                   /locus_tag="NT01EI_0363"
FT   CDS_pept        365404..366459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0363"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67605"
FT                   /db_xref="InterPro:IPR013610"
FT                   /db_xref="InterPro:IPR017113"
FT                   /db_xref="InterPro:IPR041459"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDI9"
FT                   /protein_id="ACR67605.1"
FT                   /translation="MKTDNRKTTAKVCKKPTARKTASSGKRRQAGMAATLTGSGDIYRL
FT                   VTDRIIIALENGIPPWRRPWRNAQQGINTLMPANAFTGRGYSGVNVLLLWLAAEERGFT
FT                   SDRWLTYNQAQEAGGQVRKGETATLAVIYRDWTKQAEDSNGNKLFDADGKPQMETVPML
FT                   RQFPLFNAEQCADLPDQVRGTATVTRPQEDFADVSPVQLQQVLSVVNATGVQFSPRPQN
FT                   RAYYRVATDQIVLPLTSQFDAEGDYWSTVLHELVHASGHAKRLNREGITRASKKFGDPV
FT                   YAFEELIAEIGSAFLCAHLGITGDLQHESYVDGWLSKLKSDKKALFSACRQAREASEYL
FT                   LAPLNRQAETA"
FT   gene            366567..367502
FT                   /locus_tag="NT01EI_0364"
FT   CDS_pept        366567..367502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0364"
FT                   /product="Protein of unknown function (DUF1281)"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67606"
FT                   /db_xref="InterPro:IPR009694"
FT                   /db_xref="InterPro:IPR023136"
FT                   /db_xref="InterPro:IPR041329"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDJ0"
FT                   /protein_id="ACR67606.1"
FT                   /translation="MSEWCQNRFEITGKSVCIDVLLQWINGADTPRYRHAILQSIQLFL
FT                   AGCAGILKPVRTVSYIPFQGLVRHGIGQSTAANLAFEQWLELLQKDVALDTETIRRIDR
FT                   LYHQSGLGALKWENIPLASRDIMATLMKRQYADWFGLAGMNDEPDAAACWERLREYPER
FT                   SQPCDMLMVIPTRLATELNGSGGLLAGISTTVSFYSHIYGMEWPAGHNVNLHRHAANGL
FT                   TLRLDSPWYPPSGEVVAGISALFECEVRHTYSEPVSGLSGYDCYDLGAHVDGHQGVPVE
FT                   TLPPAPALYLVSSEQPHPGPEMAGYSEVRG"
FT   gene            367621..368304
FT                   /locus_tag="NT01EI_0365"
FT   CDS_pept        367621..368304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0365"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67607"
FT                   /db_xref="GOA:C5BDJ1"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDJ1"
FT                   /protein_id="ACR67607.1"
FT                   /translation="MAGFIDHEKAFISLFNQTARYHHRHKVFEDFVSCSVIALENRLCF
FT                   SEKREGKYLRIIGGYEKPDVIRMAQLLAHVVNGLQNGLCNFLGNVFMQLELGDKYRGQF
FT                   FTPWDVARMMAQLQLGDVKAMFDEKPFITLHEPACGAGCMVLAFADALNQAGYASHLYL
FT                   WVSATDIDPLAAGMAYIQLSLCGVAGEVVIGNALCDERRRVLLTPGHYLGSWSLRLHSR
FT                   RKKVA"
FT   gene            complement(368530..370116)
FT                   /locus_tag="NT01EI_0366"
FT   CDS_pept        complement(368530..370116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0366"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67608"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDJ2"
FT                   /protein_id="ACR67608.1"
FT                   /translation="MCNKTLTLKKKSLQTVELPTDYDRLLQSITLLAPVQKVSLDIDVT
FT                   HKAALPAVIESALLLVAQLETVSPLELGGFFGLADHERQVLVDEMIDTGLVRYNDEGDI
FT                   ATTIRLTMQRREGAADEGIAIEDVENHRGFTFIDLCTGHIQPKCNADLQKGLPELARKI
FT                   NSSDFTDLIADQFRRFQVCLPDTKSMRALRSSKARLYRVNRASVGQSGLKQQISLDVHA
FT                   HSDPLNGIRLEARLMDYSSEHTRLMESSGLKTEAINWLHERKLEAATTTLEDYCDLAKD
FT                   TVIRRYIGRGGKLDLGRLLHDRQRRKTGYGDSATQRMIIGPVYAASNRDTLIKWAKWLP
FT                   LNQRTHQGVWLGATNELFGASLGFGSFIKQMNTELGSGERNSRLNLAFQCDEEYRAQRL
FT                   ITNLFNSRTDGSLRIFQKGRSESHLEMLVFPGEQGMAVVQYHAALDPSLGYAGLTLPIG
FT                   YFTTDPERVALLWAQVQQRIQSPLRSANQPEVVLDDLDQLLGCTSAELTQLLVDNSEEK
FT                   LKKLVEKFNQH"
FT   gene            complement(370109..375070)
FT                   /locus_tag="NT01EI_0367"
FT   CDS_pept        complement(370109..375070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0367"
FT                   /product="Nuclease-related domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67609"
FT                   /db_xref="GOA:C5BDJ3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011528"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041677"
FT                   /db_xref="InterPro:IPR041679"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDJ3"
FT                   /protein_id="ACR67609.1"
FT                   /translation="MKIHIAATQGLHQNEHDAIIAMEKALPAHWVGYAGILLVDKNRKS
FT                   LEFDVLIFAEDRILMVELKNFHGQIHMEDDQWIQTTPGGRKIKHGSPIDRKREHAQRIK
FT                   SMFDEELRALWGNTFYEIQALVVLTGEAKVTQQSPKDKGFVLALDEFLTIANLDTYFDK
FT                   MPETRAEGYFRRHPEKRPCAPGQIAIFEKWKRGGSYVQIRQRLEAGYVLSEKIPRLKGP
FT                   KGFYNEFDGEHERDLEDKSQIRMWDFSKMAHVGTDMSVRVFFGLREDRTQRHIRRTDSQ
FT                   LGKDYLLEPKHNLQEDTLTIDMAEVYQLPRLAERLDEFLVSSPLSIEKRTLLLRALLTP
FT                   LAGMHAMGVYHRDLSSKRLWWDRERNAIIISGLTSAKFPDLGHKSISDMRQDMDTTGIL
FT                   LPEDAFGETEVLGQAVDVFQLGVLCYQIAYGEQLTLPRDEPPQWKQPLNDPFEGKLDGF
FT                   IQQSLELDASKRHTDAGAMLETLTRTLNFQNLDSNEDKARVLDALAAFNTDAMPITEYP
FT                   QVETPSTDPQRQRMTFRSKTIDGQPCTVRIYLNARPNKDNHGQSQRLLHFLERCAIASN
FT                   NVLSLPPLIEFGCGMMGTHVVQSYALGESLEQWMTRPNRSYEERYQLADALIRAVHNLH
FT                   DLDLSHGDLKPENLLVQAEGGKLSILLLDMFDLDLDGLAPANSEYAPTTDVSATARDRY
FT                   AVYMIVDEIFAACIHHGANKIRGEIRNALGDKNAVPRSLDMLRRTMIHANEPELVEATP
FT                   LVIESLYFPNEQGELFEMDSGIYHLTASYTPKSNVLKLFFLGVSHKLTLNLKVDGQSLT
FT                   VHRMFYDRLGTGEIVYDTRNNRKNGNRAMSVGQPFIIKKGPFVAENTELLGFIRTLHVV
FT                   QHALDIKPESEEHPTVVAGDQEGYLKRLWLRLVEVERETLPTVKVIASPKELDGIVHVQ
FT                   INENIDSLEFAEDDVINVTMDDHETHFGQLDVAKSGNGVLVFSDDNRGNNFRLQNIRED
FT                   TILTLSNSGSDVSWERRDRALSRIVASDAVMGDLTDRFMNGPRGFQPPALPIPTDEQIN
FT                   RYGLDESKRAAFLYLLQNPLSVLMGPPGTGKTTLLSAALDYLLNDANVRRVLVVSQSHT
FT                   AVDEVANRVRELSFKRQEQSPDFKLPSIVRLGERRRVSEGMLDVHTNALQAQARTAFHR
FT                   DLEVRLLALSARLKLPEAFVLESAALYRACGRELFEFTPARNEVREAQQDGVDVDNLPN
FT                   DKRMIRLTTERRLDNLKNALIGRLSAFTDMPNQVLLHNKPLLAVLNMIAERHQINNPQR
FT                   IERMAEVIKVAHHWYQRLATDETGYAAFAARTRQLVVGTLVGIGHGGYQLDKNAFDLVV
FT                   IDEAARATFSELAIAMQSAKRVLLVGDYKQLAPSYDVSHVRQVARDLGLNEADVKRTDF
FT                   ERAYALNDGHMLSKQYRMAPAIGDIISHCFYDGTLATGRPPAPEWMSSLPTPWDRTVSW
FT                   IDTSDSKVLETNISKGIANEVEVNLLCSLLRQLVDDEQAMLQLRQWNDADTTPAIGIIT
FT                   GYRKQVELLQKRLESESWAAPIRSMMKVDTIDSYQGSENRIILLSLVRHNAEQKGGFMT
FT                   DNARVNVALSRAKERLLIIGAGSMWQQADACQPLARVFDYIHQQLPCQDSEYQIIRSAD
FT                   LTHNACTELQENDYV"
FT   gene            375659..377131
FT                   /locus_tag="NT01EI_0368"
FT   CDS_pept        375659..377131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0368"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67610"
FT                   /db_xref="GOA:C5BDJ4"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDJ4"
FT                   /protein_id="ACR67610.1"
FT                   /translation="MTWKTTPEQNAIIEWRGNQLVVNAFAGTGKTTTLVQFAQANPESK
FT                   MLYLAYNRAIRDEAEQKFPFNVECKTSHQLAWSHFGRHFRHRLTANLRITDVARKLNTR
FT                   HWPLARLALTGLNAFLGSAESEPGIIHLPTEDERHGLSADKILGAVQALWYEVSRTESD
FT                   FPITHDVYLKLFQLSGPNLARKWDTLLFDEAQDANPVTSAFVLSQPCRIVLVGDRYQQI
FT                   YRFRGADNALSSPRLEQADRLWLTTSFRFGPAVAQMANMLLAMSGEEIKVTDSGEDDEV
FT                   VTHLPADVPHCSVLSRTVSGVIGAALSASLQEKKVFWVGGIEGYKTEELEDLYWFSADM
FT                   PERMQSPRLGQDYQDFDEYCAIAKATQDVEMNQAIRLLDEYFPLPQKLAIMRRQVVTHE
FT                   KDAQVTVSTAHRSKGLEWDVVVLNEDFCDISDPLLSAEERQDETNLLYVAVTRARKTLV
FT                   LNELMLFLKQKDCEQPVTGDAENDEGEVIFPC"
FT   gene            377125..378717
FT                   /locus_tag="NT01EI_0369"
FT   CDS_pept        377125..378717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0369"
FT                   /product="Protein of unknown function (DUF1528)"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67611"
FT                   /db_xref="InterPro:IPR011093"
FT                   /db_xref="InterPro:IPR011119"
FT                   /db_xref="InterPro:IPR022391"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDJ5"
FT                   /protein_id="ACR67611.1"
FT                   /translation="MLNKIKTLLSRTPAVTEPSNKLPVSVPTGYFSPAKAEELVITALR
FT                   QDALQKIRENNALSAEVYQRFYLAPVLLLLERTQNVPAAPDGRWAYAGGFGDLSLRFTA
FT                   YAVRLARGYMFPPGAAPEEQAAQGVIWQAVIFWAALCYHLPLLASIEGETTGGVNWQPG
FT                   ISVPDAPYRFRFRHSPPNAHDASALAALAAGQLLPTEAINWLSGTPAALFSLACAFRNG
FT                   SPDMPLIRTLLDQAAEKVDSPVLRKETGGSSVVIAPPDSVTSQEGALVVQTDDNLSSSA
FT                   VELAASELMTPLNDTGGGDRQPPQNGVSTVESPEEPDNASPGLGDADMLLSLFSAVADA
FT                   EVSEVADDASVNTLATVAPDETVVVIGKDAPEESAETEESFRHRDTDSGGRLPGTHEEQ
FT                   SHPINVGADARRSGEVFLAWLSDGVASGRITVNQHDSRVHSVAGFIYLLVPDIFFLFLK
FT                   DTGSDSHREEIQTSFEKLQLHRVRRGERFIRAKLYCSENKQGRFSRVNGYLIKAVRLKG
FT                   VRPQEDSKLLFFP"
FT   gene            378778..379788
FT                   /locus_tag="NT01EI_0370"
FT   CDS_pept        378778..379788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0370"
FT                   /product="site-specific recombinase, phage integrase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67612"
FT                   /db_xref="GOA:C5BDJ6"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDJ6"
FT                   /protein_id="ACR67612.1"
FT                   /translation="MRNEITWDELLEEYFFAHRLRPATEWSYSKVVRGFRRYSCDTLPA
FT                   QITHRQVLEWRRYLLQDKQQSAQTWNNKIAHLRALYNYGMEYEILPPGKNPFNKSNVQR
FT                   DTRKKKTLTRSQLIRVYLVMQQFEEAERAGHGIRGGRNALWPAWYWLTVLDSFRYTGMR
FT                   LNQLLHIRLGDINLSEGYLDLCLEGSKTHREWRVPIVSALKPRLHHLTEKSTELGAGNE
FT                   DYLFDVNRIHLKRHMAWDAAKVYQKIRSFFRRLSKECGFAVSPHRFRHTLATELMKSPE
FT                   RNLQLVKDLLGHRSVSTTMEYVELKMDIVGKTLEAELSLHTDVTGERNLHLLTQA"
FT   gene            complement(379986..380063)
FT                   /locus_tag="NT01EI_T00012"
FT   tRNA            complement(379986..380063)
FT                   /locus_tag="NT01EI_T00012"
FT                   /product="tRNA-Phe"
FT                   /note="putative tRNA-Phe"
FT   gene            380656..381294
FT                   /locus_tag="NT01EI_0372"
FT   CDS_pept        380656..381294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0372"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67613"
FT                   /db_xref="InterPro:IPR021236"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDJ7"
FT                   /protein_id="ACR67613.1"
FT                   /translation="MKRILTATALSLAMFSTFTWAADAAPAASAATTAAAGMSAQQVQD
FT                   VAKVAQQGFTAMRDMQFARVALFRGSPEVATKLTDQAAGLLADDSTDWKAFIKSDKKAP
FT                   LAGDNYVIINASIALSEDFVATPEKQKAIARANEKLSKGDRKGALEELRLAGVGITETQ
FT                   YLMPLKQTRQAVAHAQSLLKAGKYYEANLALKGAEEGIITDSVTLAGGK"
FT   gene            complement(381358..381933)
FT                   /locus_tag="NT01EI_0373"
FT   CDS_pept        complement(381358..381933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0373"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67614"
FT                   /db_xref="GOA:C5BDJ8"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDJ8"
FT                   /protein_id="ACR67614.1"
FT                   /translation="MQREQILTQALQRLERHGLAGATLPALIDSEMLSLDQARRYWPDS
FT                   EALLYDCLRFHSQQIDTWRRQLLLNDTLSHDDKILARYSVLAEHVEQGRFPGCLFISAC
FT                   IQYPVTDHPIHQLASRQKQASFDFTLQLLQESEIDDASLVAHQMELVQEGCLNRLLVSR
FT                   RREDVDIALHLAQDILHIAHCRRHDALS"
FT   gene            complement(381965..383692)
FT                   /locus_tag="NT01EI_0374"
FT   CDS_pept        complement(381965..383692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0374"
FT                   /product="thiol:disulfide interchange protein DsbD,
FT                   putative"
FT                   /EC_number="1.8.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67615"
FT                   /db_xref="GOA:C5BDJ9"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR022910"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="InterPro:IPR035671"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036929"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDJ9"
FT                   /protein_id="ACR67615.1"
FT                   /translation="MAQRIFALIALFITTLLPAQASLFGGQPRFVPVNQAFAFDFQQRG
FT                   ESLTLRWQIQPGYYLYRQQIRITPHQAQLGHWQLPPGIPHHDEFQGETAIFRDGLSLTL
FT                   PLLSAAAGGEVSVTYQGCAAAGFCYPPETRRIPLKAITAAVGVLPPPGTAAMATANTEH
FT                   APTLPFPALWALLIGIGIAFTPCVLPMYPLISALILGQKQRHGWGHTALLALVYVQGMA
FT                   ITYTVLGMVVAAAGLRFQAAFQHPYVLIGLSLLFILLALSMFGAFTLQLPASLQTRLTL
FT                   WSNRQRSGSLLGVFVMGALAGLICSPCTTAPLSAILLYIAQNGNLWVGGGTLYLYALGM
FT                   GIPLIAVTLFGNRLLPRSGPWMQHVKEGFGFVILALPVFLLERILGDAWGARLWSLLGI
FT                   TFFLWGFSLSLHARRRGTRLWQILLLGAALICARPLQDWIFDETPRASIGVSAPLAFQP
FT                   IDSPQQLTQALAQAKARRQPVMLDFYADWCTACKEFEKYTFSNDAVRSQLAGTLLLQAN
FT                   VTANTEQHAQLLQQLNVLGLPSILFFTPDGQPLDDARVTGFMDAKRFLAHLQQLPYAQ"
FT   gene            complement(383668..383889)
FT                   /locus_tag="NT01EI_0375"
FT   CDS_pept        complement(383668..383889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0375"
FT                   /product="divalent cation tolerance protein, CutA1 family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67616"
FT                   /db_xref="GOA:C5BDK0"
FT                   /db_xref="InterPro:IPR004323"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDK0"
FT                   /protein_id="ACR67616.1"
FT                   /translation="MTLIPGATSLYCWEGKIEQEYEVQMIIKSERRHQQALLAYLKHQH
FT                   PYQTPELLVIPVQAGDQDYLSWLNASLR"
FT   gene            complement(384173..385474)
FT                   /locus_tag="NT01EI_0376"
FT   CDS_pept        complement(384173..385474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0376"
FT                   /product="anaerobic C4-dicarboxylate transporter DcuA,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67617"
FT                   /db_xref="GOA:C5BDK1"
FT                   /db_xref="InterPro:IPR004668"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDK1"
FT                   /protein_id="ACR67617.1"
FT                   /translation="MLVLELVIVLLAIFLGARLGGIGIGFAGGLGVLVLAAIGVAPGKI
FT                   PFDVISIIMAVIAAISAMQVAGGMDYLVHQTEKVLRKNPKYITILAPVVTYLLTIFAGT
FT                   GNISLSALPVIAEVAKEQGIKPCRPLSTAVVSAQIAITASPISAAVVYMSSVMEGHGIS
FT                   YLHLLMVVLPSTFLAVLVMSLIVSWCFDSKLSNDPVYRKRLEEGLITLRGDKQIEIKKG
FT                   AQTSVWLFLLGVIAVVAYAIINSPSLGLVAKPLMNTTNAILIIMLSVATLTTIICRVDT
FT                   DNVLNSSTFKAGMSACICILGVAWLGDTFVSSNIDWIKETAGTVIQNHPWLLAVIFFFA
FT                   SALLYSQAATAKALMPMALALNVSPLTAVASFAAVSGLFILPTYPTLVAAVQMDDTGTT
FT                   RIGKLVFNHPFFIPGTLGVALSVCFGFLLGSVML"
FT   gene            complement(385590..387026)
FT                   /locus_tag="NT01EI_0377"
FT   CDS_pept        complement(385590..387026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0377"
FT                   /product="aspartate ammonia-lyase, putative"
FT                   /EC_number="4.3.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67618"
FT                   /db_xref="GOA:C5BDK2"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004708"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDK2"
FT                   /protein_id="ACR67618.1"
FT                   /translation="MSNNIRIEEDLLGTREVPADAYYGVHTLRAMENFYISNNKISDIP
FT                   EFVRGMVMVKKAAALANRELQTIPRKIADTIILACDEVLNNGKCMDQFPVDVFQGGAGT
FT                   SVNMNTNEVLANIGLELLGHKKGEYQYLNPNDHLNKCQSTNDAYPTGFRIAVYASIMKL
FT                   IEAVKNLREGVDRKADEFKNILKMGRTQLQDAVPMTLGQEFHAFSVLLNEEVKNLQRTA
FT                   ELLLEINLGATAIGTGLNTPEGYQKLAVQKLAEVSGLPCVPAEDLIEATSDCGSYVMVH
FT                   SALKRTAVKLSKICNDLRLLSSGPRAGLNEINLPELQAGSSIMPAKVNPVVPEVVNQLC
FT                   FKVIGNDTCVTMAAEAGQLQLNVMEPVIGQAMFESISLLTNGCYNLREKCIDGITANKE
FT                   ICEKFVFNSIGIVTYLNPFIGHHNGDIVGKICAETGKSVREVVLERGLLTEAQLDDIFS
FT                   VENLMHPAYKAKRYTDESEK"
FT   gene            387391..387867
FT                   /locus_tag="NT01EI_0378"
FT   CDS_pept        387391..387867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0378"
FT                   /product="FxsA cytoplasmic membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67619"
FT                   /db_xref="GOA:C5BDK3"
FT                   /db_xref="InterPro:IPR007313"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDK3"
FT                   /protein_id="ACR67619.1"
FT                   /translation="MRWLPFILIFFYVYIEISIFIKVAAVLGVALTLLLVILTSCLGAS
FT                   LVRNQGMKTLMQMQQKLAMGESPAAEMIKSVSLVMAGLLLLLPGFCTDLLGLLLMLPLV
FT                   QKRLALKLLPYFRIYRSSGPGDGGGFGGGPGGGGHTFDGEFERKDDDRQRLDNK"
FT   gene            388085..388378
FT                   /locus_tag="NT01EI_0379"
FT   CDS_pept        388085..388378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0379"
FT                   /product="chaperonin GroS, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67620"
FT                   /db_xref="GOA:C5BDK4"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BDK4"
FT                   /protein_id="ACR67620.1"
FT                   /translation="MKIRPLHDRVIVKRKEVESKSAGGIVLTGSAAGKSTRGEVVAVGH
FT                   GRILENGDVKPLDVKVGDTVIFNDGYGVKAEKIDNEEVLIMSESDILAIVEA"
FT   gene            388438..390081
FT                   /locus_tag="NT01EI_0380"
FT   CDS_pept        388438..390081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0380"
FT                   /product="chaperonin GroL, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67621"
FT                   /db_xref="GOA:C5BDK5"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BDK5"
FT                   /protein_id="ACR67621.1"
FT                   /translation="MAAKDVKFGNDARVKMLRGVNVLADAVKVTLGPKGRNVVLDKSFG
FT                   SPAITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVNEGL
FT                   KAVAAGMNPMDLKRGIDKAVSAAVEELKALSVPCSDSKAIAQVGTISANADDTVGQLIA
FT                   EAMEKVGKEGVITVEEGTGLQDELDVVEGMQFDRGYLSPYFINKPETGAVELESPFILL
FT                   ADKKISNIREMLPVLEAVAKAGKPLLIIAEDVEGEALATLVVNNMRGIVKVAAVKAPGF
FT                   GDRRKAMLQDIATLTAGTVISEEIGMELEKATLEDLGQAKRVVINKDTTIIIDGVGEES
FT                   AIQGRVAQIRQQIEEATSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDA
FT                   LHATRAAVEEGVVAGGGVALVRVAAKLVDLKGINEEQNVGIKVALRAMESPLRQIVANA
FT                   GEEPSVVTNNVKAGEGNYGYNAATEQYGDMIEMGILDPTKVTRSALQYASSVAGLMITT
FT                   ECMVTDLPKEEKADLGAAGMGGMGGMGGMM"
FT   gene            390331..390678
FT                   /locus_tag="NT01EI_0381"
FT   CDS_pept        390331..390678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0381"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67622"
FT                   /db_xref="InterPro:IPR025294"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDK6"
FT                   /protein_id="ACR67622.1"
FT                   /translation="MRIKGLLGLAAIMLLAGCSTMTQLSSSGQQVKFTDAKPGTECQLL
FT                   GEAVGTQSNWLSGQGGETSSMRAAANDLRNKAAAMGGNVVYGAVSPSESFWSSFAPLDS
FT                   KMSGQVYKCPN"
FT   gene            complement(390762..391457)
FT                   /locus_tag="NT01EI_0382"
FT   CDS_pept        complement(390762..391457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0382"
FT                   /product="hypothetical protein"
FT                   /note="Uncharacterized ACR, YkgG family COG1556"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67623"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDK7"
FT                   /protein_id="ACR67623.1"
FT                   /translation="MNNRDEFLATIARQLGREVRHIPQPRPQPINDYAQTRLTGLSVQQ
FT                   RCDAFIDVASNVMLAHCERCSEADAAQAALHLCQRYGQTPTIVSGDGRLAQLGITETLV
FT                   RECPATVWDPALGAENLRMAEQAKVGVVYAEYGLAESGGVVLFSSALHGRALSLLPESS
FT                   IFVLRKSTILPRVAQLASLLHQRAQRGGRMPSCINLIGGPSSTADIELIKVIGVHGPVN
FT                   AAYLIVEDC"
FT   gene            complement(391457..392878)
FT                   /locus_tag="NT01EI_0383"
FT   CDS_pept        complement(391457..392878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0383"
FT                   /product="iron-sulfur cluster-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67624"
FT                   /db_xref="GOA:C5BDK8"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR004452"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR024569"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDK8"
FT                   /protein_id="ACR67624.1"
FT                   /translation="MSLKTSDVKFKDRIRLQLDDAVMRKAVANAQERISANRQKMVDEL
FT                   GHWDEWRERAEQIRDHVLDNLDAYLYQLAEKVTENGGKVYFAKTKEDATRYILQVAQGK
FT                   NAKKVVKAKSMVTEEIGMNHALQQAGIQVVETDLGEYILQLDQDPPSHVVVPAIHKDRT
FT                   QIRRVLHETLGYDGPETPEAMTLFIRQKIRQDFLSADIGVTGCNFAVAETGSVCLVTNE
FT                   GNARMCTTLPPTHIAVMGMERIAPTFEEVDVLITMLARSAVGARLTGYNTWLTGPREAD
FT                   NLDGPQEFHLVIVDNGRSSILGSPFRAVLRCIRCGACMNTCPAYRHIGGHGYGSIYPGP
FT                   IGAVISPLLGGYANFKDLPYACSLCTACDSVCPVNIPLSKLILRHRRAMVEAGLPPKAE
FT                   QRATRLFAYANSHPTLWKVGMIAGARVASWLIKGGKAPINAGALAEWTAARDLPQADGE
FT                   SFRSWFKQHKEQGNK"
FT   gene            complement(392889..393608)
FT                   /locus_tag="NT01EI_0384"
FT   CDS_pept        complement(392889..393608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0384"
FT                   /product="Cysteine-rich domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67625"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDK9"
FT                   /protein_id="ACR67625.1"
FT                   /translation="MNVNFFVTCLGDALKSRMARDSVLLLEQLGCTVHFPEKQGCCSQP
FT                   AINGGYVEDAIPGMKTLIRALEENDDPIISPAGSCTYAVKSYPSYLSDEPGWALRAERV
FT                   ANRMVDLTSFIVNSLGVQDVGAHLPGRAVYHPSCSLLRKMKVRDEPLTLLSHVRGLELL
FT                   PFPAAETCCGFGGTFSIKMAEISGEMVKEKVSHMMEAQPEYLIGADISCLINIGGRLQR
FT                   EGLPVKVMHIAEVLMSR"
FT   gene            complement(393658..395211)
FT                   /locus_tag="NT01EI_0385"
FT   CDS_pept        complement(393658..395211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0385"
FT                   /product="transporter, lactate permease (LctP) family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67626"
FT                   /db_xref="GOA:C5BDL0"
FT                   /db_xref="InterPro:IPR003804"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDL0"
FT                   /protein_id="ACR67626.1"
FT                   /translation="MPAYLPFFLGILPIAVMIILILKLKTPIHLAVLITLALTLTVTGL
FT                   YWHTPLQTLGSALIYGALKGLWPIVIVILGAIYSYNLMLKTGSMDILRDVLAAVSDDKR
FT                   IQVLLIAWCFGGFLEAAAGYGTAVAIPIGILIALGFNPLKAAIASLVANTVPTAFGAVG
FT                   IPVSILAEQVNLPVTALSGTIISQLALFNILLPFVIVTIIGGGVKALRDVFTLTLLCGI
FT                   STLIPQYLVAIKLGAELPAFAGSLVSLIVVTLMAKARRGETAAEYRIDGTHLKGNVRYS
FT                   APQLLRACAIYLLIFIFILLCSPLFPAIRSTVAQVASVLPFPLANGQVLKLKIDWIATP
FT                   GVLIIIATLIGGVIQGAALRQMLQVFVATVKQLKNSIIAISAIVAMATVMDVSGLIATL
FT                   AQTLVNVTGGGYLFIAPIIGALGTFVTGSDTNSNVLFGKLQTMAAEKLHVDPLWLAAAN
FT                   TSGATGGKMISPQSIAIAVSATRMDGQGSAIMSGTLKYCCAYIVILGLKVGLVYYLFIP
FT                   "
FT   gene            complement(395450..396478)
FT                   /locus_tag="NT01EI_0386"
FT   CDS_pept        complement(395450..396478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0386"
FT                   /product="KamA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67627"
FT                   /db_xref="GOA:C5BDL1"
FT                   /db_xref="InterPro:IPR003739"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022462"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDL1"
FT                   /protein_id="ACR67627.1"
FT                   /translation="MAHIITQKGQPREDWLQQLADVVTDPADLLAQLGLSDHPQWLAGC
FT                   EARRLFPLRVPHAFISRIRRGDPNDPLLRQVMSDAAEFIETPGFSTDPLAEQHSVVPGL
FT                   LHKYQNRALLLVKGSCAVNCRYCFRRHFPYQENQGTRANWQRAVAYLCEHPELDEIIFS
FT                   GGDPLMAKDHELDWLFTQLEQLPHLRRLRIHSRLPVVIPARVTDALCQRMADSRLQMIL
FT                   VTHINHANEIDEALSEAMERLKQAGVTLLNQSVLLRGINDNADTLAALSNALFEAGILP
FT                   YYLHVLDKVQGGAHFMVPDDEARRLMNGLLSRVSGYLVPRLTREIGGEPSKTPLDLHLR
FT                   QQ"
FT   gene            396526..397092
FT                   /locus_tag="NT01EI_0387"
FT   CDS_pept        396526..397092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0387"
FT                   /product="translation elongation factor P, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67628"
FT                   /db_xref="GOA:C5BDL2"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDL2"
FT                   /protein_id="ACR67628.2"
FT                   /translation="MATYSSNDFRSGLKIMMDGEPYAVESSEFVKPGKGQAFARVKLRR
FT                   LLTGKLIEKTFKSTDSAEGADVMDVNLTYLYNDGEFWHFMNNDTFEQLAADAKAVGDNA
FT                   KWLLDQAECVVTLWNGQPIAVTPPNFVELEIVETDPGLKGDTAGTGGKPATLTTGAVVK
FT                   VPLFVQIGEVIKVDTRSGEYVSRVK"
FT   gene            397298..397600
FT                   /locus_tag="NT01EI_0388"
FT   CDS_pept        397298..397600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0388"
FT                   /product="multidrug resistance protein, SMR family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67629"
FT                   /db_xref="GOA:C5BDL3"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDL3"
FT                   /protein_id="ACR67629.1"
FT                   /translation="MLIAGLLEVVWAISLKYSHGFTRLWPSVVTLLAMVASVLLLAHAM
FT                   KTLPAGTAYAVWTGIGAVGAAIMGIVLQGESASPLRLLSLGLIICGILGLKFSNA"
FT   gene            complement(397671..398030)
FT                   /locus_tag="NT01EI_0389"
FT   CDS_pept        complement(397671..398030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0389"
FT                   /product="fumarate reductase, subunit D, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67630"
FT                   /db_xref="GOA:C5BDL4"
FT                   /db_xref="InterPro:IPR003418"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BDL4"
FT                   /protein_id="ACR67630.1"
FT                   /translation="MMNNKVYKRSDEPVFWGLFGAGGMWGAIFAPAVILIVGILLPLGM
FT                   FPDALTFERALSFSQSIIGRIFWLLMIILPLWCGLHRLHHMMHDLKIHVPASSWVFYGL
FT                   AAILSVVALIGIFTL"
FT   gene            complement(398044..398442)
FT                   /locus_tag="NT01EI_0390"
FT   CDS_pept        complement(398044..398442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0390"
FT                   /product="fumarate reductase, subunit C, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67631"
FT                   /db_xref="GOA:C5BDL5"
FT                   /db_xref="InterPro:IPR003510"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDL5"
FT                   /protein_id="ACR67631.1"
FT                   /translation="MTTSTKRKPYVRGMSSNWWHKLGFYKFYMLRESSALENVWFSIVL
FT                   IYGVFSLKDGAAGWESFVAFLQNPLVLVLNIISLLLAVLHTKTWFELAPKAANIVVNDE
FT                   KMGPAPIIKALWVVTIVVTVVVLGLALL"
FT   gene            complement(398459..399193)
FT                   /locus_tag="NT01EI_0391"
FT   CDS_pept        complement(398459..399193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0391"
FT                   /product="fumarate reductase, iron-sulfur subunit,
FT                   putative"
FT                   /EC_number="1.3.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67632"
FT                   /db_xref="GOA:C5BDL6"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDL6"
FT                   /protein_id="ACR67632.1"
FT                   /translation="MAEMKNLKMEVMRYNPEQDAEPRFVTYEVPYDDATSLLDALLYVK
FT                   DNLAPDLSFRWSCRMAICGSCGMMVDNVPKLACKTFLRDYPNGMRVEALANFPVERDLV
FT                   VDMTHFIESLEAIKPYVIGNDRKPEEGTNKQTPAEMEKYHQFSGCINCGLCYAACPQFG
FT                   LNPEFIGPAAITLAHRYNLDNRDHGKKERMPVLNTQNGVWSCTFVGYCSEVCPKHVDPA
FT                   AAIQQGKVESAKDFMIAMLKPQ"
FT   gene            complement(399186..400985)
FT                   /locus_tag="NT01EI_0392"
FT   CDS_pept        complement(399186..400985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0392"
FT                   /product="fumarate reductase, flavoprotein subunit,
FT                   putative"
FT                   /EC_number="1.3.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67633"
FT                   /db_xref="GOA:C5BDL7"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005884"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDL7"
FT                   /protein_id="ACR67633.2"
FT                   /translation="MQTFNADLAIVGAGGAGLRAAIAAAEANPQLKIALISKVYPMRSH
FT                   TVAAEGGSAAVTQAHDSFDFHFHDTVAGGDWLCEQDVVDHFVHNCPREMTQLELWGCPW
FT                   SRKPDGSVNVRRFGGMKIERTWFAADKTGFHMLHTLFQTSLKYPQIQRFDEHFVLDILV
FT                   DDGQARGVVAINMMEGTMVQIRANAVILATGGAGRVYRYNTNGGIVTGDGMGMAFKHGI
FT                   PLRDMEFVQYHPTGLPGSGILMTEGCRGEGGILVNKDGYRYLQDYGLGPETPLGEPKNK
FT                   YMELGPRDKVSQAFWHEWRAGRTISTPRGDVVYLDLRHLGAKKLHERLPFICELAKAYV
FT                   GVDPVNEPIPVRPTAHYTMGGIETDQNCETRIKGLFAVGECSSVGLHGANRLGSNSLAE
FT                   LVVFGRVAGESALQHLQNVTPTNGTALDAQVKDIEGNLKALVNQEGNENWATLRDEMGT
FT                   SMEEGCGIYRTTDLMQKTVDKLAELKERFKHVKITDTSSVFNTELLYAIELEHGLNVAE
FT                   CMAHSAINRRESRGAHQRLDEGCTERDDVNFLKHTLTYFNESGAPRIEYSDVKITKLPP
FT                   AKRVYGAEAEAQEAKKKEEKANG"
FT   gene            complement(401188..401301)
FT                   /locus_tag="NT01EI_0393"
FT   CDS_pept        complement(401188..401301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0393"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67634"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDL8"
FT                   /protein_id="ACR67634.1"
FT                   /translation="MNLKTIYTILKSKQNILKIEYNGRNILKITFYYFFPL"
FT   gene            401458..402435
FT                   /locus_tag="NT01EI_0394"
FT   CDS_pept        401458..402435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0394"
FT                   /product="lysyl-tRNA synthetase-like protein GenX"
FT                   /note="lysyl-tRNA synthetase homolog GenX"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67635"
FT                   /db_xref="GOA:C5BDL9"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004525"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BDL9"
FT                   /protein_id="ACR67635.1"
FT                   /translation="MSDMASWQPSAPVANLLKRASILSTIRRFFSDRGVLEVDTPSMSQ
FT                   ATVTDVHLVPFQTHFVGPGVAQGMMLYLMTSPEYHMKRLLAAGSGPIYQLCRSFRNEES
FT                   GRYHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLECESAETLSYQQAFIRHLDVDPLS
FT                   ADKTQLREVAAKLDLSNVADNEEDRDTLLQLLFAFGVEPHIGKERPVFVYHFPASQASL
FT                   AQISTEDHRVAERFEVYYRGVELANGFHELTDAAEQRQRFEQDNRKRAAAGLPQQPIDE
FT                   HLLAALEHGMPDSSGVALGVDRLIMLALSAERLSEVIAFSVDRA"
FT   gene            complement(402438..402749)
FT                   /locus_tag="NT01EI_0395"
FT   CDS_pept        complement(402438..402749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0395"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67636"
FT                   /db_xref="GOA:C5BDM0"
FT                   /db_xref="InterPro:IPR025692"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDM0"
FT                   /protein_id="ACR67636.1"
FT                   /translation="MRYYRTSIWLIAPLLMAVVIFNNLANRSFTSTLGCACFIMMCPTL
FT                   LLLATSLRRAGTPLYLNRADSGENQLNHLLWGGLLYALLTEYAGHKKPAPGAGLGGNR"
FT   gene            complement(403338..403520)
FT                   /locus_tag="NT01EI_0396"
FT   CDS_pept        complement(403338..403520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0396"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67637"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDM1"
FT                   /protein_id="ACR67637.1"
FT                   /translation="MRHILQRILLSDLRRRLLPGLAQPPLNKRQLTLALKQAEAAKSAP
FT                   HRTKPSMPCKAPRGG"
FT   gene            complement(403577..404476)
FT                   /locus_tag="NT01EI_0397"
FT   CDS_pept        complement(403577..404476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0397"
FT                   /product="phosphatidylserine decarboxylase, putative"
FT                   /EC_number="4.1.1.65"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67638"
FT                   /db_xref="GOA:C5BDM2"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033177"
FT                   /db_xref="InterPro:IPR033178"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDM2"
FT                   /protein_id="ACR67638.2"
FT                   /translation="MLDSIKIRLQYLLPKQGLTRLAGWAADKPAGWLTQSAIKGFARYY
FT                   GINMQEALYPDPAHYKTFNDFFVRPLRDGVRPLAEFDDGVVLPADGAISQLGPIDEDRI
FT                   LQAKGHDYTLEALLAGQYPLAETFRGGQFVTTYLSPRDYHRVHMPCDGQLREMIYVPGD
FT                   LFSVNPLTAANVPNLFARNERLICIFDTAFGPLAQILVGATIVGSIETVWDGCVNSERA
FT                   GIIRRWTYPAEGERAVALKKGQEMGRFKLGSTVINLFAPGRIQFDCALSAGCITRMGRE
FT                   LGHAPAAAQESAANAEPT"
FT   gene            complement(404571..405614)
FT                   /locus_tag="NT01EI_0398"
FT   CDS_pept        complement(404571..405614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0398"
FT                   /product="ribosome small subunit-dependent GTPase A,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67639"
FT                   /db_xref="GOA:C5BDM3"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDM3"
FT                   /protein_id="ACR67639.2"
FT                   /translation="MSKKKLSHGQQRRVHTNHQRRLQQTDNSAEMDDSLFGDAQDGIVV
FT                   SRFGKHADVEAADGTQQRCNIRRTLPSLVTGDRVVWRAALQAGSKGIIEAVHPRSSVLT
FT                   RPDYYDGVKPIAANIDQIVIVSAILPELSLNIIDRYLVACETLCVEPLIVLNKVDLLDE
FT                   EGREFVEQAMEIYRHIGYRVVLVSSHNGEGIVQLQDRLTQRISIFAGQSGVGKSSLLNA
FT                   LLPTLESQIEVGAVSDNSGLGQHTTTAARLYHFPHGGDVIDSPGVREFGLWHLDAEQIT
FT                   QGFIEFRDYLGGCKFRDCKHGNDPGCALREAVERGDIAETRFDNYHRILEGMAQVKLRK
FT                   NFGNGDS"
FT   gene            405764..406309
FT                   /locus_tag="NT01EI_0399"
FT   CDS_pept        405764..406309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0399"
FT                   /product="exonuclease family protein"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67640"
FT                   /db_xref="GOA:C5BDM4"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR022894"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDM4"
FT                   /protein_id="ACR67640.2"
FT                   /translation="MSASETRLIWIDLEMTGLDPQRDRIIEIATLVTDADLNVLAEGPV
FT                   IALHQDDAQLALMDEWNVRTHTASGLVARVKASQYDDAAAEQATLDFLRQWVPAGVSPI
FT                   CGNSVGQDRRFLFRYMPELERYFHYRYLDVSTLKELARRWKPEILEGFKKRNTHQALDD
FT                   IRESVAELTYYRTHFIQP"
FT   gene            406491..406566
FT                   /locus_tag="NT01EI_T00013"
FT   tRNA            406491..406566
FT                   /locus_tag="NT01EI_T00013"
FT                   /product="tRNA-Gly"
FT                   /note="putative tRNA-Gly"
FT   gene            406614..406689
FT                   /locus_tag="NT01EI_T00014"
FT   tRNA            406614..406689
FT                   /locus_tag="NT01EI_T00014"
FT                   /product="tRNA-Gly"
FT                   /note="putative tRNA-Gly"
FT   gene            406741..406816
FT                   /locus_tag="NT01EI_T00015"
FT   tRNA            406741..406816
FT                   /locus_tag="NT01EI_T00015"
FT                   /product="tRNA-Gly"
FT                   /note="putative tRNA-Gly"
FT   gene            complement(407106..408245)
FT                   /locus_tag="NT01EI_0403"
FT   CDS_pept        complement(407106..408245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0403"
FT                   /product="iron-sulfur cluster-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67641"
FT                   /db_xref="GOA:C5BDM5"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDM5"
FT                   /protein_id="ACR67641.1"
FT                   /translation="MTHPLDLHQLAQHIKQWGLSLGFQQVGIGDTDLRAEEAPLQAWLD
FT                   SGYHGDMAWMARHGMMRARPAELLPGTLRVISVRMNYLPPSAAFASTLKDPTLGYISRY
FT                   ALGRDYHKVLRARLKKLGEMIQAYCGELRFRPFVDSAPLLERPLAAKAGLGWTGKHSLL
FT                   LNPQAGSWFFLGELLIDLPLPVDTPQTAQCGRCVACITTCPTDAIVAPYKVDARRCISY
FT                   LTIELEGAIPEALRPLLGNRIYGCDDCQMICPWNRLAPLSEEADFLPRAALHAPPLTIL
FT                   FAWDETTFLRMTEGSPIRRIGYQRWLRNLSVALGNAPYDAHIVTLLQQRLGVSALLDEH
FT                   IHWALAQQLQKRAAQAVEVVSSQQRRLIRAVEKGLPRDA"
FT   gene            408247..409740
FT                   /locus_tag="NT01EI_0404"
FT   CDS_pept        408247..409740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0404"
FT                   /product="YjeF-like protein, C-terminus"
FT                   /note="YjeF homolog, C-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67642"
FT                   /db_xref="GOA:C5BDM6"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDM6"
FT                   /protein_id="ACR67642.1"
FT                   /translation="MGHSCNRNIDSLSHYVAPADWVRDAETRAVAAQGIALATLMQRAG
FT                   LAAFNRGRQCYPTSRRWLILCGRGNNGGDGYVIARLARASGLQVTLMAVAGDSPLPPEA
FT                   QQARAQWLQCGGSEIAASLPLPAAEVIVDALLGIGLSSAPRAPYDALISAINAHSAPVL
FT                   SIDLPSGLNADTGAAAGAVVRADHTQSFICLKPGLLTGLARAVVGQLHCDPLGLTVWLA
FT                   QQDWPLQRLDGHCLPRWLAPRSPLAHKGDNGRLLLIGGDSGMGGAIRLAGQAALRSGAG
FT                   LVRVLTRGEHVAPLLAAAPELMVKALSRDTLREALSWAEAVVVGPGLGQGEWGQMVLAA
FT                   LASVRKPMLWDADALNLLSGAPSVCEWRVMTPHPGEAARLLGCGIADVENDRPAAVRAL
FT                   QRRYGGVALLKGAGTLIADDARCAIADVGNPGMASGGMGDILSGIIGGLLAQKLTLYDA
FT                   ACAGAVLHGVAADAAALRDGERGMLASDLLPEIRRWANP"
FT   gene            409771..410235
FT                   /locus_tag="NT01EI_0405"
FT   CDS_pept        409771..410235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0405"
FT                   /product="conserved hypothetical protein TIGR00150"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67643"
FT                   /db_xref="GOA:C5BDM7"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDM7"
FT                   /protein_id="ACR67643.1"
FT                   /translation="MTSIVLQLPDEAATIVLGGALARACQRATVIYLYGDLGAGKTTFS
FT                   RGFLQAMGHQGTVKSPTYTLVEPYPLAPRPVYHFDLYRLADPEELEFMGIRDYFAQDAL
FT                   LLVEWPQQGMGFLPEPDITLHLTYTDGGRQAVIEAHSVHGQGVLAALDGQ"
FT   gene            410258..411883
FT                   /locus_tag="NT01EI_0406"
FT   CDS_pept        410258..411883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0406"
FT                   /product="N-acetylmuramoyl-L-alanine amidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67644"
FT                   /db_xref="GOA:C5BDM8"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDM8"
FT                   /protein_id="ACR67644.1"
FT                   /translation="MQRFLRITLPLALGWCLATMAGAAQLTNIQVSNGERQAVVTLTFN
FT                   APPELSQRVERSPDRVLVEIANSKRITGGLPMQFSGENMLSRIRDGGEQRAGKVLLVLD
FT                   TTARPRVSVTRRGNRAVLTLRAESRAAVAPAPPPASAGKNSLHSRPRQAVPAAAPLPSV
FT                   PVSAVKKSGRYDGSQIVVAIDAGHGGQDPGAIGQDGLREKDVTLAIARRLQGLMDDDPM
FT                   FQPVLTRGGDYFISVMGRSDVARRQKANLLISIHADAAPNRSANGASVWVLSNRRANSE
FT                   MAGWLEQHEKQSELLGGAGDVLANSNQDKYLSQTVLDLQFGHSQRVGYDVAVQVLRQMQ
FT                   SVVRLHKRDPEHASLGVLRSPDIPSLLVETGFISNSEGERQLGSGQHQERIARAIYLGV
FT                   RSYFLAHPLQSGPKVENRPQQASAAGNAAAAASSASGIHVVKRGETLLGIANRYGSTLS
FT                   GMMRLNNLKKEGVWVGQRLKVPSVGGSAQPATASVPRIHLVKRGDTLTRIAAHYGVSMD
FT                   ALRQANKMKSDGVQLGQRLRIPSR"
FT   gene            411900..413819
FT                   /locus_tag="NT01EI_0407"
FT   CDS_pept        411900..413819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0407"
FT                   /product="DNA mismatch repair protein MutL, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67645"
FT                   /db_xref="GOA:C5BDM9"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BDM9"
FT                   /protein_id="ACR67645.1"
FT                   /translation="MPIQILPPQLANQIAAGEVVERPASVVKELVENSLDAGATRIDID
FT                   IERGGAKLIRIRDNGGGIGKAELALALARHATSKISTLDDLEAIVSLGFRGEALASISS
FT                   VSRLTMTSRPEGQAEAWQAYAEGREMAVMVKPSAHPVGTTVEVLDLFYNTPARRKFLRT
FT                   EKTEFAHIDEVVRRIALARFDITLTLQHNGKTVRQYRAVKEGDARERRLGAICGPVFVQ
FT                   HALALTWRHDELAIHGWVAAPQAIRQIGELQYCYVNGRMMRDRLITHAIRQAYQDRLSD
FT                   EMPPAYVLYLEIDPRQVDVNVHPAKHEVRFHQARLVHDFIYQAVVEVLQQAQVASAHDD
FT                   PTPAISGAARDEEPRGVENRASAGENRFNRPASSPVASAPRPAHVAAPRMPAGDIFRRR
FT                   EGELYQRLLAANPAPAAETDSAFVAAPGAPVTVAGPPAVAVSTAAENGAPGDSFGRVLT
FT                   LCADGVALTECRSGVALVSLFHARRCLLRAQLQPPDEGLKAQPLLVPLRLTLEAAERQA
FT                   LKTQQPLLQQMGLRLQPERQHALLHAVPLPLRQQNLPRLIPQMLRYLATASVCDAASLA
FT                   DWLAAHWHSADEAPWTVAQAVQLLADLERLCPQLVQSPPRALLQPLDLQPGVDRLRQEE
FT                   QLNE"
FT   gene            413812..414765
FT                   /locus_tag="NT01EI_0408"
FT   CDS_pept        413812..414765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0408"
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase, putative"
FT                   /EC_number="2.5.1.75"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67646"
FT                   /db_xref="GOA:C5BDN0"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDN0"
FT                   /protein_id="ACR67646.1"
FT                   /translation="MSNDKQMQKLPPAIFIMGPTASGKTALAMALRERFPVEIISVDSA
FT                   LIYRGMDIGTAKPSAEELARAPHRLIDIRSPTQSYSAADFRADALREMAQISAQGRIPL
FT                   LVGGTMLYYKALLEGLSPLPPADDAVRARIEQQASEQGWEVLHRELARIDPVAAARIHP
FT                   NDPQRLSRALEVFFVSGNTLTELTRVSGEALPYAVSQFAIAPSRRELLHQRIALRFQQM
FT                   LEAGFEQEARRLFARDDLHPDLPSVRCVGYRQMWSYLAGEIDYDEMVYRGVCATRQLAK
FT                   RQMTWLRGWESVQWLDSDKPAEALDCVAQVVSASLD"
FT   gene            414928..415236
FT                   /locus_tag="NT01EI_0409"
FT   CDS_pept        414928..415236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0409"
FT                   /product="RNA chaperone Hfq, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67647"
FT                   /db_xref="GOA:C5BDN1"
FT                   /db_xref="InterPro:IPR005001"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDN1"
FT                   /protein_id="ACR67647.2"
FT                   /translation="MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVIL
FT                   LKNTVSQMVYKHAISTVVPSRPVSHHSGNAGTGSAGSSYHHGGQAASQPTQGSDDAE"
FT   gene            415335..416615
FT                   /locus_tag="NT01EI_0410"
FT   CDS_pept        415335..416615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0410"
FT                   /product="GTP-binding proten HflX"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67648"
FT                   /db_xref="GOA:C5BDN2"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDN2"
FT                   /protein_id="ACR67648.1"
FT                   /translation="MFDRYEAGEQAVLVHIYFSQEKDSEDLSEFESLVSSAGVQALRVI
FT                   TGSRKAPHPKYFVGEGKAQEIAQAVAETQASVVLFDHPLSPAQERNLERLCQCRVIDRT
FT                   GLILDIFAQRARTHEGKLQVELAQLRHLATRLVRGWTHLERQKGGIGLRGPGETQLETD
FT                   RRLLRDRIHLILGRLEKVEKQREQGRRARVRAEIPTVSLVGYTNAGKSTLFNTLTSATV
FT                   YAADQLFATLDPTLRRVEVNDVGPTVLADTVGFIRHLPHDLVAAFKATLLETRQASLLL
FT                   HVVDASDARVDENIDAVNTVLADIGADEIPVLLVMNKIDMLQDFVPRIDRDEENRPLRV
FT                   WVSAQQASGMDLLFQALSERLGGEIASYTLRLPPAAGRLRSRFYQLQAIEKEWIEEDGS
FT                   IGLQVRMPVVDWRRLCKQQQELINFIV"
FT   gene            416674..417933
FT                   /locus_tag="NT01EI_0411"
FT   CDS_pept        416674..417933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0411"
FT                   /product="HflK protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67649"
FT                   /db_xref="GOA:C5BDN3"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR010201"
FT                   /db_xref="InterPro:IPR020980"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDN3"
FT                   /protein_id="ACR67649.1"
FT                   /translation="MAWNQPGNNGQNRDPWGSSNNNGGNSGGNNNKGGRDQGPPDLDDL
FT                   FRKVSKKLGGLGGGKSGGSGSAGTPRSSIGGKKVVGLAVAAVVVIWAASGFYTIKEAER
FT                   GVVTRFGKFSHLVQPGLNWKPTFIDDVIPVNVESVRELAASGVMLTSDENVVRVEMNVQ
FT                   YRVTNPEEYLFNVTNADDSLRQATDSALRAVIGKYTMDTILTEGRTVIRNDTQKVLEEI
FT                   IRPYHMGITILDVNFQAARPPEEVKAAFDDAIAARENEQQYIREAEAYANEVQPRANGQ
FT                   AQRILEDAKAYKDRTVLEAQGEVGRFSRLLPEYKASPEITRERLYLETMERVLGHTRKV
FT                   LVDDKSNNLMVLPLDQIMRSGDKGASQAGDSKDTSLIRLNPPQASSKPVSAGSSTDSSV
FT                   MDQRRVNAQRNDTTRLGRDY"
FT   gene            417933..418937
FT                   /locus_tag="NT01EI_0412"
FT   CDS_pept        417933..418937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0412"
FT                   /product="HflC protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67650"
FT                   /db_xref="GOA:C5BF64"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010200"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:C5BF64"
FT                   /protein_id="ACR67650.1"
FT                   /translation="MRKSLLVILIVVLVALYASLFVVQEGQRGIVLRFGKVLRDDENKP
FT                   LVYAPGLHLKIPFIESVKMLDARIQTMDNQADRFVTKEKKDLIVDSYIKWRISDFSRYY
FT                   LATGGGDVSQAEVLLKRKFSDRLRSEIGRLDIKDIVTDSRGKLMEDVRNALNTGTVDDA
FT                   AAPTEADDAIASAAARVARETSGKQPAVNPNSMAALGIQVVDVRIKQINLPTEVSDAIY
FT                   QRMRAEREAVARRHRSQGQEEAEKLRATADYEVTRTLAEAEREGRIIRGEGDAKAAKLF
FT                   ANAFSKDPDFFAFIRSLKAYENSFKGGQDVMVLRPDSDFFKYMKSPDGGKNAK"
FT   gene            complement(419247..420359)
FT                   /locus_tag="NT01EI_0413"
FT   CDS_pept        complement(419247..420359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0413"
FT                   /product="putative acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67651"
FT                   /db_xref="GOA:C5BF65"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:C5BF65"
FT                   /protein_id="ACR67651.1"
FT                   /translation="MKPGRNHFFDILRVVSVLFVITSHYSYMFDTSTVLTFPREYLTAG
FT                   IGRLGVSFFFMISGALAYLSLRKYAAHEYYLRRIYSVLIPYNIAYFGMALLLLALGIFF
FT                   TYPGNPLVEVGPNGTRSVLDMLPSVLGFDHYLHGVYEIKTVYFTGEWFIGCIILLYVIS
FT                   PLIYRAIVRYPMWTMLATVAITLMAYDTRVTNPYWSAQVRISDFTFGMLFIHLQAQFTR
FT                   YVRPLALTGALLIAVGVSWAHISHQPVREVLFPLAPVSLLFAVAFFLIVQGTYQLLHPW
FT                   LSRPRASQILLSLASRAYIIMLLQHVVVIFLNANLDMSVLNATQAIALYLIVLVTIERL
FT                   SVLFKPLAVKTEQLLMNKTLRRSTRQMPTA"
FT   gene            420569..420751
FT                   /locus_tag="NT01EI_0414"
FT   CDS_pept        420569..420751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0414"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67652"
FT                   /db_xref="GOA:C5BF66"
FT                   /db_xref="InterPro:IPR019201"
FT                   /db_xref="UniProtKB/TrEMBL:C5BF66"
FT                   /protein_id="ACR67652.1"
FT                   /translation="MALALVLVVEGLGPMLFPQAWRRMIATMAQLPDGLLRRYGGGLVV
FT                   AGLVIYYMLRSRLGG"
FT   gene            420850..422148
FT                   /locus_tag="NT01EI_0415"
FT   CDS_pept        420850..422148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0415"
FT                   /product="adenylosuccinate synthetase, putative"
FT                   /EC_number="6.3.4.4"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67653"
FT                   /db_xref="GOA:O31047"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31047"
FT                   /protein_id="ACR67653.1"
FT                   /translation="MGKNVVVLGTQWGDEGKGKVVDLLTERAKYVVRYQGGHNAGHTLV
FT                   INGEKTVLHLIPSGILRENVVSIIANGVVLAPDALLREMTELEARGVPVRERLLLSEAC
FT                   PLILPYHVALDNAREKARGAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKASFAVKLK
FT                   EIMEYHNFQLVNYYHVDAVDYQSVLDEVMAVADLLTSMVVDVADLLNKAYRNGEYVMFE
FT                   GAQGTLLDIDHGTYPYVTSSNTTAGGVATGSGIGPRCVDYVLGIVKAYSTRVGAGPFPT
FT                   ELFDSVGEFLCEKGNEFGATTGRRRRTGWLDAVAVRRAVELNSLSGFCLTKLDVLDGLD
FT                   EVKICVGYRLPDGREVDVTPLAAEGWEGIEPIYEVLPGWKESTFGVKLRDGLPQAALNY
FT                   IKRIEEVTGVPVDIISTGPDREETIVLRHPFDA"
FT   gene            complement(422272..422487)
FT                   /locus_tag="NT01EI_0416"
FT   CDS_pept        complement(422272..422487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0416"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67654"
FT                   /db_xref="UniProtKB/TrEMBL:C5BF68"
FT                   /protein_id="ACR67654.1"
FT                   /translation="MYTKARNPKSVKLVNCTNTSIHHAALPAGNEDGSGAQASSSRPSM
FT                   RKMHPARPTHDHRMQRALQRGTPYTG"
FT   gene            422438..422860
FT                   /locus_tag="NT01EI_0417"
FT   CDS_pept        422438..422860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0417"
FT                   /product="transcriptional repressor, NsrR family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67655"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5BF69"
FT                   /protein_id="ACR67655.2"
FT                   /translation="MQLTSFTDFGLRALVYMAALPEGQMTSITQVTAVYGVSRNHMVKI
FT                   INQLSRAGFVTAVRGKHGGIRLGRPASEIRIGDVVRELEPLTLVNCSQAFCHITPACRL
FT                   KQVLRRATDAFLTELDQCTLADLIEHNPPLYKLLLV"
FT   gene            422900..425350
FT                   /locus_tag="NT01EI_0418"
FT   CDS_pept        422900..425350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0418"
FT                   /product="ribonuclease R, putative"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67656"
FT                   /db_xref="GOA:C5BF70"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR013668"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR040476"
FT                   /db_xref="UniProtKB/TrEMBL:C5BF70"
FT                   /protein_id="ACR67656.1"
FT                   /translation="MSQDPYLEREAEKYASPIPSREFILMHLAKRKTPASREELAQELA
FT                   LSSEEALEALRRRLRAMERDGQLIFTRRQCYALPERLDLIKGTVIGHRDGFGFLRSEGQ
FT                   KEDLYLSPEQMKMCMHGDEILAQVTGTDRRGRKEVRVVRVVESRTGLIVGRYFTDAGTG
FT                   FVVPDDGRLSFDILIPSDAIAGARMGYVVVVELTQRPTRRTKAVGKIVEVLGDNMGTGM
FT                   AVDIALRSHDIPHAWPDLVERQVAELCEEVPEAAKVGRIDLRDLPLVTIDGEDARDFDD
FT                   AVYCEKKRGGGWRLWVAIADVSYYVRPNTALDHEARSRGNSVYFPSQVVPMLPEVLSNG
FT                   LCSLNPQVDRLCMVCEMTIAASGRLSSYKFYEAVMSSHARLTYTKVAHILAGDPDLRAQ
FT                   YHALVKPLEELHALYKALDHARAERGGISFETEEAKFIFNAERRIERIEPTVRNDAHKL
FT                   IEECMILANISAARFMEKNHEPVLFRIHDKPSEDHVMALRSVLAELGLSLGGGTQPEPK
FT                   DYALLMDKVADRPDHEMLQTMLLRSMKQAVYDPENRGHFGLALQAYAHFTSPIRRYPDL
FT                   SLHRGIKYLLASEHGHAERWTPSGGWHYHTEDMLQLGEHCSMTERRADEATRDVSDWLK
FT                   CDFMQDHVGQTYGGIITSVTGFGFFVRLDDLFIDGLVHVSTLDNDYYRFDQIGQRLIGE
FT                   SSGQVYRLGDKVEVKVDAVHLDERKIDFALISTARGVRGAGKTARNKARQANGGAEKKP
FT                   SRSARRGGKMPANFASDSVQRRGDEAAPAKKGRGKGKGKKPSVQTRNIAASTKAKRARK
FT                   KTTD"
FT   gene            425441..426184
FT                   /locus_tag="NT01EI_0419"
FT   CDS_pept        425441..426184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0419"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67657"
FT                   /db_xref="GOA:C5BF71"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR024915"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:C5BF71"
FT                   /protein_id="ACR67657.1"
FT                   /translation="MSEIIYGIHAVKALLEQDPQRFLDVFVMKGREDRRLLPLLQQLEE
FT                   CGIRVQVAQRQWLDEKVEGAVHQGIVARVKPGRQYQENDLPDLLAGLEHPPFLLILDGV
FT                   TDPHNLGACLRSADAAGVDAVIVPRDRSAQLNATAKKVACGAAENVPLIRVTNLARTIR
FT                   LLQQENIWIVGTAGEADHSLYQSRMTGAMALVMGAEGDGMRRLTREHCDELISIPMAGS
FT                   VSSLNVSVATGICLFEVVRQRSAKA"
FT   gene            complement(426212..426487)
FT                   /locus_tag="NT01EI_0420"
FT   CDS_pept        complement(426212..426487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0420"
FT                   /product="Protein of unknown function (DUF1471)"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67658"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:C5BF72"
FT                   /protein_id="ACR67658.1"
FT                   /translation="MSRSPLFTSLLFSIGLIGTSAQSAEYARADLVTDLSRMGMISLRG
FT                   ILGNPQDVERSIAHQADQRGARYYRILHMWESDGQQGWQATAALYR"
FT   gene            complement(426664..426975)
FT                   /locus_tag="NT01EI_0421"
FT   CDS_pept        complement(426664..426975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0421"
FT                   /product="Protein of unknown function (DUF1471)"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67659"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:C5BF73"
FT                   /protein_id="ACR67659.1"
FT                   /translation="MKACKLTLTLLLTLLLGACSVMDGKPMPPPPPIAGHAQELRRNQT
FT                   EGLSKMWNISASVYGSPMNVQEVIQQRADAAGARYYYIVMLQENRVPGQWYSVATLYR"
FT   gene            426987..427109
FT                   /locus_tag="NT01EI_0422"
FT   CDS_pept        426987..427109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0422"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67660"
FT                   /db_xref="UniProtKB/TrEMBL:C5BF74"
FT                   /protein_id="ACR67660.1"
FT                   /translation="MAGKRIVMIILALSDADFPEKRRIVRAEDTGACLRSLAGR"
FT   gene            427142..427891
FT                   /locus_tag="NT01EI_0423"
FT   CDS_pept        427142..427891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0423"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67661"
FT                   /db_xref="GOA:C5BF75"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C5BF75"
FT                   /protein_id="ACR67661.2"
FT                   /translation="MVEMFEQTVGGIPLLHAVPAGQRDSALPTIFFYHGFTSSKEMYSY
FT                   FGYAFAAAGFRVLLPEADMHGSRYDGDERRRLAHFWDILKSNIDELPSLYDHFLRAGLI
FT                   LDGRVGVAGASLGGMTALGAKARYPWLRATASFMGSGFYLSLSQRLFPRQHQPTEDERE
FT                   WVRQRVSALADYDVSGRLAQLADRPLLIWHGLADDLVPAAESQRLAQALASHHLMDNVS
FT                   VVTEPGIAHKITASALACGTAFFSRRL"
FT   gene            complement(427930..428046)
FT                   /locus_tag="NT01EI_0424"
FT   CDS_pept        complement(427930..428046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0424"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67662"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:C5BF76"
FT                   /protein_id="ACR67662.1"
FT                   /translation="MGDIWAQTDANGATYDQIITIHEPLSHRQIHVSAVLYH"
FT   gene            428495..428890
FT                   /locus_tag="NT01EI_0425"
FT   CDS_pept        428495..428890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0425"
FT                   /product="30S ribosomal protein S6, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67663"
FT                   /db_xref="GOA:C5BF77"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR020815"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BF77"
FT                   /protein_id="ACR67663.1"
FT                   /translation="MRHYEIVFMVHPDQSEQVPGMIERYTGAITGAEGKIHRLEDWGRR
FT                   QLAYSINKLHKAHYVLMNVEASQEVIDELETNFRYNDAVIRSMVMRTKHAVTEASPMVK
FT                   AKDERRERREDFANETSEETEAGDSEE"
FT   gene            429221..429448
FT                   /locus_tag="NT01EI_0426"
FT   CDS_pept        429221..429448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0426"
FT                   /product="30S ribosomal protein S18, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67664"
FT                   /db_xref="GOA:C5BF78"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BF78"
FT                   /protein_id="ACR67664.1"
FT                   /translation="MARYFRRRKFCRFTAEGVQEIDYKDIATLKNYITESGKIVPSRIT
FT                   GTRAKYQRQLARAIKRARYLSLLPYTDRHQ"
FT   gene            429491..429940
FT                   /locus_tag="NT01EI_0427"
FT   CDS_pept        429491..429940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0427"
FT                   /product="50S ribosomal protein L9, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67665"
FT                   /db_xref="GOA:C5BF79"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BF79"
FT                   /protein_id="ACR67665.1"
FT                   /translation="MQVILLDKVANLGSLGDQVNVKAGYARNFLVPMGKAVPATKKNVE
FT                   FFEARRADLEAKLAETLSAAEARAVKINELATVTIASKAGDEGKLFGSIGTRDIADAVT
FT                   AAGVAVTKSEVRLPNGVLRTLGDHEVHFQVHSDVFAQLNVVVVAE"
FT   gene            430155..430523
FT                   /locus_tag="NT01EI_0429"
FT   CDS_pept        430155..430523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0429"
FT                   /product="Protein of unknown function, DUF488"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67667"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="UniProtKB/TrEMBL:C5BF80"
FT                   /protein_id="ACR67667.1"
FT                   /translation="MVSIGLQRVYDVWAPCSPHTFLTDRLWPRGIAKARLDGVHWLKEV
FT                   APSTALRQAFHHAQLDWPAFVARYREELAANPRAWQSLVQLLCQGESLTLLYGSRDSQC
FT                   NQAVALRDWLLEQLIAGE"
FT   gene            complement(430507..431154)
FT                   /locus_tag="NT01EI_0428"
FT   CDS_pept        complement(430507..431154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0428"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67666"
FT                   /db_xref="InterPro:IPR007340"
FT                   /db_xref="InterPro:IPR013731"
FT                   /db_xref="UniProtKB/TrEMBL:C5BF81"
FT                   /protein_id="ACR67666.1"
FT                   /translation="MGRIAPKKNKIPAYSGVAIQNIWRRLRRGLTALPAARPRKEDLRR
FT                   IPQQCRAALRALWHWPEQCDWMAPLPAFHRRWLTLICAVLLMALLWPIDDAAPPIQPPA
FT                   AHTEGSAIQATLQPQRATPISPDANDWQAYLILPGQTLAQVLREHNLDVTDAFAMARIE
FT                   GDDRPLSNLKAGQYVMIRHNPQGQILALKIETTDDRQVTFRRESDSSFIRLR"
FT   gene            431401..432021
FT                   /locus_tag="NT01EI_0430"
FT   CDS_pept        431401..432021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0430"
FT                   /product="peptidyl-prolyl cis-trans isomerase, FKBP-type,
FT                   putative"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67668"
FT                   /db_xref="GOA:C5BF82"
FT                   /db_xref="InterPro:IPR000774"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR036944"
FT                   /db_xref="UniProtKB/TrEMBL:C5BF82"
FT                   /protein_id="ACR67668.1"
FT                   /translation="MSTPAFDSIEAQASYGIGLQVGQQLNESGLQDLQPEALLAGLRDA
FT                   MEGNAPAVPVETVHRALREIHGRADAVRREQQKALAEAGERFLAENAQQNDVTVTESGL
FT                   QFKVLKQGEGVIPSRQDKVRVHYTGRLVDGTVFDSSEQRGEPAEFPVGGVIAGWIEALS
FT                   MMPVGSRWQLYIPHQLAYGERGAGAAIAPYSALIFDVELLDIL"
FT   gene            complement(432073..432738)
FT                   /locus_tag="NT01EI_0431"
FT   CDS_pept        complement(432073..432738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0431"
FT                   /product="Hemerythrin HHE cation binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67669"
FT                   /db_xref="GOA:C5BF83"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR019903"
FT                   /db_xref="InterPro:IPR023742"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BF83"
FT                   /protein_id="ACR67669.1"
FT                   /translation="MTYRDRPLGELAISIPRATRLFRQYELDFCCGGKLTLQRAAARHS
FT                   LDLVMLESQLAELDSTPDQHRDWRQAPLDELCAFIVTRYHQRHRDQLPELVLMAQKVEQ
FT                   VHTGKTGCPRGLAKQLDSLRQELDSHMMKEERILFPLIEQGEGARCHGPISVMEHEHRD
FT                   AGELLDVIRFLTDNMTPPTGACTTWRALYAGISELINDLMEHVSLENNLLFPRALGDV"
FT   gene            complement(432775..432894)
FT                   /locus_tag="NT01EI_0432"
FT   CDS_pept        complement(432775..432894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0432"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67670"
FT                   /db_xref="UniProtKB/TrEMBL:C5BF84"
FT                   /protein_id="ACR67670.1"
FT                   /translation="MFIMGFAIDKRQRKLQFSPVNTAIPLHAAKEVARAINSI"
FT   gene            432981..433721
FT                   /locus_tag="NT01EI_0433"
FT   CDS_pept        432981..433721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0433"
FT                   /product="3'(2'),5'-bisphosphate nucleotidase, putative"
FT                   /EC_number="3.1.3.7"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67671"
FT                   /db_xref="GOA:C5BF85"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006240"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="UniProtKB/TrEMBL:C5BF85"
FT                   /protein_id="ACR67671.1"
FT                   /translation="MLEQICQLARDAGATIMAVYQGDQPLALAYKGDESPVTAADLAAH
FT                   EIIKAGLLRVTPLIPLLSEEEPPAWPQRRDWQRYWLVDPLDGTKEFLQRNGEFTVNIAL
FT                   IEQGIPTLGVVYVPTSGVLYCACGGKAWKEQDGVRMEIGVRNAIPPLVVISRSHGDAEL
FT                   TDYLQQLGEHQTMMVGSSLKFCLVAEGVAQLYPRFGPTHIWDTAAGHAIALAAGAQVRD
FT                   WQGKTLSYIPAESLLNPGFRVSLY"
FT   gene            434037..434243
FT                   /locus_tag="NT01EI_0434"
FT   CDS_pept        434037..434243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0434"
FT                   /product="Protein of unknown function (DUF1107)"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67672"
FT                   /db_xref="InterPro:IPR009491"
FT                   /db_xref="UniProtKB/TrEMBL:C5BF86"
FT                   /protein_id="ACR67672.1"
FT                   /translation="MKIFQRYNPLLVAKYVKTLFRGRLYIQGVGAFEFDMGRILLPKVK
FT                   DKRHLSVMSEINRQVLRLQAEMS"
FT   gene            complement(434292..435638)
FT                   /locus_tag="NT01EI_0435"
FT   CDS_pept        complement(434292..435638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0435"
FT                   /product="hypothetical protein"
FT                   /note="Protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67673"
FT                   /db_xref="GOA:C5BF87"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C5BF87"
FT                   /protein_id="ACR67673.1"
FT                   /translation="MLNSILLIILLIAISAFFSISEISLAASRKIKLKTMADEGDINAA
FT                   RVMALQDQPGYFFTVVQIGLNAVAILGGIVGDAAFSPAFRLLFDRFMPLEVSQQASFIC
FT                   SFVLVTSCFILFADLTPKRIGMIAPEAVAVRIVNPMRFCLLLFRPLVWFFNGLANLIFH
FT                   LFKIPMVRKDDITPDDIYAVVEAGALAGVLRKQEHEIIENVFELESRTVPSSMTPRENI
FT                   IYFDLGETEDSIKEKVSTHPHSKFLVCDGAIDHVVGYVDSKDLLNRVLGNQSLVLSSGV
FT                   QIRNVLIVPDTLTLSEALESFKNAGEDFAIILNEYALVVGVITLNDVMTTLMGDLVGQG
FT                   QEEQIIARDENSWLVEGVTPIDDVMRVLDIEEFPQSSNYETIGGFMMYMLRKIPKRTDA
FT                   VKYAGYKFEVVDIDSYKIDQLLVTRLAERLPPMSPDAGDDADVPQQAAK"
FT   gene            complement(435912..436550)
FT                   /locus_tag="NT01EI_0436"
FT   CDS_pept        complement(435912..436550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0436"
FT                   /product="Peptide methionine-S-oxide reductase, putative"
FT                   /EC_number="1.8.4.11"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67674"
FT                   /db_xref="GOA:C5BF88"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:C5BF88"
FT                   /protein_id="ACR67674.1"
FT                   /translation="MHHHNSSTPAPFTPAQALPGRTQAMSLSGKHALNGHDMYAIPAGM
FT                   EEALFAMGCFWGVERLFWQQPGIYSTAAGYSGGLTPNPTYREVCSGQTGHAETVRVVFD
FT                   PSLIRYDDLLRLFWQHHDPAQGMRQGNDVGTQYRSALFPVTSQQMQAAQASHTRFAQAM
FT                   HQVGDLRPISTEIRAAGPFYYAEEEHQQYLHKHPHGYCGVGGIGVCLPD"
FT   gene            436833..438569
FT                   /locus_tag="NT01EI_0437"
FT   CDS_pept        436833..438569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0437"
FT                   /product="outer membrane protein, OMP85 family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67675"
FT                   /db_xref="GOA:C5BF89"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR035243"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:C5BF89"
FT                   /protein_id="ACR67675.1"
FT                   /translation="MPRLRRIGLLCLLLAAPLAHAAQVRLVVEGLSGQLQQNVRATLST
FT                   IGEDEISNDGRFRVRAADAIRQGLRALGYFQPTIEFEYRPGSIFSRPQLIANVTPGEPV
FT                   RIAGLNVRIRGAAKDDSAYQALLAKSLPPVGSVLDQGDYDNLKNALNSLALQRGYFSAT
FT                   MPVHQLGVIEDQHKAFWDIEFDSGPRYRFGDVRFSGSQIQTAYLQNLRPFKSGEYYSAD
FT                   DLAKFSGNLSATNWFNSVVVSPDFKALGTDQTLPLQAVVTPRSQNMVDLGGGYATDVGP
FT                   RMKVSWKRPWMNSYGHSLDTSLNLSMPEQTADFSYKIPLLKAPLEQYYLVQGGFQRTDL
FT                   NDTQSDSTTLNLARYWELSSGWQRGINMRWGLDHFTQGNVTETAMLLYPGVSVNRTRSR
FT                   GGLMPSWGDTQRYSMDVSNRYWGSSVDFVVFQAQNVWIRTLAERHRFVVRGDLGWIETN
FT                   DFNKVPPSLRFFAGGDRSIRGYKYKSISPKGSDGKLTGASRLATGSLEYQYNLSGKWWG
FT                   GVFIDSGEAVNDFTKSDFHTGTGVGVIWVSPVGPIRLNLGVPVGREDKHDVQIYIGLGP
FT                   EL"
FT   gene            438566..442330
FT                   /locus_tag="NT01EI_0438"
FT   CDS_pept        438566..442330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0438"
FT                   /product="Protein of unknown function (DUF490)"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67676"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="UniProtKB/TrEMBL:C5BF90"
FT                   /protein_id="ACR67676.1"
FT                   /translation="MRWYNIRRYALMLLLGLLLLLALLLGGVMTQGGLHLALNAAARWV
FT                   PGLEIGRVEGGWRDLTLRDVGYRMPGVDVAVGQFHLSLDIGCLKRSELCLNVLSAQRVR
FT                   VNVDTQALPPSEPPTTPSAPLGRLATPYPLVLRLLRLNDVQVNVDGTAISLEALRSGAE
FT                   WRGSLLRLQPSDIQGLRVSLPPPAAPAPAESAAPKGPSEPLGEVLTALFSRPLLPAAMT
FT                   LDLPLDMQLSRISARQVQIRAATDLDIASLELRAALDQQRLALHTLKVQAQQGSLSARG
FT                   SATFSGRWPLDLQLNASVNQAPLKGEKLRLALKGAMYDTLALDANLSGPLRATLKGDTR
FT                   LADAGLPLSLSLDSPSLRWPLGGTPDYQVNNMVLRLTGSAHDYRLQLRGAFSGQGLPDA
FT                   ALDLAGKGNERQFTLSQLQLATLGGKADMQALVDWSKAISWRSSLTLTGIDTGRQWPAW
FT                   PSSLNGKIETRGSLYGGSWQLQVPQLKLTGRIKQNGLDVGGQLRGNQAGQWQIPQLHIA
FT                   LGRNRIEVNGDLAQKQWSLDGRIDAPRLDGTLPGLSGSARGTLKLRGDRQAPQLLADLQ
FT                   ARGLRWQDLTIQRVALLGDIRSDQQIQGTLDLRVDSLKQGDIDISQLTLRAAGNERQHR
FT                   LQLVMQGTPLAGRLTLNGSLAQDRARWSGTLTDTDFTTPVGEWRLTRPIALEYGVAKQQ
FT                   MAIGPHCWDNPNARLCVPQTIEVGESGKVSVVLERFDLAMLQPFLGPDTQLHGRFSGRA
FT                   QASWQAGQGLPQARITLNGDGVRVVQQVQGNTLPVALSTVTLEASLAQGQARVNWLIGI
FT                   VDNGQLRGDVRIANLEGARNLSGNVDIQHLSLALFNPALMKGEKAQGMLNASLRLGGST
FT                   LHPQLYGRLALDGVDIDGQFMPFDVTDANLAINFDGMSSVLQGVIKTSQGQLNLSGNAD
FT                   WRNLNAWRARIAASGTRLRVTVPPMVRLDVSPNIVFDASPSQLALSGWVDIPWARITVQ
FT                   ELPESAVGVSSDEVMLNNAHQPIRPVTASIPLHTDLTIAIGNNVRLSAFGLKAALKGEL
FT                   KVSQNQNGLGLNGQIMIPQGRFAAYGQDLLIRQGELVFAGPPGNPLLNIEAIRNPESTA
FT                   NDVTVGVRVTGLAEQPKLEVFSDPAMSQQEALSYLLRGQGLNSSGADSNAMTSMLIGLG
FT                   VAQSGKLVGKIGETFGVSNLTLDSQGVGDSSQVVVSGYVLPGLQVKYGMGIFDSLATLT
FT                   LRYRLMPNLYLEAVSGVNQALDLLYQFEF"
FT   gene            442387..442677
FT                   /locus_tag="NT01EI_0439"
FT   CDS_pept        442387..442677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0439"
FT                   /product="AIG2-like family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67677"
FT                   /db_xref="GOA:C5BF91"
FT                   /db_xref="InterPro:IPR009288"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="InterPro:IPR039126"
FT                   /db_xref="UniProtKB/TrEMBL:C5BF91"
FT                   /protein_id="ACR67677.1"
FT                   /translation="MTNATWLGDYVLDGYDLYDLGHYPAVVPGEGRVYCEVYRITSSIL
FT                   AELDELKSNSKDYRRELIKTPYGCAWIYIYLNGVEGLPRIASGDWLKREEG"
FT   gene            complement(442725..443255)
FT                   /locus_tag="NT01EI_0440"
FT   CDS_pept        complement(442725..443255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0440"
FT                   /product="inorganic diphosphatase, putative"
FT                   /EC_number="3.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67678"
FT                   /db_xref="GOA:C5BF92"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:C5BF92"
FT                   /protein_id="ACR67678.1"
FT                   /translation="MSLINVPAGKDMPEDIYVVIEIPANADPIKYEIDKETGALFVDRF
FT                   MSTAMFYPCNYGYINHTLSLDGDPVDVLVPTPYPLQPGSVIRCRPVGVLKMTDEAGEDA
FT                   KLVAVPHSKLTKEYDHIQDVNDLPELLRAQIAHFFEHYKDLEKGKWVKVEGWADAAAAK
FT                   AEIIASFERAKNK"
FT   gene            complement(443367..444371)
FT                   /locus_tag="NT01EI_0441"
FT   CDS_pept        complement(443367..444371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0441"
FT                   /product="fructose-1,6-bisphosphatase, putative"
FT                   /EC_number="3.1.3.11"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67679"
FT                   /db_xref="GOA:C5BF93"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR020548"
FT                   /db_xref="InterPro:IPR028343"
FT                   /db_xref="InterPro:IPR033391"
FT                   /db_xref="UniProtKB/TrEMBL:C5BF93"
FT                   /protein_id="ACR67679.1"
FT                   /translation="MKTLGEFIVEKQQDFPHATGELTALLSAIKLGAKIIHRDINKAGL
FT                   VDIIGVSGAENIQGEVQMKLDLYANEKLKAALEARGEVAGIASEEEDDIVIFEGDRANN
FT                   AKYVVLMDPLDGSSNIDVNVSVGTIFSIYRRITPLGTPVTREDFLQPGNRQVAAGYVVY
FT                   GSSTMLVYTTGNGVHAFTYDPSLGVFCLSHERLRFPHSSNMYSINEGNYIKFPLGVKKY
FT                   IKYCQEQDSATQRPYTSRYIGSLVADFHRNLLKGGIYIYPSTASHPQGKLRLLYECNPM
FT                   SFLAEQAGGKATDGFRRILDIVPDQLHQRCPFFVGSCAMVEDAERFMHQFPDE"
FT   gene            444538..445914
FT                   /locus_tag="NT01EI_0442"
FT   CDS_pept        444538..445914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0442"
FT                   /product="UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate
FT                   ligase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67680"
FT                   /db_xref="GOA:C5BF94"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005757"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:C5BF94"
FT                   /protein_id="ACR67680.1"
FT                   /translation="MRIHILGVCGTFMGGLALLARQLGHDVTGSDANVYPPMSTLLQQQ
FT                   GITLLEGYDPAHLEPQPDLVIIGNALARGNPCVETILERNIPYVSGPQWLHDEVLRHRW
FT                   VIAIAGTHGKTTTAGMVNWILESCGYEPGFVIGGVPGNFSVSARLGNSPFFVIEADEYD
FT                   CAFFDKRSKFVHYCPRTLILNNLEFDHADIFDDLRAIQRQFHHLVRLVPGKGRIILPAG
FT                   DASLKQVMAMGCWSEQELCGDEAAWNVTRLSADASHFSVSLDGACVGEVQWTLVGEHNM
FT                   HNGLMAIAAARHVGVPPAEACRALGSFINARRRLELRGQAHGVSVYDDFAHHPTAILAT
FT                   LAALRGKVGGTARILAVLEPRSNTMKMGVCKNELAPALGRADEVYLYQPQHIPWQVVEV
FT                   AEACVQPAYWSADLGTLVEMIVKNAQPGDHILVMSNGGFGDIHDRLLQALAQKSAVHQE
FT                   "
FT   gene            complement(446022..446186)
FT                   /locus_tag="NT01EI_0443"
FT   CDS_pept        complement(446022..446186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0443"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67681"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:C5BF95"
FT                   /protein_id="ACR67681.1"
FT                   /translation="MQPMGVITVSKLGGSIADIDQQLAAKAQPQGASTFRIIEKRIDGN
FT                   YHATAMIYH"
FT   gene            complement(446196..446366)
FT                   /locus_tag="NT01EI_0444"
FT   CDS_pept        complement(446196..446366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0444"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67682"
FT                   /db_xref="UniProtKB/TrEMBL:C5BF96"
FT                   /protein_id="ACR67682.1"
FT                   /translation="MLDSDMSIILFDDDATSQQRYNTMKNKATIGALATLCALSFGAST
FT                   AQPPLNEITTT"
FT   gene            complement(446633..447103)
FT                   /locus_tag="NT01EI_0445"
FT   CDS_pept        complement(446633..447103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0445"
FT                   /product="arginine repressor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67683"
FT                   /db_xref="GOA:C5BF97"
FT                   /db_xref="InterPro:IPR001669"
FT                   /db_xref="InterPro:IPR020899"
FT                   /db_xref="InterPro:IPR020900"
FT                   /db_xref="InterPro:IPR036251"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BF97"
FT                   /protein_id="ACR67683.1"
FT                   /translation="MRNTTKQEDLIKAFKALLKEEKFSSQGEIVQALQELGFDSINQSK
FT                   VSRMLTKFGAVRTRNAKMEMVYCLPAELGVPTTSSPLKNLVLDVDHNDAIVVIHTSPGA
FT                   AQLIARLLDSLGKSEGILGTIAGDDTIFTTPAKGFAVEQLYAAILALFEQEL"
FT   gene            447568..448506
FT                   /locus_tag="NT01EI_0446"
FT   CDS_pept        447568..448506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0446"
FT                   /product="malate dehydrogenase, NAD-dependent, putative"
FT                   /EC_number="1.1.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67684"
FT                   /db_xref="GOA:C5BF98"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001252"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR010097"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR023958"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BF98"
FT                   /protein_id="ACR67684.1"
FT                   /translation="MKVAVLGAAGGIGQALALLLKTQLPSGSELSLYDIAPVTPGVAVD
FT                   LSHIPTAVKVCGFGGEDASPALVGADIVLISAGVARKPGMDRSDLFNVNAGIIRNLIGQ
FT                   VARTSPNACIGIITNPVNTMVPIAAEVLKKAGVYNPNKLFGVTTLDIIRSNTFVGELKH
FT                   LDPATLDIPVIGGHSGVTILPLLSQIPGVSLSEREVAELTKRIQNAGTEVVEAKAGGGS
FT                   ATLAMGQAAARFALSLVRAMQGDENVVECGYVESDGEYARFFAQPLLLGKAGLVQRLSI
FT                   GTLSAFEQDALESMLEVLRKDIALGEDFINK"
FT   gene            complement(448609..448893)
FT                   /locus_tag="NT01EI_0447"
FT   CDS_pept        complement(448609..448893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0447"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67685"
FT                   /db_xref="GOA:C5BF99"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR038722"
FT                   /db_xref="UniProtKB/TrEMBL:C5BF99"
FT                   /protein_id="ACR67685.1"
FT                   /translation="MKKTLPEDWHPAEIIAALHKRRLTLTQVSRNAGLSSSTLANALTR
FT                   PWPKGEWLIAEALSIHPSEIWPSRYYDPITHELLDRKRLIRNVASVKKG"
FT   gene            complement(449088..450059)
FT                   /locus_tag="NT01EI_0448"
FT   CDS_pept        complement(449088..450059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0448"
FT                   /product="polyprenyl synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67686"
FT                   /db_xref="GOA:C5BFA0"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:C5BFA0"
FT                   /protein_id="ACR67686.1"
FT                   /translation="MNLEQITELTAQDMADVNAKILHQLNSDVALINQLGYYIISGGGK
FT                   RIRPMIAILAARTLGYQGDHHLTIAALIEFIHTATLLHDDVVDESDMRRGKATANAAFG
FT                   NAASVLVGDFIYTRAFQMMTSLESLRILALMSEATNVIAEGEVQQLMNVNDPDISEENY
FT                   MQVIYSKTARLFEAAAQCSAILAGADPAQEQALQDYGRYLGTAFQLIDDLLDYDADGKT
FT                   LGKNTGDDLNEGKPTLPLLHAMHHGSAERSAMIRQAIEQGNGRHLLELVLETMQQAGSL
FT                   DYTRSRAEEEADKAIAALTLLPDSPHKQALIGLANLAVNRSF"
FT   gene            450319..450630
FT                   /locus_tag="NT01EI_0449"
FT   CDS_pept        450319..450630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0449"
FT                   /product="50S ribosomal protein L21, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67687"
FT                   /db_xref="GOA:C5BFA1"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/TrEMBL:C5BFA1"
FT                   /protein_id="ACR67687.2"
FT                   /translation="MYAVFQSGGKQHRVSEGQTVRLEKLDIATGETVEFDQILMVANGE
FT                   DIKIGVPFVAGGKIKAEVVAHGRGEKVKIVKFRRRKHHRKQQGHRQWFTDVKITGISA"
FT   gene            450649..450906
FT                   /locus_tag="NT01EI_0450"
FT   CDS_pept        450649..450906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0450"
FT                   /product="50S ribosomal protein L27, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67688"
FT                   /db_xref="GOA:C5BFA2"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BFA2"
FT                   /protein_id="ACR67688.1"
FT                   /translation="MAHKKAGGSSRNGRDSESKRLGVKRFGGESVLAGSIIVRQRGTKF
FT                   HAGSNVGCGRDHTLFALADGKVKFEVKGPKNRKFISIVAE"
FT   gene            450988..451929
FT                   /locus_tag="NT01EI_0451"
FT   CDS_pept        450988..451929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0451"
FT                   /product="Integral membrane protein DUF6"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67689"
FT                   /db_xref="GOA:C5BFA3"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C5BFA3"
FT                   /protein_id="ACR67689.1"
FT                   /translation="MSMESKQSAALGIALALTTAIFWGALPIAIKQLLPDMAPETIVWY
FT                   RFSMAALGLGSVLCLRGQLPPLRVFRQRRWLLLLSVATVGLLGNFILFSTSLQYLSPTT
FT                   SQVIGQLSPVGLMFASVLVLKERMRPAQVIGAALLIGGLLLFFNTSLAEIFTRLTDYTL
FT                   GVLLGVAAAGVWVCYGIGQKVLLRRLASQQILCLLYALCAICLWPLAQPGQIYQLSGWQ
FT                   LLCLLFCGINTLVGYGALAEAMVRWQVAKVGAIVTLTPLFTLMFSDILALAWPETFMTP
FT                   SLNVVGYIGAFVVVAGAMFSATGHRWWPRQRT"
FT   gene            451978..453156
FT                   /locus_tag="NT01EI_0452"
FT   CDS_pept        451978..453156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0452"
FT                   /product="GTP-binding protein Obg/CgtA , putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67690"
FT                   /db_xref="GOA:C5BFA4"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/TrEMBL:C5BFA4"
FT                   /protein_id="ACR67690.1"
FT                   /translation="MKFVDEAVIHIEAGDGGNGCVSFRREKYIPKGGPDGGDGGDGGDV
FT                   YLLADENLNTLIDYRFEKSFRAERGQNGQSRDCTGKRGQDVTIKVPVGTRITDVDTGEV
FT                   LGDMTRHQQKLMVGKGGWHGLGNTRFKSSVNRTPRQKTNGTPGDKRDLSLELLLLADVG
FT                   MLGLPNAGKSTFIRAVSAAKPKVADYPFTTLVPSLGVVRMDSEKSFVVADIPGLIEGAS
FT                   EGAGLGIRFLRHLERCRVLLHLIDLAPIDESDPVENARVIIGELEKYSEKLFQKPRWLV
FT                   FNKADLLAPEEAKARAQAIADALGWEGEHYLISAANREGVNALCWDVMNFLEAHPREAE
FT                   VEEEKEKAKKAEFMWDDYHREQLEQAEAEWEEEDDDDWDEDDDEGVEIIYQR"
FT   gene            complement(453206..454279)
FT                   /locus_tag="NT01EI_0453"
FT   CDS_pept        complement(453206..454279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0453"
FT                   /product="two-component signal transduction histidine
FT                   kinase, putative"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67691"
FT                   /db_xref="GOA:C5BFA5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C5BFA5"
FT                   /protein_id="ACR67691.1"
FT                   /translation="MISLRRTLLIMLALILLVTQLVSALWLWHESREQISFLVNETLST
FT                   KVRTEQVDKEIHAAIAALLIPSLVMMAVTLLLSWLAVSWIVRPLNQLQARLEKRSPSNL
FT                   TPIDIDSSMTEITSITRTLNHLFSRLQHTLRQERLFTADAAHELRTPLAGVRLHLELME
FT                   QSGVQEATMLVQRIDQLMHTVEQLLMLSRVGQNFASGHYPQLELINEVVLAQRSELCEM
FT                   LALRGQHLRLETPSQIPMHGDAMLLRLMLRNLVENAHRYSPEGSDILLRVTLSTDGHGS
FT                   ILQVIDRGPGIDESRASELTEPFHRLDRRFGGSGLGLNIVVRILQLHKGQLTLRNNRPG
FT                   PGLNACCYLPLTPQDFG"
FT   gene            complement(454276..454938)
FT                   /locus_tag="NT01EI_0454"
FT   CDS_pept        complement(454276..454938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0454"
FT                   /product="two-component transcriptional regulator protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67692"
FT                   /db_xref="GOA:C5BFA6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C5BFA6"
FT                   /protein_id="ACR67692.1"
FT                   /translation="MKILIVEDDTLIQQGLAQAMARENYAYDCADSAVGASALLQSSHY
FT                   SLIILDLGLPDIDGANALRQWRREGIDAPVLILTARDTVSDRVDGLDAGADDYLVKPFA
FT                   LAELLARVRALIRRMQGLCNNFLQVDDIHLDLSSQQVTCGGQALEITPKEFAILARLMM
FT                   RAGQTINREVLQQDLYSWQDGLSSNSLEVHIHNLRRKLGKKRIKTLRGVGYRLEKTQ"
FT   gene            complement(454948..456381)
FT                   /locus_tag="NT01EI_0455"
FT   CDS_pept        complement(454948..456381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0455"
FT                   /product="D-alanyl-D-alanine
FT                   carboxypeptidase/D-alanyl-D-alanine-endopeptidase,
FT                   putative"
FT                   /EC_number="3.4.16.4"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67693"
FT                   /db_xref="GOA:C5BFA7"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:C5BFA7"
FT                   /protein_id="ACR67693.1"
FT                   /translation="MRFSRLLSGLAYALVFSVQATPVQDYAQYLPEGTNLALMVQKVGS
FT                   TTPTIDYHGQQMALPASTQKVITALAALLQLGPDFRFNTTFETRGQISAGTLNGDLIVR
FT                   FDGDPTLRRQNIRNMVASLKKQGIARISGDILIDTSVFASHDKAPGWPWNDLTQCFSAP
FT                   PAAAIVDRNCFSISLYSAPKAGDRAFIRVASYYPVHMFSEVKTLARGSAEAPYCELDVV
FT                   PGELNRYTLTGCLTQRTDPLPLAFAIQDGAAYAGAIVKDELQQANIDIAGHLRRETQVT
FT                   PQGTILAQTQSAPLHDLLRVMLKKSDNMIADTIFRTIGHSYFNVPGTWRAGSDAVRQIL
FT                   RKKAGVNLGNSVVVDGSGLSRHNLISPATMMEVLLYIAQNDSQLNFISMLPLAGNDGTL
FT                   QYRGGLHEAGVDGKVSAKTGSLQGVYNLAGFITTASGQRMAFVQYLSGYAVPPQDQRTR
FT                   RQPLVRFESRLYRDIYRNN"
FT   gene            456630..457106
FT                   /locus_tag="NT01EI_0456"
FT   CDS_pept        456630..457106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0456"
FT                   /product="transcription elongation factor GreA"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67694"
FT                   /db_xref="GOA:C5BFA8"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:C5BFA8"
FT                   /protein_id="ACR67694.1"
FT                   /translation="MNQIPMTLRGAEKLREELDFLKGTRRPQIIAAIAEAREHGDLKEN
FT                   AEYHAAREQQGFCEGRIQEIEAKLSNAQVIDVTKMPNNGRVIFGSTVSVENLNTEDQQT
FT                   YRIVGDDEADFKHNLISVNSPIARGLIGKEEGDVVTIKTPGGEVEYEILNVEYL"
FT   gene            complement(457247..457540)
FT                   /locus_tag="NT01EI_0457"
FT   CDS_pept        complement(457247..457540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0457"
FT                   /product="conserved hypothetical protein TIGR00253"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67695"
FT                   /db_xref="GOA:C5BFA9"
FT                   /db_xref="InterPro:IPR001890"
FT                   /db_xref="InterPro:IPR017924"
FT                   /db_xref="InterPro:IPR035920"
FT                   /db_xref="UniProtKB/TrEMBL:C5BFA9"
FT                   /protein_id="ACR67695.1"
FT                   /translation="MNLTNKQKQHLKSLAHSLKPVVQLGANGLTEGVLAEIEQALAHHE
FT                   LIKVRIAAEERDTKTLIANAIVRETGAYNVQLIGNILVIYRPSEERKISLPR"
FT   gene            457671..458297
FT                   /locus_tag="NT01EI_0458"
FT   CDS_pept        457671..458297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0458"
FT                   /product="ribosomal RNA large subunit methyltransferase J,
FT                   putative"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67696"
FT                   /db_xref="GOA:C5BFB0"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR004512"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BFB0"
FT                   /protein_id="ACR67696.1"
FT                   /translation="MGKKRSASSSRWLQEHFSDKYVQQAQKKGLRSRAWFKLDEIQGTD
FT                   KIFRPGMTVVDLGAAPGGWSQYVVTQIGDKGRVIACDLLPMDPIVGVDFLQGDFRDELV
FT                   LAALMERVGDAKVQVVMSDMAPNMSGTPSVDIPRAMYLVELAFEMAKDVLAPGGSFVVK
FT                   VFQGEGFDEYLGQIRSLFTKVKIRKPEASRARSREVYIVATGRKL"
FT   gene            458345..460294
FT                   /locus_tag="NT01EI_0459"
FT   CDS_pept        458345..460294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0459"
FT                   /product="ATP-dependent metallopeptidase, putative"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67697"
FT                   /db_xref="GOA:C5BFB1"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:C5BFB1"
FT                   /protein_id="ACR67697.1"
FT                   /translation="MSDMAKNLILWLVIAVVLMSVFQSFGPSESNSRRVDYSTFLTEVN
FT                   QDQVRQVSIDGRAINVTKKDGNRYTTYIPINDPKLLDSLLTKNVKVIGEPPEEPSLLTS
FT                   IFISWFPMLLLIGVWIFFMRQMQGGGGKGAMSFGKSKARMLTEDQIKTTFADVAGCDEA
FT                   KEEVGELVEYLRDPSRFQKLGGKIPKGILMVGPPGTGKTLLAKAIAGEAKVPFFTISGS
FT                   DFVEMFVGVGASRVRDMFEQAKKAAPCIIFIDEIDAVGRQRGAGLGGGHDEREQTLNQM
FT                   LVEMDGFEGNEGIIVIAATNRPDVLDPALLRPGRFDRQVVVGLPDVRGREQILKVHMRR
FT                   VPLATDIDASVIARGTPGFSGADLANLVNEAALFAARNNKRVVSMVEFEKAKDKIMMGA
FT                   ERRSMVMTEAQKESTAYHEAGHAIIGRLVPEHDPVHKVTIIPRGRALGVTFFLPQGDSI
FT                   SYSRQKLESMISVAYGGRLAEELIYGTEHVSTGASQDIKQATTIARNMVTQWGFSEKLG
FT                   PLLYAEEEGEVFLGRSVAKTKHMSDETARIIDQEVKALIEHNYQRARQLLVDNMDIMHA
FT                   MKDALMKYETIDAPQVDDLMARREVRPPAGWLDEQANRQAQAQQPVVHTEPVAPAADSD
FT                   AARSDDDRHNDGEK"
FT   gene            460387..461220
FT                   /locus_tag="NT01EI_0460"
FT   CDS_pept        460387..461220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0460"
FT                   /product="dihydropteroate synthase, putative"
FT                   /EC_number="2.5.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67698"
FT                   /db_xref="GOA:C5BFB2"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:C5BFB2"
FT                   /protein_id="ACR67698.1"
FT                   /translation="MLLRSRELTLNLNYPQVMGILNVTPDSFSDGGRHNALDAALRHAE
FT                   SMIVAGATIIDVGGESTRPGAAEVSEAEELARVVPVVEALAQRFEVWVSVDTSKAAVIR
FT                   ACSAAGADMINDVRSLSEPGALAAAAESGLPICLMHMQGEPKSMQHSPHYSDVVAEVDA
FT                   YLSAQIERCVAAGIARERLLLDPGFGFGKNLTHNYRLLANLAHFHHHGLPLLVGMSRKS
FT                   MVGQLLNVPPAQRVAGSIACAVIAAMQGAQIIRVHDVRETVDAMRVVEATLSAKE"
FT   gene            461228..462565
FT                   /locus_tag="NT01EI_0461"
FT   CDS_pept        461228..462565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0461"
FT                   /product="phosphoglucosamine mutase, putative"
FT                   /EC_number="5.4.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67699"
FT                   /db_xref="GOA:C5BFB3"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BFB3"
FT                   /protein_id="ACR67699.1"
FT                   /translation="MSERKYFGTDGIRGKVGSSPITPDFVLKLGWAAGKVLARHGSRKI
FT                   IIGKDTRISGYMLESALEAGLAAAGLSAAFTGPMPTPAVAYLTRTFRAEAGIVISASHN
FT                   PYYDNGIKFFSIDGTKLPDEVEAAIEAELDKPLTCVESAELGKASRIVDAAGRYIEFCK
FT                   STFPNALSLSGLKIVADCANGATYHIAPNVLRELGAEVITIGTSPDGMNINKECGATDV
FT                   RALQARVVAENADLGMAFDGDGDRLIMVDHRGDKVDGDQILYIVAREALRQGKLHGGVV
FT                   GTLMSNMGLELALKQLGIPFARAKVGDRYVLETMQEKGWRMGAENSGHVIILDQTTTGD
FT                   GIVAGLQVLAAMARNHMSLTDLCSGMTLLPQVLVNVRFAGQCDPLQDTAVQHSCAEVER
FT                   QLAGRGRVLLRKSGTEPLIRVMVEGEDLQQVTDLANTIADAVKAAS"
FT   gene            462752..463087
FT                   /locus_tag="NT01EI_0462"
FT   CDS_pept        462752..463087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0462"
FT                   /product="preprotein translocase, SecG subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67700"
FT                   /db_xref="GOA:C5BFB4"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:C5BFB4"
FT                   /protein_id="ACR67700.1"
FT                   /translation="MYEALLVIFLLISVALIALIMLQQGKGADMGASFGAGASATLFGS
FT                   SGTGNFMTRTTGILATLFFVLSLVLGNLSGHQSKQGSEWDNLGQPMKTEQPAKPAVPAT
FT                   PSSDIPN"
FT   gene            463140..463228
FT                   /locus_tag="NT01EI_T00016"
FT   tRNA            463140..463228
FT                   /locus_tag="NT01EI_T00016"
FT                   /product="tRNA-Leu"
FT                   /note="putative tRNA-Leu"
FT   gene            463284..463360
FT                   /locus_tag="NT01EI_T00017"
FT   tRNA            463284..463360
FT                   /locus_tag="NT01EI_T00017"
FT                   /product="tRNA-Met"
FT                   /note="putative tRNA-Met"
FT   gene            463606..464028
FT                   /locus_tag="NT01EI_0465"
FT   CDS_pept        463606..464028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0465"
FT                   /product="hypothetical protein"
FT                   /note="Uncharacterized BCR, YhbC family COG0779"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67701"
FT                   /db_xref="GOA:C5BFB5"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/TrEMBL:C5BFB5"
FT                   /protein_id="ACR67701.1"
FT                   /translation="MITAPVEALGFELVGIEFIRGRHSTLRIYIDSEEGITVDNCADVS
FT                   HQVSAVLDVEDPISVAYYLEVSSPGMERPLFIAEHYTRFLNEEVTLVLRMAMQNRRKWQ
FT                   GIIKAVDGEMITVTVDGKDEVFALSNVQKANLVPHF"
FT   gene            464050..465537
FT                   /locus_tag="NT01EI_0466"
FT   CDS_pept        464050..465537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0466"
FT                   /product="transcription elongation factor NusA, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67702"
FT                   /db_xref="GOA:C5BFB6"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR010214"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:C5BFB6"
FT                   /protein_id="ACR67702.1"
FT                   /translation="MNKEILAVVEAVSNEKALPREKIFEALETALATATKKKYEQEIDV
FT                   RVAIDRKSGDFDTFRRWLIVEEVTQPTREITLDAARFEDPALDLGDYVEDQIESVTFDR
FT                   ITTQTAKQVIVQKVREAERAMVVDAFREHEGEIVTGVVKKVNRDSISLDLGNNAEAVIG
FT                   REDMLPRENFRPGDRIRGVLYAVRPEARGAQLFVTRSRPEMLIELFRIEVPEIGEEVIE
FT                   IKGAARDPGSRAKIAVKTNDKRIDPVGACVGMRGARVQAVSSELGGERIDIVLWDDNPA
FT                   QFVINAMAPADVASIVVDEDKHTMDIAVEASNLAQAIGRNGQNVRLASQLSGWELNVMT
FT                   AEDLQAKHQAEAHAAIDTFTKHLDIDEEFATLLVEEGFSSLEELAYVPERELLSIDGLD
FT                   EDTVEVLRTRAKNALTTLALAQEESLGDNKPADDLLNLPGMERSVAFKLAARGVCTLED
FT                   LAEQGVDDLTDIEGLNNEQAGELIMAARNICWFGDSE"
FT   gene            465562..468267
FT                   /locus_tag="NT01EI_0467"
FT   CDS_pept        465562..468267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0467"
FT                   /product="translation initiation factor IF-2, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67703"
FT                   /db_xref="GOA:C5BFB7"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR013575"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BFB7"
FT                   /protein_id="ACR67703.1"
FT                   /translation="MAEVTVKSLAAEIQTSVERLVQQLADAGINKSPDDSVSPQEREAL
FT                   LAHLNREHGGSSDKLTLQRKTRSTLSVPGTGGKSKSVQIEVRKKRTYVKSDAAAQQAEA
FT                   EALAKREAEEQVKREAEEQTQRDMAELAKREAAEQAKRQQEEQAKREAAEKAKREAAEK
FT                   EKVTNQHIDEKTKAAQAEKAKREAEAAELKRKAEEEARRKLEEDARKVAEEARRMAEAN
FT                   EGKWTENASEEDNSDYHVTTSHHAREAEDENDRQVEGDRRARGRGGKAAKQKKGSKLSE
FT                   SKADREEARAVNRGGKGGKRKPSSLQQGFTKPAQAVNRDVVIGETITVAELANKMAVKG
FT                   SQVIKAMMKMGAMATINQVIDQETAQLVAEDMGHKVILRRENELEEAVLSDRDTGAAAE
FT                   PRAPVVTIMGHVDHGKTSLLDYIRSTKVAAGEAGGITQHIGAYHVQTDNGMITFLDTPG
FT                   HAAFTAMRARGAQATDIVVLVVAADDGVMPQTIEAVQHAKAAGVPLVVAVNKIDKPEAD
FT                   PDRVKNELSQYGVMPEEWGGEAQFVHVSAKAGTGIDELLDAILLQAEVLELKAVRNGMA
FT                   SGVVIESFLDKGRGPVATVLVREGTLNKGDIVLCGFEYGRVRAMRDELGREITEAGPSI
FT                   PVEILGMSGVPAAGDEATVVRDEKKAREVALYRQGKFREVKLARQQKAKLENMFSNMVE
FT                   GEVSELNIVLKADVQGSVEAIADSLRKLSTDEVKVKIVGSGVGGITETDATLAAASNAI
FT                   LLGFNVRADASARRVVEAENLDLRYYSVIYDLIDEVKQAMSGMLAPEYKQEIIGLAEVR
FT                   DVFKSPKFGAIAGCMVTEGVVKRHSPIRVLRENVVIYEGELESLRRFKDDVNEVRNGME
FT                   CGIGVKNYNDVRPGDVIEVFETIEVKRTID"
FT   gene            468365..468763
FT                   /locus_tag="NT01EI_0468"
FT   CDS_pept        468365..468763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0468"
FT                   /product="ribosome-binding factor A, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67704"
FT                   /db_xref="GOA:C5BFB8"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BFB8"
FT                   /protein_id="ACR67704.1"
FT                   /translation="MAREFSRTQRVAQEMQKEIAIILQREVKDPRVGMATVSGVEVSRD
FT                   LAYAKVFVTFLNDGEPETVKSGLKALQDASGFIRMLLGKAMRLRVVPELTFAYDASLVE
FT                   GMRMSNLVSNVVKDDAARRSAADRDEEA"
FT   gene            468763..469725
FT                   /locus_tag="NT01EI_0469"
FT   CDS_pept        468763..469725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0469"
FT                   /product="tRNA pseudouridine synthase B, putative"
FT                   /EC_number="5.4.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67705"
FT                   /db_xref="GOA:C5BFB9"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR015240"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="UniProtKB/TrEMBL:C5BFB9"
FT                   /protein_id="ACR67705.1"
FT                   /translation="MSRPRRRGRDINGVLLLDKGQGISSNDVLQKVKRIYNANKAGHTG
FT                   ALDPLATGMLPICLGEATKFSQFLLDADKRYRVIARLGQRTDTSDADGQVVCERPLTFS
FT                   EAELAQALAGFRGPGRQVPSMYSALKYQGRPLYEYARQGIDVPRESREITVFELRFIRW
FT                   EGDELELEIHCSKGTYIRTIIDDLGEVLGCGAHVIYLRRLQVSGYPSERMVTLEQLQVL
FT                   LAQAQQQERDPRLLLDPLLLPMDTAAAHLPEVNLSEIVAGYVQLGQSVQTPNLPQSGMV
FT                   RISVGEPHRFIGVGEVDEQGRLAPRRMVVTSRLSEDDPA"
FT   gene            469874..470143
FT                   /locus_tag="NT01EI_0470"
FT   CDS_pept        469874..470143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0470"
FT                   /product="30S ribosomal protein S15, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67706"
FT                   /db_xref="GOA:C5BFC0"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BFC0"
FT                   /protein_id="ACR67706.1"
FT                   /translation="MSLSVEAKAKIVAEFGRDANDSGSTEVQVALLTAQINHLQGHFAE
FT                   HKKDHHSRRGLLRMVSQRRKLLDYLKRKDVARYSSLIERLGLRR"
FT   gene            470395..472518
FT                   /locus_tag="NT01EI_0472"
FT   CDS_pept        470395..472518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0472"
FT                   /product="polyribonucleotide nucleotidyltransferase,
FT                   putative"
FT                   /EC_number="2.7.7.8"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67707"
FT                   /db_xref="GOA:C5BFC1"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036456"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BFC1"
FT                   /protein_id="ACR67707.1"
FT                   /translation="MLTPTVRKFQYGQHTVTLETGMMARQATAAVMVTMDDTAVFVTVV
FT                   GAKKAREGQDFFPLTVNYQERAYAAGRFPGGFFRREGRPGEGETLTARLIDRPIRPLFP
FT                   EGFLNEVQVVATVVSVNPQVSPDIVAMIGASAALSLSGIPFNGPIGAARVGYINDQYVL
FT                   NPTQDELKQSRLDLVVAGTDNAVLMVESEADLLSEDQMLGAVVFGHEQQQIVIENIKAL
FT                   AAEVGKPRWEWHAPEVNVALQRRVAEMAEARLGEAYHITEKQARYAKVDEIKESVIADL
FT                   LAEDDALDAGEISDILGALEKAVVRGRVLRGEPRIDGREKDMIRALDVRTGVLPRTHGS
FT                   ALFTRGETQALVTATLGTERDAQNIDELMGERTDRFLLHYNFPPYSVGETGMMGSPKRR
FT                   EIGHGRLAKRGVLAVMPSQDAFPYTVRVVSEITESNGSSSMASVCGASLALMDAGVPIK
FT                   AAVAGIAMGLVKEQDNFVVLSDILGDEDHLGDMDFKVAGSRDGVTALQMDIKIEGITRE
FT                   IMQVALNQAKGARLHILGVMEQAINAPRGDISEFAPRIHTIKINPEKIKDVIGKGGSVI
FT                   RALTEETGTTIEIEDDGTVKIAATDGDKAKHAIRRIEEITAEIEVGRIYQGKVTRIVDF
FT                   GAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQEVAVKVLEVDRQGRVRLSIKEANA
FT                   SAAAGQDAPTDAE"
FT   gene            472638..473522
FT                   /locus_tag="NT01EI_0473"
FT   CDS_pept        472638..473522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0473"
FT                   /product="tetratricopeptide repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67708"
FT                   /db_xref="GOA:C5BFC2"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR023605"
FT                   /db_xref="UniProtKB/TrEMBL:C5BFC2"
FT                   /protein_id="ACR67708.1"
FT                   /translation="MKPILRWCYVATAILLAGCSNADWRQNEVLAIPLQPSLQQEVMLA
FT                   RMEQILASRALTDDERAQLLYERGVLYDSLGLRALARNDFSQALAIRPDMPEVFNYLGI
FT                   YLTQAGNFDAAYEAFDSVLELDPTYSYARLNRGIALYYGGRYSLAQDDLQAFYQDDPND
FT                   PFRSLWLYLAERELNQDQALTALSQRYNKANRSQWGWNIVEFYLGKISEKTLMERLQAD
FT                   ATDNTSLAEHLSETDFYLGKHYLSLGEKSSASALFKLTVANNVHNFVENRYALLELARL
FT                   GQEQDDIPESDQQ"
FT   gene            473696..475600
FT                   /locus_tag="NT01EI_0475"
FT   CDS_pept        473696..475600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0475"
FT                   /product="DEAD box containing helicase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67710"
FT                   /db_xref="GOA:C5BFC3"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028618"
FT                   /db_xref="InterPro:IPR034415"
FT                   /db_xref="UniProtKB/TrEMBL:C5BFC3"
FT                   /protein_id="ACR67710.1"
FT                   /translation="MAEFETTFADLGLAAPIIEALNDLGYEKPSPIQAACIPHLLNGRD
FT                   VLGMAQTGSGKTAAFSLPLLNNIDPSLKAPQVLVLAPTRELAVQVAEAMADFSKHMHGV
FT                   NVVALYGGQRYDVQLRALRQGPQIVVGTPGRLLDHLKRGTLSLTSLRGLVLDEADEMLR
FT                   MGFIEDVETIMAQIPAEHQTALFSATMPEAIRRITRRFMNEPQEVRIQSSVTTRPDISQ
FT                   SYWTVYGMRKNEALVRFLEAEDFDAAIIFVRTKNATLEVAEALERNGYSSAALNGDMNQ
FT                   ALREQTLERLKDGRLDILIATDVAARGLDVDRISLVVNYDIPMDAESYVHRIGRTGRAG
FT                   RAGRALLFVDNRERRLLRNIERTMKLTIPEVELPNAELLSARRLAKFGARVQQQLESSD
FT                   LDQYRALLAKLQPEDEQDMETLAAALLKMAQGERPLILPPDPIVERRPRREFRERDERG
FT                   GDRFARRERDERGGDRPRRERREVGDMELYRIEVGRDDGVEVRHIVGAIANEGDISSRY
FT                   IGNIRLFGSHSTIELPKGMPGDLLTHFTRTRILNKPMNMQLIGDAPAREPRRERNGERG
FT                   GERRSFGGRDGGRDGDRRSFGGQRRFSDDRRGDRGFNRDSRSARSDDNGNSRRRFNDA"
FT   gene            complement(475587..475766)
FT                   /locus_tag="NT01EI_0474"
FT   CDS_pept        complement(475587..475766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0474"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67709"
FT                   /db_xref="UniProtKB/TrEMBL:C5BFC4"
FT                   /protein_id="ACR67709.1"
FT                   /translation="MSVISGFIDAAHILVEYSFFYYLNKFKNKALVTHISRDHKKGQPE
FT                   GWPFTRLPLLITHH"
FT   gene            476178..477509
FT                   /locus_tag="NT01EI_0476"
FT   CDS_pept        476178..477509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0476"
FT                   /product="inner membrane transport protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67711"
FT                   /db_xref="GOA:C5BFC5"
FT                   /db_xref="UniProtKB/TrEMBL:C5BFC5"
FT                   /protein_id="ACR67711.2"
FT                   /translation="METTQMSSVILAGHPAVTRDGMSDSEWWAATRFDSTDVGWVMMSI
FT                   GMAIGAGIVFLPVQVGLMGLWVFLLSSVVGYPAMYLFQRLFINTLAESPECRDYPSVIS
FT                   GYLGKNWGILLGGLYFVMLVIWMFVYSTAITNDSASYLHTFGVTEGLLSENPFYGLALI
FT                   CVLVAISSRGEQLLFKLSSFMVLTKLLVVAALGIAMVGMWHLYNVGALPPLGLLVKNAV
FT                   ITLPFTLTSILFIQTLSPMVISYRAHCKSREVARYKALRAMNIAFGVLFVTVFFYAVSF
FT                   TLAMGHDEAVKAYQQNISALAIAAQFIDGGIDNWVTVVSVILNIFAVMTAFFGVYLGFR
FT                   EATQGIVMNLLRRMVPPERIKERWVQGSIMALAVLLAWGAIILNAPVLSFTSICSPIFG
FT                   MVGCLIPAYLVYRVPALHKYKGVSLLVIIITGLLLCISPLLAFF"
FT   gene            477884..478153
FT                   /locus_tag="NT01EI_0477"
FT   CDS_pept        477884..478153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0477"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67712"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR021144"
FT                   /db_xref="UniProtKB/TrEMBL:C5BFC6"
FT                   /protein_id="ACR67712.1"
FT                   /translation="MGAAVGIAWLIDGRYEVVAMSIGSMSGDVSGMICDGASNSCTMKV
FT                   SISLSAAFKVVLMAQDNSAMSGNERIVAHDVDHSIATCACWPVA"
FT   gene            complement(478414..479292)
FT                   /locus_tag="NT01EI_0478"
FT   CDS_pept        complement(478414..479292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0478"
FT                   /product="peptidase, U32 family"
FT                   /EC_number="3.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67713"
FT                   /db_xref="GOA:C5BFC7"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="UniProtKB/TrEMBL:C5BFC7"
FT                   /protein_id="ACR67713.1"
FT                   /translation="MQFALGAVLYCWPQARLEAFYRAAAVSEADIIYLGETVCSKRRAM
FT                   KSSDWLALARTLADSGKQVVLSTLALLQAPSELSELRRYIENGEFLIEANDLAAVNMAA
FT                   ERRLPFVAGPALNCYNAITLRLLLRQGMVRWCMPVELSRDWLRNIRQQCDELGILGQFE
FT                   TEVFAYGHLPLAYSARCFTARAENLPKDECDICCIRYPQGRQVLSQEQQQVFVLNGIQT
FT                   LSGYCYNLGNQLREMQGSVDIVRLSPQGEDTLEMLSRFRANQQGEAPLALERQAECNGY
FT                   WHQLAGLTLSS"
FT   gene            complement(479304..480299)
FT                   /locus_tag="NT01EI_0479"
FT   CDS_pept        complement(479304..480299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0479"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67714"
FT                   /db_xref="GOA:C5BFC8"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="UniProtKB/TrEMBL:C5BFC8"
FT                   /protein_id="ACR67714.1"
FT                   /translation="MELLCPAGNLPALKAAVENGADAVYIGLKDDTNARHFAGLNFNEK
FT                   KLQEALEYVHQRGRKLHIAINTFAHPDGYIRWQRAVDMAAQLGADALILADLAMLEYAA
FT                   ERYPHIERHVSVQASVTNEEAIRFYQRHFAVARVVLPRVLSLHQVKQLARCSPVPLEVF
FT                   AFGSLCIMSEGRCYLSSYLTGESPNTAGACSPARFVRWQQTPQGMESRLNDVLIDRYAN
FT                   NENAGYPTLCKGRYLVDGVRYHTLEEPTSLNTLTLLPALMEANIASVKIEGRQRSPAYV
FT                   SQVTRVWRQAIDRCRHDPEHFTPDAAWMEALGAVSEGAQTTLGAYHRRWQ"
FT   gene            480605..481126
FT                   /locus_tag="NT01EI_0480"
FT   CDS_pept        480605..481126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0480"
FT                   /product="SCP-2 sterol transfer family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67715"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR016830"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR039543"
FT                   /db_xref="UniProtKB/TrEMBL:C5BFC9"
FT                   /protein_id="ACR67715.1"
FT                   /translation="MLEQLRARIVRQGPAFLSLPLKVTPFVLQRHVLEQLLSWQFRQAL
FT                   AEGDLAFLDGRWLQVDVCDLGLRWFVTVQQGMLRVSRHQQADVSFSADANDLILIAASK
FT                   EDPDTLFFQRRLRIEGDTELGLQVKNLMDAIDPELMPAPLRLALMQLADFVEAGLREGT
FT                   PIDARAVTSC"
FT   gene            481120..481623
FT                   /locus_tag="NT01EI_0481"
FT   CDS_pept        481120..481623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0481"
FT                   /product="acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67716"
FT                   /db_xref="GOA:C5BFD0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C5BFD0"
FT                   /protein_id="ACR67716.1"
FT                   /translation="MLIRAEIPVDAPGIDRLLRRCFPGADEAEQVSCLREGGLLTLGIV
FT                   ATDDEGGVVGYVAFSPVTVDGEECQWVGLAPLAVDEAYRRQGIAEQLVYEGLDTLNEFG
FT                   YAGVTVLGESHYYQRFGFVNAAQHGLHCRWPGCDALFQVYALAPQALEQARGCIEYAEP
FT                   FNHF"
FT   gene            481721..481927
FT                   /locus_tag="NT01EI_0482"
FT   CDS_pept        481721..481927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0482"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67717"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH34"
FT                   /protein_id="ACR67717.1"
FT                   /translation="MRGISLPASRIYRHLLRLSPRLIAYWAFHCRTAVRIRVIAQTAAV
FT                   SSVFRPQLHAVDSASFNNKKNGA"
FT   gene            481951..483435
FT                   /locus_tag="NT01EI_0483"
FT   CDS_pept        481951..483435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0483"
FT                   /product="sodium/proline symporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67718"
FT                   /db_xref="GOA:C5BH35"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR011851"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH35"
FT                   /protein_id="ACR67718.1"
FT                   /translation="MSVNTPTLITFLIYIFGMILIGLLAYRATNNFSDYILGGRRLGSV
FT                   VTALSAGASDMSGWLLMGLPGAIFVAGLSESWIAIGLVLGAYLNWRIVAGRLRVHTELN
FT                   NNALTLPDYFTQRFEDKQHILRLISALIILVFFTVYCASGVVAGARLFESTFGMSYESA
FT                   LWAGAAATIAYTFIGGFLAISWTDTVQATLMIFALILTPVMVVVSVGGFDDAINAIAQR
FT                   SPAYLDLFRGLDWVAIVSLMGWGLGYCGQPHILARFMAADSHHTIRKARRISIVWMIFC
FT                   LGGAVAVGFFGIAFFSTHPQLALEVHENKERVFISLAKLLFNPWIAGVLLSAILAAVMS
FT                   TLSCQLLVSASAVTEDLYKAFLRKHANQRELVIVSRTMVMLIALIAIGLAANPHNYVLD
FT                   LVSYAWAGFGAAFGPVIIISLLWPGMTRNGALAGMLVGAATVVVWKQYAWFHLYEIIPG
FT                   FILASLAIVLVSLVGRGPSPQMRERFAQANKIYLTK"
FT   gene            483822..484277
FT                   /locus_tag="NT01EI_0484"
FT   CDS_pept        483822..484277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0484"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67719"
FT                   /db_xref="GOA:C5BH36"
FT                   /db_xref="InterPro:IPR011194"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH36"
FT                   /protein_id="ACR67719.1"
FT                   /translation="MINDDTLAAIRRFLTRQHVVTLAVGQGETLWCADCFYALDALPMT
FT                   LYLLTSPTSHHGRLMSANPRVAGTVAHQTRSVAKIQGIQFHGRIACLDGEDAAVAYAAY
FT                   YRRFPLARARPSPVWGLHLMRVKMTDNTCGFGHKRHWAREGEPVGVY"
FT   gene            484373..485023
FT                   /locus_tag="NT01EI_0485"
FT   CDS_pept        484373..485023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0485"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67720"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH37"
FT                   /protein_id="ACR67720.1"
FT                   /translation="MYVLLLGATGLIGRALLTLLASDPRVTQIYAPTRTALPASDKLIN
FT                   PVGADICRAMLDWDTPCDVAFCCLGTTRKAAGSDSNFRYVDYSLVVECGAVALQHGCRH
FT                   YVVVSALGANAQSPFLFSRTKGEMEQALELQAWRRLSLLRPSLLQGERAKPRLLEQISE
FT                   PLFRLLPEKWKAIEADCVARAMLRCALYPAEYRLQILESEQVQRLGETVAGAL"
FT   gene            complement(485036..485500)
FT                   /locus_tag="NT01EI_0486"
FT   CDS_pept        complement(485036..485500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0486"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein, putative"
FT                   /EC_number="1.97.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67721"
FT                   /db_xref="GOA:C5BH38"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012837"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH38"
FT                   /protein_id="ACR67721.1"
FT                   /translation="MNYHQYYPVDVVNGPGTRCTLFVAGCVHQCPGCYNKATWRLDSGV
FT                   PFTAALEDRIIADLNDTRINHQGLSLSGGDPLHPHNVATILRLVQRVRAECRGKDIWLW
FT                   TGYRLEELTAEQQAVVNLINVLVDGKFVQDLKDPMLIWRGSSNQVVHCLR"
FT   gene            complement(485584..487722)
FT                   /locus_tag="NT01EI_0487"
FT   CDS_pept        complement(485584..487722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0487"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase,
FT                   putative"
FT                   /EC_number="1.17.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67722"
FT                   /db_xref="GOA:C5BH39"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH39"
FT                   /protein_id="ACR67722.1"
FT                   /translation="MKPIVIKRDGCQVPFNEQRIKEAVLRAAQAADVNDADYCATVARV
FT                   VAMQMADRERVDINDIQHAVENQLMAGNYKQLARAYIEYRHDRDVAREQRGRLNQDIRG
FT                   LIEQSNSALLNENANKDSKVIPTQRDLLAGIVAKHYAKQHLLPRDVVQAHERGEIHYHD
FT                   LDYSPFFPMFNCMLIDLKGMLTNGFKMGNAEIERPKSISTATAVTAQIIAQVASHIYGG
FT                   TTINRIDEVLAPFVSASFTKHRQIAEQWDIPDVEGYAHARTEKECYDAFQSLEYEVNTL
FT                   HTANGQTPFVTFGFGLGTSWESRMIQQSILKNRIAGLGKNRKTAVFPKLVFAIRDGLNH
FT                   KFGDPNYDIKQLALECASKRMYPDILNYDQVVKVTGSFKTPMGCRSFLGVYEENGEMIH
FT                   DGRNNLGVISLNLPRIALEAHGDEAAFWKLLDRRLILARKALMTRIARLEGVKARVAPI
FT                   LYMEGACGVRLKADDAIADIFKNGRASISLGYIGIHETINALFGTQTHVFDDAALRAKA
FT                   IAIVERLRQATDTWKQETGYAFSLYSTPSENLCDRFCRLDTAEFGIVEGVTDKGYYTNS
FT                   FHLDVEKQVNPYDKLDFEAPYPPLANGGFICYGEYPNLQHNLKALEDVWDYSYSRVPYY
FT                   GTNTPIDECYECGYTGEFECTSKGFTCPKCGNHDSTKVSVIRRVCGYLGSPDARPFNAG
FT                   KQEEVKRRIKHLNNGQIG"
FT   gene            487747..487890
FT                   /locus_tag="NT01EI_0488"
FT   CDS_pept        487747..487890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0488"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67723"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH40"
FT                   /protein_id="ACR67723.1"
FT                   /translation="MCIHLPVIHSTKPREIRLYTRCVDALWITTIYRCLFTLQTLYMGM
FT                   AI"
FT   gene            complement(488137..488424)
FT                   /locus_tag="NT01EI_0489"
FT   CDS_pept        complement(488137..488424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0489"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67724"
FT                   /db_xref="InterPro:IPR025612"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH41"
FT                   /protein_id="ACR67724.1"
FT                   /translation="MNHQRQTLAAEKARLLQKIAQQRLDLHTESLCAERLCINVDRTLT
FT                   TLWRLRRSLSLAAGLAVVYAARHPSRLPGGIKQAVGLWSTLRLARRMFYP"
FT   gene            complement(488421..488825)
FT                   /locus_tag="NT01EI_0490"
FT   CDS_pept        complement(488421..488825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0490"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67725"
FT                   /db_xref="GOA:C5BH42"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH42"
FT                   /protein_id="ACR67725.1"
FT                   /translation="MPGDTSPSQGSASGILGTARRIVTLLLGMTETRLRLAVVELEEER
FT                   ANLIQLLLMAGITLLFTAFGLMCLLVLLFLAVEPTYRLMALGIATALLLLLACVGAIWT
FT                   LIKARRSTFLLATRKQLEIDRQLLERREKP"
FT   gene            complement(488825..489130)
FT                   /locus_tag="NT01EI_0491"
FT   CDS_pept        complement(488825..489130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0491"
FT                   /product="Bacterial protein of unknown function (DUF883)"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67726"
FT                   /db_xref="GOA:C5BH43"
FT                   /db_xref="InterPro:IPR010279"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH43"
FT                   /protein_id="ACR67726.1"
FT                   /translation="MTNDSTAEHLRAELKSLADALEDVLNSSTDKPKAELEKLRARAHD
FT                   ALHNSRERLSQAGESVATQTREMAGRADDYVRDNPWTGVGIGAAVGIVLGVLLARR"
FT   gene            complement(489403..489819)
FT                   /locus_tag="NT01EI_0492"
FT   CDS_pept        complement(489403..489819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0492"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67727"
FT                   /db_xref="GOA:C5BH44"
FT                   /db_xref="InterPro:IPR026574"
FT                   /db_xref="InterPro:IPR027398"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BH44"
FT                   /protein_id="ACR67727.1"
FT                   /translation="MNQANSQPFTRRQGWKRILGLLLFIVAALTVVILPQLGHKEVSLQ
FT                   IRATHNGLATPDGFFVYQKLDENGVSITSITQDREGLVIRLAHPEQRTLALQVLQRELP
FT                   PGYSIADKILHRSLFYKSERPAAATLSYSAGHNR"
FT   gene            complement(489821..490501)
FT                   /locus_tag="NT01EI_0493"
FT   CDS_pept        complement(489821..490501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0493"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67728"
FT                   /db_xref="GOA:C5BH45"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH45"
FT                   /protein_id="ACR67728.1"
FT                   /translation="MDIIRELITALWHQDYETLANPSLVWTIYGILFMILFLENGLLPA
FT                   AFLPGDSLLILVGVLIARDTMDFPLTLLVLTSAASLGCWVGYLQGRWLGNTHLVQKWLS
FT                   HLPAHYHQRAHQLFHRHGLAALLIGRFLAFVRTLLPLIAGLSGLSAPRFQFFNWVSGLL
FT                   WVLILSTLGYVLGKTPLFLRYEDQLMNLLMLLPLVLLVFGLCGSLLVLWRKKHAHATDK
FT                   SPRK"
FT   gene            complement(490602..491129)
FT                   /locus_tag="NT01EI_0494"
FT   CDS_pept        complement(490602..491129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0494"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67729"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH46"
FT                   /protein_id="ACR67729.1"
FT                   /translation="MWAILLKWTPIFLSVSGNDKILKRVTSASLLLLLFCWAATAIGKI
FT                   GAWHSQVITTLPLNQLPCNTAIFSEDDRNPAGGHCLSRIPHNRKITALIRLHICGGSEV
FT                   ARNGLVPPDVPPPESRQPYPPQAPGNDGHYARLSRILLRTLQLPPHQNRLGGWKESNIL
FT                   YRGQVTYHPTLA"
FT   gene            complement(491258..491647)
FT                   /locus_tag="NT01EI_0495"
FT   CDS_pept        complement(491258..491647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0495"
FT                   /product="crcB protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67730"
FT                   /db_xref="GOA:C5BH47"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH47"
FT                   /protein_id="ACR67730.1"
FT                   /translation="MNYGLTLLVVACGGALGAISRFQITNWFSSWFGDGFPYATLTVNV
FT                   IGCFIMGALVSMLNSGTLIAPHWRPLIGVGFLGALTTFSTFSFDTFALFSEGFWVKAML
FT                   NVVLNLILCMAAVSAGYYLLLSRSA"
FT   gene            491749..491889
FT                   /locus_tag="NT01EI_0496"
FT   CDS_pept        491749..491889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0496"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67731"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH48"
FT                   /protein_id="ACR67731.1"
FT                   /translation="MPGVISIGLGEVARYDSSATDIGLCDRLSPTVFNSFVELKVEHHH
FT                   R"
FT   gene            complement(491927..492694)
FT                   /locus_tag="NT01EI_0497"
FT   CDS_pept        complement(491927..492694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0497"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67732"
FT                   /db_xref="GOA:C5BH49"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH49"
FT                   /protein_id="ACR67732.1"
FT                   /translation="MECTRLYQQLAAELTQRIEGGVYPVGDKLPAERFIAEEMDVSRTV
FT                   VREAIIMLEVEGYVEVRKGSGIHVINNQPKSLIQPDNTIEFASAGPFELLQARQLIESN
FT                   IAEFAATQVTKQDIVALMEIQERARQEDRFRDSEWDLKFHVQVALATQNSAMATIVEKM
FT                   WSQRTHNPYWLKLHEHIDDKSIESWCEDHDKILKALIRKDPYGAKIAMWQHLENTKQML
FT                   FHATTDDFEFNVDRYLFAENPVVHLDAVANSGK"
FT   gene            complement(492848..493192)
FT                   /locus_tag="NT01EI_0498"
FT   CDS_pept        complement(492848..493192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0498"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67733"
FT                   /db_xref="GOA:C5BH50"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH50"
FT                   /protein_id="ACR67733.1"
FT                   /translation="MIGPGMIGLFSSPYIAIALLCIGGFAHQALSGSLITLSSNIFDRN
FT                   EAATANGLTGMAAWTVSTLFALVSSTLTNTLDFSPRLATLGVFDLLDVLIIWTVLQNCT
FT                   ANDPLSLLPG"
FT   gene            complement(493221..493370)
FT                   /locus_tag="NT01EI_0499"
FT   CDS_pept        complement(493221..493370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0499"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67734"
FT                   /db_xref="GOA:C5BH51"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH51"
FT                   /protein_id="ACR67734.1"
FT                   /translation="MFKAYGFNLQEIAMFAWIPVLFADLGCVIGGYPDSTVSEVLQIQP
FT                   ARLP"
FT   gene            493456..493587
FT                   /locus_tag="NT01EI_0500"
FT   CDS_pept        493456..493587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67735"
FT                   /db_xref="GOA:C5BH52"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH52"
FT                   /protein_id="ACR67735.1"
FT                   /translation="MQNLPGRYVGRVIAIILSCLVAQNVLTFFVAPAILTLGLFVEE"
FT   gene            complement(493832..494044)
FT                   /locus_tag="NT01EI_0501"
FT   CDS_pept        complement(493832..494044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0501"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67736"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH53"
FT                   /protein_id="ACR67736.1"
FT                   /translation="MIGMVTIGVVLGYLTRNAIAAPAWKTPCVSQSNIIATYSACDTIM
FT                   QPVAGYMLDPLGTQIDYAVFTVIWT"
FT   gene            494560..495969
FT                   /locus_tag="NT01EI_0502"
FT   CDS_pept        494560..495969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0502"
FT                   /product="glucuronate isomerase"
FT                   /EC_number="5.3.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67737"
FT                   /db_xref="GOA:C5BH54"
FT                   /db_xref="InterPro:IPR003766"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BH54"
FT                   /protein_id="ACR67737.1"
FT                   /translation="MSPFLTEDFLLDTEFARRLYHDYAEEQPIFDYHCHLPPEQIAENY
FT                   RFKNLYDIWLKGDHYKWRAMRTNGVAECFCTGEASDREKFQAWAETVPHTIGNPLYHWT
FT                   HLELRRPFGITDTLLSATTAEDIWTRCNRMLAEDSFTARGIMGQMNVKMVGTTDDPIDD
FT                   LRHHRTIAADSSFTTKVLPSWRPDKAFNIEAALFSDYIVKLGAVADVDITRFADLCQAL
FT                   KVRMDHFAAHGCKVSDHALDVVVYGEADDATLDGILARRLSGGTPGEIEVAQFKTAVLL
FT                   FLGCEYRRRGWVQQYHIGALRNNNTPMFERLGPDIGFDSINDAPVAQPLSRLLDAQSRN
FT                   GGLTKTILYCLNPRDNEVLGTMIGNFQGEGMPGKMQFGSGWWFNDQKDGMQRQMTQLAQ
FT                   LGLLSRFVGMLTDSRSFLSYTRHEYFRRILCQMIGRWVAQGEAPADIALLGSMVKNICF
FT                   DNAKSYFAIEL"
FT   gene            496076..497554
FT                   /locus_tag="NT01EI_0503"
FT   CDS_pept        496076..497554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0503"
FT                   /product="altronate oxidoreductase, putative"
FT                   /EC_number="1.1.1.58"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67738"
FT                   /db_xref="GOA:C5BH55"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH55"
FT                   /protein_id="ACR67738.1"
FT                   /translation="MQTLNRRDFPGRQHPDRVIQFGEGNFLRAFIDWQLDLLNEHTDLD
FT                   AGIVVVRPIDSDFPPSLNSQDGLYTTIVRGLNERGEAVSASRVIRSVNRELNVYREFDA
FT                   FLALARDPNIRFVFSNTTEAGISYAPQDRLSDTPPSSFPAKLTRLLYERFCHFDGAADR
FT                   GWVLLPCELIDYNGEALRELLLRYAGQWDLPPAFTVWLTEHNTFCSTLVDRIVTGYPHD
FT                   EATSLCDELGYQDSLLDTAEYFYLFVIQGPQWLAQALCLDAYAAAQGPLNIRIVEDIRP
FT                   YKERKVAILNGAHTALVPVAYLAGLDTVGQSMDDALVAAFVTQTIAQEIVPQLDLPAEE
FT                   LSAFSAAVITRFRNPYIQHQLLSIALNGMTKFRTRILPQLLSYHARQGTVPVRLSFALA
FT                   ALIAFYRGERDGQRYPLQDNAHWLDFYAASWQAVRAGEQTLEQLVCAALAQSAHWGEDL
FT                   NRIPGLRQQVSGALQAIEQQGMRAALSTLLASSC"
FT   gene            497573..499063
FT                   /locus_tag="NT01EI_0504"
FT   CDS_pept        497573..499063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0504"
FT                   /product="altronate hydrolase, putative"
FT                   /EC_number="4.2.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67739"
FT                   /db_xref="GOA:C5BH56"
FT                   /db_xref="InterPro:IPR007392"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH56"
FT                   /protein_id="ACR67739.1"
FT                   /translation="MQSIIKIHPQDNVAVALRDLVSGETIALDDGALTLRAAVQRGHKV
FT                   ALCSLAPQAMVIKYGLPIGHALMAIAAGDHVHAHNLRTNLSDLDSYQYQPDFAIPTSQP
FT                   TDRAISLYRRASGEVAIRNELWILPTVGCVNGMARQMLQRFLRESDGAPEIDGVHLFTH
FT                   PFGCSQLGDDHQNTRTILQNMVRHPNAGGVLVVGLGCENNQIAAFRETLGDYDPARVRF
FT                   LVCQQQDDEVEAGMEALHELYGAMRGDRREPGRLSELRFGLECGGSDGFSGISANPLLG
FT                   RFSDYVIAHGGTSVLTEVPEMFGAEQILMSRCRDGETFEKTVAMVNDFKRYFIDHQQPI
FT                   YENPSPGNKAGGITTLEEKSLGCTQKAGQSQVMDVLRYGERLRMPGLNLLSAPGNDAVA
FT                   TSALAAAGCHMVLFSTGRGTPYGGFVPTVKLATNTPLAVKKPHWIDFDAGQLLQGKPME
FT                   QLLSEFIDLIVAIADGRQTCNEKNDFRELAIFKSGVTL"
FT   gene            499113..499634
FT                   /locus_tag="NT01EI_0505"
FT   CDS_pept        499113..499634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0505"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67740"
FT                   /db_xref="GOA:C5BH57"
FT                   /db_xref="InterPro:IPR019629"
FT                   /db_xref="InterPro:IPR026267"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH57"
FT                   /protein_id="ACR67740.1"
FT                   /translation="MNGELLFAQGVGVVAFLIGITTFFNRDERRFRLQLALYSAIIGAH
FT                   FFLMGASAAGMSAELNAIRSVATTRTRNVWIMVLFIALTLGLGSWELKHPVEVLPIAGT
FT                   IVSTWALFRCRGLVTRCLMWCSTACWVIHNLWLGSLGGSLIEGSFLLINGYNIVRFYRM
FT                   QRRGIDPFRS"
FT   gene            complement(499748..500989)
FT                   /locus_tag="NT01EI_0506"
FT   CDS_pept        complement(499748..500989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0506"
FT                   /product="transporter, dicarboxylate/amino acid:cation (Na+
FT                   or H+) symporter (DAACS) family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67741"
FT                   /db_xref="GOA:C5BH58"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR023025"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BH58"
FT                   /protein_id="ACR67741.1"
FT                   /translation="MEKHSGFVRFITRGSLVGQILVGLVLGIALASFSQSGAIAAGLLG
FT                   TLFVSALKAVAPVLVFILVAASIANHRQGQKTNMRPIVLLYLLGTFAAALVAVVVSFAF
FT                   PSQLALVSHTNDITPPGGIVEVLQSLLMNVVDNPFHALASGNFIGILAWAIGLGVALRH
FT                   ASDTTKRVVGDLSYGVTFIVRVVIRFAPLGIFGLVSSTLAETGFDALWGYAHLLMVLIG
FT                   AMLLVALVLNPLIVFWKIRRNPYPLVFTCLRESGLTAFFTRSSAANIPVNMELCKKLGL
FT                   NEDTYAVSIPLGATINMAGAAITITVLTLAAAHTLEISVDLPTALLLSLVAAVCACGAS
FT                   GVAGGSLLLIPLACSLFGISSDIAMQVVAVGFIIGVLQDSCETALNSSTDVLFTATACV
FT                   AAEESTGDSAAELG"
FT   gene            complement(501338..502306)
FT                   /locus_tag="NT01EI_0507"
FT   CDS_pept        complement(501338..502306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0507"
FT                   /product="Integral membrane protein TerC family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67742"
FT                   /db_xref="GOA:C5BH59"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022369"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH59"
FT                   /protein_id="ACR67742.1"
FT                   /translation="MLNSVGTPWLWGSFALIILIMLAIDLLLQGRRGAQAMTMRQAAVW
FT                   SLVWVSLALLFNAGLWFYLSETLGRAAANQQALAFLTGYLIEKALAVDNVFVWLMLFSY
FT                   FSVPASMQRRVLVYGVLGAIILRTVMIFAGSWLVTQFQWILYLFGAFLLFTGVKMAMAR
FT                   DDEGDLGERPLVRWLRRHLRMTDSIESEHFFTRRSGMLFATPLLLVLILVELSDVIFAV
FT                   DSIPAIFAVTTDPFLVLTSNLFAILGLRAMYFLLAGVAERFTLLKYGLAAILTFIGIKM
FT                   LIVDFYHIPIAFSLGIVAGILALTLLINAWVNHRRTSCALR"
FT   gene            502691..503599
FT                   /locus_tag="NT01EI_0509"
FT   CDS_pept        502691..503599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0509"
FT                   /product="Integral membrane protein DUF6"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67743"
FT                   /db_xref="GOA:C5BH60"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH60"
FT                   /protein_id="ACR67743.1"
FT                   /translation="MEVARKTNLLAIAGLIALTLIWSYNWIAMKQVTQYIGAFDFTALR
FT                   CVCGALLLLLVLRLRGHGMRPTPFGYTLAIALLQTCGMVGLAQWALMSGGAGKVAILSY
FT                   TMPFWVVIMAALFLGERMRRLQYAAIAVAALGLLLVLQPWKLDLSSLKSALLAVLSGIS
FT                   WGASAIVAKRMYARYPGVDLLGLTTWQMLYAAVVMSAVAWLVPQRSVDWQPYVFWALAY
FT                   SAILATALAWSLWLFVLKNLSAGIASLSTLAVPVCGVLFSWWLLGEDPGPVEGSGIVLI
FT                   VLALAAISIKRQGPQAQSTRR"
FT   gene            complement(503628..504608)
FT                   /locus_tag="NT01EI_0510"
FT   CDS_pept        complement(503628..504608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0510"
FT                   /product="oxidoreductase, putative"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67744"
FT                   /db_xref="GOA:C5BH61"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH61"
FT                   /protein_id="ACR67744.1"
FT                   /translation="MIRLAIIGTNWITQRFVDAALACGQYRLSAVYSRRLEQAADFSAP
FT                   YGTVHCFDSLEALACSPEVDAVYIASPNALHCAQTLLMLRHGKHVICEKPLASTHAEAQ
FT                   RAFDCARANGVILFEAFKTAYLPNFDVIRSALPHLGRLRKAFLNYCQYSSRYPRYLNGE
FT                   NPNTFNLAFSNGSIMDIGFYCLASGVALFGEPQRVSAGAVLLDSGVDAHGHVAMHYPGL
FT                   EVVLFHSKVSDSALPSEIQGEEGSLVIEHLSQCQRVTLIPRGGAAQEIGVIQRENTMEY
FT                   EAQAFARLIGEGRVTHAGVARTLTTARLLDEIRRQTGVVFPADRA"
FT   gene            complement(504664..505167)
FT                   /locus_tag="NT01EI_0511"
FT   CDS_pept        complement(504664..505167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0511"
FT                   /product="hypothetical protein"
FT                   /note="Protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67745"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH62"
FT                   /protein_id="ACR67745.1"
FT                   /translation="MTHLSYLVGYPEPLLAQVRTLLEQKRLGDTLRRRYPERHAITTDR
FT                   ALYDYAQRLKNHYMRNTPPLSRVQYDSRIQVIQQALGLHRAVSRVQGNRLKAKAEIRIA
FT                   SLFRQGPEALLRMIVVHELAHLREKNHDKAFYSLCCHMEPNYHQLEFDARLYLTCLDVE
FT                   GSVY"
FT   gene            505245..506390
FT                   /locus_tag="NT01EI_0512"
FT   CDS_pept        505245..506390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0512"
FT                   /product="methyltransferase, small subunit domain protein"
FT                   /note="methyltransferase, small subunit domain"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67746"
FT                   /db_xref="GOA:C5BH63"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR017237"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH63"
FT                   /protein_id="ACR67746.1"
FT                   /translation="MSQLESSAGCPAITDLTLARFPHQSDDPSLQAWEAADEYLLQQID
FT                   PTQAQGRPTIIFNDAFGALACALHALRPYSVSDSYVSQLATRHNLQLNDLDGDAVTLLD
FT                   SLSPLPEAPALVVIKLPKMLALLEQQLHALRAVVAPDTRIIAAAKARDIHTSTLQLFES
FT                   ILGETHTSLAWKKARLIYCQVAERTVIPAPATTVWPLEGTPYTMHNHAGVFSRGSLDIG
FT                   ARFFLQHLPEGLQGEVADLGCGNGVLGLAALSGSPQARVLFADESYMAVASAHLNVQHN
FT                   RPQDLARCEFWVGNGLAGREGGTLDAVLCNPPFHQQHSITDQVAWDMFVAARRCLKRNG
FT                   VLYIVGNRHLDYYPKLRRLFGNCTTLGMNRKFVVLKAVKTV"
FT   gene            506569..507726
FT                   /locus_tag="NT01EI_0513"
FT   CDS_pept        506569..507726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0513"
FT                   /product="aminotransferase, classes I and II"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67747"
FT                   /db_xref="GOA:C5BH64"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH64"
FT                   /protein_id="ACR67747.1"
FT                   /translation="MDRRTLLKSSVALLGALSLSGQGALARVPSVAQRPAAPDADHPLA
FT                   LNFNENALGMSAQARQAIVAALPGAFRYPDAAREALMTALASEMALTPAHLSLGNGSSE
FT                   CIRAILQAQAIAAQRRGRAVQLVVPDPTFNYAELCLQPLGVEVVKVPLDAQLGFPLAEM
FT                   QRRTRAFNGLSLVYLCNPNNPTATLTAADALAAWITQAPPDTFFVIDEAYAEFVSDPAF
FT                   RSAVTLVQAGYENLLVTRTFSKLYALAGLRVGYGVAAPSVAVQSNALMSLDNINSAGAA
FT                   AALASLQDRTFVEHSRKTMDLSRQIVCAALDKLQLTYLPSQANFIFHQVNGDTARYQAR
FT                   MKQHHILVGRPFPPLNNWNRLTLGTPQEMQLFVAQLHAFRRQGWV"
FT   gene            complement(507768..509132)
FT                   /locus_tag="NT01EI_0514"
FT   CDS_pept        complement(507768..509132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0514"
FT                   /product="sensory histidine kinase QseC, putative"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67748"
FT                   /db_xref="GOA:C5BH65"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH65"
FT                   /protein_id="ACR67748.1"
FT                   /translation="MRHLPRQLTHSLRARLTGGFLILVLLVWSSASALTWYQTRDALNE
FT                   LFDTQQMLFAKRLLAFDLSQLKHPLQLPQSHDLLHKHRGDQDKDALAFAIFNADGRMLL
FT                   NDGDNGDNLVYRYQGDGFTDGYLDNDDDSWRLLWLTTPDGRYRILVGQEWDYRNDMALS
FT                   IVGGQMIPWLVALPVMVILLLLVVSRGLAPLHRLAAALGRRRPDDATPLPRDAIPSEVW
FT                   PVVESLNTLFSRTNAQMVRERRFTSDAAHELRTPLAALRVQAEVVQLAQDDIALRQRAL
FT                   GQLEQGIDRATRLVDQLLTLSRLDSLSQLDDVQPRVLAELLQTAVIDMDAKAHAAGVAL
FT                   ALSVDDPKVRRRIQPLLFSLLIRNLLDNAICYSPAGSQVTLRLTSHRLQITDNGTGVSD
FT                   AVLQRLGERFYRPPGQEKTGSGLGLSIVRQIASLHEMQVQFSHAPGGGFQVTLRW"
FT   gene            complement(509132..509791)
FT                   /locus_tag="NT01EI_0515"
FT   CDS_pept        complement(509132..509791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0515"
FT                   /product="transcriptional regulator QseB, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67749"
FT                   /db_xref="GOA:C5BH66"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH66"
FT                   /protein_id="ACR67749.1"
FT                   /translation="MRVLLIEDDRLIGDGIKAGLSKMGFTVDWFTDGQQGMTALDSAPY
FT                   DAVILDLSLPGIDGLEILRCWREAGHAEPVLILTARDALEQRVIGLQQGADDYLCKPFA
FT                   LIEVAARLQALIRRNHGQAQTLLSHGAVSLDPLSLTATLDGASLPLKPKEFALLELLLR
FT                   NAGRVLPRSLIEEKLYSWDDEVSSNAVEVHIHHLRRKLGSHFIRTVHGVGYTLGDA"
FT   gene            510004..510405
FT                   /locus_tag="NT01EI_0516"
FT   CDS_pept        510004..510405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0516"
FT                   /product="Protein unknown function (DUF388)"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67750"
FT                   /db_xref="InterPro:IPR005220"
FT                   /db_xref="InterPro:IPR016052"
FT                   /db_xref="InterPro:IPR036700"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH67"
FT                   /protein_id="ACR67750.1"
FT                   /translation="MKKGAAIFAILALCSAPVLAQTGGFSGPGAMQQAQDTQQSGGFVS
FT                   GQQAVTTVAKAKDLSDNSWVVLQGNIEQRVRGDHYTFRDATGTIEVEIDHKYWNGQTIT
FT                   PKDKVEIQGEIDKDWSTTKIDVKRLHKMN"
FT   gene            complement(510464..510592)
FT                   /locus_tag="NT01EI_0517"
FT   CDS_pept        complement(510464..510592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0517"
FT                   /product="formate acetyltransferase 3, putative"
FT                   /EC_number="2.3.1.54"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67751"
FT                   /db_xref="GOA:C5BH68"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH68"
FT                   /protein_id="ACR67751.1"
FT                   /translation="MIVSLPMSNRDLVVRITGYSAFFSALSTDTQDDIITHTEQVL"
FT   gene            511202..513562
FT                   /locus_tag="NT01EI_0518"
FT   CDS_pept        511202..513562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0518"
FT                   /product="N-6 DNA Methylase"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67752"
FT                   /db_xref="GOA:C5BH69"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH69"
FT                   /protein_id="ACR67752.1"
FT                   /translation="MTNTNFSQTAAFIWSVADLLRGDFKQSQYGRVILPFTLLRRLECV
FT                   LAESKDAVVAKYDELKTSPLPEEAKQKFLLRASGLAFFNTSKMDLGKMGQNDIKANLEN
FT                   YVQAFSPDAREIFEHFKFSEFVGLLEDANLLFKVVKKFATTDLSPKAISNYEMGLVFEE
FT                   LIRRFAESSNETAGEHFTPRDIVRLTTSLVFMEDDEALTQDGIIRTIYDPTAGTGGFLS
FT                   SGMEYVHELNPNAVMRAFGQELNPESYAICKADMLIKGQDVSRIKLGNTLSNDQLPQDQ
FT                   FDYMLSNPPFGVDWKKIEGEINDEHMQKGFNGRFGPGLPRVSDGSLLFLMHLISKMRDS
FT                   HNVDGSVSNGGRIGIILNGSPLFTGGAGSGESEIRRYILEADLLEGIVALPTDMFYNTG
FT                   IATYVWILSNQKAAERKGKVQLIDGSNLCGKMRKSLGSKRNLMGDDDIKLITQTFGDFK
FT                   VMNATTLEALGLEKAAEQKSNRGRQPATAKAEAPKTFASKIFNSTDFGYRRLTIERPLR
FT                   LSAQVTDEAIATLRFAPKPFNVPMERLYDEFAVQWQAESYGDLSELEAEARAIIKAEFA
FT                   ELKEKQIKDLLDSKLWLAQRSLMEKAQQIQAALGTQVGGKTQVSNDFNQFKLTLKGAIK
FT                   TAGVKLDAKENKQFIDAITSKNPDAEPVVKKVLKEAAQPLYGAFEYKGKVVEFEQDGEL
FT                   RDNENVPLNPAQSTSNLIENYVQAEVLPHVNDAWINADKRDAKDGEVGIVGYEIPFNRH
FT                   FYVYQPPRPLSEIDADLDAVSAEMMKLLQEVHS"
FT   gene            513562..514887
FT                   /locus_tag="NT01EI_0519"
FT   CDS_pept        513562..514887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0519"
FT                   /product="restriction modification system DNA specificity
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67753"
FT                   /db_xref="GOA:C5BH70"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH70"
FT                   /protein_id="ACR67753.1"
FT                   /translation="MANYKAYPEYKDSGVEWLGLVPESWTICRLKNLAAIKNGQDYKSV
FT                   QTDDGYPVMGSGGQFTFASKFMYDKPSVLLGRKGTIDKPLYINEPFWTVDTMYYTELNE
FT                   GFDARYLYYLALTIQFSRYSTNTALPSMTQEHLSNYKFSVPKAESERKKITKFLDHETA
FT                   KIDNLIEKQQQLIELLKEKRHAVISHAVTKGLNPDVPMKDSGVEWLGEVPEHWTISTLK
FT                   HHAKFIDGDRGSEYPNDNDLVDDGVVFLSSKNISNWEINIDDANYISREKFNRLNRGKA
FT                   INGDVIVKVRGSTGRIGELAIFETERLNKSTAFINAQMMIIRLKNSFNNRFLCNVAQGH
FT                   YWMEQLNVGAYGTAQQQLNNAIFSGMIMVVPPIDEQLTINKFLELEIKRFDGLIKNTSN
FT                   MIQLIQERRTALISAAVTGKIDVRDWVAPDTQEAEEPQEVSA"
FT   gene            514884..518132
FT                   /locus_tag="NT01EI_0520"
FT   CDS_pept        514884..518132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0520"
FT                   /product="Type III restriction enzyme, res subunit"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67754"
FT                   /db_xref="GOA:C5BH71"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040980"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH71"
FT                   /protein_id="ACR67754.1"
FT                   /translation="MSMDSTKERIFQDEMIAQMIDRGWVRGKTDGYDRERALYSQDALT
FT                   FVQTTQPQEWEKFTKVYPSDTERHFLDALVAQLKKADINATDMLSRTYGTLGVLRHGIK
FT                   SHNARFSLCQFKPEHNLNPQTLTRYQQNICRLVPELVYSPHASNGAFAETGVKAKKWRI
FT                   DLVLFVNGLPIATLELKSEFKQTVQNAITQYKKTRLPKDPGTNKPEPLLTFKRGALVHF
FT                   AVSQYDVFMTTRLDGDKTFFLPFNKGTHDGGAGNDIPEDANDYATSYLWKEVLLPDNLL
FT                   KILASFMHLQIVEKENALGLKYKSESLIFPRYHQWDVVNKLITAATVEGTGNKYLIQHS
FT                   AGSGKSNSIAWTAHQLSRLYDENGEKQFHSVIVVTDRTVLDDQLQDTIYQFEHQDGVVG
FT                   RINNKEGDGSKSEKLASALENSQPIIIVTIQTFPFVLKAIENSVSLKQRKYAVIADEAH
FT                   SSQSGSTARQLKEVLMTEEADDDVEMSSEDILDATVAARRGSSNLNYYAFTATPKAKTL
FT                   ELFGRRPNPLEPASKTNKPEAFHVYSMRQAIEEGFILDVLKNYTNYKVAYKLLQKLGDP
FT                   DREVDSKKAKVKLNQWVSLHDYNVSQKVRVIVEHFRQHVMHLLAGQAKAMVVTSSRKAA
FT                   VRYKLAFDKYIAERKYAKISAMVAFSGEVEFHEDDHNSLALLHQKFTEINMNPGLKGRD
FT                   MRKAFDTDEYQVMLVANKFQTGFDQPKLCAMYVDKKLGGVECVQTLSRLNRTYPGKAQS
FT                   GTFVLDFYNEPEDILGAFQPYYQTAELTDVSDPQLVFELYEKLRTSGIFLWNEVEQFCT
FT                   AFFSKNKSNAAISNICKPAVQRWKNRYTSAIDAYLLAKEMFERTRKTGDIVLITNAENT
FT                   FKECEKEKSKLDIFKKDLGSFVRFYEFMSQIVDYDDKNLEKLSLFARHLRPLLHEQRIE
FT                   EDEIDLSNVEMSHYRLSKLHEQHLKLQEDAEDDKIKPGNEVGTAKPKDKKEEFLSNILA
FT                   RLNELFVTDNLTDKDMINYAFAVRDKLSENQAVMTQIANNTREQAMLGDFPQAIDDAVM
FT                   DSNDAQQEMMLQYLSNPELAKGFARVVFDMLKGA"
FT   gene            518354..518482
FT                   /locus_tag="NT01EI_0521"
FT   CDS_pept        518354..518482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0521"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67755"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH72"
FT                   /protein_id="ACR67755.1"
FT                   /translation="MALLGRLAQLEGSRSLALICIRPCIREHTPLDDSLFLSFSIH"
FT   gene            complement(518624..518699)
FT                   /locus_tag="NT01EI_T00018"
FT   tRNA            complement(518624..518699)
FT                   /locus_tag="NT01EI_T00018"
FT                   /product="tRNA-Met"
FT                   /note="putative tRNA-Met"
FT   gene            518876..519067
FT                   /locus_tag="NT01EI_0523"
FT   CDS_pept        518876..519067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0523"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67756"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH73"
FT                   /protein_id="ACR67756.1"
FT                   /translation="MRYQPGTEPGPGDHFANPRNRFWSVIHLAGFTDRPLAPQAEPHLL
FT                   IPAVGLSRWYRVPDGNGC"
FT   gene            complement(519438..521273)
FT                   /locus_tag="NT01EI_0524"
FT   CDS_pept        complement(519438..521273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0524"
FT                   /product="RNA polymerase sigma factor RpoD, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67757"
FT                   /db_xref="GOA:C5BH74"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007127"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR007631"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR042189"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH74"
FT                   /protein_id="ACR67757.1"
FT                   /translation="MEQNPQSQLKLLVTKGKEQGYLTYAEVNDHLPEDIVDSDQIEDII
FT                   QMINDMGIQVMEEAPDADDLMLAENIADEDAAEAAVQVLSSVESEIGRTTDPVRMYMRE
FT                   MGTVELLTREGEIDIAKRIEDGINQVQCSVAEYPEAITYLLEQYDRVEASEARLSDLIT
FT                   GFVDPNAEEDMAPTATHVGSELPEEELDDDGDENEDEDDDSDDDNSIDPELARQKFVEL
FT                   RQQYEKTRLAIKAEGRSSGKAQEEIQNLSEIFKQFRLVPKQFDYLVSNMREMMDRVRGQ
FT                   ERLIMKLCVEQSKMPKKNFITLFTGNETSITWFDAALAMGKPWGEKLKDMREEVERSLQ
FT                   KLHQIEEETGLTIEQVKDINRRMSIGEAKARRAKKEMVEANLRLVISIAKKYTNRGLQF
FT                   LDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIETI
FT                   NKLNRISRQMLQEMGREPTPEELAERMMMPEDKIRKVLKIAKEPISMETPIGDDEDSHL
FT                   GDFIEDTTLELPLDSATSESLRSATRDVLAGLTAREAKVLRMRFGIDMNTDHTLEEVGK
FT                   QFDVTRERIRQIEAKALRKLRHPSRSEVLRSFLDD"
FT   gene            complement(521509..523257)
FT                   /locus_tag="NT01EI_0525"
FT   CDS_pept        complement(521509..523257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0525"
FT                   /product="DNA primase, putative"
FT                   /EC_number="2.7.7.-"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67758"
FT                   /db_xref="GOA:C5BH75"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013173"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR019475"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH75"
FT                   /protein_id="ACR67758.2"
FT                   /translation="MAGRIPRVFINDLLARTDIVELVDARVKLKKQGKNYHACCPFHSE
FT                   KTPSFTVNADKQFYHCFGCGAHGNAIDFLMNYDRLEFVESIEELATMAGLEVPYESGSG
FT                   PSQMERHQRQNLYQLMDGLCGYYQQSLRQPGATQAQQYLTGRGMSQAIMDSFAIGYAPQ
FT                   GWDNALKRFGRDAGGRTALNDAGMLVNNENGRSYDRFRDRIMIPIRDKRGRVIAFGGRV
FT                   LGNGTPKYLNSPETEIFHKGRQLFGLYEALQHAAQPERLLVVEGYMDVIALAQYGVNYA
FT                   VASLGTSTTAEHIQLLFRHTDSVVCCYDGDNAGREAAWRALETALPYLSDGRQLKFMFL
FT                   PEGEDPDTLIRKEGAEAFERRMNDAHPLSTFLFDSLLPQVDLSTPDGRTKLSALALPLI
FT                   GQVPGETLRLYLRQSLGQKLGILDDSQLEKLLPRRSEAVKNYQPPRLKPTTMRILIALL
FT                   VQNPALAAEVPTLDGLHQHPLPGLPLFIELVETCLAQPGLTTGQLLELYRDNKYASQLE
FT                   TLATWNHMIIEPMVLETFVDTLGSLYDAVLEQRLEQLIARARTDGLTPAEREEVRSLNE
FT                   ALAKKN"
FT   gene            complement(523445..523660)
FT                   /locus_tag="NT01EI_0526"
FT   CDS_pept        complement(523445..523660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0526"
FT                   /product="30S ribosomal protein S21, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67759"
FT                   /db_xref="GOA:C5BHG0"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BHG0"
FT                   /protein_id="ACR67759.1"
FT                   /translation="MPVIKVRENEPFDVALRRFKRSCEKAGILAEVRRREFYEKPTTER
FT                   KRAKASAVKRHAKKLARENARRTRLY"
FT   gene            523874..524899
FT                   /locus_tag="NT01EI_0527"
FT   CDS_pept        523874..524899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0527"
FT                   /product="O-sialoglycoprotein endopeptidase, putative"
FT                   /EC_number="3.4.24.57"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67760"
FT                   /db_xref="GOA:C5BHG1"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BHG1"
FT                   /protein_id="ACR67760.1"
FT                   /translation="MRILGIETSCDETGIAIYDDEKGILANQLYSQIKLHADYGGVVPE
FT                   LASRDHVRKTVPLIQAALREADLTPADLDGVAYTAGPGLVGALLVGATVGRSLAFAWGV
FT                   PAVPVHHMEGHLLAPMLEENPPAFPFVALLVSGGHTQLISVTGIGEYRLLGESIDDAAG
FT                   EAFDKTAKLLGLDYPGGPVLSRMAQQGVPGRFVFPRPMTDRPGLDLSFSGLKTFAANTI
FT                   HANGDDAQTRADIARAFEDAVVDTLAIKCRRALDQTGFQRLVMAGGVSANRALRGRLAQ
FT                   MMQQRGGAVFYARPEFCTDNGAMIAYAGMVRLKSGVDADLSISVRPRWPLAELPPVAAR
FT                   S"
FT   gene            complement(524921..525589)
FT                   /locus_tag="NT01EI_0528"
FT   CDS_pept        complement(524921..525589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0528"
FT                   /product="conserved hypothetical protein TIGR00023"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67761"
FT                   /db_xref="GOA:C5BHG2"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BHG2"
FT                   /protein_id="ACR67761.1"
FT                   /translation="MSATALGMIIFAYLCGSISSAILVCKAAGLPDPRENGSGNPGATN
FT                   VLRNGGRLAAAAVLIFDVLKGMIPVWLAYTLEMSPFYLGLTAIAACLGHIYPVFFRFRG
FT                   GKGVATAFGAIAPIGWDLTGLMVGTWLLTVLLSGYSSLGAIVSALIAPFYVWWFKPQFT
FT                   FPVAMLSCLILVRHHDNIQRLWRGKEGKIWRKKGAKSAQNSERPASASPPHDDEPQTPR
FT                   "
FT   gene            525768..526133
FT                   /locus_tag="NT01EI_0529"
FT   CDS_pept        525768..526133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0529"
FT                   /product="dihydroneopterin aldolase, putative"
FT                   /EC_number="4.1.2.25"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67762"
FT                   /db_xref="GOA:C5BHG3"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHG3"
FT                   /protein_id="ACR67762.1"
FT                   /translation="MDIVFIEGLTVVTTIGVFEWEQTIRQRLVFDVELGWDNRRAAQSD
FT                   DVAHCLSYAEVSEAILQHVEPNRFALVERVAEEVATLLMTRFNSPWVRLRVSKPGAVAQ
FT                   ARSVGVVIERGCRTAGV"
FT   gene            526182..527000
FT                   /locus_tag="NT01EI_0530"
FT   CDS_pept        526182..527000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0530"
FT                   /product="undecaprenyl-diphosphatase, putative"
FT                   /EC_number="3.6.1.27"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67763"
FT                   /db_xref="GOA:C5BHG4"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHG4"
FT                   /protein_id="ACR67763.1"
FT                   /translation="MDLHTLLNAFILGIVEGLTEFLPVSSTGHMIIVGHWLGFEGDKAK
FT                   TFEVIIQLGSILAVVVMFWRRLFGLIGIHFGRPVVHEGRGQGQLRLGHIVLAMIPAVVL
FT                   GLLLHDFIKSLFTPLTVAYALVVGGLLLLAAEWLKPAQTRAVGLDDITYRQAFMIGCFQ
FT                   CLALWPGFSRSGATISGGMLMGVSRYAASEFSFLLAVPMMMGASALELYKSLPYLSLGD
FT                   LPMFSVGFVTAFIVALIAIKTFLNLIKRISFVPFAIYRFIVAAAVYLVFC"
FT   gene            complement(527034..528278)
FT                   /locus_tag="NT01EI_0531"
FT   CDS_pept        complement(527034..528278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0531"
FT                   /product="tRNA nucleotidyltransferase/poly(A) polymerase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67764"
FT                   /db_xref="GOA:C5BHG5"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR012006"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BHG5"
FT                   /protein_id="ACR67764.1"
FT                   /translation="MKTYLVGGAVRDKYLQLPTQDRDWVVVGAAPQTLLAQGYQQVGKD
FT                   FPVFLHPRSKEEYALARTERKAGQGYTGFSTYFAPDVTLEQDLLRRDLTINAMAEDDEG
FT                   QLIDPYGGLQDLQQRQLRHVSEAFVEDPLRVLRVARFAARFAPLGFEVAAPTLALMQQM
FT                   SQQGELAHLTPERVWLETEKALSGPVPQVYFQVLRDCGALAVLFPEIDRLFGVPAPAQW
FT                   HPEIDTGIHTLLTLAMASHLSDDVAVRFAALTHDVGKGLTNPNFWPHHHGHGPAGVRLV
FT                   REMCQRLRTPNPVRDLALLVAEYHDLIHTVERLRPATLLKLLDTIDVWRRPQRLQQMIL
FT                   CSEADARGRTGLEDQPYPQAGYLRAAYHQAAQVAVCNVITDGFQGAAIREELQTRRLQA
FT                   LKSWKAAQEAALNAE"
FT   gene            complement(528395..529012)
FT                   /locus_tag="NT01EI_0532"
FT   CDS_pept        complement(528395..529012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0532"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67765"
FT                   /db_xref="GOA:C5BHG6"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR016476"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHG6"
FT                   /protein_id="ACR67765.1"
FT                   /translation="MHLFCRLLLPLLSLCLTFQSHAEEQRFISDALSTYVHSGPGNQYR
FT                   ISGTINAGDPVTLLDINQQSQFAQIRDAKGRSGWLPLDQLSNQPSLRTRVPALEAQLSA
FT                   LTAKLSHIDGEWQQKTAEMQSKVAGSDDAIARLQAENQQLRQQLSSAQKNLGALNSQLD
FT                   DKKRAIILQWFLYGGGVAGAGLLLGLLLPRLLPRRRKERWMN"
FT   gene            complement(529221..530486)
FT                   /locus_tag="NT01EI_0533"
FT   CDS_pept        complement(529221..530486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0533"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67766"
FT                   /db_xref="GOA:C5BHG7"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHG7"
FT                   /protein_id="ACR67766.1"
FT                   /translation="MEIIANHGSLLIMVAAFFGLLMAIGIGANDVANAMGTSVGARAVT
FT                   IRQAIVIAMIFEFAGAYLAGGEVTQTIRSGIIDTNAFAGHPQTLVFGMMASLLAAGIWL
FT                   IVASLMGWPVSTTHSIIGAIIGFACVSVGPEAVEWDGVKGIVGSWIITPLISGVVAYGI
FT                   FLSAQRLIFNTENPFANARRFGPVYMFLTALVISLVTIKKGLKHVGLHLTDGETWLISL
FT                   LVSLLVMLGGYLYLSRKSFTDDADEQDHFRGVERVFSLLMVITACAMAFAHGSNDVANA
FT                   IGPLSAIVAIVRDPSVLAGTSPIVWWILPLGGIGIVVGLALMGRRVMETVGTGITDLTP
FT                   SRGFAAQFATASTVVIASGTGLPISTTQTLVGAVLGVGFARGIAALNLNVVRNIVASWI
FT                   VTLPAGAALSIALFYLLQAVFG"
FT   gene            complement(530509..531192)
FT                   /locus_tag="NT01EI_0534"
FT   CDS_pept        complement(530509..531192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0534"
FT                   /product="conserved hypothetical protein TIGR00153"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67767"
FT                   /db_xref="InterPro:IPR002727"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHG8"
FT                   /protein_id="ACR67767.1"
FT                   /translation="MMPVNTILGLFAKSPLKPLQEHASRVHECCSLLVPFFAATAQQQW
FT                   DQAQEIREQISNLEKQADTLKREIRLKLPRGLFLPVDRGDMLELVTQQDRLANRAKDIA
FT                   GRVIGRRLQIPAVMQADFVSYLQRCLDATALSSKVIHEMDELLETGFRGREADLVEQMV
FT                   MELDHIEDDTDHQQILLRQTLLSLEHQLNPVDIMFLYQIIEWVGGLADKALRVGSRLEL
FT                   MLARS"
FT   gene            531328..532644
FT                   /locus_tag="NT01EI_0535"
FT   CDS_pept        531328..532644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0535"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67768"
FT                   /db_xref="GOA:C5BHG9"
FT                   /db_xref="InterPro:IPR007899"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="InterPro:IPR039013"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHG9"
FT                   /protein_id="ACR67768.1"
FT                   /translation="MTEKMTVEIELKFIALPSAVHELPASLARWPLQHTPAQALSNIYY
FT                   ETECQTLRRHDMGLRIRGCDGAYEMTLKTAGSDVGGLHQRPEYNVALDAPQLDLRRFPA
FT                   QVWPDGCDVDALQAALQPLFSTDFQRERWVVTYRESQIEVALDRGDICAAGEREALHEI
FT                   ELELLQGERGDLLAFAEQLLTLDGIRMGAMSKAARGYRLAAGNAALRRRAFPLLRPAVR
FT                   ASVEQGMSAALTQILAHWQYHEEAWLRGDAESRDGIQEALVALRQSLTLFGGIVPRKAS
FT                   ATLRAGLSALEAQIQQPACAAQTLCYGRESLTTQWALTRWLAESGWRAYLDAAGSAKLS
FT                   GSFKRFADIMLGRCGAELKALFALVRHPQEYQDKLPRLQHQILAIRLLGGAYGEAAVDG
FT                   YLAPWQTLAHAIAHPAAATPEAACAQALHQPAFWRNGAH"
FT   gene            532724..535564
FT                   /locus_tag="NT01EI_0536"
FT   CDS_pept        532724..535564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0536"
FT                   /product="glutamate-ammonia-ligase adenylyltransferase"
FT                   /EC_number="2.7.7.42"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67769"
FT                   /db_xref="GOA:C5BHH0"
FT                   /db_xref="InterPro:IPR005190"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="InterPro:IPR023057"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHH0"
FT                   /protein_id="ACR67769.1"
FT                   /translation="MSETRALPTLLHSQGARQAARLQGATSAALPTLALSDFVADSLAA
FT                   YPAWWQQLQQMPPQVQEWQQYAGWLAERLAPAQDEATLMQALRLFRRHMLTRIAWMQAS
FT                   AQADCQQTLLQLSALAETLVIGARDWLYHRCCQEWGVPCNAAGEAQPLLILGMGKLGGG
FT                   ELNFSSDIDLIFVYPQAGATRGGRRELDNAQFFTRLGQRLIKALDQPTEDGFVYRVDMR
FT                   LRPFGDSGPLVLSFSALEDYYQEQGRDWERYAMVKARLLGEGQDRHGQELYRLLRPFVF
FT                   RRYIDFSVIQSLRNMKGMIAREVRRRGLKENIKLGAGGIREIEFITQVFQLIRGGRERS
FT                   LQQRALLPALAAIGELGLLTSAQVAALRCAYLFLRRLENLLQAIDDQQTQTLPSDDLNR
FT                   ARLAYGMGLTDWAALSRALQAHMVAVRAIFNALIGDDDQDEDEGSDDAALRFAPLWQER
FT                   LDESELAALMPQLDPAQRLRLQQTLDAFRCDVDKRTIGPRGREVLARLMPALLAQVCVR
FT                   DDALVLQQRLMPLLLNIVTRTTYLELLMEFPAALHQLIRLCAASPMLAEQLARYPLLLD
FT                   ELLDPVTLYRPVDQGSYRDELRQYLLRIPDDEEQRLEALRQFKHAQQLRIAASDIAGAL
FT                   PVMKVSDHLTYLAEAVIDAVVQQAWEQMVARYGQPTHLADHGQRGFAVIGYGKLGGWEL
FT                   GYGSDLDLVFLLECPMEVMTDGPRCIDGRQFYLRLAQRIMHLFSARTASGILYEVDARL
FT                   RPSGAAGMLVSTLTAFGDYQRSEAWTWEHQALVRARPVYGDAQMHRRFDAIRREILCRG
FT                   RDAATLRCEVAEMREKMRTHLGSRDAAQFDIKADRGGIVDIEFIAQYLVLRYGAEQPGL
FT                   TRWSDNVRIFELMAQYAVMPQEEADALTHAYVTLRNTLHHLALQAQPGVVESARFADER
FT                   AQVCDSWQRWLGGAAR"
FT   gene            complement(535575..536504)
FT                   /locus_tag="NT01EI_0537"
FT   CDS_pept        complement(535575..536504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0537"
FT                   /product="lipid A biosynthesis (KDO)2-(lauroyl)-lipid IVA
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67770"
FT                   /db_xref="GOA:C5BHH1"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="InterPro:IPR011920"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHH1"
FT                   /protein_id="ACR67770.1"
FT                   /translation="MSDNHVYPQFQRSMLHPRYWLTWLGIGIFYLMMLLPYPWLYRLGK
FT                   MLGKTAMRFMKTRVEVTRRNLALCFPQMPEAQREAWVIQNFESVGMALVETGMAWFWPD
FT                   WRIRRWCRLEGEENMRQAKQTGKGILLIGLHFLTLELGARIFGMHNPGVGVYRPNDNPV
FT                   LDWLQTWGRLRSNKYMLDRRDVKGMIRALKEGEIVWYAPDHDYGPRSSVFVPLFAVAQA
FT                   ATTTGTYILARMGKPTILPFMPLRNADGSGYTLHIQPMLQDVPLDDQTATAAYMNRVVE
FT                   REIMLAPTQYMWLHRRFKTCPPGIASRY"
FT   gene            536612..538045
FT                   /locus_tag="NT01EI_0538"
FT   CDS_pept        536612..538045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0538"
FT                   /product="RfaE bifunctional protein, putative"
FT                   /EC_number="2.7.1.-"
FT                   /EC_number="2.7.7.-"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67771"
FT                   /db_xref="GOA:C5BHH2"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011913"
FT                   /db_xref="InterPro:IPR011914"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023030"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BHH2"
FT                   /protein_id="ACR67771.1"
FT                   /translation="MKVTLPDFRRAQVLVVGDVMLDRYWYGPTSRISPEAPVPVVKVET
FT                   IEERPGGAANVAMNIASLGASARLVGLTGVDDAARALSTRLDEVHVECDFVAIPAQPTI
FT                   TKLRVLSRNQQLIRLDFEEGFGGVDPGPILARIRQALPQVGAVILSDYAKGALASVQAM
FT                   ICLARDAGVPVLIDPKGTDFERYRGATLLTPNLSEFEAVVGRCHSEQEIVDRGLALMER
FT                   FDLTALLVTRSEQGMTLLQRGIAPLHMPTQAQEVYDVTGAGDTVIGMLAASIAAGASLD
FT                   EACFLANAAAGVVVGKLGTSTVSPIELENAIRGRADTGFGVMTQEELKTAVLQARQRGE
FT                   KVVMTNGVFDILHAGHVSYLANARRLGDRLIVAVNSDASTSRLKGPERPVNPLVQRMLV
FT                   LAALEAVDWVIPFEEDTPQRIIAEILPDLLVKGGDYKPEEIAGGKEVIAAGGEVRVLNF
FT                   EDGCSTSNIINIIRQGQND"
FT   gene            538077..538601
FT                   /locus_tag="NT01EI_0539"
FT   CDS_pept        538077..538601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0539"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67772"
FT                   /db_xref="GOA:C5BHH3"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHH3"
FT                   /protein_id="ACR67772.1"
FT                   /translation="MAALKQELGLVQGVGLLSTSLLGTGVFAVPALAAQVAGNDSLWTW
FT                   PLLIVLVFPIAIGFAALGRHFPSAGGAAHFVGKAFGPHMARVTGWLFLSVIPVGLPASL
FT                   QIAAGFWQALFGWQGVALLVVELITLLTVWLLGMRGAGSSANLQTLIALLVVVLIAAVW
FT                   WRGGILPTQIP"
FT   gene            538653..539324
FT                   /locus_tag="NT01EI_0540"
FT   CDS_pept        538653..539324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0540"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67773"
FT                   /db_xref="GOA:C5BHH4"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHH4"
FT                   /protein_id="ACR67773.1"
FT                   /translation="MFWCFVGLEAFAHLASEFRHPQRDFPRALLLGLLLAGAVYWACSV
FT                   AVLHFHAFGDGRAAAASLPGIVVQLFGRHALWVACVIGYLACFASLNVYIQSFARLVWS
FT                   QAQRRPQSRLAQLSARQAPLNALTAVMLCCLLCSLLIYLSGLSLDALIVYANGVFIMIY
FT                   LLCMLAGCRLLRGPARLMARMGSVLCLLLLAMVGVRSLYALGMLLLLYLLLPRRAVPHG
FT                   G"
FT   gene            complement(539343..539609)
FT                   /locus_tag="NT01EI_0541"
FT   CDS_pept        complement(539343..539609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0541"
FT                   /product="Protein of unknown function (DUF526)"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67774"
FT                   /db_xref="InterPro:IPR007475"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHH5"
FT                   /protein_id="ACR67774.1"
FT                   /translation="MIDPKKIEQIARQVHQSMPKGLREFGDDMEKRVRQILQQQLSRLD
FT                   LVNREDFDVQTQVLLRTREKLALLEQRVAALEARLNDAGDGQA"
FT   gene            complement(539763..540971)
FT                   /locus_tag="NT01EI_0542"
FT   CDS_pept        complement(539763..540971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0542"
FT                   /product="transposase, IS605 OrfB family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67775"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHH6"
FT                   /protein_id="ACR67775.1"
FT                   /translation="MKRLQAFKFQLRPNGQQECDMRRFAGACRFVLNKSLALQNENHEA
FT                   GNKFMPYVKMAAWLVEWKNEPETRWLKEAPSQPLQQALKDLERAYKNFFQKRASFPRFK
FT                   KRGQSDSFRYPQGVKLEQENNRISLPKLGWISYRNNREVVGEVKNVTVSQSCGKWYVSI
FT                   QTEYEVSEPQHESTSMVGLDAGIAKLATLSDGTVFEPVNSFKTNQKKLARLQREMSRKV
FT                   KFSNNWKKAKRKVQNLHSRIANIRHDYLHKVSTTLSKNHAMIVIEDLKVANMSKSAAGT
FT                   VSQHGRNVRAKSGLNRSILDQGWYELRRQLEYKQLWRGGQVLAVPPAYTSQRCACCGHT
FT                   AKENRQSQSRFECLECGYTENADINGARNILAAGHAALACGEMAALGRSMKQEPTEASQ
FT                   TSV"
FT   gene            541084..541392
FT                   /locus_tag="NT01EI_0543"
FT   CDS_pept        541084..541392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0543"
FT                   /product="Transposase IS200 like protein"
FT                   /note="Transposase IS200 like"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67776"
FT                   /db_xref="GOA:C5BHH7"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHH7"
FT                   /protein_id="ACR67776.1"
FT                   /translation="MFDQDAIEKLRIYFASVCADFDVELVEMDGERDHVHLLINYPPKL
FT                   AVSSLVNSLKGVSSRLLRRDRPDIAARYYYKGVLWTPSYFASSCGGAPISIIKQYIE"
FT   gene            541843..542502
FT                   /locus_tag="NT01EI_0545"
FT   CDS_pept        541843..542502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0545"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67777"
FT                   /db_xref="GOA:C5BHH8"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BHH8"
FT                   /protein_id="ACR67777.1"
FT                   /translation="MNQILLSDFGTPMERVERALSALRDGRGVMVLDDENRENEGDMIF
FT                   AAEKMTVEQMALTIRHGSGIVCLCITEARRQQLDLPMMVSNNTSHYGTAFTVTIEAAEG
FT                   VTTGVSAQDRLTTVRAAIADDAKPGDLHRPGHVFPLRARPGGVLARRGHTEATIDLVSL
FT                   AGFRPAGVLCELTNDDGTMARAPQVMAFARQHEMPVVTIEDLVAYRQAREPQEQAD"
FT   gene            complement(542567..543334)
FT                   /locus_tag="NT01EI_0546"
FT   CDS_pept        complement(542567..543334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0546"
FT                   /product="metal cation transporter, zinc (Zn2+)-iron (Fe2+)
FT                   permease (ZIP) family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67778"
FT                   /db_xref="GOA:C5BHH9"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHH9"
FT                   /protein_id="ACR67778.1"
FT                   /translation="MSIPLLLTLLAGGATVVGALLAIIGQRPSNRVLAFSLGFAAGIML
FT                   LISLMEMLPAALNTPNMSPLLGYTMFILGLVGYFLLDRLLPHQHAHDMVALGNRTPRNL
FT                   KRTALLLTLGISLHNFPEGIATYVTASADLELGMGIALAVAIHNIPEGLAVAGPVYAAS
FT                   GSRLRALWWASLSGIAEILGGLLAFTLLGSAVSPVGMAAIMALVAGIMVALSVDELMPL
FT                   AREIDPHSNPSRGVLCGMTVMGLSLALLQATPL"
FT   gene            543551..544336
FT                   /locus_tag="NT01EI_0547"
FT   CDS_pept        543551..544336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0547"
FT                   /product="Catalytic LigB subunit of aromatic ring-opening
FT                   dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67779"
FT                   /db_xref="GOA:C5BHI0"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR014436"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHI0"
FT                   /protein_id="ACR67779.1"
FT                   /translation="MNDATMPALFLAHGSPMNAIEDNPFSALWQRLGRELPRPKAIVAI
FT                   SAHWCTQGLWATAMAQPRTLHDFGGFPPALSALRYPAPGSPALARELQSLLATQYTLLL
FT                   DENGWGLDHGAWSLLVHLYPQADIPVIQLSLDPRQPAAYHYQLGQALAPLRQRGVLILG
FT                   SGNVVHNLGTLRWEAEVEPYPWARRFEEVVRQGLRERGEDAALLRFTDDPDATLANPTP
FT                   EHFLPLLPVLGCWDGTEPLRVFEQGIVMGSLSMLSLQIG"
FT   gene            complement(544504..544592)
FT                   /locus_tag="NT01EI_T00019"
FT   tRNA            complement(544504..544592)
FT                   /locus_tag="NT01EI_T00019"
FT                   /product="tRNA-Leu"
FT                   /note="putative tRNA-Leu"
FT   gene            complement(544624..544712)
FT                   /locus_tag="NT01EI_T00020"
FT   tRNA            complement(544624..544712)
FT                   /locus_tag="NT01EI_T00020"
FT                   /product="tRNA-Leu"
FT                   /note="putative tRNA-Leu"
FT   gene            complement(544746..544834)
FT                   /locus_tag="NT01EI_T00021"
FT   tRNA            complement(544746..544834)
FT                   /locus_tag="NT01EI_T00021"
FT                   /product="tRNA-Leu"
FT                   /note="putative tRNA-Leu"
FT   gene            complement(545010..546050)
FT                   /locus_tag="NT01EI_0551"
FT   CDS_pept        complement(545010..546050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0551"
FT                   /product="methyltransferase, small subunit domain protein"
FT                   /note="methyltransferase, small subunit domain"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67780"
FT                   /db_xref="GOA:C5BHI1"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR013675"
FT                   /db_xref="InterPro:IPR023543"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHI1"
FT                   /protein_id="ACR67780.1"
FT                   /translation="MSAFTPASEVVLRHREEFEPRRVLFAGDLQDTLPAQFNAVEVRAH
FT                   TTQYHHWQALHTAMGDRCLFSLTISAEFAAGIDTLIYFWPKSKPEALFQLTQLLAQLPA
FT                   GCDVFIVGENRAGVRSAEEMASGMLTLNKIDSARRCGLYHGLLAQPPHFDLNDWWMSYD
FT                   TGSLRIATLPGVFSRDGLDIGSHLLLSSLPHGLKGRVLDVGCGAGVLSAAITRMSPETT
FT                   LTLSDVNAAALTASRQTLAQNEIDGEILASNVFSDISGRFDLIISNPPFHDGVQTSLLA
FT                   AQTLIRGAVSHLQLGGELRIVANAFLPYPQVLDAVFGRHEVVAQTGKFKVYSAILDRAA
FT                   LEQSRR"
FT   gene            546246..546656
FT                   /locus_tag="NT01EI_0552"
FT   CDS_pept        546246..546656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0552"
FT                   /product="DNA polymerase III, psi subunit, putative"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67781"
FT                   /db_xref="GOA:C5BHI2"
FT                   /db_xref="InterPro:IPR004615"
FT                   /db_xref="InterPro:IPR036654"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHI2"
FT                   /protein_id="ACR67781.1"
FT                   /translation="MTSRRDQLLQQLGITQWVLRRPALLRGEIAITLSAQTRLLIVSEV
FT                   PLSPDDLLLCDILRALSLAAEQAVILTPEQYEMLGDRQRYLCWWLGEPASSEACLRSPA
FT                   LSALYHNPGAKRALWQQICHEQHHFFPDPGGH"
FT   gene            546616..547062
FT                   /locus_tag="NT01EI_0553"
FT   CDS_pept        546616..547062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0553"
FT                   /product="ribosomal-protein-alanine acetyltransferase,
FT                   putative"
FT                   /EC_number="2.3.1.128"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67782"
FT                   /db_xref="GOA:C5BHI3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHI3"
FT                   /protein_id="ACR67782.1"
FT                   /translation="MSNTISSLIPADTDAAYAVECASHAFPWTHSTFLSNQGERYYNLK
FT                   LESQGQLAAFAITQVVLDEATLFNVAVAPAYQRQGLGRTLLQRLIDDLTERGVMTLWLE
FT                   VRDSNRAAIALYHALGFSEVSLRRNYYPTADGREDARIMALPLG"
FT   gene            547258..548847
FT                   /locus_tag="NT01EI_0554"
FT   CDS_pept        547258..548847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0554"
FT                   /product="peptide chain release factor 3, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67783"
FT                   /db_xref="GOA:C5BHI4"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR032090"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038467"
FT                   /db_xref="InterPro:IPR041732"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BHI4"
FT                   /protein_id="ACR67783.1"
FT                   /translation="MSPSEYAREVAKRRTFAIISHPDAGKTTITEKVLLFGQAIQVAGT
FT                   VKGRGSSQHAKSDWMEMEKQRGISITTSVMQFPYHDCLVNLLDTPGHEDFSEDTYRTLT
FT                   AVDCCLMVIDAAKGVEDRTRKLMEVTRLRDTPILTFMNKLDRDIRDPMELLDEVESELR
FT                   IACAPITWPIGCGKLFKGVYHLYKDETYLYQSGKGHTIQEVRVIKGLDNPLLDTAVGED
FT                   LAAQLREELELVQGASTEFEEEAFLNGQLTPVFFGTALGNFGVDHMLDGLVAWAPAPMP
FT                   RMTDVRKVSADEEKFSGFVFKIQANMDPKHRDRVAFMRVVSGRYDKGMKLRQVRTGKDV
FT                   VIADALTFMAGDRAHVEEAYPGDIIGLHNHGTIQIGDTFTQGEEMKFTGIPNFAPELFR
FT                   RIRLRDPLKQKQLLKGLVQLSEEGAVQVFRPVANNDLIVGAVGVLQFDVVVARLKSEYN
FT                   VEAIYESVNVSTARWVECDDVKKFDEFQRKNELHLALDGGDNLAYIAPTMVNLNLTQER
FT                   YPEVRFRKTREH"
FT   gene            549072..550076
FT                   /locus_tag="NT01EI_0555"
FT   CDS_pept        549072..550076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0555"
FT                   /product="phospholipase, patatin family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67784"
FT                   /db_xref="GOA:C5BHI5"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR037483"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHI5"
FT                   /protein_id="ACR67784.1"
FT                   /translation="MGYRIPITLGNIEPLAYKPYHPGRIALVCEGGGQRGIFTAGVLDE
FT                   FLRARFNPFDLYLGTSAGAQNLSAFVCGQAGYARRVITRYTTRSEFFNPLRFVRGGHLI
FT                   DLDWLVDCTHHDMPLAFDRAERMLGQQRQFYMVASRSDDFGAAYFPAQRDSWLQVIKAS
FT                   SAIPGFYRSGVELNGVVYQDGGIADAVPVREAYRLGADTIVVIRTVPSQMFYTPRWVKR
FT                   MESLFSESSLQQMVRMMQRHEKSYRRTQRFIEQPPGRLRIFEIYPPKPLASHALGSTVA
FT                   SLNTDYHLGRRCARYFLAAVGHWLLPRDLPAHAHGPTRPSALPLVHGTAGEKR"
FT   gene            550073..550864
FT                   /locus_tag="NT01EI_0556"
FT   CDS_pept        550073..550864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0556"
FT                   /product="hydrolase, TatD family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67785"
FT                   /db_xref="GOA:C5BHI6"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHI6"
FT                   /protein_id="ACR67785.1"
FT                   /translation="MIVAGLIDTHCHFDFAPFCGDEVASLRRARAAGIGDIIVPSIDAT
FT                   RFAQVLALAHRYPVLHAALGLHPLYIEHHRDTDIAVLDTLLAQADPAVVALGEIGLDHY
FT                   GDVCQPARQLSLLQDQLTLAQRYDLPVILHSRRSHDLLAKTLRQRRLTRTGVVHGFAGS
FT                   LAQAQAFVRLGYAIGVGGTITYARAGKTRAAVAALPLEALLLETDAPDMPLSGYQGAPN
FT                   RPEQLPRVFAALCALRSETPAQIAQALYDNTHRLFHFPPRA"
FT   gene            551113..552390
FT                   /locus_tag="NT01EI_0557"
FT   CDS_pept        551113..552390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0557"
FT                   /product="nucleoside transporter, NupC family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67786"
FT                   /db_xref="GOA:C5BHI7"
FT                   /db_xref="InterPro:IPR002668"
FT                   /db_xref="InterPro:IPR008276"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR011657"
FT                   /db_xref="InterPro:IPR018270"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHI7"
FT                   /protein_id="ACR67786.1"
FT                   /translation="MQLLMGVVGMVTLILLGVLLSNNRRAIRIRTVAGAFVVQVCLGAF
FT                   VLYVPAGRDMLGAMSAGVANVIAYGNQGISFMFGGLVSDKMFELFGGGGFIFALRVLPV
FT                   IVFFSSLIAVLYYLGIMQLVIRVLGGALHKLLGTSRTESLSATANIFVGQTEAPLVVRP
FT                   YIATMTQSELFAVMCGGLASVAGSVLAGYAQMGVPLEYLIAASFMAAPGGLLFAKLIVP
FT                   ETEQTHDREDATALVAAEDRPANVIDAAASGAASGLQLALNVGAMLLAFIALIALLNGM
FT                   LGGIGGWFNYPQLSMELILGWVFSPIAFLIGVPWSGAQIAGSFIGQKLIVNEFVAYMNF
FT                   GEYLRADAEVTAAGMQVLSGHTKAIISFALCGFANLSSVAILLGGLGSMAPKRRHEIAR
FT                   FGLRAVAAGTLSNLMSATIAGFFLAL"
FT   gene            complement(552447..553310)
FT                   /locus_tag="NT01EI_0558"
FT   CDS_pept        complement(552447..553310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0558"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67787"
FT                   /db_xref="GOA:C5BHI8"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012839"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023912"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="InterPro:IPR040074"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHI8"
FT                   /protein_id="ACR67787.1"
FT                   /translation="MNNRRALVSKLLPFSCVDGPGIRLVLFLQGCNLRCRGCHNPYTIG
FT                   RCDDCAQCVAACPHQALSLQAGKILWDALSCRQCDTCLQGCPRQANPMALSLSVDDVLM
FT                   QLRRQAAFIKGITVSGGEATLQLPFLLALFQAIRRDPGLQALDCLVDSNGELSEPGWTR
FT                   LIPWCDGVMVDLKAWGDERHRWLTGRGNRRILHSILWLAQRRRLAELRLLVIPQHSDYL
FT                   AHIDALAEFILLLDDVPVRLNAFHHHGVYGPASAWLTATKADIEQVAQALEARGVGAVI
FT                   RPALYL"
FT   gene            complement(553282..553698)
FT                   /locus_tag="NT01EI_0559"
FT   CDS_pept        complement(553282..553698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0559"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67788"
FT                   /db_xref="InterPro:IPR016905"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHI9"
FT                   /protein_id="ACR67788.1"
FT                   /translation="MPDSSDRGTTPGAHLPYGCEPDPVGHLMAVAPHHAYYPAGISDIL
FT                   TLDPTVKSNPQALMQLCLGAFSAGMREFTANVSGNDLVRVTGYMVRLSDLARYGQEGSR
FT                   LNTTRLAEEAARNTGMLERRARMISHEQQTRFSQ"
FT   gene            complement(553691..554758)
FT                   /locus_tag="NT01EI_0560"
FT   CDS_pept        complement(553691..554758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0560"
FT                   /product="conserved hypothetical protein, authentic
FT                   premature stop"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67789"
FT                   /db_xref="InterPro:IPR016905"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHJ0"
FT                   /protein_id="ACR67789.1"
FT                   /translation="MAIACDPHLSALQKRHFLALEAENDLPYPTLPEAARRALDEGVIC
FT                   DMFEGHAPYKPRYVLPDYTRFLANGSEWLELGPAQDFDDALSMLTILYHHVPSVTSMPV
FT                   FLGYLDQLLLPYVGILTEEELYIRIKRFWRYLDRTFPDAFMHANLGPSDNILTRLFLRA
FT                   DVELAQVVPNLTFLYHPDITPTERLQQAIENICTCSKPHIANAPLHDNIFTAGGYGIVS
FT                   CYNVLPLGGGGSTLVRLNLKEVALRSQGEEDFFTRTLPDYCRRQTEILRARSDFLFTRS
FT                   HFFSQSFLVHGGLIDAQRFVPMFGIFALAEAVDILCQQSGSAARYGQDETANALGYRIS
FT                   VWLDAFVRATPLPHA"
FT   gene            complement(554790..554975)
FT                   /locus_tag="NT01EI_0561"
FT   CDS_pept        complement(554790..554975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0561"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67790"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHJ1"
FT                   /protein_id="ACR67790.1"
FT                   /translation="MTINETDANAQMHASHGITLTYPPLAAGNPAGTTPGSHAVTGHSP
FT                   TLILIITLIAMDTDHA"
FT   gene            555281..556060
FT                   /locus_tag="NT01EI_0562"
FT   CDS_pept        555281..556060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0562"
FT                   /product="deoxyribose-phosphate aldolase, putative"
FT                   /EC_number="4.1.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67791"
FT                   /db_xref="GOA:C5BHJ2"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023649"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BHJ2"
FT                   /protein_id="ACR67791.1"
FT                   /translation="MTELQIAAQRALRLMDLTTLNDNDTDEKVIALCHQAKSPAGDTAA
FT                   VCIYPRFIPIARKTLREQGTPDVRIATVTNFPHGNDDIEIALVETRAAIAYGADEVDVV
FT                   FPYRALMAGNEQVGFDLVKACKEACAAANVLLKVIIETGELKDAALIRKASEISIKAGA
FT                   DFIKTSTGKVPVNATLESAELMMSVIRDMGVAKRVGFKPAGGVRTAEDAAQYLALADRL
FT                   LGEGWADSRHFRFGASSLLASLLQTLGYDAKGTGSSY"
FT   gene            556169..557491
FT                   /locus_tag="NT01EI_0563"
FT   CDS_pept        556169..557491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0563"
FT                   /product="thymidine phosphorylase, putative"
FT                   /EC_number="2.4.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67792"
FT                   /db_xref="GOA:C5BHJ3"
FT                   /db_xref="InterPro:IPR000053"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR013102"
FT                   /db_xref="InterPro:IPR013465"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR017872"
FT                   /db_xref="InterPro:IPR018090"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="InterPro:IPR036566"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHJ3"
FT                   /protein_id="ACR67792.1"
FT                   /translation="MFLAQEIIRKKRDGRALSEEEIRFFINGIRDNTISEGQIAALAMT
FT                   IFFHDMSMPERVALTMAMRDSGTVLDWNSLNLNGPIVDKHSTGGVGDVTSLMLGPMVAA
FT                   CGGYVPMISGRGLGHTGGTLDKLESIPGFDIFPDDSRFRSIIADIGVAIIGQTSSLAPA
FT                   DKRFYATRDITATVDSIPLITASILAKKLAEGLDALVMDVKVGSGAFMPTFELSEALAQ
FT                   AIVGVANGAGCRTTALLTDMNQVLASSAGNALEVREAVQFLTGKARNPRLFEVTMALCV
FT                   EMLISGKLAADQTEARSKLQAVLDNGRAAEIFGRMVAAQGGPRDFVERYDHYLPQAVLC
FT                   KPVFAEQAGIITAMDTRALGMSVVGLGGGRRQASDSIDYSVGLTDMVRLGDSVDGQRPL
FT                   AVVHARDEASWQQAAEAVRAAVTLGGCVPEPTPVVYRRITQ"
FT   gene            557592..558815
FT                   /locus_tag="NT01EI_0564"
FT   CDS_pept        557592..558815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0564"
FT                   /product="phosphopentomutase, putative"
FT                   /EC_number="5.4.2.7"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67793"
FT                   /db_xref="GOA:C5BHJ4"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR010045"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024052"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BHJ4"
FT                   /protein_id="ACR67793.1"
FT                   /translation="MKRAFIMVLDSFGIGEAKDAKSFGDEGADTLGHIARACARGEADI
FT                   GRQGPLHLPNLSRLGLGKAALESTGRFPEGLDENAEVIGAYGYANELSSGKDTPSGHWE
FT                   IAGVPVLFDWGYFHEHQNSFPQALLDTLVERANLPGYLGNCHSSGTVILDQLGEEHMKS
FT                   GKPIFYTSADSVFQIACHEETFGLERLYELCEIARDELNKGGYNIGRVIARPFVGDKAG
FT                   HFQRTGNRHDLAVEPPAPTMLKKLVDEKQGDVVSIGKIADIYANVGITKKVKATGIDAL
FT                   FDATLQEMRQAGNDTIVFTNFVDFDSSYGHRRDVAGYAAALELFDRRLPEMLALVKEDD
FT                   ILILTADHGCDPTWHGSDHTREHIPVLVYGPKVKPGSLGERDTFADIGQTVARYFGLSP
FT                   MAYGKPMF"
FT   gene            558882..559595
FT                   /locus_tag="NT01EI_0565"
FT   CDS_pept        558882..559595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0565"
FT                   /product="purine nucleoside phosphorylase, putative"
FT                   /EC_number="2.4.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67794"
FT                   /db_xref="GOA:C5BHJ5"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR004402"
FT                   /db_xref="InterPro:IPR018016"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BHJ5"
FT                   /protein_id="ACR67794.1"
FT                   /translation="MATPHINAEMGDFADVVLMPGDPLRAKHIAETFLQDVRQVNNVRG
FT                   MLGFTGTYKGRKISVMGHGMGIPSCSIYAKELITDFGVKKIIRVGSCGAVSMDVKLRDV
FT                   VIGMGACTDSKVNRLRFKDNDFAAIADFDMVRNAADAAKAKGIDARVGNLFSADLFYSP
FT                   DPTMFDVMEKYGILGVEMEAAGIYGVAAEFGVKALTICTVSDHIRTHEQTTAAERQTTF
FT                   NDMIEIALESVLLGD"
FT   gene            559781..560167
FT                   /locus_tag="NT01EI_0566"
FT   CDS_pept        559781..560167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0566"
FT                   /product="soluble cytochrome b562, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67795"
FT                   /db_xref="GOA:C5BHJ6"
FT                   /db_xref="InterPro:IPR009155"
FT                   /db_xref="InterPro:IPR010980"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHJ6"
FT                   /protein_id="ACR67795.1"
FT                   /translation="MRKSVLALAGLAMMAGSALAQAASVSEDMGIINQSYRQAQQATTA
FT                   QDFKQALTAMRAAAAAAKSETPSKLQGQASDSADMQGYRHGLDLLIGQIDKAENLADAG
FT                   HLDQAKAEAQQMLQTRNTYHKKYR"
FT   gene            560192..560683
FT                   /locus_tag="NT01EI_0567"
FT   CDS_pept        560192..560683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0567"
FT                   /product="Nickel-dependent hydrogenases b-type cytochrome
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67796"
FT                   /db_xref="GOA:C5BHJ7"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHJ7"
FT                   /protein_id="ACR67796.1"
FT                   /translation="MRLTHWSVALGFLCNRLYLTVPGGTPHQLIGLTVAGLVLLRLLWG
FT                   VTWARGAARLSAFIPTPSALIHHLHELRTRTVPPVLHHNPLGALGIWATWLLLLLIALT
FT                   GWGQGTDLVFRWPVDVWHVWLVDALTLVVCVHIVAVFTLSFWLRRNLINAMLPGRHGGE
FT                   "
FT   gene            560868..560981
FT                   /locus_tag="NT01EI_0568"
FT   CDS_pept        560868..560981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0568"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67797"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHJ8"
FT                   /protein_id="ACR67797.1"
FT                   /translation="MAHQGMDMFLIGIQIAKVYASMVTMSSGIATGASSWA"
FT   gene            complement(561260..561532)
FT                   /locus_tag="NT01EI_0569"
FT   CDS_pept        complement(561260..561532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0569"
FT                   /product="phosphocarrier, HPr family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67798"
FT                   /db_xref="GOA:C5BHJ9"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHJ9"
FT                   /protein_id="ACR67798.1"
FT                   /translation="MSVTQTVEIKNRLGMHARPAMKLFELVQTFDADVILRNENGIEAE
FT                   ANSVIALLMLDSAQGGQIEIQATGPDERQALDAVVSLFNAGFDEE"
FT   gene            complement(561540..562391)
FT                   /locus_tag="NT01EI_0570"
FT   CDS_pept        complement(561540..562391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0570"
FT                   /product="Uncharacterized P-loop ATPase protein family
FT                   (UPF0042)"
FT                   /note="Uncharacterised P-loop ATPase protein family
FT                   (UPF0042)"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67799"
FT                   /db_xref="GOA:C5B725"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5B725"
FT                   /protein_id="ACR67799.1"
FT                   /translation="MVLMIVSGRSGSGKSVALRALEDMGFYCVDNLPVELLPELARTLA
FT                   TRDTSAAVSIDVRNMPESPEVLETAMDHLPESFTPQLLFLDADRNTLIRRYSDTRRLHP
FT                   LSSKNLSLENAIDQENELLEPLRSRADLIIDTSEMSVHELAEMLRARLLGKRERELTMV
FT                   FESFGFKHGIPIDADYVFDVRFLPNPHWDPKLRPMTGLDKPVAAFLDRHTEVHNFIYQT
FT                   RSYLEQWLPALENNNRSYLTVAIGCTGGKHRSVYVAEQLADYFRSRGKNVQSRHRTLEK
FT                   RK"
FT   gene            complement(562489..562953)
FT                   /locus_tag="NT01EI_0571"
FT   CDS_pept        complement(562489..562953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0571"
FT                   /product="PTS IIA-like nitrogen-regulatory protein PtsN,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67800"
FT                   /db_xref="GOA:C5B726"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR006320"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:C5B726"
FT                   /protein_id="ACR67800.2"
FT                   /translation="MSNDLTMPLSVVLTPECTRNAVHCASKKRVLEIISELAAAQLNLP
FT                   TQVVFDAILTRERMGSTGIGNGIAIPHGKLEEDTLRAIAVFIHLDQPINFDAIDNQPVD
FT                   LLFALLVPADQCKTHLQTLSLMAQKLSDKGVCRRLRAAQSDEGLYQIITE"
FT   gene            complement(563073..563360)
FT                   /locus_tag="NT01EI_0572"
FT   CDS_pept        complement(563073..563360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0572"
FT                   /product="ribosomal subunit interface protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67801"
FT                   /db_xref="GOA:C5B727"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:C5B727"
FT                   /protein_id="ACR67801.1"
FT                   /translation="MQLNITGHHLEITDAIRQFVSEKFAKLGQYFDRINQVNVTLSIEK
FT                   VDHIAEATVFINGGELHASAQQEDMYAAIDVLIDKLARQLNKHKDKLKQH"
FT   gene            complement(563382..564857)
FT                   /locus_tag="NT01EI_0573"
FT   CDS_pept        complement(563382..564857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0573"
FT                   /product="RNA polymerase sigma-54 factor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67802"
FT                   /db_xref="GOA:C5B728"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:C5B728"
FT                   /protein_id="ACR67802.1"
FT                   /translation="MKQGLQLRLSQQLTMTPQLQQAIRLLQLSTLELQQEIQQALESNP
FT                   LLEQLEPNDEADGDSADDGRQQDEADVRDRDDDEPLDTRDALEQREMPDELPLDASWDE
FT                   IYTAGTPSGTGTDYHDDELPVFQGETTQTLQDYLMWQVELTPFSEMDLAIATAIVDAVD
FT                   DTGYLTASLEEILESLGDEHALPEEVEAVLKRIQRFDPIGVAARDLRDCLLVQLSQFAP
FT                   DTPYLNEAHSIVDRHLDLLGNHDFRNLMRSTKLKEEVLKEAMQLIQSLDPRPGLSINTG
FT                   DSDYVIPDVLVHKRQGRWVVELNQDSVPRLHINQRYAALGNQARSDSDSQFIRSNLQEA
FT                   KWLIKSLESRNDTLLKVSRCIVEQQQAFFEHGAESMKPMVLADIAQQVEMHESTISRVT
FT                   TQKFLHSPRGIFELKYFFSSHVNTENGGEASSTAIRALVKKLIAAENPAKPLSDSKLTT
FT                   LLADQGIMVARRTVAKYRESLFIPPSNQRKQLV"
FT   gene            complement(564982..565707)
FT                   /locus_tag="NT01EI_0574"
FT   CDS_pept        complement(564982..565707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0574"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67803"
FT                   /db_xref="GOA:C5B729"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:C5B729"
FT                   /protein_id="ACR67803.1"
FT                   /translation="MARLIAENLAKSYKGRRVVENVSLTVNSGEIVGLLGPNGAGKTTT
FT                   FYMVVGIVPRDAGRIIIDDDDISLLPLHARARRGIGYLPQEASIFRRLSVYDNLMAVLE
FT                   IRDDLNAEQRADRADELLDEFHIAHLRDNLGQSLSGGERRRVEIARALAANPKFILLDE
FT                   PFAGVDPISVIDIKKIIEHLRDRGLGVLITDHNVRETLDVCERAYIVSQGNLIAYGSPD
FT                   EILADEQVKRVYLGEEFRL"
FT   gene            complement(565714..566271)
FT                   /locus_tag="NT01EI_0575"
FT   CDS_pept        complement(565714..566271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0575"
FT                   /product="cell envelope biogenesis protein YhbN, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67804"
FT                   /db_xref="GOA:C5B730"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR014340"
FT                   /db_xref="UniProtKB/TrEMBL:C5B730"
FT                   /protein_id="ACR67804.1"
FT                   /translation="MKFKASTLKLRDLILAGALLSASASALAVTGDTDQPIHINSMQQS
FT                   LDMQGNVATFTGDVIVTQGTIKITADKVVITRPNGQQGSEIVEAYGNPVTFYQMQDNGK
FT                   PVEGHSQQLRYELAKDYVILTGKAFLKQLDSNIEGDRITYLVKQQQMEAFSDKGKRVTT
FT                   VLLPSQLQDKGSAKPAPQKKSN"
FT   gene            complement(566246..566797)
FT                   /locus_tag="NT01EI_0576"
FT   CDS_pept        complement(566246..566797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0576"
FT                   /product="Protein of unknown function (DUF1239)"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67805"
FT                   /db_xref="GOA:C5B731"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="InterPro:IPR026265"
FT                   /db_xref="UniProtKB/TrEMBL:C5B731"
FT                   /protein_id="ACR67805.1"
FT                   /translation="MIILLSLIALALIGWNLADNSPDGAPTTQDPNTPNYQSQHTLTVV
FT                   YDPSGKLSYKLVAQDVQHYSEQGVTWFTRPVLTTFDPQAAATWSVRADKAKLAKDNRLY
FT                   LYGNVEVNSLTPTSQLERITTDNAQVNLVTQDISSDDEVTLYGSNFTSHGLKMRGNMRD
FT                   KTARLIDKVNTYYEIQSKHP"
FT   gene            complement(566815..567381)
FT                   /locus_tag="NT01EI_0577"
FT   CDS_pept        complement(566815..567381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0577"
FT                   /product="3-deoxy-D-manno-octulosonate 8-phosphate
FT                   phosphatase, YrbI family"
FT                   /EC_number="3.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67806"
FT                   /db_xref="GOA:C5B732"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR010023"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C5B732"
FT                   /protein_id="ACR67806.1"
FT                   /translation="MQQNTSPIATCYGPVPADVMARATQIRLLICDVDGVLSDGLIYMG
FT                   NQGEELKAFNVRDGYGIRCLVTQGIEVAIITGRSSQLVADRAATLGIRHLYQGQSDKLI
FT                   AFEHILADLQLAPHQAAYIGDDLIDWPVMARVGLSVAVADAHPLLLPNAHYTTRIAGGR
FT                   GAVRELCDIILQAQGCLSQAKGLSI"
FT   gene            complement(567397..568383)
FT                   /locus_tag="NT01EI_0578"
FT   CDS_pept        complement(567397..568383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0578"
FT                   /product="sugar isomerase, KpsF/GutQ family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67807"
FT                   /db_xref="GOA:C5B733"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:C5B733"
FT                   /protein_id="ACR67807.1"
FT                   /translation="MSHMELQPDFDFQQAGKDVLRIEREGLAHLDLFINQDFSRACDAM
FT                   LRCRGKVVVMGMGKSGHIGRKIAATLASTGTSAFFVHPGEASHGDLGMVEQRDVVLAIS
FT                   NSGESQEIQALIPVLKRQNVTLICMTNNPDSAMGRAADIHLCIRVPQEACPMGLAPTTS
FT                   TTATLVMGDALAVALLQARGFTAEDFALSHPGGALGRKLLLRVSDIMHSGDEVPMVSPT
FT                   ASLRDALLEITRKNLGLTVICGPDAHIDGIFTDGDLRRIFDMGINLNNAKIADVMTRGG
FT                   IRIRPTALAVDALNLMQERHITSLLVAENDRLIGVVHMHDMLRAGVV"
FT   gene            complement(568438..569427)
FT                   /locus_tag="NT01EI_0579"
FT   CDS_pept        complement(568438..569427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0579"
FT                   /product="K+-dependent Na+/Ca+ exchanger-like protein"
FT                   /note="K+-dependent Na+/Ca+ exchanger homolog"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67808"
FT                   /db_xref="GOA:C5B734"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:C5B734"
FT                   /protein_id="ACR67808.1"
FT                   /translation="MLLATLLMLIGLLLLVYGADRVVYGAAAVAHALGVAPLVIGMTIV
FT                   SMGTSLPELTVSLTATLHNQIDTAVGNVLGSNITNILLILGCAALIRPLSVRSDIVRRE
FT                   LPLTLGATILCGFLLYDNQLNRIDGAILMTFFGAFLWLMLKMAHRVMPGGQDSYTREQI
FT                   AELPRDTGLPVALLWIALGFIILPLASRMVIDNATVLARYLGVSELIIGLTVIAVGTSL
FT                   PELATACAGAIKGEHDIVLGNIIGSNTFNILVVLGIPALIGPRNPLIDDAAFARDYWVM
FT                   LAFTLVLTLLCLRRRHSIGRLTGALLLCAFIAYIGLLYMQPSLMLYWD"
FT   gene            569707..570537
FT                   /locus_tag="NT01EI_0580"
FT   CDS_pept        569707..570537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0580"
FT                   /product="ABC-type transport system, ATPase component,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67809"
FT                   /db_xref="GOA:C5B735"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030296"
FT                   /db_xref="UniProtKB/TrEMBL:C5B735"
FT                   /protein_id="ACR67809.1"
FT                   /translation="MNHQENNLVDICGMSFSRGNRQIFTDINLTVPRGKVTAIMGPSGI
FT                   GKTTLLRLIGGQLRPDRGEIWFDGENIPALSRGRLFEARKKMSMLFQSGALFTDLSVFD
FT                   NVAFPLREHTQLPEILLRTTVLMKLEAVGLRGAADLMPSELSGGMARRAALARAIALDP
FT                   QMILFDEPFVGQDPITMGVLVKLIDELNHALGITCVVVSHDVPEVLSIADHAYIVAEQH
FT                   VIAHGDRQGLRANQDPRVRQFLDGIADGPVPFRYPAGDYRHALLASGEGSSHVA"
FT   gene            570602..571309
FT                   /locus_tag="NT01EI_0581"
FT   CDS_pept        570602..571309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0581"
FT                   /product="Protein of unknown function DUF140"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67810"
FT                   /db_xref="GOA:C5B736"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:C5B736"
FT                   /protein_id="ACR67810.1"
FT                   /translation="MLFSALVGRPEPGKQWPLLRRQLYSVGVQSLLIIIVSGLFIGMVL
FT                   GLQGYLVLTTYSAEASLGMMVALSLLRELGPVVTALLFAGRAGSALTAEIGLMKATEQL
FT                   SSLEMMAVDPLRRVVAPRFWAGVISMPLLTVIFVAVGIWGGSVVGVDWKGIDAGFFWSA
FT                   MQGAVDYRTDLLNCLIKSLIFAITVMWIALFNGYDAVPTSAGISRATTRTVVHASLAVL
FT                   GLDFVLTALMFGN"
FT   gene            571314..571847
FT                   /locus_tag="NT01EI_0582"
FT   CDS_pept        571314..571847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0582"
FT                   /product="MCE related protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67811"
FT                   /db_xref="GOA:C5B737"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR030970"
FT                   /db_xref="UniProtKB/TrEMBL:C5B737"
FT                   /protein_id="ACR67811.1"
FT                   /translation="MQTKKAEVWVGLFMLIALCAAIFLCLQVANVKSLGSAPTYRLYAT
FT                   FDNVGGLKARSPVKIGGVVIGRVAEISLDPQTYLPRVAMDIDRRYNHIPDTSSLAIRTS
FT                   GLLGEQYLALNVGFEDPEMGTAILKDGGTIQDTKSAIVLEDLIGQFLYKSGGESTNAPA
FT                   STAPAGNTPAPVAH"
FT   gene            571868..572518
FT                   /locus_tag="NT01EI_0583"
FT   CDS_pept        571868..572518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0583"
FT                   /product="toluene tolerance protein Ttg2D"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67812"
FT                   /db_xref="InterPro:IPR008869"
FT                   /db_xref="InterPro:IPR042245"
FT                   /db_xref="UniProtKB/TrEMBL:C5B738"
FT                   /protein_id="ACR67812.1"
FT                   /translation="MLKRIVMVALLCVAPWFSAQASAAPMLDQSNPYTLMNQAAAATFS
FT                   RLKSEQPRIRQDPDYLRTIVREELMPYVQVKYAGALVLGQYYRGVTPTQRAAYFKAFQS
FT                   YLEQVYGQALALYHGQRYEVAAERPLGDATIVTIRVTIFDNQGRPPVRLDFQWRKNTQT
FT                   GHWQAFDMIAEGVSMITTKQNEWAAILREKGVDGLTQQLIAVAKQPITLDNKQ"
FT   gene            572515..572829
FT                   /locus_tag="NT01EI_0584"
FT   CDS_pept        572515..572829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0584"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67813"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:C5B739"
FT                   /protein_id="ACR67813.1"
FT                   /translation="MTARGELRWRRDGAILYLQGVLECDSLGEIWQQRQALLTGIACLD
FT                   ISELSRVDSAGLALLLHVQNLRPEMPIPLRGISDRLRTLITLYNLQEIVPCAAPSANLA
FT                   "
FT   gene            572970..573224
FT                   /locus_tag="NT01EI_0585"
FT   CDS_pept        572970..573224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0585"
FT                   /product="BolA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67814"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:C5B740"
FT                   /protein_id="ACR67814.1"
FT                   /translation="MNNDQIKDVLMKALALQEVHVTGDGSHFQVIVVGELFAGMSRVKQ
FT                   QQAVYAPLMEFIADNRIHALTIKAYTPGEWQRDRKLSGL"
FT   gene            573288..574544
FT                   /locus_tag="NT01EI_0586"
FT   CDS_pept        573288..574544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0586"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase, putative"
FT                   /EC_number="2.5.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67815"
FT                   /db_xref="GOA:C5B741"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:C5B741"
FT                   /protein_id="ACR67815.2"
FT                   /translation="MDKFRLQGPTRLDGEVTISGAKNAALPILFAALLAEEPVEIQNVP
FT                   KLRDIDTTMKLLCQLGAKVERNGSVHVDASGVNELCAPYELVKTMRASIWALGPLVARF
FT                   GRGQVSLPGGCAIGARPVDLHISGLEQLGAEIRLEEGYVKASVQGRLQGAHIVMDKVSV
FT                   GATVTIMSAATLAQGTTVIENAAREPEIVDTAGFLNTLGAKISGAGTDRITIEGVERLG
FT                   GGVYRVLPDRIETGTFLVAAAVSRGRVVCRHTRPDTLDAVLAKLREAGADIEVGEDWIS
FT                   LDMHGQRPKAVTVRTAPHPGFPTDMQAQFSLLNLVSEGTGVITETIFENRFMHIPELIR
FT                   MGARAEIEGNTAICHGVETLSGAQVMATDLRASASLVIAGCIAQGTTLVDRIYHIDRGY
FT                   ERIEDKLSAMGAQIERVAE"
FT   gene            complement(574629..575690)
FT                   /locus_tag="NT01EI_0587"
FT   CDS_pept        complement(574629..575690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0587"
FT                   /product="periplasmic serine peptidase DegS, putative"
FT                   /EC_number="3.4.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67816"
FT                   /db_xref="GOA:C5B742"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011783"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:C5B742"
FT                   /protein_id="ACR67816.1"
FT                   /translation="MLVKLLRSTLLGLAVAIVLMIALPSLRPQGLMPLFSEATFEEQPV
FT                   SYNAAVRRAAPTVVNVYNGSMSGSSSGLAIKTLGSGVIMDEKGYILTNKHVVSAADQIV
FT                   VALQDGRWFEAMLVGSDTLTDLAVLKIQASNLPVITINPKRVPHIGDVVLAIGNPYNIG
FT                   QTTTQGIISATGRVGLSTYGHQNFLQTDASINHGNSGGALVNSLGELVGINTLSLDKSN
FT                   DGETPEGIGFAIPTALATKIMNKLIRDGRVIRGFIGISGREIVPVRNQPASAERIQGII
FT                   VNSVAANGPAALAGIRPGDIVLNVNGKPAISATETMDQVAEIRPGSEVPVIIMRNGERL
FT                   KLNVAIAEFPNVD"
FT   gene            complement(575782..576321)
FT                   /locus_tag="NT01EI_0588"
FT   CDS_pept        complement(575782..576321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0588"
FT                   /product="protease DegQ, putative"
FT                   /EC_number="3.4.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67817"
FT                   /db_xref="GOA:C5B743"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:C5B743"
FT                   /protein_id="ACR67817.1"
FT                   /translation="MTADLANAFKLDSPSGTFVNEILPKSVAARAGIRAGNELIPLNDT
FT                   PIGSFAELRAKEGSVAPDTALQIGLLRNGKPMNVTVILENHALASVQGKTLTPTLARTS
FT                   LSPGAIQKTSGICSDTLENRSPAAQIGLHKADLVIGVNHLHTRNIAALRSALVGDPPVI
FT                   ALHLIRGGEGMYLLRR"
FT   gene            576389..576559
FT                   /locus_tag="NT01EI_0589"
FT   CDS_pept        576389..576559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0589"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67818"
FT                   /db_xref="UniProtKB/TrEMBL:C5B744"
FT                   /protein_id="ACR67818.1"
FT                   /translation="MRHIAGDRKDDTDAAADRGQDRGIDPDLFDLEVDQRPAGVTAVDG
FT                   GVGLNKVFQLS"
FT   gene            complement(577063..577455)
FT                   /locus_tag="NT01EI_0590"
FT   CDS_pept        complement(577063..577455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0590"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67819"
FT                   /db_xref="GOA:C5B745"
FT                   /db_xref="InterPro:IPR009386"
FT                   /db_xref="UniProtKB/TrEMBL:C5B745"
FT                   /protein_id="ACR67819.1"
FT                   /translation="MTWEYALIGLVVGIIIGALAMRFGNRKLRQQKTLQDELEKSKTDL
FT                   DQYRQELVNHFARSAELLDNMAKDYRQLYQHMATSSNNLLPDMPAHDNPFRYRLTEADN
FT                   DQAPVEIPPRDYSEGASGLLRADRHD"
FT   gene            577653..578786
FT                   /locus_tag="NT01EI_0591"
FT   CDS_pept        577653..578786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0591"
FT                   /product="ATPase, AFG1 family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67820"
FT                   /db_xref="GOA:C5B746"
FT                   /db_xref="InterPro:IPR005654"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030870"
FT                   /db_xref="UniProtKB/TrEMBL:C5B746"
FT                   /protein_id="ACR67820.1"
FT                   /translation="MFSPYALTHDTPLARYRAALAVGDYQPDAAQQRAVEALDEIHRQW
FT                   TMRWQAAAPAGWRTRLPHWLGGRRIAEPITGLYLWGGVGRGKTWLMDLFFDTLPGQRKQ
FT                   RLHFHRFMLWVHESLAAKQGLADPLALLADTLKAQADVLCFDEFFVTDIGDAMLLGTLL
FT                   PVLLARGVTLVTTSNIPPAQLYPNGLQRGRFLPAIANIQTYCQVLNVDGGIDYRLRTLT
FT                   RAHLYLTPLGARTEQAMDALFLRLAGQAGQAGGTLEINHRQLPVLRRAEAVVALHFSAL
FT                   CEAPCSSRDYIALAQRYHTVLLHGVSAMNSDREECARRFLALVDEFYERRVTLIISASC
FT                   DMFGLYCGERLTFEYQRCLSRLQEMQSEAYLSLPHRP"
FT   gene            579040..579468
FT                   /locus_tag="NT01EI_0592"
FT   CDS_pept        579040..579468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0592"
FT                   /product="50S ribosomal protein L13, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67821"
FT                   /db_xref="GOA:C5B747"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5B747"
FT                   /protein_id="ACR67821.1"
FT                   /translation="MKTFTAKPETVKRDWYVVDASGKTLGRLATELARRLRGKHKAEYT
FT                   PHVDTGDYIIVLNAEKVAVTGNKRLDKKYFHHTGHIGGIKEATFEEMIARHPERVIEIA
FT                   VKGMLPKGPLGRAMFRKLKVYAGNEHNHAAQQPQVLDI"
FT   gene            579483..579875
FT                   /locus_tag="NT01EI_0593"
FT   CDS_pept        579483..579875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0593"
FT                   /product="ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67822"
FT                   /db_xref="GOA:C5B748"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5B748"
FT                   /protein_id="ACR67822.1"
FT                   /translation="MAENQYYGTGRRKSSAARVFIKPGSGKIVINQRSLEQYFGRETAR
FT                   MVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYDETLRSELRKAGFV
FT                   TRDARQVERKKVGLRKARRRPQFSKR"
FT   gene            579902..580027
FT                   /locus_tag="NT01EI_0594"
FT   CDS_pept        579902..580027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0594"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67823"
FT                   /db_xref="UniProtKB/TrEMBL:C5B749"
FT                   /protein_id="ACR67823.1"
FT                   /translation="MLKTRLSRVFLFPYGIGLFAVKDFIHKIIICHPQARQFLVD"
FT   gene            580210..580851
FT                   /locus_tag="NT01EI_0595"
FT   CDS_pept        580210..580851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0595"
FT                   /product="Glutathione S-transferase, N-terminal domain
FT                   protein"
FT                   /note="Glutathione S-transferase, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67824"
FT                   /db_xref="GOA:C5B750"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034341"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:C5B750"
FT                   /protein_id="ACR67824.1"
FT                   /translation="MAVAANKRSVMTLFSGPTDIFSHQVRIVLAEKGVSVEIEQVDMGN
FT                   LPQDLIDLNPYRTVPTLVDRELTLYESRIIMEYLDERFPHPPLMPVYPVARGESRLFMH
FT                   QIERDWYSLLYKIEKGSAQEADAARKQLREELLAIAPVFSQKPFFMSDEFSLVDCYLAP
FT                   LLWRLPVLGIELSGAGAKELKGYMTRVFERDAFLASLTEVEREMRLHTRG"
FT   gene            580869..581345
FT                   /locus_tag="NT01EI_0596"
FT   CDS_pept        580869..581345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0596"
FT                   /product="stringent starvation protein B"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67825"
FT                   /db_xref="InterPro:IPR007481"
FT                   /db_xref="InterPro:IPR036760"
FT                   /db_xref="UniProtKB/TrEMBL:C5B751"
FT                   /protein_id="ACR67825.1"
FT                   /translation="MSPRRPFLLRAFYDWLLDNQLTPHLVVDVHCAGVMVPMEYARDGQ
FT                   IVLNIAPRAVGALELADDAVRFNARFGGVPRQVYVPMAAVMAIYARENGAGTMFEPEAA
FT                   YEQDTDETRIEAENDEPPMMLIDGDRSPDNKAPADDDGGDEPPPRGRPALRVVK"
FT   gene            complement(581555..582031)
FT                   /locus_tag="NT01EI_0597"
FT   CDS_pept        complement(581555..582031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0597"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67826"
FT                   /db_xref="InterPro:IPR004375"
FT                   /db_xref="InterPro:IPR037012"
FT                   /db_xref="UniProtKB/TrEMBL:C5B752"
FT                   /protein_id="ACR67826.1"
FT                   /translation="MILGHLDDLTQRGDLPNPIRRALQRALEAGAAHLENGTHPIDGEQ
FT                   LYMNVMTLTPLGAEEKLGEIHRDYLDIQLVLQGEERIDFAMAGQARECQPYQQEGDYQL
FT                   CAAMMQPQRLIMTPGMFAVFLPGEPHKPGCISRTSDPIRKVVVKLHRDCLKEEK"
FT   gene            complement(582028..582903)
FT                   /locus_tag="NT01EI_0598"
FT   CDS_pept        complement(582028..582903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0598"
FT                   /product="ROK family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67827"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:C5B753"
FT                   /protein_id="ACR67827.1"
FT                   /translation="MNTLAIDLGGTKLAAALVDANGQLSQRSEVATPVSGDPEALTKAL
FT                   SQLVTRYRGMAGRVAVASTGIIHQGILSALNPDNLGGLDRFPLQECIERLSALPCYLLN
FT                   DAQAAAWSEYLTLTPSGQDMAFITVSTGVGGGLVLNGRLQIGRGAFAGHIGHTLADPAG
FT                   PRCGCGRSGCVESIASGRAIAAAAQGDLTGLDARAIFQRAAADDAQAQRLIARSAQAIA
FT                   QLIADLRATLDIQCAVIGGSVGLAPDYLAQVQYFLRQLPHAYHTTLYPARHQRDAGLIG
FT                   AALWSRRETI"
FT   gene            complement(582884..583591)
FT                   /locus_tag="NT01EI_0599"
FT   CDS_pept        complement(582884..583591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0599"
FT                   /product="Putative N-acetylmannosamine-6-phosphate
FT                   epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67828"
FT                   /db_xref="GOA:C5B754"
FT                   /db_xref="InterPro:IPR007260"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5B754"
FT                   /protein_id="ACR67828.1"
FT                   /translation="MSVFTTLQQHIQRNGALIVSCQPVPGSPMDSPEIVAAMATAAAQA
FT                   GAAALRIEGVANLQAVRPHVSLPIIGIIKRDLDESPVRITPFLRDIDDLVQAGADIIAF
FT                   DGTQRPRPERREALLARIQHHGRLAMADCSSLEDGLYCQRLGCDFIGTTLSGYTHGETP
FT                   CEPDFALVHALSNAGCRVIAEGRYNTPAQAAQALSQGAWAVTVGSAITRIEHICQWYCQ
FT                   ALQAEAHHEYAGH"
FT   gene            complement(583757..584458)
FT                   /locus_tag="NT01EI_0600"
FT   CDS_pept        complement(583757..584458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0600"
FT                   /product="disulfide bond formation protein, DsbB family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67829"
FT                   /db_xref="GOA:C5B755"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="InterPro:IPR023792"
FT                   /db_xref="UniProtKB/TrEMBL:C5B755"
FT                   /protein_id="ACR67829.1"
FT                   /translation="MSAKMWSDLRQNPVETLVRWQERRFLWLLMALAMGGLIVLAHAFF
FT                   QIYLYMAPCEQCVYIRFAMFVMVIGGLVAAINPRNLALKLFGCIAAFYGAIIGMGYSIK
FT                   LNGIHHAVHSPDALFGVQGCSTDPHFPFGLPLAEWSPSWFKPTGDCGYDAPMVPQGVAL
FT                   DSVQQWFIDMYVQAEGWYLIPSMQFMNMAQACFLAFALCFAILVIMSVAWAIHLLRRRA
FT                   VPADHTASTPR"
FT   gene            complement(584475..585146)
FT                   /locus_tag="NT01EI_0601"
FT   CDS_pept        complement(584475..585146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0601"
FT                   /product="DsbA-like thioredoxin domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67830"
FT                   /db_xref="GOA:C5B756"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR028588"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C5B756"
FT                   /protein_id="ACR67830.1"
FT                   /translation="MHLTLGKTHLKALLSATLLTCAFGAAAFSEGTDYVVLEKPIPNAQ
FT                   KTLIKVFSYDCPFCYKYDKAVTGPVSEKVKDVVRFEPYHLDTKGVYGPQGSEILAVLLN
FT                   KDRTAGVSIFDDASQFKKAKFAYYAAYHDKKERWKDGKDPAAFTQTGLDAAGLSHADLE
FT                   EGLKDPAVQNTLGEWKASAYDVAKIQGVPAYVVNGKYLLMTKSIKSVDSMADLVKELAA
FT                   K"
FT   gene            complement(585209..587221)
FT                   /locus_tag="NT01EI_0602"
FT   CDS_pept        complement(585209..587221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0602"
FT                   /product="Arylsulfotransferase (ASST)"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67831"
FT                   /db_xref="GOA:C5B757"
FT                   /db_xref="InterPro:IPR010262"
FT                   /db_xref="InterPro:IPR035391"
FT                   /db_xref="InterPro:IPR038477"
FT                   /db_xref="UniProtKB/TrEMBL:C5B757"
FT                   /protein_id="ACR67831.1"
FT                   /translation="MNLIKYIHLRNNLIYHDNDNRLSLLIIALFILHLRGVDDIEFPFW
FT                   DSADGMQSNAGCPLMIKMDLLQSQENTMLSTTRKTLVAGAIAFAIGAISPALQAAGMPA
FT                   APAVGNFGSVVVDPYGNSPLTALINLNGHAISDVKVTVLGKGENGVAVSYPVGKQSLLT
FT                   YDGIPIFGLYQKHDNQVTIEYIEAGKRKKDSYTIRTSAIVNKYMDNRSLTDLQQVKPVK
FT                   VAKGFEDRLYLVNTHTFTPQGSDLHWSGEKDKNAGLLDANPATGSMPFDIAPFTFIVDT
FT                   QGEYRWWLNQDALYNAHDVDVNKRGYLMGIRETPRGTFTAVQGQRWYEFDMMGQVLNNH
FT                   RLPRGYLDATHESVETPNDTVLLRVGKRNYVREDGQRVHTIRDHILEVDKSGRVVDVWD
FT                   LNLILDPLRDSLLGALDAGAVCVNVDLDQAGKQAKLEPDTPFGDALGVGPGRNWAHVNS
FT                   IAYDPKDDSIILSSRHQGVVKIGRDKQVKWILAPSEGWNEKLSAKLLKPVDAQNKPLNC
FT                   SAKGVCENSDFDFAYTQHTAWLSPKGTLTVFDNGDGRHLEQPALPTMKYSRIVEYKIDE
FT                   KNMTVQQVWEYGKDRGYEWYNPITSIVEYQPDRDTMFSFGGSTNLFEPGQPTTGRLNEI
FT                   DYKTKDVKVELDVLSDKANQTHYRAALIRPQGLFL"
FT   gene            587392..588393
FT                   /locus_tag="NT01EI_0604"
FT   CDS_pept        587392..588393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0604"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67833"
FT                   /db_xref="GOA:C5B758"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037402"
FT                   /db_xref="UniProtKB/TrEMBL:C5B758"
FT                   /protein_id="ACR67833.1"
FT                   /translation="MRKVDNVAVDSELLALFRALAETGSLTQAAGRVGLSQAAASRALS
FT                   KLRTVFQDLLFVKGGYGMQATPRARELMPRVTAALQALDHLTMPYEFDPQTLRRTLYLG
FT                   AVDNGVWMIFSRVVKSLFQQAPNARIEILPIGDDLFSSLKFGRMDLAIYPLIDIPADFH
FT                   EANLFKTTFSCLVRQGHPLARQMQCGEAPTLAQINAYRRLQVSLHDGQPGAVVGNAVHR
FT                   QGKDYDIAMSVPYFLAAPMILAQTDFVLTLPIQTARHFSQMANLAILPYPDGETTFYTR
FT                   LIWHHRVHHDPVIQWLRALFLRFASEEAALENVQDNADAAGCHVGAERYTQR"
FT   gene            complement(588378..589796)
FT                   /locus_tag="NT01EI_0603"
FT   CDS_pept        complement(588378..589796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0603"
FT                   /product="glutamate synthase [NADPH] small chain, putative"
FT                   /EC_number="1.4.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67832"
FT                   /db_xref="GOA:C5B759"
FT                   /db_xref="InterPro:IPR006006"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C5B759"
FT                   /protein_id="ACR67832.1"
FT                   /translation="MSQNVYQFIDLQRIDPPKKPLKQRQGEFIEIYEPFSDGQAQAQAD
FT                   RCLSCGNPYCEWRCPLHNYIPNWLKLVNEGRIWDAATLSHQTNSLPEVCGRVCPQDRLC
FT                   EGACTLHDEFGAVTIGNVERYITDKALTEGWMPDLSGVQPTGKRVAIVGAGPAGLACAD
FT                   VLARSGVQAEIFDRHPEIGGLLTFGIPAFKLEKQVMVRRREIFSAMGIRFHMNTEIGRD
FT                   ITLESLLSQFDAVFLGVGTYQALPGGLEQEEASGVHSALPYLIATARHLMGYPEDPQTP
FT                   YVSMHGKRVVVLGGGDTAMDCVRSALRQGATQVTCAYRRDEENMPGSRREVKNAREEGA
FT                   AFRFNLQPLAIETNAAGRVCGVRMAQTALADPDAAGRHAVRLIPDTEVTLAADAVLLAF
FT                   GFRPHAMAWLAEHDVDLDAQGRIVATDHGDYPHQTSNPQIFAGGDAVRGSDLVVTAIAE
FT                   GRRAAQGILSYLCV"
FT   gene            complement(589812..594269)
FT                   /locus_tag="NT01EI_0605"
FT   CDS_pept        complement(589812..594269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0605"
FT                   /product="glutamate synthase [NADPH] large chain, putative"
FT                   /EC_number="1.4.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67834"
FT                   /db_xref="GOA:C5B760"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:C5B760"
FT                   /protein_id="ACR67834.1"
FT                   /translation="MLYDASHERDNCGFGLIAHIEGEPSHKVVRTAIHALARMQHRGAI
FT                   LADGKTGDGCGLLLQKPDRFLRMVAEERGWRLAKNYAVGMLFLSRDEERASTARRIVEE
FT                   ELQNETLSIVGWRDVPVNQEVLGDIARSSMPHIAQIFINAPAGWRPRDLERRLFIARRR
FT                   IEKRIEDPDFYVCSLSNLVTIYKGLCMPADLPRFYHDLADLRMESAICLFHQRFSTNTV
FT                   PRWPLAQPFRYLAHNGEINTITGNRQWARARTYKFKTPLIPDLHDAAPFVNETGSDSSS
FT                   LDNMLELLLSGGMDIVRAMRLLVPPAWQNNPDMDPDLRAFFDFNSMHMEPWDGPAGIVM
FT                   SDGRFAACNLDRNGLRPARYVITKDRLITCASEVGIWDYQPDEVVEKGRVGPGELMVID
FT                   TRAGQILHSRETDDDLKSRHPYREWMEKNVRRLIPFEDLPDEQVGSRTLDDAALLTYQK
FT                   QFAYSQEEIDQILRVLGENGQEATGSMGDDTPFAVLSSRPRLIYDYFRQQFAQVTNPPI
FT                   DPLREAHVMSLSTSIGREMNVFCEAEGQAHRLNFKSPVLLYSDFAQLTGQEKEHYRAET
FT                   LDITFDPEQRDLQQALAALCDEAEAQVRHGAVLLVLSDRAISARRLPIPAPMAVGAVQQ
FT                   RLVEHSLRCDANIIVETAGARDPHHFAVLLGFGATAIYPYLAYETLAKLVDCGAITRSY
FT                   RQVMLNYRNGINKGLYKIMSKMGISTVASYRCSKLFEAVGLHPDICDLCFPGVVSRIGG
FT                   AAFSDFQQDLHNLSRRAWLARQPLEQGGLLKYVHDGEYHAYNPDVVRALQQAVQSGDYR
FT                   DYQRYASLVNQRPITTLRDLLALRPVAQPLALEQVEEESTLFQRFDTAAMSIGALSPEA
FT                   HEALAQAMNGLGGFSNSGEGGEDPARYNTDKASRIKQVASGRFGVTPAYLVNADVIQIK
FT                   VAQGAKPGEGGQLPGDKVTPYIARLRYSVPGVTLISPPPHHDIYSIEDLAQLIFDLKQV
FT                   NPRALISVKLVSEPGVGTIATGVAKAYADLITIAGYDGGTGASPLSSVKHAGCPWELGL
FT                   VETQQALVANGLRHKIRLQVDGGLKSGADIIKAAILGAESFGFGTGPMVALGCKYLRIC
FT                   HLNNCATGVATQDEKLRRDHFHGLPLRVTHYFHFIARETRELMAQLGVSRLVDLIGRTD
FT                   LLTVLEGETAKQSRLDLAPLLHTATPHPGKGLHCSEGNPPFDPGQLNQSLLSQLQDNIV
FT                   TRQGRALFCDIHNTDRSVGASLSGAIAERYGEQGMATSPLKIQFSGTAGQSFGVWNAAG
FT                   LELTLTGDANDYVGKGMAGGRIVIRPPVGSAFRSHEASIIGNTCLYGATGGRLFAAGRA
FT                   GERFAVRNSGALTVVEGIGDNGCEYMTGGIVCVLGRTGINFGAGMTGGFAYVLDEDGEF
FT                   RQRVNAELVEVLEMAELPIHEEHLRGLITEHVRLTGSGRAEAILADWSQWAARFILVKP
FT                   KSSDVKALLGHRSRSAAELRVQAQ"
FT   gene            594948..595853
FT                   /locus_tag="NT01EI_0606"
FT   CDS_pept        594948..595853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0606"
FT                   /product="radical SAM protein, TIGR01212 family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67835"
FT                   /db_xref="GOA:C5B761"
FT                   /db_xref="InterPro:IPR005911"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR032432"
FT                   /db_xref="InterPro:IPR039661"
FT                   /db_xref="UniProtKB/TrEMBL:C5B761"
FT                   /protein_id="ACR67835.1"
FT                   /translation="MQLQQLVNMFGADLQRRYGEKIHKLTLHGGFSCPNRDGTLGRGGC
FT                   TFCNVASFADEQMQRRSIAEQLEAQARKVNRARRYLAYFQAYTSTYAEVCILRDMYREA
FT                   LQQADMVGLCVGTRPDCVPESVLDLLAEYREQGYEVWLELGLQSASEKTLRRINRGHDF
FT                   ACYQRTTRAARARGLKVCSHLIVGLPGETQADCLSTLQRVVETGVEGIKLHPLHIVTGS
FT                   VLAKAWQAGRLQGLTLDRYVHTAGEMIRHTPPEVIYHRISASARRPTLLAPQWCENRWT
FT                   GMVAINNYLLEYGGQASALS"
FT   gene            596042..598378
FT                   /locus_tag="NT01EI_0607"
FT   CDS_pept        596042..598378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0607"
FT                   /product="aerobic respiration control sensor protein ArcB,
FT                   putative"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67836"
FT                   /db_xref="GOA:C5B762"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR014409"
FT                   /db_xref="InterPro:IPR027460"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR040642"
FT                   /db_xref="UniProtKB/TrEMBL:C5B762"
FT                   /protein_id="ACR67836.1"
FT                   /translation="MKQIRVLAQYYVDLMVKLGLVRFSILLASALVLLAMVVQMAVTML
FT                   LRGQVDSIDVVRSVFFGLLITPWAVYFLSVVVEQLEESRQRLSKLVNKLEEMRHRDLKL
FT                   NQQLKDNIRQLNQEIADRVKAEEARLQVLDTLQHEIDQRELAQVELEQQSALLRSFLDS
FT                   SPDLVYYRNENGEFSGCNRAMELLTGKSEKQLIGLTPRDVYDQDIAQKVIETDEKVFRH
FT                   NVSLTYEQWLVYPDGRKACFELRKVPFYDRVGKRHGLMGFGRDITERKRYQDALENASR
FT                   DKTTFISTISHELRTPLNGIVGLSRILLDTELNEEQLKYLKTIHVSAIALGNIFNDIIE
FT                   MDKLERRKVQLDNQTIDFTGFLTDLENLSGLLVQPKGLSFTLAPDPALPHKVMVDGTRL
FT                   RQILWNLIGNAVKFTQRGGVSVRVWREQQDKLLFEVRDTGIGIPPEEQDKIFAMYYQVK
FT                   DMHGGKPATGTGIGLAVSKRLAQTMGGDIVVSSVAGEGACFTLSICAPVVEETLSEPLA
FT                   EEEMPLPALHVLLVEDIELNVIVARSVLEKMGNSVDVAMSGTEALAMFAPQEYDLVLLD
FT                   IQLPDMTGLDIARTLCRRYGKTALPPLVALTANVLKDKKEYLDAGMDDVLSKPLAVPAL
FT                   TAVIHRFWDSTPLTVLEDGEPHAHDLCELLDTEMLQQYLDLVGPQLIEQSLAVFERMMP
FT                   GYLSVLESNMTARDQKGITEEGHKIKGAAGSVGLRHLQQLAQQIQTPTLPAWWDNVQEW
FT                   IDELKQEWRHDVQILRDWVVQTNKK"
FT   gene            598755..599408
FT                   /locus_tag="NT01EI_0609"
FT   CDS_pept        598755..599408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0609"
FT                   /product="DJ-1/PfpI family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67837"
FT                   /db_xref="GOA:C5B763"
FT                   /db_xref="InterPro:IPR026041"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C5B763"
FT                   /protein_id="ACR67837.1"
FT                   /translation="MKRVGVVLSGCGVFDGSEIHEAVLTLLALSRIGAQAVCLAPDREQ
FT                   MQVIDHLHREPVAERRNVLVEAARIARGDVTSLAQADASQLDALIVPGGFGAAKNLSSF
FT                   ATDGAECSIDPALQRLVTSLHRDGKPLGFMCIAPALLPRLLGVPVRVTIGNDAATAAAI
FT                   EAMGGEHVACVVNDIVVDEVQRVVTTPAYMLANTIAEAAEGIDKLVTQVLDMTR"
FT   gene            599405..600139
FT                   /locus_tag="NT01EI_0610"
FT   CDS_pept        599405..600139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0610"
FT                   /product="monofunctional biosynthetic peptidoglycan
FT                   transglycosylase, putative"
FT                   /EC_number="2.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67838"
FT                   /db_xref="GOA:C5B764"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR011812"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:C5B764"
FT                   /protein_id="ACR67838.1"
FT                   /translation="MSQTAASRRVFQHLWCWGRRLVFALLGAWIAALLIFAVLPVPYSS
FT                   VMVQRQIGAWLHGDFSYIAYQTWRPMSQIAPQMALAAIAAEDQSFPQHWGFDLTAIGQA
FT                   LDSADEEGSPLRGASTLSQQTMKNLLLWDGRSWLRKGLEAPLTLAEELVWSKRRILTVY
FT                   LNIAEFGPGVFGVEEAAQRYFHKSARRLTAGEAALLAAVLPNPHRFSVRAPSRYVLQRQ
FT                   RWILRQMHQLGGEAFLQRYDLH"
FT   gene            complement(600189..600773)
FT                   /locus_tag="NT01EI_0611"
FT   CDS_pept        complement(600189..600773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0611"
FT                   /product="Putative phospholipid-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67839"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:C5B765"
FT                   /protein_id="ACR67839.1"
FT                   /translation="MRFSLTRCFPALVVLSALLLQGCVAAVIGSATVATQAASDPRSVG
FT                   TQVDDGTLEARISNALSKDAQLKKEARVVVTAYQGQVLLTGQAPSQALISRAKQIAMGV
FT                   EGTKAVYNEVRLGQPVSLGTASADAWITTKVRSQLLASDQVKSTNVKVTTENSEVFLLG
FT                   LVTPKEGQAAAQTASKVSGVKHVTTAFTLLK"
FT   gene            complement(600790..601380)
FT                   /locus_tag="NT01EI_0612"
FT   CDS_pept        complement(600790..601380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0612"
FT                   /product="phosphoheptose isomerase, putative"
FT                   /EC_number="5.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67840"
FT                   /db_xref="GOA:C5B766"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR023070"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5B766"
FT                   /protein_id="ACR67840.1"
FT                   /translation="MLERIKGCFTESIQTQIAAAEALPDAISRAALTLVQSLLNGNKIL
FT                   CCGNGASGANAQHFAATLINRFETERPSLPAIALNADSVVLTAIGNDRLHDEIYAKQVR
FT                   ALGHAGDVLLAISTRGNSRDIVKAVEAAVTRDMTIVALTGYDGGELAGLLGQQDVEIRI
FT                   PSHHSTRIQEMHMLTVNCLCDLIDNTLFPHQAD"
FT   gene            complement(601427..601813)
FT                   /locus_tag="NT01EI_0613"
FT   CDS_pept        complement(601427..601813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0613"
FT                   /product="conserved hypothetical protein TIGR00252"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67841"
FT                   /db_xref="GOA:C5B767"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:C5B767"
FT                   /protein_id="ACR67841.1"
FT                   /translation="MAAVPERQHRSGSVTAHQIGAYHEQRARRYLERAGLRFYAANVRL
FT                   RGGEIDLIMRDGATWVFVEVRYRKTACYGDAAASIDSRKRQRLQRCAAHWLAVRNQSIE
FT                   TADCRFDVLAITGSQLQWLPNAFV"
FT   gene            complement(601771..603819)
FT                   /locus_tag="NT01EI_0614"
FT   CDS_pept        complement(601771..603819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0614"
FT                   /product="LppC putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67842"
FT                   /db_xref="GOA:C5B768"
FT                   /db_xref="InterPro:IPR007443"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5B768"
FT                   /protein_id="ACR67842.2"
FT                   /translation="MLSSITVRTKSGRLIPLVLAATLLAACSGRISTTPPAPVQSEATA
FT                   SADYYLQQMQQSSDDSKADWQLLAIRALLREGKLPQADDLLGQLPSQLTEAQQLEQRLV
FT                   SAELEIARHAPQQAQAILSKLDISLLSQAQQLRYYQAVIAAVQGKTTLAQIRAYIALQP
FT                   LLTQENQRKSNIDATWTALNTLTPADLNSMVINANEDILRGWLDLLRLYQDNRQDPALL
FT                   KAAIKEWQTRYPNNPAATMLPSALDNILHLQSDSTASIALLLPLNGQAKVFSDAIEAGF
FT                   NAAKNGAFNQNSAAVTTDGTPTAQVDAPAQPDVNAAGAVSTSTQSADATASVLPADSAA
FT                   LPPLDAAGDPIAPSVSPGNPDAHIQVYDTSSQPLPELLSQAQQAGVSLVIGPLLKNNVD
FT                   QLNTISTPLNILALNQPEQVQNHPNICYFALSPEDEARDAARHIWAQGKRTPLLLIPRN
FT                   PLGDRVAKAFATEWQSLGGGSVLRQTFGSSAELRSTINSGTGIRLTGQPVSITPAQPTS
FT                   VTIAGLTIPAPVQPPVASGGGVDAVYIIATPAEITLIKPMIDLANGTHNGISLYASSRS
FT                   YQAGAGPDFRLEMEGVQFSDIPLLAGSDPAILQQAPAQYRNDYSLMRLYAMGADAWTLA
FT                   NHFAQLRQIPGFQVQGATGTLSASDNCVIQRKLPWLQYQKGSIVPVL"
FT   gene            603880..604749
FT                   /locus_tag="NT01EI_0615"
FT   CDS_pept        603880..604749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0615"
FT                   /product="conserved hypothetical protein TIGR00096"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67843"
FT                   /db_xref="GOA:C5B769"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C5B769"
FT                   /protein_id="ACR67843.1"
FT                   /translation="MNQNDHAAISAATLYVVPTPIGNLGDITQRALETLKAVDLIAAED
FT                   TRHTGMLLQHFAINARFFALHDHNEQQKADQLLAKLREGQSIALVSDAGTPLINDPGYH
FT                   LVRRCREAGIRVVPLPGACAAITALSAAGVASDRFCYEGFLPAKGKARRDRLRGLQQEA
FT                   RTLIFYESTHRLLESLADMVSELGTDRYVVLARELTKTWESIHGAPVAELLAWVQQDEN
FT                   RRKGEMVLIVEGYQADEEVLSPEALRTLALLQAELPLKKAAALAAEIHGVKKNALYKYA
FT                   LAQQSGDK"
FT   gene            complement(605188..605868)
FT                   /locus_tag="NT01EI_0617"
FT   CDS_pept        complement(605188..605868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0617"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67844"
FT                   /db_xref="GOA:C5B770"
FT                   /db_xref="InterPro:IPR019305"
FT                   /db_xref="UniProtKB/TrEMBL:C5B770"
FT                   /protein_id="ACR67844.1"
FT                   /translation="MVKATLRFRLHRTAIVLICLALLVTLMQGASYFSLSHQRARLDQV
FT                   GELAQTLAQQVAARLSPLINDDTPDTKKIAPILDALTRHSRILDVSVYALDGALIAQAG
FT                   ERVEVRDRLALDGQRAGSYFNHQIVQPIEGRDGPLGFLRLTLDTHVLATESQQVDNTTN
FT                   LLRLMMLLALAIGIILARTLLQTRRSRWQQSSYLLTANVPLEEENERDASVQENTAPTT
FT                   PPKS"
FT   gene            605976..606953
FT                   /locus_tag="NT01EI_0618"
FT   CDS_pept        605976..606953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0618"
FT                   /product="phosphoserine phosphatase, putative"
FT                   /EC_number="3.1.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67845"
FT                   /db_xref="GOA:C5B771"
FT                   /db_xref="InterPro:IPR023190"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041449"
FT                   /db_xref="UniProtKB/TrEMBL:C5B771"
FT                   /protein_id="ACR67845.1"
FT                   /translation="MPNSLTFCDLPAEIYRWPGLPLSLSGDEVMPLDYRAGHTGWLLYG
FT                   RHLDKSALQAFQRRLAAPLVVVAAWCIEDYQVVRLAGGMPARAARFANEQGIDTAVLGH
FT                   LPHLRSPGLLVMDMDSTAITIECIDEIARLAGVGGEVAAVTERAMRGELDFAASLRQRV
FT                   AALEGTDAALLQQVRDSLPLMPGLTSLVRKLQAFDWHVAIASGGFTYFADHLRARLNLS
FT                   AAVANALEVHNGRLTGRVTGRIVDAQCKEDTLCELAQRLNIPLAQTVAIGDGANDLKMI
FT                   QRAGLGIAFHAKPCVYDRAPLAIRHADLIGVLCVLSATLKHEER"
FT   gene            607008..608396
FT                   /locus_tag="NT01EI_0619"
FT   CDS_pept        607008..608396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0619"
FT                   /product="DNA repair protein RadA, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67846"
FT                   /db_xref="GOA:C5B772"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:C5B772"
FT                   /protein_id="ACR67846.1"
FT                   /translation="MAKAVKRAFVCNECGADYPRWQGQCSACQAWNSISEVRLAAAPAA
FT                   GRSARLSGYAGDAGSLSKVQKLSEISLEALPRFSTGFTEFDRVLGGGVVPGSAILIGGN
FT                   PGAGKSTLLLQTLCRLSQQMKTLYVTGEESLQQVAMRAHRLGLPTEGLNMLSETSIEQI
FT                   CLIAEQEQPKLMVIDSIQVMHMADIQSSPGSVAQVRETAAYLTRFAKTRGVAIVMVGHV
FT                   TKDGSLAGPKVLEHCIDCSVLLDGDADSRFRTLRSHKNRFGAVNELGVFAMTEQGLREV
FT                   SNPSAIFLSRGEEITAGSSVMVVWEGTRPLLVEIQALVDTSMMSNPRRVAVGLEQNRLA
FT                   ILLAVLHRHGGLQMADQDVFVNVVGGVKVSETSADLALLMSLVSSLRDRPLPQDLVIFG
FT                   EVGLAGEVRPVASGQERIIEAAKHGFRRAIVPYANVPKKAIPNMTVYGVKKLSDALDIL
FT                   QDLA"
FT   gene            complement(608459..610126)
FT                   /locus_tag="NT01EI_0620"
FT   CDS_pept        complement(608459..610126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0620"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67847"
FT                   /db_xref="GOA:C5B773"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022374"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:C5B773"
FT                   /protein_id="ACR67847.1"
FT                   /translation="MAQYVYTMNRVGKIVPPKRHILKDISLSFFPGAKIGVLGLNGAGK
FT                   STLLRIMAGVDTDIEGEARPQPGIKIGYLPQEPKLNLEQTVREAVEEAVGEVKQALTRL
FT                   DEVYALYADPDADFDKLAKEQGELEAIIQSHDGHNLDNQLERAADALRLPAWDAKIANL
FT                   SGGERRRVAICRLLLEKPDMLLLDEPTNHLDAESVAWLERFLHDYEGTVVAITHDRYFL
FT                   DNVAGWILELDRGEGIPWEGNYSSWLEQKDQRLAQEASAEAARRKSIEKELEWVRQGAK
FT                   GRQSKGKARLARFEELNNTDYQKRNETSELFIPPGPRLGDKVLEVSNLSKSYGDRLLID
FT                   ALSFSIPKGAIVGIIGPNGAGKSTLFRMISGQEQPDSGSITLGDTVTLASVDQFRDAMD
FT                   DKKSVWEEVSGGQDIMRIGNFEIASRAYVGRFNFKGTDQGKRVGELSGGERGRLHLAKL
FT                   LQVGGNMLLLDEPTNDLDVETLRALENALLEFPGCAMVISHDRWFLDRIATHILDYQDE
FT                   GRVEFFEGNFSEYEEYKKRTQGAEALQPHRIKYKKIAK"
FT   gene            610507..612435
FT                   /locus_tag="NT01EI_0621"
FT   CDS_pept        610507..612435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0621"
FT                   /product="transglycosylase SLT domain protein"
FT                   /EC_number="3.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67848"
FT                   /db_xref="GOA:C5B774"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR008939"
FT                   /db_xref="InterPro:IPR012289"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR023800"
FT                   /db_xref="InterPro:IPR037061"
FT                   /db_xref="UniProtKB/TrEMBL:C5B774"
FT                   /protein_id="ACR67848.1"
FT                   /translation="MVMVGKWRYWSVGLCLALSAAAASADSLDAQRARYQQIKQAWDAN
FT                   RMDSVNQLMPTLRDYPLYPYLAYRALTQDMSQVNAQQIKAFLQQYPTLPPARSLTSRYV
FT                   NELARREDWIGLLVFSPQLPQPVAARCNYYYAQYATGHAEVAWRGAQTVWMSGQSLPSS
FT                   CDKLFDAWRGAGGLRDQAVLARLRLALEKGNAGLVKYLQQQLPENYRTLNTALTALQAN
FT                   PRSVEAFARSVAPSDFTRDIVGGAFASLARQDADAARAMLPTLVRLQHIPPDKRQEMEE
FT                   IIAWRLMGSDASADDRRWRDGVIRRSHNAALLERRLRMALGEGNQVQVREWLGRLPKSV
FT                   HDKDEWRYWHAVALIDEGKRSEGQAILRALIKQRGFYPMVAAQRLGIPYPLQVMRAARP
FT                   DAALTQEPAIARVRELMYWNMDNTARSEWRALVASKPRPQQEALARYALEQGWADLSVQ
FT                   ATIVAKLWDHLQERFPLAWPQEFRSATEDKGITQSYAMAIARQESAWNPGARSSVGASG
FT                   LMQLMPKTAEHTAKMFSLSHYQNSSQLFDPKTNIDIGTRYLEYVYQSLGRNRILASAAY
FT                   NAGPSRVNSWLGNSAGQIDAVAFIESIPFSETRGYVKNVLAYDAYYRYFMHRPEQILTD
FT                   AEWARRY"
FT   gene            612524..612856
FT                   /locus_tag="NT01EI_0623"
FT   CDS_pept        612524..612856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0623"
FT                   /product="trp operon repressor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67850"
FT                   /db_xref="GOA:C5B775"
FT                   /db_xref="InterPro:IPR000831"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013335"
FT                   /db_xref="InterPro:IPR038116"
FT                   /db_xref="UniProtKB/TrEMBL:C5B775"
FT                   /protein_id="ACR67850.1"
FT                   /translation="MQKTTPTPDQVSAEPDDWQRFIQLLQQAYQEGRQEPMLQLFLTPD
FT                   ERDALATRVRIIEELLKGEMSQRELKSQLGAGIATITRGSNSLKMASPDFKQWLVRQLL
FT                   PATPQA"
FT   gene            complement(612847..613383)
FT                   /locus_tag="NT01EI_0622"
FT   CDS_pept        complement(612847..613383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0622"
FT                   /product="hypothetical protein"
FT                   /note="Protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67849"
FT                   /db_xref="GOA:C5B776"
FT                   /db_xref="InterPro:IPR002786"
FT                   /db_xref="InterPro:IPR026533"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:C5B776"
FT                   /protein_id="ACR67849.1"
FT                   /translation="MYHVVAATTNPAKIQAITLAFDATFGAGQYRIEGIDVDSGVPEQP
FT                   LGSIQTRSGARHRVICARQLRPEADFWVGIEAGIEDNMTFAWMSVENRCHRGESRSASL
FT                   TLPDRVMDGIRQGQTLGYEMRRLSGIDDINRREGAIGIFTQGRLSRTSVYYQALLLALA
FT                   ALEPGYHHKPPPHYA"
FT   gene            613552..614199
FT                   /locus_tag="NT01EI_0625"
FT   CDS_pept        613552..614199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0625"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /EC_number="5.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67852"
FT                   /db_xref="GOA:C5B777"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:C5B777"
FT                   /protein_id="ACR67852.1"
FT                   /translation="MRQVYLIRHGETEWNVQRRIQGQSNSPLTVMGERQARQVGTRLGQ
FT                   MGITHVIASDLGRAQQTGEVIAASCRCPLTLDVRLRELSMGVLESRLLASLTLQEEQWR
FT                   LSMLDGSPQGCIPQGETMTQLAERMQQALNDCLTLPQGSRPVLVSHGIALGCLLSTILG
FT                   LPPYAERRLRLRNCSLSRVDYQQSAWLASGWVVETAGDVQHLAQPSMDEVLR"
FT   gene            complement(614196..615086)
FT                   /locus_tag="NT01EI_0624"
FT   CDS_pept        complement(614196..615086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0624"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67851"
FT                   /db_xref="GOA:C5B778"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:C5B778"
FT                   /protein_id="ACR67851.1"
FT                   /translation="MDQADIIHDLLNWLEGHLDHPLTLDNVAAKAGYSKWHLQRMFKDV
FT                   TGQAIGAYIRARRLSNAAAALRLTSRPILDIALQYRFDSQQTFTRAFKKQFNKTPALYR
FT                   RAEEWHAYGIRPPIRLGDYTIPTPEFITLPSLSLVGVTQSYTCTLEQICRVRTELRTQF
FT                   WRDFLHTVQDIRDIPPVLYGLHHSHPNPDKDDEQSIMYTTALEPHLLPRQLTREVQSIE
FT                   LAGGEYAKFSYQGPTGHFQEFIMSLYNSALPALNLTRRRGHDVERFYPLEDSTQRPPKN
FT                   LSCEYLIPIRHMPSP"
FT   gene            615280..615768
FT                   /locus_tag="NT01EI_0626"
FT   CDS_pept        615280..615768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0626"
FT                   /product="CreA protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67853"
FT                   /db_xref="InterPro:IPR010292"
FT                   /db_xref="UniProtKB/TrEMBL:C5B779"
FT                   /protein_id="ACR67853.1"
FT                   /translation="MNKYFVGLCVALTTLLGSSVHAEEIGSVDTVFKLLGPDHKIVVEA
FT                   FDDPDVENVTCYVSRAKTGGIKGGLGLAEDTSDAAISCQQVGPIALSEKIRNKKADGEV
FT                   VFRKRTSLIFKKLQVVRFYDSKRNVLIYLSYSDRVVEGSPKNAISAVPVMPWSAAPQG"
FT   gene            complement(615837..617555)
FT                   /locus_tag="NT01EI_0627"
FT   CDS_pept        complement(615837..617555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0627"
FT                   /product="prolyl-tRNA synthetase, putative"
FT                   /EC_number="6.1.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67854"
FT                   /db_xref="GOA:C5B780"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5B780"
FT                   /protein_id="ACR67854.1"
FT                   /translation="MRTSQYLLSTLKETPADAEVISHQLMLRAGMIRKLASGLYTWLPT
FT                   GLRVLNKVENIVREEMNYAGAIEVSMPVVQPADLWQESGRWEQYGPELLRFVDRGDRPF
FT                   VLGPTHEEVITDLVRNEISSYKQLPLNFYQIQTKFRDEVRPRFGVMRSREFLMKDAYSF
FT                   HTTQESLQETYEAMYAAYSRIFSRMGLDFRAVQADTGSIGGNASHEFQVLAQSGEDDIV
FT                   FSTASDYAANIELAEALAPATGRAAANQPMQLVNTPDARTIAELVEQHGLPIEKTVKTL
FT                   LVHASEESGHALVALLVRGDHELNEVKAEKLALVASPLTFANEAEIRALVNAGPGSLGP
FT                   VNLPLPIVADRAVAAMSDFGAGANIDGKHYFGINWERDAALPQIADIRNVIEGDPSPDG
FT                   KGTLLIKRGIEVGHIFQLGTKYTEALNATVQGEDGRNQLMTMGCYGIGVTRVVAAAIEQ
FT                   NHDERGIIWPDAIAPFQVAILPMNMHKSFRVKEVAERLYDGLRAKGIEVLLDDRKERPG
FT                   VMFADMELIGIPHTIVIGDRNLDNNEIEYKYRRSGDKLMISVDEIEAFLQAQIAR"
FT   gene            complement(617674..618378)
FT                   /locus_tag="NT01EI_0628"
FT   CDS_pept        complement(617674..618378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0628"
FT                   /product="conserved hypothetical protein TIGR00104"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67855"
FT                   /db_xref="InterPro:IPR023368"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="InterPro:IPR041369"
FT                   /db_xref="UniProtKB/TrEMBL:C5B781"
FT                   /protein_id="ACR67855.1"
FT                   /translation="MTQLQFEPIGVIRSPYKEKFAIPRQPGLICDGGGTLDLLPPYNQP
FT                   EAVRGLEGFSHLWVIFVFHQTMDGGWRPTVRPPRLGGNARVGVFATRSTFRPNPIGMSL
FT                   VELHGIETRNGVRLQLGSLDLVDGTPVLDIKPYLPFAESQPQARAGFAQQAPPANMPVL
FT                   FSPGAQAQIAQRQQDYPHLTRFIRQILAQDPRPAYRRVEEENRVYAVHLLDFNLRWQVK
FT                   NDVCEVLGLDPR"
FT   gene            complement(618375..618797)
FT                   /locus_tag="NT01EI_0629"
FT   CDS_pept        complement(618375..618797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0629"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67856"
FT                   /db_xref="GOA:C5B782"
FT                   /db_xref="InterPro:IPR030852"
FT                   /db_xref="UniProtKB/TrEMBL:C5B782"
FT                   /protein_id="ACR67856.1"
FT                   /translation="MRALPLCLLTASLALSGCSLLSRQATLIKPLAADKTPETVAKPRA
FT                   VTPRQTPITLYESAEDLIGKPFRDLGEVSGSVCQTRTHHRAPSLTTARKRMLYKAAQLK
FT                   ANAVLLHSCQILSQSNGCYRQAICTGSALSIAMSAQ"
FT   gene            complement(618908..619723)
FT                   /locus_tag="NT01EI_0630"
FT   CDS_pept        complement(618908..619723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0630"
FT                   /product="D-methionine-binding lipoprotein MetQ, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67857"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:C5B783"
FT                   /protein_id="ACR67857.1"
FT                   /translation="MSTKFKSLALVGTLLGTLALAGCGQEEKDPNHIKIGVIVGAEQQV
FT                   AEVAQKVAKDKYGLNVELVTFNDYVLPNEALNKGDIDANAFQHKPYLDQQIKDRGYKLV
FT                   AVGNTFVYPIAGYSKKIKSLNELQDGAQIAIPNDPTNLGRSLLLLQSVGLIKLKDGIGL
FT                   LPTVLDITENPKHLKLVELEAPQLPRSLDDNQIALAVINTTYASQIGLTPAKDGIFVEG
FT                   KDSPYVNLIVAREDNKDAENVKKFVQAYQSDEVYNAANKIFNGGAVKGW"
FT   gene            complement(619786..620439)
FT                   /locus_tag="NT01EI_0631"
FT   CDS_pept        complement(619786..620439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0631"
FT                   /product="D-methionine transport system permease protein
FT                   MetI, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67858"
FT                   /db_xref="GOA:C5B784"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5B784"
FT                   /protein_id="ACR67858.2"
FT                   /translation="MSEAMMWLMVRGIWETVVMTLVSGFFGFVIGLPIGVLLYTSRPGQ
FT                   ILENAQLYKLLSALVNIFRSIPFIILLVWMIPFTRLIVGTSIGLQAALVPLTIGAAPFI
FT                   ARMVENSLLEIPSGLIEAARAMGATPMQIINKILLPEALPGLINAATITLITLVGYSAM
FT                   GGAVGAGGLGQIGYQYGYIGYNATVMNTVLVLLVVLVYLIQFSGDRIVKAISRK"
FT   gene            complement(620432..621394)
FT                   /locus_tag="NT01EI_0632"
FT   CDS_pept        complement(620432..621394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0632"
FT                   /product="D-methionine ABC transporter, ATP-binding
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67859"
FT                   /db_xref="GOA:C5B785"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012692"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/TrEMBL:C5B785"
FT                   /protein_id="ACR67859.1"
FT                   /translation="MSLHVPAGQIYGVIGSSGAGKSTLIRCVNLLERPTQGQVFVDGQD
FT                   LTAMSAGQLTRTRRQIGMIFQHFNLLSSRTVYGNIALPLELDRVPRDEITRRVTELLAL
FT                   VGLADKRDAYPANLSGGQKQRVAIARALASNPKVLLCDEATSALDPATTRAILELLKDI
FT                   NRRLGLTILLITHEMDVVKRICDQVAVISQGKLIEQGSVGEVFSHPKTPLAQQFIHATL
FT                   HLDIPDDFAARMTPTRGADSQPLLRLEFTGQSVDAPLISQAVRRFNVDINILSSQMDYA
FT                   GGVKFGVMLAEVHGDDTDAQAAIAFFEQHHVKVEVLGYV"
FT   gene            621651..622214
FT                   /locus_tag="NT01EI_0633"
FT   CDS_pept        621651..622214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0633"
FT                   /product="D,D-heptose 1,7-bisphosphate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67860"
FT                   /db_xref="GOA:C5B786"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C5B786"
FT                   /protein_id="ACR67860.1"
FT                   /translation="MAQQIPAIFLDRDGTMNVDHGYVHDSDDFQFIDGVIDAMRELKAM
FT                   GFALVMVTNQSGIARGMFTEDQFMHLTEWMDWSLADRGVDLDGIYYCPHHPQGTVPEYT
FT                   QACDCRKPQPGMLLEAQRFLHIDMAASYMVGDKLEDLQAAQTAGVGTKVLVRSGKPLSA
FT                   EGEALADIVLDSLAQLPQAIKVRC"
FT   gene            622606..624137
FT                   /locus_tag="NT01EI_R00011"
FT   rRNA            622606..624137
FT                   /locus_tag="NT01EI_R00011"
FT                   /product="16S ribosomal RNA"
FT   gene            624215..624291
FT                   /locus_tag="NT01EI_T00022"
FT   tRNA            624215..624291
FT                   /locus_tag="NT01EI_T00022"
FT                   /product="tRNA-Ile"
FT                   /note="putative tRNA-Ile"
FT   gene            624345..624422
FT                   /locus_tag="NT01EI_T00023"
FT   tRNA            624345..624422
FT                   /locus_tag="NT01EI_T00023"
FT                   /product="tRNA-Ala"
FT                   /note="putative tRNA-Ala"
FT   gene            624586..627575
FT                   /locus_tag="NT01EI_R00020"
FT   rRNA            624586..627575
FT                   /locus_tag="NT01EI_R00020"
FT                   /product="23S ribosomal RNA"
FT   gene            627667..627781
FT                   /locus_tag="NT01EI_R0002"
FT   rRNA            627667..627781
FT                   /locus_tag="NT01EI_R0002"
FT                   /product="5S ribosomal RNA"
FT   gene            627980..628168
FT                   /locus_tag="NT01EI_0639"
FT   CDS_pept        627980..628168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0639"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67862"
FT                   /db_xref="GOA:C5B788"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:C5B788"
FT                   /protein_id="ACR67862.1"
FT                   /translation="MLHTTNPIIKYKAGLLNLAEELSNVSKACKIMGVSRDTFYRYREL
FT                   ADEGGVDALINHSRACT"
FT   gene            628227..629435
FT                   /locus_tag="NT01EI_0640"
FT   CDS_pept        628227..629435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0640"
FT                   /product="transposase, Mutator family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67863"
FT                   /db_xref="GOA:C5B789"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:C5B789"
FT                   /protein_id="ACR67863.2"
FT                   /translation="MNEKQLQALANELAKNLKTPDDLSQFDRLLKKISVEAALNAEMSH
FT                   HLGYDKNQPKPGANSRNGYSTKTVTTGDGPLELRTPRDRDGSFEPQLVKKNQTRITGMD
FT                   NQILSLYAKGMTTREIAAAFKELYDADVSPALVSKVTDAVMEQVTEWQNRPLDAVYPIV
FT                   YLDCIVLKVRQDSRVINKSVFLALGINLEGQKELLGMWLAENEGAKFWLNVLTELKNRG
FT                   LNDILIACVDGLKGFPDAINTVYPEARIQLCIVHMVRNSLRFVSWKDYKAVTRDLKAIY
FT                   QAPTEDAGQHALEAFASAWDNRYPQISRSWQTNWANLATFFAYPADIRKVIYTTNAIES
FT                   LNSVIRHAIKKRKVFPTDEAVKKVVWLAIQAASQKWTMPLRDWRMAMSRFIIEFGDRLD
FT                   GHF"
FT   gene            complement(629579..630895)
FT                   /locus_tag="NT01EI_0641"
FT   CDS_pept        complement(629579..630895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0641"
FT                   /product="Pentapeptide repeat family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67864"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:C5B790"
FT                   /protein_id="ACR67864.1"
FT                   /translation="MLPLPHSGLFSRNLSRNDISLVKNATDIGHIGSRFNRIVNKVLDW
FT                   CCNTKKTEAMEQLFIVMNQDHNQSNKARCEAFDQLQELVGSAHSDRFTKKYDVVDNCIK
FT                   FNIDIDGEENFITLTKDDFFEGLNLSGADLTDISLQNGKLGYVDLSGAKLDHANLTGAQ
FT                   LSFANLSGATLDHADLTGAQLSFAKLSGASLNNATLNQADMDNADLSNATLNQAVLKNV
FT                   NLSSAILRQAKLNDADLTGADLSEAIMIEVEAVRMCAKGANLSQTDLEGAKLSKATLAG
FT                   ATMDETNLEAADMTSADLSRAALTNVNLNRTKLNEANLSGATLQSIVVDNIGSGVDLSG
FT                   AKLTYASINDSTFHKSDFTDADLTGSGIPQCQFRDCELSHCNMTGAELSNVDFIHKEIS
FT                   SVGEKEFASDVYGMRLDSVKCYKVYHYNSDNKPTIINGY"
FT   gene            631193..631321
FT                   /locus_tag="NT01EI_0642"
FT   CDS_pept        631193..631321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0642"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67865"
FT                   /db_xref="UniProtKB/TrEMBL:C5B791"
FT                   /protein_id="ACR67865.1"
FT                   /translation="MFYRDAPSQPIEGIIQKLSFEGRHLFDSLNKSAVKRSAAVVF"
FT   gene            complement(631432..631614)
FT                   /locus_tag="NT01EI_0643"
FT   CDS_pept        complement(631432..631614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0643"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67866"
FT                   /db_xref="UniProtKB/TrEMBL:C5B792"
FT                   /protein_id="ACR67866.1"
FT                   /translation="MNARHRYVSYELRKEIAAGETSAQVKSALHGHILDKFNCIDVQIM
FT                   PPHFVMQPKEAVQVH"
FT   gene            complement(631583..631819)
FT                   /locus_tag="NT01EI_0644"
FT   CDS_pept        complement(631583..631819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0644"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67867"
FT                   /db_xref="UniProtKB/TrEMBL:C5B793"
FT                   /protein_id="ACR67867.1"
FT                   /translation="MIPRVPNALLASSNIVNPSTHTAPSGIIINTGVTISYDMPWRQVH
FT                   AMLLLALPQTKMRQNGVAPVIRQNECKTQVCQL"
FT   gene            complement(631884..632243)
FT                   /locus_tag="NT01EI_0645"
FT   CDS_pept        complement(631884..632243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0645"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67868"
FT                   /db_xref="GOA:C5B794"
FT                   /db_xref="UniProtKB/TrEMBL:C5B794"
FT                   /protein_id="ACR67868.1"
FT                   /translation="MQDLIAASPDLLSPTSIALLIQRPLRLLFRQVESGRLRLPGFYPD
FT                   TIKTTRRQLSVIIWMFALSMPYPFFPCANTRVFKSVSVFLGLMITQDSAGLVSLAMSGL
FT                   IQISSLVLHQGIMFA"
FT   gene            complement(632322..632441)
FT                   /locus_tag="NT01EI_0646"
FT   CDS_pept        complement(632322..632441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0646"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67869"
FT                   /db_xref="UniProtKB/TrEMBL:C5B795"
FT                   /protein_id="ACR67869.1"
FT                   /translation="MQKQIRRHADILIMQAPLSPTLATLSVAYRPIAGYTWLV"
FT   gene            complement(632711..634069)
FT                   /locus_tag="NT01EI_0647"
FT   CDS_pept        complement(632711..634069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0647"
FT                   /product="phosphatidylserine synthase protein family"
FT                   /EC_number="2.7.8.8"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67870"
FT                   /db_xref="GOA:C5B796"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR016270"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:C5B796"
FT                   /protein_id="ACR67870.1"
FT                   /translation="MMLSKFKRAKHQQHLAQLPKLPQQVGEVETLFSPAAFRQALLEAI
FT                   GQATQRIYLVALYLENDDGGRDVLNALYQAKRQRPQLEIFVLVDWHRAQRGRIGAEASN
FT                   TNADWYCRMTNEYPDVIVPIYGVPVNTREALGVLHLKGFVIDDRVIYSGASLNDVYLHR
FT                   HDKYRYDRYHFIRNPRLAAVMCQFVQSTLLGNPAVQRLDRCDRPKSPEIRNETRQFRHA
FT                   LRDSSYQVPAEAGNEELAVTPLAGLGKQNILNKTIHHLICCTERTLTLCTPYFNLPTPL
FT                   VRDIIFLLRQGKQVEIIVGDKKANDFFIPEEEPFKIIGALPYLYEINLRRFISRLQPYL
FT                   DNGQLTVRLWRDDDNTYHLKGMWVDDRWQLITGNNLNPRAWRLDLENAILIHDPQGEIQ
FT                   HQRQHELECIRRHTQVVRSYEDLETIQQYPLKVRKLIRRLRRIRVDRLISRIL"
FT   gene            complement(634201..636873)
FT                   /locus_tag="NT01EI_0648"
FT   CDS_pept        complement(634201..636873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0648"
FT                   /product="acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67871"
FT                   /db_xref="GOA:C5B797"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5B797"
FT                   /protein_id="ACR67871.1"
FT                   /translation="MSQRSLESLLRPKSIAVIGASNQPERNGHLVMLNLLNGGFPGPIM
FT                   PVTPRYQAVCGVLAYPSITDLPCVPDLAILCTNAQRTPVLIAELGAKGCRAAIVISSPA
FT                   SQADALRSLALRHGVRLLGPNSLGLLAPWQKLNASFSPVPILPGRLAFISQSAAVSNTI
FT                   LDWARQREIGFSLFVALGDSLDTDVDDLLDYLARDAKTSAILLYLEHLHDARRFLSAAR
FT                   SAARNKPILVIKSGRSPQARHVLGEAAGLDIAYDAAIQRAGLLRVQNTHELFSAVETLS
FT                   HMHPLRGERLLIVGNGAAPLAMALDELQRRGGHPASCDDVLYSTLCAVLPVETYLQGPI
FT                   DLRDDATPARYQATLQCLLDSRCYDALLIQHAPSATAPATETARALIETLSAHPRARHV
FT                   TLMTNWSGENTSQEARRLFNEAGIPTYRTPEGAVTAFMHMVEYRRNQRQLMETPALPAS
FT                   LPANTALAHRLLAQAQTDGVTRLDTHEVRDILACYGLDTLPGWIANDSTEAVHIAERIG
FT                   YPVALKLRSPDIAHNSDVQGVMLYLRNAREVEQAANAIFDRARQAYPHARILGLLVQST
FT                   ANRIGAQELRICVENDAVFGPLILLGEGGAEWDAQRDAAAALPPLNMNLARYLIVQAQK
FT                   RGQIRRRAPLADLDIAGLSQVLVQVSHLIVDCPTIQRLEIHPLLACGSTFTLLDVSLQL
FT                   LERHAAPTRLAICPYPHQLKESIRLKNGDDALLRPILPEDEPLLQQFIQRVSKEDLYYR
FT                   YFSEINEFTHEDLAKMTQIDYEREMAFVAVQSTPQGEEILGVTRALIDPDNTNAEFAVL
FT                   VRSDHHGLGLGSILLDKLIRYARQRQLRHLLGITMPTNRGMIALARKVGFQVEVLLEDG
FT                   IVNLSLSLSDNVRPSSEKC"
FT   gene            complement(636946..637626)
FT                   /locus_tag="NT01EI_0649"
FT   CDS_pept        complement(636946..637626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0649"
FT                   /product="DTW domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67872"
FT                   /db_xref="InterPro:IPR005636"
FT                   /db_xref="InterPro:IPR039262"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7J5"
FT                   /protein_id="ACR67872.1"
FT                   /translation="MSANAVLRLRAARLSQSTRPFHARGCRVQRCLLPQIHCLCDTLTS
FT                   YPAHSRFCLMMYDTEPLKPSNTGRLIADVLPETLAYSWSRTQPDPQLLQLLDDPDYQPY
FT                   VVFPGSYAEPERVVTRVRHNTHRPLFIMLDGTWPEARKMFHKSPYLDRFPVLSINMAQA
FT                   PGYLLREAHRPEQYCTAEVAAALLALADDRQASQGLLQHFHHFRQQYLLGKSHPQVPVA
FT                   ATVE"
FT   gene            complement(637728..638159)
FT                   /locus_tag="NT01EI_0650"
FT   CDS_pept        complement(637728..638159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0650"
FT                   /product="thioredoxin, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67873"
FT                   /db_xref="GOA:C5B7J6"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7J6"
FT                   /protein_id="ACR67873.1"
FT                   /translation="MNTVCPACHATNRIPDDRRNEQAKCGRCSHALFDGAIVNASEDTL
FT                   DKLLQDDLPVLIDFWAPWCGPCQGFAPVFAAVAAARAGEVRCIKVNTEDQPALSSRFRI
FT                   RNIPTIMLYRNGQRIDMLNGAMPQAPFEAWLDEQLAKQA"
FT   gene            638366..639439
FT                   /locus_tag="NT01EI_0651"
FT   CDS_pept        638366..639439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0651"
FT                   /product="RNA methyltransferase, TrmH family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67874"
FT                   /db_xref="GOA:C5B7J7"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR016479"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7J7"
FT                   /protein_id="ACR67874.1"
FT                   /translation="MSDSLNGKNGKVKVMYVRDSDAADERQSRAPAKGRPGVRGDRSRS
FT                   DRGDRSRSDRSDRGDRAARPARREKGAGERSPWRTVSLGDNDGVGGESDHGGISGKSFI
FT                   DPEQLRRQRAEETRVYGENACQALFASRPEAIVRAWFLQAVTPRFRDALRWMAANRKAY
FT                   HVVDDAELTKASGTDHHGGVCFLIKKRRSLDAQQYLANQAEDAVDCVLALENVANPHNL
FT                   GGIMRTCAHFGIRGIIAPESAALESGAAVRTAEGGAEHVQAIDAEDFSATLDTFRRAGY
FT                   TIVTTSSHKGTTQLHRAVLPAKIVLVVGHEGDGLSDGTLQQGDLSISIGGTGSVESLNV
FT                   SVATGIMLAEWWRQNAH"
FT   gene            complement(639859..639975)
FT                   /locus_tag="NT01EI_0652"
FT   CDS_pept        complement(639859..639975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0652"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67875"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7J8"
FT                   /protein_id="ACR67875.1"
FT                   /translation="MPLELACARNGYFYGLTLREDLPGHFFTMLTLSSFSGR"
FT   gene            640129..640374
FT                   /locus_tag="NT01EI_0653"
FT   CDS_pept        640129..640374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0653"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67876"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7J9"
FT                   /protein_id="ACR67876.2"
FT                   /translation="MLNIGRDRLFTLQDEHRLPVSVKREYRKTTNSYRRFYRHPNSLKP
FT                   GPGQATTLKPEQVWVADMTYLPLRSGTIYLSLVTDA"
FT   gene            640387..640731
FT                   /locus_tag="NT01EI_0654"
FT   CDS_pept        640387..640731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0654"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67877"
FT                   /db_xref="GOA:C5B7K0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7K0"
FT                   /protein_id="ACR67877.2"
FT                   /translation="MGYHVGEKLQTENVVKAFRQALRRRKTTGPPVHHSDRGVQYCSAL
FT                   YQSIHERNGVTCSMTDGYDCYQNALAERINGILKNTFLPSCPADLAQARTMVKESVDIY
FT                   NHERPHLALK"
FT   gene            complement(640819..641535)
FT                   /locus_tag="NT01EI_0655"
FT   CDS_pept        complement(640819..641535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0655"
FT                   /product="aerobic respiration control protein ArcA,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67878"
FT                   /db_xref="GOA:C5B7K1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7K1"
FT                   /protein_id="ACR67878.1"
FT                   /translation="MQTPHILIVEDELVTRNTLKSIFEAEGYIVHEANDGAEMHQILSE
FT                   FDINLVIMDINLPGKNGLLLARELREQANVALMFLTGRDNEVDKILGLEIGADDYITKP
FT                   FNPRELTIRARNLLSRTMNLGSGTEERKSVEHYRFNGWELDINSRSLVSPDGEQYKLPR
FT                   SEFRAMLHFCENPGKIQSRAELLKKMTGRELKPHDRTVDVTIRRIRKHFESTPDTPEII
FT                   ATIHGEGYRFCGDLEE"
FT   gene            complement(641963..642079)
FT                   /locus_tag="NT01EI_0656"
FT   CDS_pept        complement(641963..642079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0656"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67879"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7K2"
FT                   /protein_id="ACR67879.1"
FT                   /translation="MLNNDLIENFQQLMAKRKFHRKCCIIIIIFIRLIYNEN"
FT   gene            642185..642901
FT                   /locus_tag="NT01EI_0657"
FT   CDS_pept        642185..642901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0657"
FT                   /product="RNA methyltransferase, TrmH family, group 1"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67880"
FT                   /db_xref="GOA:C5B7K3"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004384"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7K3"
FT                   /protein_id="ACR67880.1"
FT                   /translation="MQIHIVLVAPARAENVGAAARAMKTMGFTSLRIVDSRADGESAAR
FT                   WVAHGAGDILDGACHFDTLAQALEDIDFSVASTARSRARFHYYCTPQELCAVLQEKQHW
FT                   MANCALVFGREDSGLTNDELALVDLLTGVPMAADYPSLNLGQAVMVFCYQLSSLMQVQA
FT                   ALAPAAQGDQLTALRTRADRLLTTLGVDGDTKLSDWLDQRIGLLAQRDTAMLHRLLHDI
FT                   ESALGMSVAGKKKQKE"
FT   gene            643259..645721
FT                   /locus_tag="NT01EI_0659"
FT   CDS_pept        643259..645721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0659"
FT                   /product="bifunctional aspartokinase/homoserine
FT                   dehydrogenase 1"
FT                   /EC_number="2.7.2.4"
FT                   /EC_number="1.1.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67881"
FT                   /db_xref="GOA:C5B7K4"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR011147"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041743"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7K4"
FT                   /protein_id="ACR67881.1"
FT                   /translation="MRVLKFGGTSVANAERVFCVADILESKASQGQVAVVLSAPARITN
FT                   HLVALIERTIAGQDIQPILGDAEKIFTDLIDGLAQVQPGFDAASLRLRVSQEFGQIRQV
FT                   LHGIALLGQCPDGVNAALICRGEVLSIAIMATLLQARGRQVTVIDPVSSLLARGGYLES
FT                   SVDIAESARRIAAQAIPADSLILMAGFTAGNERGELVVLGRNGSDYSAAVLAACLRAEC
FT                   CEIWTDVDGVYTCDPHLVPDARLLEAMSYQEAMELSYFGAKVLHPRTILPIAQFQIPCL
FT                   IKNTANPQAPGTLIGAQHRADDALLVKGITHLNHMAMLNVSGPGMKGMVGMAARVFAVM
FT                   SRSGISVVLITQSSSEYSISFCVPQGELGRACLALQDEFFLELKDGLLEPLDVIEHLAI
FT                   ISVVGDGMRTQRGVSANFFSALARANINIIAIAQGSSERSISVVVSNDVATTAVRVTHQ
FT                   MLFNTDQVIEVFVIGVGGVGGALLAQIERQQAWLKSKHIDLRVCGIANSRALLTHVHGI
FT                   DMTNWRGALEQATQPFNLGRLMRLVSEYHLLNPVIVDCTSSQALADQYADFLGNGFHVV
FT                   TPNKKANTASMDYYRLLRQKAAGSQRKFLYDTNVGAGLPVIENLQNLLSAGDELQRFCG
FT                   ILSGSLSFIFGRLEEGATLSQATREARQLGYTEPDPRDDLSGMDVARKLLILAREAGYA
FT                   LELGDICVEPVLPKAFDACGDVDTFLANLTQADDVFSARVVAARERGCVLRYVGEIDRG
FT                   RCAVRIAEVDSDDALYKVKNGENALTFYSRYYQPLPLVLRGYGAGNDVTAAGVFADLLR
FT                   TLSWKLGV"
FT   gene            645724..646653
FT                   /locus_tag="NT01EI_0660"
FT   CDS_pept        645724..646653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0660"
FT                   /product="homoserine kinase, putative"
FT                   /EC_number="2.7.1.39"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67882"
FT                   /db_xref="GOA:C5B7K5"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5B7K5"
FT                   /protein_id="ACR67882.1"
FT                   /translation="MVKIYAPASIGNVSIGFDVLGAAVTPLDGTLLGDCVSIAASSHFS
FT                   LHCHGRFVDSLPSTVQENIVYQCWQRFCEVTGRELAVEMVLEKNMPIGSGLGSSACSVV
FT                   AALAALNRFAGEPLDAHRLLMLMGELEGRISGSVHYDNVAPCYLGGLQLMLEAQEIISQ
FT                   PVPCFDEWLWVMAYPGIKVSTAEARAILPPHYSRGDCVRHGRHLAGFIHACHTRQPSLA
FT                   AALMQDVIAEPYRCGLLPGFADARRAAGELGALACGISGSGPTLFAVCDDLTAAQAVAQ
FT                   WLAQHYLQNEQGFVHICRLDSAGARQLG"
FT   gene            646657..647943
FT                   /locus_tag="NT01EI_0661"
FT   CDS_pept        646657..647943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0661"
FT                   /product="threonine synthase, putative"
FT                   /EC_number="4.2.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67883"
FT                   /db_xref="GOA:C5B7K6"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR029144"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR037158"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7K6"
FT                   /protein_id="ACR67883.1"
FT                   /translation="MKLYNLKDHNEQVNFAQALVQGLGRQQGLFFPHELPALARTQVDS
FT                   LLEQDFVTRSAHILAAYLGDEFPFDTLWARVQAAFDFPAPVVPVSDDIAALELFHGPTL
FT                   AFKDFGGRFMAQMLQQVAGERPVTILTATSGDTGAAVAHAFYGLKNVQVVILYPRGKVS
FT                   PLQEKLFCTLGGNIRTLAIEGDFDACQALVKQAFDDPMLCRELGLNSANSINISRLLAQ
FT                   ICYYFEAVAQLPQAARNQLVISVPSGNFGDLTAGLLAQSLGLPVKRFIAATNANDTVPR
FT                   FLSSGVWQPHETVATLSNAMDVSRPNNWPRVEELFRRREWALGALGYGALSDAQTAEAM
FT                   RELAALGYVSEPHAAIAYRALCDSLQPGEYGLFLGTAHPAKFQESVEAILQRSIPLPQA
FT                   LEARAELPLLSQTLPADFSRLRAALLERP"
FT   gene            complement(648004..648801)
FT                   /locus_tag="NT01EI_0662"
FT   CDS_pept        complement(648004..648801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0662"
FT                   /product="Protein of unknown function (DUF328)"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67884"
FT                   /db_xref="InterPro:IPR005583"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5B7K7"
FT                   /protein_id="ACR67884.1"
FT                   /translation="MLMIISPAKTLDYTSPLAIQRYTQPQMLAQAETLMQTVRTLTPAQ
FT                   LGSLMKISDKLAGLNAARFTEWQPSFTPENARQAILAFKGDVYTGLQAETFSEQDFDFA
FT                   QRHLCMLSGLYGVLRPLDLMMPYRLEMGTRLHTPYGNDLYAFWGDSITRQINQQLLQQG
FT                   DRVVVNLASDEYFKAVRPAALEGELIKPIFMDEKNGSMKVISFYAKKARGMMSRFIIQA
FT                   RLREPEQLKAFDLEGYAFAGETQGRQGRELLFTRRHSAISPAR"
FT   gene            complement(648911..649453)
FT                   /locus_tag="NT01EI_0663"
FT   CDS_pept        complement(648911..649453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0663"
FT                   /product="amino acid carrier protein family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67885"
FT                   /db_xref="GOA:C5B7K8"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7K8"
FT                   /protein_id="ACR67885.2"
FT                   /translation="MQMLGVFMDTLVICSATAAIILSSGVLDAAPGTISGIELTQRALS
FT                   SAVGDWGGIFIAVAIFFFAFTSIIANYAYAESNLIFLEHNHPHGLVFLRLCTLGMVMFG
FT                   ALAELPLVWKMADLSMALMAITNLIAILLLSGVAFKLARDYNHQRRLGLLPRLDLSKYP
FT                   EIQQQVEPGIWEKPTRP"
FT   gene            complement(649341..650351)
FT                   /locus_tag="NT01EI_0664"
FT   CDS_pept        complement(649341..650351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0664"
FT                   /product="amino acid carrier protein family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67886"
FT                   /db_xref="GOA:C5B7K9"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7K9"
FT                   /protein_id="ACR67886.1"
FT                   /translation="MTDLISFINNILWGSVLIYLLIGAGLYFTFRTGFIQFRHFGHMFS
FT                   VLKNSNKADSGGISSFQALCTSLAARVGTGNLTGVAIALTAGGPGAIFWMWIIALIGMA
FT                   TSFIESTLAQLYKTRDDQGNFRGGPAYYMEKGLGMRWMGILFSLFLLVAFGLVFNAVQA
FT                   NSIAQATAVAFHIPPLYVGIALMLMCGVVIFGGLRSIARTAELVVPVMAIAYLLLAFWV
FT                   MGHNLARMPEVLLLVLKSAFGLQEAAAGAIGYGISQAMTQGIQRGLFSNEAGMGSAPNA
FT                   AASATPYPVSAAPRLAGLCADAGGLYGYAGYLQRDCRHHPLLRRPGRGAGHHQRH"
FT   gene            650783..651736
FT                   /locus_tag="NT01EI_0665"
FT   CDS_pept        650783..651736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0665"
FT                   /product="transaldolase, putative"
FT                   /EC_number="2.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67887"
FT                   /db_xref="GOA:C5B7L0"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004730"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5B7L0"
FT                   /protein_id="ACR67887.1"
FT                   /translation="MTDKLTSLRQLTTVVADTGDIAAMKQYQPQDATTNPSLILNAAQI
FT                   PEYRKLIDDAIAWARAQSGDRAQQIVDASDKLAVNIGLEILKLIPGRISTEVDARLSYD
FT                   TEASVAKAKRLIKLYNDAGISNDRILIKLASTWQGIRAAERLEKEGINCNLTLLFSFAQ
FT                   ARACAEAGVFLISPFVGRILDWHKANGGKSEFAPAEDPGVISVTEIYNYYKQHGYETVV
FT                   MGASFRNVGEILELAGCDRLTISPPLLKELSESTGNVERKLADQGEIKARPARMSEAEF
FT                   YWQHNQDPMAVEKLADGIRKFAVDQGKLESMIGALL"
FT   gene            651857..653311
FT                   /locus_tag="NT01EI_0666"
FT   CDS_pept        651857..653311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0666"
FT                   /product="succinate-semialdehyde dehydrogenase, putative"
FT                   /EC_number="1.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67888"
FT                   /db_xref="GOA:C5B7L1"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7L1"
FT                   /protein_id="ACR67888.1"
FT                   /translation="MQLHDMGLFRQQALIDGVWCDADSGDVITVINPANGDTLGSVPKM
FT                   GAAETRRAIEAAAHALPGWRARTGKARAQILRRWFELILVHQDDLARLMTLEQGKPLAE
FT                   SRGEIAYAASFIEWFAEEAKRVYGDTIPTPQGDKRLLVIKQPIGVTAAITPWNFPAAMI
FT                   TRKAGPALAAGCTMVLKPASQTPYSALALALAELALRAGVPQGVFSVVTGSAGAVGDEL
FT                   TANPQVRKLSFTGSTEIGRQLMAQCAHDIKKVSLELGGNAPFIVFDDADLDQAVAGAMA
FT                   SKFRNAGQTCVCANRLYVQEGIYERFAEKLCSAVQALKMGNGLDEGVTVGPLIDGRARA
FT                   KVEEHIADAVARGARIACGGQADARGGNFFCPTVLLDVPADAQVAREETFGPLAPLFRF
FT                   RDEDEVIARANATEFGLASYFYTRDVGRVFRVAEALEYGIVGINSGLISNEMAPFGGVK
FT                   SSGLGREGSKYGIEDYLEIKYLCLGL"
FT   gene            complement(653334..653447)
FT                   /locus_tag="NT01EI_0667"
FT   CDS_pept        complement(653334..653447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0667"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67889"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7L2"
FT                   /protein_id="ACR67889.1"
FT                   /translation="MLWQNVSAIAAKRQNLSNGRRWENGTENGQRTLARRG"
FT   gene            653489..654145
FT                   /locus_tag="NT01EI_0668"
FT   CDS_pept        653489..654145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0668"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67890"
FT                   /db_xref="GOA:C5B7L3"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7L3"
FT                   /protein_id="ACR67890.1"
FT                   /translation="MWRKHFAAIFLDMDGALLDSNGHAEPVWEQWAHQRQIDYALLRPR
FT                   IYSQRVQEILRQLTPRYSDDAECQRLEQALLAVVRQRRSRLRQDAAAWLAMLGETPWGV
FT                   VTQAGQPRAAEQIAHSGMCQPPLVIGAEQVSCGRPDPEPYLLAASHYGLDPRDCLVIES
FT                   DEAGIRAAQAAGMTVIALSCRRPRHSLQCADVVIGGWRSIILHPQPEGIVVEVIA"
FT   gene            654142..654729
FT                   /locus_tag="NT01EI_0669"
FT   CDS_pept        654142..654729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0669"
FT                   /product="putative molybdopterin binding domain protein"
FT                   /note="Probable molybdopterin binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67891"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7L4"
FT                   /protein_id="ACR67891.1"
FT                   /translation="MNTLRIGLVSISDRASSGVYQDLGIPALETWLASALATPYTLESR
FT                   LIPDEQPLIEQTLCELVDERGCHLVLTSGGTGPARRDVTPDATLAVADREMPGFGEQMR
FT                   QVSLRFVPTAILSRQVGVIRKQALIINLPGQPKSIRETLEGLKDGDGNTVVHGIFASVP
FT                   YCIQLLDGPYVETHPAVIAAFRPKSARRETID"
FT   gene            654851..656161
FT                   /locus_tag="NT01EI_0670"
FT   CDS_pept        654851..656161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0670"
FT                   /product="transporter, major facilitator family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67892"
FT                   /db_xref="GOA:C5B7L5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7L5"
FT                   /protein_id="ACR67892.1"
FT                   /translation="MELHNQRRLNRQDYKTLALAALGGALEFYDFIIFVFFATVVGALF
FT                   FPPDMPEWLRLVQTFGIFAAGYLARPLGGIIMAHFGDRIGRKKMFSLSILLMALPTLLM
FT                   GMLPTYQSIGIVAPLLLLLMRVLQGAAIGGEVPGAWVFVAEHVPPQRIGFACGVLTSGL
FT                   TFGILLGSLVATWLNSWLTPQEVLNGGWRIPFFLGGLFGLMAMYLRRWLHETPVFLEMQ
FT                   ARRALAAELPLKSVVRDHRRAVVVSMLLTWLLSAGIVVVILMTPSLLQAQYHLPAALTL
FT                   QANSVAIITLTLGCVLAGSLVDSLGAGRLFIGWGVLLAVCTWQFFSRLSPEIEPVQLFW
FT                   RYGLAGFSVGLVGAVPFIMVCAFPAEVRFSGISFSYNLAYAIFGGLTPIVVTLLLTLTP
FT                   LAAGWYVLTLSLLGVALGFYFQRSPLRAAEGEIRLSR"
FT   gene            complement(656250..656753)
FT                   /locus_tag="NT01EI_0671"
FT   CDS_pept        complement(656250..656753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0671"
FT                   /product="GPR1/FUN34/yaaH family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67893"
FT                   /db_xref="GOA:C5B7L6"
FT                   /db_xref="InterPro:IPR000791"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7L6"
FT                   /protein_id="ACR67893.1"
FT                   /translation="MLNLHNAGLFPLTSVILAMGIFFGGIAQILAGLMEYKKGNTFGLT
FT                   AFTAYGSFWLTLAALLTLPKMGLAEATDALSLGTYLALWGIFTLFMFFGTLRGNRVLQF
FT                   VFASLTVLFFLLAYGNITANASVLHIAGIEGIICGASAIYLAMAEVINEQYGRDVLPIG
FT                   AKHA"
FT   gene            657136..659043
FT                   /locus_tag="NT01EI_0672"
FT   CDS_pept        657136..659043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0672"
FT                   /product="chaperone protein DnaK, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67894"
FT                   /db_xref="GOA:C5B7L7"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5B7L7"
FT                   /protein_id="ACR67894.1"
FT                   /translation="MGKIIGIDLGTTNSCVAVMDGGKARVLENAEGDRTTPSIIAYTQD
FT                   GEVLVGQPAKRQAVTNPQNTLFAIKRLIGRRFEDAEAQRDKDIMPYKIVAADNGDAWVE
FT                   VKDQKIAPPQISAEVLKKMKKTAEDFLGETVTEAVITVPAYFNDAQRQATKDAGRIAGL
FT                   DVKRIINEPTAAALAYGMDKGVGNRTIAVYDLGGGTFDISIIEIDDVDGEKTFEVLATN
FT                   GDTHLGGEDFDSRLINYLVDEFKKEQGIDLRNDPLAMQRLKEAAEKAKIELSSAQQTDV
FT                   NLPYITADATGPKHMNIKVTRAKLESLVEELVARSMEPLKVALKDAGLSVSDIDDVILV
FT                   GGQTRMPMVQKQVADFFGKEPRKDVNPDEAVAIGAAVQGGVLAGDVKDVLLLDVTPLSL
FT                   GIETMGGVMTALISKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFN
FT                   LDGIQPAPRGMPQIEVTFDIDADGILHVSAKDKNSGREQNITIKASSGLSEDEIKQMVR
FT                   DAEANAEADRKFEELVQVRNQADQLVHGTRKLVEEAGDKLPATDKSAIEEAVKALEAAS
FT                   KGEDKADIEAKIQALVQSSAKLQELAQQQAQAGEAQADTSAKKDDDVVDAEFEEVKDKK
FT                   "
FT   gene            659154..660287
FT                   /locus_tag="NT01EI_0673"
FT   CDS_pept        659154..660287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0673"
FT                   /product="chaperone protein DnaJ, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67895"
FT                   /db_xref="GOA:C5B7L8"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5B7L8"
FT                   /protein_id="ACR67895.1"
FT                   /translation="MAKKDYYEILGVSREADEREIKKAYKRLAMKYHPDRNQGDKEAED
FT                   KFKEIKEAYEILTDAQKRAAYDQYGHAAFEQGGMGGGGGGFGGGADFSDIFGDVFGDIF
FT                   GGGRRQRAARGADLRYNMDLTLEEAVRGVTKEIRIPTLAECDVCHGSGAKKGSEPITCP
FT                   TCHGAGQVQMRQGFFTVQQPCPHCHGRGTIIKDPCNKCHGHGRIEKSKTLSVKIPAGVD
FT                   TGDRIRLAGEGEAGENGAPAGDLYVQVQVKAHPIFEREDNNLFCEVPINFAMAALGGEI
FT                   EVPTLDGRVNLKIPAETQTGKMFRMRGRGVKSVRGGAQGDLLCRVVVETPVNLNDKQKQ
FT                   LLRELEESFGGPASDKNSPRSKRFFDGVKKFFDDLTR"
FT   gene            660516..661694
FT                   /locus_tag="NT01EI_0674"
FT   CDS_pept        660516..661694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0674"
FT                   /product="Na+/H+ antiporter NhaA, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67896"
FT                   /db_xref="GOA:C5B7L9"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5B7L9"
FT                   /protein_id="ACR67896.1"
FT                   /translation="MIKSLQRFVGSDAFGGVILIIAAALAMILANTDWTSHIYQAFLNT
FT                   PVEVHVGSLHINKNMLLWVNDALMAVFFLMIGLEVKRELVCGSLASARQAAFPVIAAVG
FT                   GMVVPALIYLLFNGQDAVASTGWAIPAATDIAFALGVLALLGNRVPLALKVFLLALAII
FT                   DDLGAIIIIALFYTSDLSILSLAVAGAAIVALALLNLFNVRRVGLYILVGVVLWTAVLK
FT                   SGVHATLAGVVIGFFVPLKEQDGKSPARSLEHALHPWVAYMILPLFAFANAGVSLDGVT
FT                   LSGLFSLLPLGVIAGLFIGKPLGISLFCWLAVKLKLATLPQGTTFKEIIAIGVLCGIGF
FT                   TMSIFIASLAFGDADPALAVFSRLGILLGSSLAAIVGYLLLRRVLPVQKAVA"
FT   gene            661903..662805
FT                   /locus_tag="NT01EI_0675"
FT   CDS_pept        661903..662805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0675"
FT                   /product="transcriptional activator protein NhaR, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67897"
FT                   /db_xref="GOA:C5B7M0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7M0"
FT                   /protein_id="ACR67897.1"
FT                   /translation="MRLSHINFNHLYYFWQVCKEGSVVGAAEALFLTPQTITGQIKALE
FT                   ERLGGKLFKRQGRGLVPSELGQLVFRYADRMFMLSQEMLDIVNYRKESSMLFDVGVADA
FT                   LSKRLVSQVLETAVADHEQIHLRCFESTHELLLEQLSQHKLDMILSDCPVDSSQQEGLF
FT                   SVKLGECGVSFFCRQPLPEMPFPTCLEQRKLLIPGRRSMLGRKLLNWFNSQGLQVQILG
FT                   EFDDAALMKAFGLYHDAIFVAPSIYAQDMYANVQDNIREVGRIDNVQEEYYVIFAERMI
FT                   QHPAVQRVCNKDFSALFSR"
FT   gene            662914..663123
FT                   /locus_tag="NT01EI_0676"
FT   CDS_pept        662914..663123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0676"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67898"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7M1"
FT                   /protein_id="ACR67898.2"
FT                   /translation="MTSSFILVDQAFVCLTVDDRLHVVVRCLSSCFVASSDSCVYFLDE
FT                   STHHGTAASIVLATLFRLNGAFLS"
FT   gene            complement(663211..663402)
FT                   /locus_tag="NT01EI_0677"
FT   CDS_pept        complement(663211..663402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0677"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67899"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7M2"
FT                   /protein_id="ACR67899.1"
FT                   /translation="MERHRYRLCTSGDHLAPIHHCQMAMMGKIARNAVFHTTKLVKFGA
FT                   IETHGCRHYKRRLFAQIH"
FT   gene            663550..664545
FT                   /locus_tag="NT01EI_0678"
FT   CDS_pept        663550..664545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0678"
FT                   /product="riboflavin biosynthesis protein RibF, putative"
FT                   /EC_number="2.7.1.26"
FT                   /EC_number="2.7.7.2"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0678"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67900"
FT                   /db_xref="GOA:C5B7M3"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7M3"
FT                   /protein_id="ACR67900.1"
FT                   /translation="MELIRGTHNLRARHRGCVLTIGNFDGVHRGHRALLARLRQEGDRL
FT                   GVPVMVMIFEPQPLEMFAPQNAPARLTRLRDKCRYLADAGVDAVLCVGFDRQFASHSAQ
FT                   DFVKHLLVERLGVKFLMIGDDFRFGAGREGDYQMLQAAGKVYGFTVTNSLSFCVGDRRV
FT                   SSTAVRHALRHDDLALAESLLGHPYRIAGRVVHGDALGRTIGFPTANLPLKRLVAPVKG
FT                   VYAVDVYGLGPTPLPGVANIGTRPTVAGIRQQLEVHLLDVTMDLYGRHIDVVLRAKLRN
FT                   EQRFDSLDALKRQIAQDVVAAREFFWADNTGPEPDGSIPIVENGTEIEDE"
FT   gene            664538..667384
FT                   /locus_tag="NT01EI_0679"
FT   CDS_pept        664538..667384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0679"
FT                   /product="isoleucyl-tRNA synthetase, putative"
FT                   /EC_number="6.1.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0679"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67901"
FT                   /db_xref="GOA:C5B7M4"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5B7M4"
FT                   /protein_id="ACR67901.1"
FT                   /translation="MSDYKNTLNLPETGFPMRGDLAKREPGMLQHWYEQDLYGIIRNAK
FT                   QGKKSFILHDGPPYANGSIHIGHSVNKILKDIIIKSKGLSGYDSPYIPGWDCHGLPIEL
FT                   KVEQLIGKPGEKYSAAEFREQCRAYAAEQVAGQKADFIRLGVLGDWEHPYLTMDYGTEA
FT                   NIIRALARIVDNGHLMKGAKPVHWCPDCGSSLAEAEVEYYDKVSPSIDVRFAAVDKAQV
FT                   LAKFGVSEAKGDVNVVIWTTTPWTLPANRAVALHPELEYQLVQVEGECLILAADLVESV
FT                   MKRAGIDYWQVLGSCKGEALELLHFCHPFMNFDVPIIMGDHVTLDAGTGAVHTAPGHGP
FT                   DDYVVGQKYGLEIANPVGSNGCYLPGTHPVLDGLFVFKANDIVIDLLKDSGALLHVEKL
FT                   THSYPCCWRHKSPIIFRATPQWFISMDRQGLRSQSLAEIDRIERQGLDEQNLSGWIPAW
FT                   GKARIESMVANRPDWCISRQRTWGVPMAMLVHKETQELHPRTTELMEMVAKRVEQAGIQ
FT                   AWWDLDIRDLLGDEADQYEKVPDTLDVWFDSGSTSYSVVDARPEFNGHSPDMYLEGSDQ
FT                   HRGWFMSSLMISVAMKGKAPYRQVLTHGFTVDGQGRKMSKSVGNVVSPQQVMNKLGGDI
FT                   LRLWVASTDYTSEMAVSDEILKRSADAYRRIRNTARFLLANLNGFDPCKDMVKPEDMVV
FT                   LDRWAVGCAKQAQDEIIAAYENYDFHEVVQRLMQFCSVEMGSFYLDIIKDRQYTAKADS
FT                   VARRSCQTALYHIAEALVRWMAPILSFTADEVWGYLPGDRAQFVFTEEWYQGLFGLDAA
FT                   EQMNDAFWAELLKVRGEVNRVIEQARNDKKVGGSLEAAITLYADEALATQLDSLQDELR
FT                   FVLITSAARVQPLVQATADAVASELAGLKVGLGKADGSKCPRCWHYSTAIGQDAAHPQL
FT                   CPRCVTNVAGQGEERKFA"
FT   gene            667381..667881
FT                   /locus_tag="NT01EI_0680"
FT   CDS_pept        667381..667881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0680"
FT                   /product="signal peptidase II, putative"
FT                   /EC_number="3.4.23.36"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67902"
FT                   /db_xref="GOA:C5B7M5"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7M5"
FT                   /protein_id="ACR67902.1"
FT                   /translation="MMRRPIFSTGLRWLWIVVAVLIVDLGSKQLILQHFMLGETLPLFP
FT                   SLNLHYARNYGAAFSFLADSGGWQRWFFAGIAIAICVALLVMMYRSAASQRLSNIAYAL
FT                   IIGGALGNLFDRLWHGFVVDMIDFYVGNWHFATFNLADTAICIGAALVVVEGFLPQRDK
FT                   ENK"
FT   gene            667881..668348
FT                   /locus_tag="NT01EI_0681"
FT   CDS_pept        667881..668348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0681"
FT                   /product="peptidyl-prolyl cis-trans isomerase, FKBP-type,
FT                   putative"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0681"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67903"
FT                   /db_xref="GOA:C5B7M6"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7M6"
FT                   /protein_id="ACR67903.1"
FT                   /translation="MPQVQATSAVLVHFTLTLEDGSLAESSHERGQPALFRLGDGSLSP
FT                   ALEAHLLGCRRGDRRTFTLVPADAFGERSDDLVQFFPLGQFRDSGMPQAGAVILFTAAD
FT                   GAQMPGLVREIVGESVTVDFNHPLAGMPVTFDLEVLAIDPPQGDEHAHSAG"
FT   gene            668329..669282
FT                   /locus_tag="NT01EI_0682"
FT   CDS_pept        668329..669282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0682"
FT                   /product="4-hydroxy-3-methylbut-2-enyl diphosphate
FT                   reductase, putative"
FT                   /EC_number="1.17.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67904"
FT                   /db_xref="GOA:C5B7M7"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5B7M7"
FT                   /protein_id="ACR67904.1"
FT                   /translation="MRILLANPRGFCAGVDRAISIVERALAIYGAPIYVRHEVVHNRFV
FT                   VNDLRERGAVFIEEISEVPDGAILIFSAHGVSQAVRAEAKARHLTMLFDATCPLVTKVH
FT                   MEVARASRRGTEAILIGHAGHPEVEGTMGQYSNPQGGMYLVESPQDVWQLQVKDEQNLC
FT                   FMTQTTLSVDDTSEVIDALRARFPAIVGPRKDDICYATTNRQEAVRSLAVQADVVLVVG
FT                   SKNSSNSNRLAELARRAGRAAYLIDSASDIDDAWLSGVGCVGVTAGASAPDVLVREVID
FT                   RLQALGGAAAQEIQGREENIVFEVPRELRIEVQQAD"
FT   gene            complement(669368..669922)
FT                   /locus_tag="NT01EI_0683"
FT   CDS_pept        complement(669368..669922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0683"
FT                   /product="conserved hypothetical protein TIGR00481"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0683"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67905"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7M8"
FT                   /protein_id="ACR67905.1"
FT                   /translation="MFTKKALACLLVAGGLSLSAQAMTLSSPSVDNGKSLQNVQIFNGW
FT                   GCTGQNKSPALTWSDVPAGTKSFAVTMYDPDAPTGSGWWHWMMIDIPASVHSLAQNVGE
FT                   KESRDLPKGAIQLRNDFGYNGFGGACPPPGAKPHNYQITVYALNVAKLDIPAHASPAYA
FT                   GYFILQHKIGEARLTAPTNMR"
FT   gene            complement(670113..670601)
FT                   /locus_tag="NT01EI_0684"
FT   CDS_pept        complement(670113..670601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0684"
FT                   /product="xanthine dehydrogenase, Fe-S subunit, putative"
FT                   /EC_number="1.17.1.4"
FT                   /note="xanthine dehydrogenase, Fe-S subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0684"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67906"
FT                   /db_xref="GOA:C5B7M9"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7M9"
FT                   /protein_id="ACR67906.1"
FT                   /translation="MNVKEWVEIRCQINGKTYQFCVSPAISLLEMLREHGLTSVKQGCC
FT                   VGECGACSVLIDGVATDSCLYLALWADGKQIVTAEGLGRADSLSPIQQAYVDAGAVQCG
FT                   FCTPGLVVATHALLAKPRSRPLTHQEIRRGLSGNLCRCTGYQAIVRAVDLCQHEEEEQ"
FT   gene            complement(670598..671476)
FT                   /locus_tag="NT01EI_0685"
FT   CDS_pept        complement(670598..671476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0685"
FT                   /product="xanthine dehydrogenase, FAD-binding subunit"
FT                   /EC_number="1.17.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0685"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67907"
FT                   /db_xref="GOA:C5B7N0"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7N0"
FT                   /protein_id="ACR67907.1"
FT                   /translation="MYDIKRYLRATSARHASELMLAHPDSRLLAGGTDVLIQLHHHNAQ
FT                   YAHIVDIHGLPELCGITMLEDGSLRIGSGTTFTQLIEHPLIQMHLPMLAEAAATIAGPQ
FT                   IRNVATYGGNICNGATSADSAAPSVALKAQLEILTPDGVTIRPIDGFHTGPGKVALTPG
FT                   EILLAFRFHPNDHRHAGSAYIKYAMRGAMDIATIGCAALCRIESGRFSELRLAYGVAAP
FT                   TPIRCPQAESCANGQPLSRQTLAAVAAAVAADVSPRSSWRAEKEFRLHLIRTLAQRAIT
FT                   LAVQRAGGDIL"
FT   gene            complement(671483..673774)
FT                   /locus_tag="NT01EI_0686"
FT   CDS_pept        complement(671483..673774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0686"
FT                   /product="xanthine dehydrogenase, molybdenum-binding
FT                   subunit"
FT                   /EC_number="1.17.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0686"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67908"
FT                   /db_xref="GOA:C5B7N1"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7N1"
FT                   /protein_id="ACR67908.1"
FT                   /translation="MSLGSPLRRVDAEAKVTGQARYTDDMMMPGMLHACYVRSRIAHGN
FT                   VTAIDTREAESMPGVEAVFTFHDVPSAPFPTAGHAWSLEPGKRDIADRHLLTGHVRHFG
FT                   DGVAIVVARDLLSAERAAARVQVSYDALPVITRPQAALADGAPAIHPGGNLLRHSEIDA
FT                   GEPEVRISTADLQLEGHYETPVVQHCHMEGVTCYAYMEQPDHIVIVSSTQIPQIVRRTV
FT                   AQALGLPWSHVRVIKPYVGGGFGNKQDVLEEPMAAFLTQRLGGKPVKVSLSREECFVAT
FT                   RTRHAFSIDARLGMRRDGQLEGYRLTVLSNTGAYASHGHSIAAAGANKISYLYPRSAFG
FT                   YCADTVYTNLPAAGAMRGYGAPQVDFALECLMDDAAARLDLDPLEVRLRNVARQGDRNP
FT                   VNGKTIYSAGLTECLEKGRRLFEWDQRRAECLAQAADAPVRRGIGIACFSYGSNTYPVG
FT                   VEIAGARLLLNQDGTVNLQIGATEIGQGSDTVFAQMASETLGIPFKQIRVISTQDTDIT
FT                   AFDPGAFASRQSYVAAPAIRRAAEIMRQKILAHAALISHQPEWGLTLCDGNVVMAMQPD
FT                   QVLMSVADVAMQAYYHQEIGAQILAEVSHKTTTNPPAFGCTFVDLSIDIALCQVTINRI
FT                   LNLHDSGRILNPQLAEGQVHGGMGMGIGWALFEEMIIDEQSGVVRNPNLLDYKFPTCVD
FT                   LPDLECAFVETVEPQSAYGHKALGEPPIISPGPAIRNAIRMATGVAINALPITPKTLYR
FT                   EFVQAGLIRE"
FT   gene            674220..675038
FT                   /locus_tag="NT01EI_0687"
FT   CDS_pept        674220..675038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0687"
FT                   /product="dihydrodipicolinate reductase, putative"
FT                   /EC_number="1.17.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0687"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67909"
FT                   /db_xref="GOA:C5B7N2"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5B7N2"
FT                   /protein_id="ACR67909.1"
FT                   /translation="MAEQIRVAIAGAGGRMGRQLIAAAAAIPGVTLGAALEREGSGLLG
FT                   CDAGELAGCGVTGVTVESSLERVAGQFDILIDFTRPEGTMAHLAFCQAHGKAMVIGTTG
FT                   FSEQEKATIEAASQHVAIVLAANFSVGVNVMLRLLEKAAQVMGSYCDIEILEAHHRHKV
FT                   DAPSGTALAMGEAIAGALGRSLESCAVYTRLGHTGERAPGSIGFATLRAGDIVGEHTAM
FT                   FADVGERLEITHKASSRMTFASGAMRAAQWLGAQQPGMYDMCDVLALDTL"
FT   gene            675154..675315
FT                   /locus_tag="NT01EI_0688"
FT   CDS_pept        675154..675315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0688"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0688"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67910"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7N3"
FT                   /protein_id="ACR67910.1"
FT                   /translation="MAIFSVYLLFPPLHCPHIDFFSEKTHYSAVAFDICVRQPFSPFLK
FT                   LAFLITWH"
FT   gene            675503..676660
FT                   /locus_tag="NT01EI_0689"
FT   CDS_pept        675503..676660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0689"
FT                   /product="carbamoyl-phosphate synthase, small subunit,
FT                   putative"
FT                   /EC_number="6.3.5.5"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0689"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67911"
FT                   /db_xref="GOA:C5B7N4"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7N4"
FT                   /protein_id="ACR67911.1"
FT                   /translation="MIKSALLVLEDGTQFHGRSIGADGSAVGEVVFNTSMTGYQEILTD
FT                   PSYSRQIVTLTYPHIGNVGTNAADEESSTVHAQGLIVRDLPPIASNFRCQETLPDYLRR
FT                   HRVVAIADIDTRKLTRLLREKGAMNGCIVTAENGSEPDAALALEKARAFPGLKGMDLAK
FT                   EVTTKEAYRWCQGSWTLSGGLPAPRDDAELPYHVVAYDFGVKRNILRMLVDRGCRLTVV
FT                   PAQTPAQDVLALDPDGIFLSNGPGDPAPCDYAIEAIATFLRGEIPLFGICLGHQLLALA
FT                   SGAQTVKMKFGHHGGNHPVKDLEGDRVMITAQNHGFAVDEATLPTTLRATHKSLFDGSL
FT                   QGIHRTDRPAFSFQGHPEASPGPHDAAPLFDHFMTLIENYRRTAK"
FT   gene            676680..679901
FT                   /locus_tag="NT01EI_0690"
FT   CDS_pept        676680..679901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0690"
FT                   /product="carbamoyl-phosphate synthase, large subunit,
FT                   putative"
FT                   /EC_number="6.3.5.5"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0690"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67912"
FT                   /db_xref="GOA:C5B7N5"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7N5"
FT                   /protein_id="ACR67912.1"
FT                   /translation="MPKRTDIKSILILGAGPIVIGQACEFDYSGAQACKALREEGYRVV
FT                   LVNSNPATIMTDPEMADATYIEPIHWEVVRKIIEKERPDAVLPTMGGQTALNCALELER
FT                   QGVLAEFGVTMIGATADAIDKAEDRRRFDQAMKKIGLDTARSGIAHSMEESLAVAEQVG
FT                   FPCIIRPSFTMGGTGGGIAYNREEFEEICARGLDLSPTNELLIDESLIGWKEYEMEVVR
FT                   DKNDNCIIVCAIENIDPMGIHTGDSITVAPAQTLTDKEYQIMRNASMAVLREIGVETGG
FT                   SNVQFAVNPKSGRLIVIEMNPRVSRSSALASKATGFPIAKVAAKLAVGYTLDELMNDIT
FT                   GGRTPASFEPSIDYVVTKIPRFNFEKFAGANDRLTTQMKSVGEVMAIGRTQQESLQKAL
FT                   RGLEVGASGFDPKVNLDDPQALTKIRRELKDAGAERIWYIADAFRAGLSVDGVFNLTNI
FT                   DRWFLVQIEELVRLEEQVADVGINGLTPDFLRQLKRKGFADARLARLAGVAESEIRKLR
FT                   HKQGLHPVYKRVDTCAAEFATDTAYLYSTYEEECEANPTHDRPKIMVLGGGPNRIGQGI
FT                   EFDYCCVHASLALREDGYETIMVNCNPETVSTDYDTSDRLYFEPVTLEDVLEIVAVERP
FT                   QGVIVQYGGQTPLKLARALEAAGVPVIGTSPDAIDRAEDRERFQKAVNRLGLKQPANAT
FT                   VTAIEQAVEKGAQIGYPLVVRPSYVLGGRAMEIVYDESDLRRYFQTAVSVSNDAPVLLD
FT                   HFLDDAVEVDVDAICDGERVLIGGIMEHIEQAGVHSGDSACSLPAYTLSAEIQDELRRQ
FT                   AEKLAMELCVRGLMNVQFAVKDNQVYLIEVNPRAARTVPFVSKATGVPLAKVAARVMVG
FT                   QTLAQQGMTEEVIPPYYSVKEVVLPFAKFPGVDPILGPEMRSTGEVMGVGRTFAEAFAK
FT                   AMLGSLSQVKTPGRALLSVREGDKHRVVDLAAKLLRQGFELDATHGTAVVLGEAGINPR
FT                   LVNKVHEGRPHIQDRIKNGEYTYIVNTTAGRQAIEDSKLIRRSALRYKVHYDTTLNGGF
FT                   ATAMALNADPTEQVISVQEMHARLK"
FT   gene            680123..680893
FT                   /locus_tag="NT01EI_0691"
FT   CDS_pept        680123..680893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0691"
FT                   /product="Protein of unknown function (DUF1212)"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0691"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67913"
FT                   /db_xref="GOA:C5B7N6"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7N6"
FT                   /protein_id="ACR67913.1"
FT                   /translation="MESDRQREITRLCIHCALFLLQHGAESMLVEQLSTRLGLALGVDS
FT                   VESSISANAVVLTTIKDGRCLTSTRKNVDRGINMHVVTEVQHIVIMAEHRLLDMHDVRR
FT                   RLEHIRPLRYPRALVVLMVGLSCACFCKLNGGGWDGALVAFFASAVAMYARQLMTHRQL
FT                   NPLINFCITAFIATSVSGGLLQLSVFAGTSLIAMAASILLLVPGFPLINAVADMFKGHV
FT                   NTGLARWAMATLLTLATCLGVVMALSLWGLQGWA"
FT   gene            680890..681357
FT                   /locus_tag="NT01EI_0692"
FT   CDS_pept        680890..681357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0692"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0692"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67914"
FT                   /db_xref="GOA:C5B7N7"
FT                   /db_xref="InterPro:IPR020914"
FT                   /db_xref="InterPro:IPR024528"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7N7"
FT                   /protein_id="ACR67914.1"
FT                   /translation="MITLLLQLVQDMLLAAVPALGFAMVFNVPNRALRYCALLGAIGHG
FT                   SRLLLITLGLNIEWASLMAAILIGVIGIQWSRWLLAHPKVFTVAAVIPMFPGIYAYRAM
FT                   IAVVEISRSGYSEPLFASMVTNFLKASFIVGALSIGLSLPGIWLYRKRPGV"
FT   gene            681486..681968
FT                   /locus_tag="NT01EI_0693"
FT   CDS_pept        681486..681968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0693"
FT                   /product="dihydrofolate reductase, putative"
FT                   /EC_number="1.5.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0693"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67915"
FT                   /db_xref="GOA:C5B7N8"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR017925"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7N8"
FT                   /protein_id="ACR67915.1"
FT                   /translation="MIISLIAALSADRVIGLDNAMPWHLSADLAWFKRNTLAKPVIMGR
FT                   KTYESIGRPLPGRHNIVISRQAGCDDRVSWVATPEAALTAAADADEVMIIGGGTLYEQF
FT                   LPQASRLYLTHVDADVAGDTYFPDYAPDEWQTCFSEFHEADSDNSHAYCFEILDRR"
FT   gene            complement(682220..683059)
FT                   /locus_tag="NT01EI_0694"
FT   CDS_pept        complement(682220..683059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0694"
FT                   /product="bis(5'-nucleosyl)-tetraphosphatase, putative"
FT                   /EC_number="3.6.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0694"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67916"
FT                   /db_xref="GOA:C5B7N9"
FT                   /db_xref="InterPro:IPR004617"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5B7N9"
FT                   /protein_id="ACR67916.1"
FT                   /translation="MSTLLIGDVHGCYHELRDLLSLADFDPARDTLWLTGDLVARGPDS
FT                   LAVLRYVKSLGDSARLVLGNHDLHLLAIYAGISRNKPKDKLTPLLEAPDADSLINWLRR
FT                   QPVLQVDNDLCLVMAHAGISPQWDLTTAQRCAREVEAMLASDSYPFFLNAMYGDMPNNW
FT                   SESLSGLARLRFTTNALTRMRYCFPGGELDMICKDAPEDAPAPLRPWFDLDSPVREAGY
FT                   SIAFGHWASLEGRSTPPQVYALDTGCCWGGTLTALRWEDRHSFSVPSRRASRHAKAE"
FT   gene            complement(683064..683441)
FT                   /locus_tag="NT01EI_0695"
FT   CDS_pept        complement(683064..683441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0695"
FT                   /product="Protein of unknown function (DUF525)"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67917"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR023065"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5B7P0"
FT                   /protein_id="ACR67917.1"
FT                   /translation="MIDAPRIIVQVQSVYAGSQSLPEEARFVFAYTVTLRNLGRFNVQL
FT                   LRRYWLITNGNGRQTEVQGEGVIGEQPLIQPNGEFQYTSGAIIETPCGTMEGHYEMVDH
FT                   QGHTFRIAIPVFRLAIPSLIN"
FT   gene            complement(683466..684281)
FT                   /locus_tag="NT01EI_0696"
FT   CDS_pept        complement(683466..684281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0696"
FT                   /product="dimethyladenosine transferase, putative"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0696"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67918"
FT                   /db_xref="GOA:C5B7P1"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7P1"
FT                   /protein_id="ACR67918.2"
FT                   /translation="MNSRVHQGHLARKRFGQNFLTDQFVIDSIVSAINPLPGQAVVEIG
FT                   PGLGALTEPVADRMDKMTVVELDRDLAERLSTHPFISRKLTIRQQDAMTVDFSEMAREA
FT                   GQPLRVFGNLPYNISTPLMFHLFSYASAISDMHFMLQKEVVNRLVAGPDSKTYGRLSVM
FT                   AQYYCQVVPVLEVPPSAFRPAPKVDSAVVRLIPHRELPYPVSDVRVLSRITTEAFNQRR
FT                   KTIRNSLGHLFSADQLSALGIDPARRAETLSVADYCRLANWLCEHPQAQ"
FT   gene            complement(684271..685266)
FT                   /locus_tag="NT01EI_0697"
FT   CDS_pept        complement(684271..685266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0697"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase,
FT                   putative"
FT                   /EC_number="1.1.1.262"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0697"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67919"
FT                   /db_xref="GOA:C5B7P2"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="InterPro:IPR037510"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7P2"
FT                   /protein_id="ACR67919.1"
FT                   /translation="MASIRRIVITPGEPAGVGPELLVQLAQRPWPAELVVCADPGLLEA
FT                   RAHALGLPLTLRRYDSALSPQAQQAATLTVLPIPLEADVIPGKLNVANGNYVVATLTRA
FT                   CDGCLSGEFAALVTGPVHKGIINDAGVPFTGHTEFFADRSGCPRVVMMLASERLRVALA
FT                   TTHLPLQEVPAAITPQTLREVITILDADLRRRFGLRQPHIYVCGLNPHAGEGGHMGREE
FT                   LDIIIPTLDALRASAIHLTGPLPADTLFQAKYLDDADAVLAMYHDQGLPVLKYQGFGRA
FT                   VNITLGLPFIRTSVDHGTALDLAASGQAQPGSFITALNLAIEMTNHSNEQ"
FT   gene            complement(685271..686575)
FT                   /locus_tag="NT01EI_0698"
FT   CDS_pept        complement(685271..686575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0698"
FT                   /product="SurA N-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0698"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67920"
FT                   /db_xref="GOA:C5B7P3"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR015391"
FT                   /db_xref="InterPro:IPR023034"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7P3"
FT                   /protein_id="ACR67920.1"
FT                   /translation="MKNWRTLILGVALCANTAFAAPQVVDKVVAIVDNGVVLESDVDGM
FT                   MKSVKLNAQQAGQQLPDDATLRHQILERLIMDNVQLQMAKRMGLEISDSELDNAINGIA
FT                   QQNHISMQQLRSRLAADGLDYKTYRDQIRKEMLISEVRNNEVRSRVTILPQEVDALAKQ
FT                   IGSQNSGETAVNLSHILIPLPENPTQQQVSEAQKQAESLIQQLHQGASFAKLAAAYSAD
FT                   PQALKGGEMGWGRLQELPTLFAEALQSAKKGDIVGPIRSGVGFHILRVNDLRGDQASVS
FT                   VTEVHARHILLRPSPVMSDTQARAKLEALSAQIKSGQITFEQAAKEYSQDPGSAQKGGD
FT                   LGWAVPSMYDPAFRDALMKLNKGEISQPVHSNFGWHLIQLLDTRQVDRTDEAQKERAYR
FT                   MLFNRKFAEEAQTWLQEQRAAAYVKILGNSANGAQ"
FT   gene            complement(686695..689082)
FT                   /locus_tag="NT01EI_0699"
FT   CDS_pept        complement(686695..689082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0699"
FT                   /product="Organic solvent tolerance protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0699"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67921"
FT                   /db_xref="GOA:C5B7P4"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR007543"
FT                   /db_xref="InterPro:IPR020889"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7P4"
FT                   /protein_id="ACR67921.1"
FT                   /translation="MTESLTPRMKKSIPTLIATLVWSALYSQHALASLAEQCLIGVPVY
FT                   DKPLVSGDINSLPVHITADQSEANYPNNALFHGNVDIQQGNSTLTADKVQLDQKAIQGQ
FT                   PNPLRTVTAIGNVHYADSQIRLQGPSAWSNLNNKDTNVWRGDYQFVGRQGRGDADLMKT
FT                   RDANRYTILDNGTFTSCLPGDNSWSIAGSEIIQDRKEQVAEIWNARFKIGPVPVFYSPY
FT                   LQFPTGNKRRSGFLIPSVNYSNGDGIEFTLPWYWNIAPQADATFTPHYMEKRGLQLQNE
FT                   FRYLSEFGMGQVEFDWLGNDRQFQQDRKNQGITGQELEDLKNRDRWLFYWRHSGVLDHW
FT                   RFGVDYTKVSDPYYFTDLSSSYGSSTSGYATQKFTLGYAETNWNATLSTTQFQVFANAG
FT                   DVNAYRTAPQLDLNYYKNDLGPFDFTLYGQAVKFTNDNVYLPGADRYHVEPVLSLPLSN
FT                   RWGSINTEAKLMATHYQQDVPSQGNLTQLKDNVNRVMPEFKIDGKMIFERDATLLSGYT
FT                   QTLEPRAQYLYIPYRDQSDIYSYDATLLQTDYTGLFRDRSYSGLDRIASANQVTTGLTT
FT                   RLYDDEQNERFNASIGQIYYFSPSRTGDETTTIDRHDNTGSLVWAGDSYLKLTDSWGLR
FT                   GGLQYDTRLNSVALGNAVMEYRKDAESVLQLSYRYASPEYITSMLPSYANNTIYNQGIS
FT                   QAGIIGSLPLAERWALVAGYYYDTKAKQSADAIAGLQYNTCCWSMGVTYERKINSWDSA
FT                   TQNSKYDNKFSLKFALRGMNQNYSLGSAEMLRSGILPYQRAF"
FT   gene            689240..690061
FT                   /locus_tag="NT01EI_0700"
FT   CDS_pept        689240..690061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0700"
FT                   /product="DnaJ domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0700"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67922"
FT                   /db_xref="GOA:C5B7P5"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR023749"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7P5"
FT                   /protein_id="ACR67922.1"
FT                   /translation="MRYWGKFVGVLLGLMSGIGFWGVVLGFLIGHMFDKSRAIKRQGYF
FT                   ANQQQRQGLFFRTTFQVMGHLTKSKGRVTEADIQVASMFMDRLNLHGDARLMAQQAFRE
FT                   GKEPGYPLRERLRELRSVCFGRIDLIRIFLEIQLQAAFADGQLHPNERAVLYVIAEELG
FT                   FSHAQFDQFLGMMEGGRQFGGGYHQAGGQQGGFYTPPQGPTLEDACKVLGVASSADATT
FT                   IKRAYRKLMSEHHPDKLVAKGLPPEMMELAKQKAQEIQAAYDLIKKEKGFK"
FT   gene            complement(690138..690845)
FT                   /locus_tag="NT01EI_0701"
FT   CDS_pept        complement(690138..690845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0701"
FT                   /product="RNA pseudouridine synthase"
FT                   /EC_number="5.4.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0701"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67923"
FT                   /db_xref="GOA:C5B7P6"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7P6"
FT                   /protein_id="ACR67923.1"
FT                   /translation="MGRRTPAGGALPPSATPALEHYDPPREPWLHILYQDAHIIVVNKP
FT                   SGLLSVPGRLPEHQDSIITRIQAQFPDAESVHRLDMATSGVLVVALTKDAERELKRQFR
FT                   EREPKKNYVARVWGHPPQDQGVIDLPLICDWPNRPKQKVCFEQGKPAQTEYQVLAHDAD
FT                   GTARVLLTPITGRSHQLRVHLLALGHPILGDGFYAPPQALALASRLLLHAQELRIVHPA
FT                   FTTPMHFRCEADF"
FT   gene            complement(690845..693697)
FT                   /locus_tag="NT01EI_0702"
FT   CDS_pept        complement(690845..693697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0702"
FT                   /product="Type III restriction enzyme, res subunit"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0702"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67924"
FT                   /db_xref="GOA:C5B7P7"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022737"
FT                   /db_xref="InterPro:IPR023949"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="InterPro:IPR040765"
FT                   /db_xref="InterPro:IPR040766"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7P7"
FT                   /protein_id="ACR67924.1"
FT                   /translation="MGTVVALDARMVTLLFPATGENRLYARNDSPITRVMFNPGDTITT
FT                   HEGWQLCVEEVQEHEGLLTYIGNRCDNGENSVAVREVLLDSRLTFSKPQDRLFAGQIDR
FT                   MDRFALRYRARKYQSEQFRLPCSGLRGMRASLIPHQLHIARDVGQRHAPRVLLADEVGL
FT                   GKTIEAGMIIHQQLLSGRAERVLIVVPETLQHQWLVEMLRRFNLRVALFDDERYAEAAQ
FT                   DSSNPFETEQLVICSLDFVRRSRQRLEQLADASWDLLVVDEAHHLAWSEQAPSREYQVI
FT                   EQLAEQIPGVLLLTATPEQLGQESHFARLRLLDPNRFHDYAQFVAEQLRYRPVADAVTL
FT                   LLNDGHLQQDELNMLCEMVAEQDIEPLLKAANTDGEDSQQARAELVRMLMDRHGTSRVL
FT                   FRNTRQGVKGFPQRTLHQITLPLPAQYQTAIKVSGIMGSKKSVEAQANDMLYPERIYQE
FT                   FEGENATWWNFDPRAEWLLDFLLTQRDEKVLVICAQAATAIHLEQLLREREGIRAAVFH
FT                   QGMSLIERDRAAAYFASQEEGAQVLLCSEIGSEGRNFQFANHLVMFDLPFNPDLLEQRI
FT                   GRLDRIGQARDIQIYVPCLEGTAQSVLIRWYHQGLDAFEHTCPTGRTIYDRYYETLLAF
FT                   LAKPAQLDGFDDFIKTCRTDHDTLKIQLEKGRDRLLEMHSNGGEAAQALAGSIAAQDND
FT                   VNLVNFALNLFDIVGINQEDRSDSLIVLTPSDHMLVPDFPGLPQDGCTVTFDREQALSR
FT                   EDAQFISWEHPLMRNGLDLILSGDTGSSAVSLLKNKALPVGTLLLEAVYVVEAQAPKQL
FT                   QLTRFLPPTPVRMLLDAKGNDLAAQVEFESFNRQLNAVNRHTASKLVNAVQPNVHAMLQ
FT                   SGEALIADQAQALIDAAKREADEALSAELARLESLRAVNPNIRDDELETLEFTRRKVLE
FT                   TLDQAGWRLDALRLIVVSHQ"
FT   gene            complement(694015..696354)
FT                   /locus_tag="NT01EI_0703"
FT   CDS_pept        complement(694015..696354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0703"
FT                   /product="DNA polymerase family B protein"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0703"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67925"
FT                   /db_xref="GOA:C5B7P8"
FT                   /db_xref="InterPro:IPR006134"
FT                   /db_xref="InterPro:IPR006172"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017964"
FT                   /db_xref="InterPro:IPR023211"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR042087"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7P8"
FT                   /protein_id="ACR67925.1"
FT                   /translation="MNTPQPGFILTRHWRDTPQGVCVTLWLATERGPRCITLPPEPAVA
FT                   FMNAAQRDAAQHLLRGFPDVELRPVTLRDFHHQPVLALYCRGYRQLQQIERRLKAQGIP
FT                   LLEADIRPADRYLMERFINAPLWFCSDAGGAEARIKPHPHYRPTLRTVSLDIETSPRGE
FT                   LYSIGLHGCDQRIVYMLGPANGDAQALDFTLEYVASRAALLDALNRWMACHDPDAIIGW
FT                   NLVQFDLQILQRHAEREGVPLLLGRAATPLEWREHGFRAGHFFASAPGRLIIDGIEALK
FT                   SAFWHFPSYSLDSVAQTLLGEGKALDDPYRRMAEITRHFRQDKPALAHYNLRDCELVTR
FT                   IFAHTALMPFLLERASVTGLAPDRSGGSVAAFYHLYLPRMHRLGYVAPSLGEVAPQASP
FT                   GGFVMASRPGLYDSVLVLDYKSLYPAIIRSFLIDPVGLASGGEQPDDAHSVPGFLGARF
FT                   SRTRHALPEIVRQLWQGREAAKRLDNAPLAQALKILMNAFYGVLGTSACRFFDPRLASS
FT                   ITLRGHEIMRQTRSLIEALGYTVIYGDTDSTFVWLGKPHDEAQAEAIGQTLAGRVNAWW
FT                   REHLSQQYGLESALELEYECHYRRFLMPTLRGADLGSKKRYAGLCGERLVFKGLETVRS
FT                   DWTPLAQRFQQELYRRVFLGQSYRDVIRRYADGLLAGAFDDQLIYRKRLRRPLAEYQRN
FT                   VPPHVRAARLADEYNHQLERPLQYQNGGWISYIITRSGPQPLECIDAPADYQHYLERQL
FT                   QPVADAILPFLGDDFETLLTGQLGLF"
FT   gene            complement(696496..697209)
FT                   /locus_tag="NT01EI_0704"
FT   CDS_pept        complement(696496..697209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0704"
FT                   /product="thiamine ABC transporter, ATP-binding protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0704"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67926"
FT                   /db_xref="GOA:C5B7P9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005968"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7P9"
FT                   /protein_id="ACR67926.1"
FT                   /translation="MIRLDNLNYRYQRQTLSFSLHAAVGERIAILGPSGAGKSTLLSLI
FT                   AGFLAPSSGNLYLNGIDCHRAPPSQRPVSMLFQEHNLFAHLTIAQNLGLGLNPALRLNA
FT                   DQRRQLEEIAGQVGILDYLPRLPGQLSGGQRQRAALARCLLRRQPILLLDEPFSALDPA
FT                   LRAEMLTLLDDICRQRQLTLLMVSHNLDDAACIAPRTLVIDDGCVAYDGPTVALLAGSV
FT                   AAARLLGREVLGLTE"
FT   gene            complement(697206..698813)
FT                   /locus_tag="NT01EI_0705"
FT   CDS_pept        complement(697206..698813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0705"
FT                   /product="thiamine/thiamine pyrophosphate ABC transporter,
FT                   permease protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0705"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67927"
FT                   /db_xref="GOA:C5B7Q0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005947"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7Q0"
FT                   /protein_id="ACR67927.1"
FT                   /translation="MAKRPEPLIPRWLWPGLLAAALLLSIALLAFGALYHSAPSGAPVA
FT                   MWQDAYLWHVVRFSFWQALLSTLLSLLPAIALALALFRRRFPGRALLLRLCAMTLVLPV
FT                   LVAVFGLLSVYGRQGWLALLCQTLGIDYHFSPYGLQGILLAHVFFNLPLATRLLLQALE
FT                   SIPVEQRQLAAQLDMSPHQILRFVEWPYLRRQLPPAGALIFMLCFSSFATVLSLGGGPQ
FT                   ATTIELAIYQALSYDYDPARAAQLALLQLGCCLGLVVLSQRLSGILPVGHTRRMRWRDT
FT                   RDSLRLKLSDTLTIGLALLLLLPPLLAVIVDGLNQALGSVLRQPALWQALGTSLYIALG
FT                   AGALTVSLTMMLLWSSRELILRGQRWRAQGMELCGMLILAMPGIVLATGFFLLLNATIG
FT                   LPTSPGLLVMVTNALMAIPYAMKVLEYPMRDLAERYDPLCLSLRIGGLNRLRWIELRAL
FT                   RRPLAQALAFACVLSLGDFGVVALFGSEQFRTLPFYLYQQLGAYRSADGAVTALLLLLF
FT                   CLTLFSLLERLPTGRKSP"
FT   gene            complement(698789..699784)
FT                   /locus_tag="NT01EI_0706"
FT   CDS_pept        complement(698789..699784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0706"
FT                   /product="thiamin/thiamine pyrophosphate ABC transporter,
FT                   thiamin/thiamine pyrophospate-binding protein, putative"
FT                   /note="thiamin/thiamin pyrophosphate ABC transporter,
FT                   thiamin/thiamin pyrophospate-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0706"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67928"
FT                   /db_xref="GOA:C5B7Q1"
FT                   /db_xref="InterPro:IPR005948"
FT                   /db_xref="InterPro:IPR005967"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7Q1"
FT                   /protein_id="ACR67928.1"
FT                   /translation="MLKKLFSILALLTVSLLAQAAGKPVLTVYTYDSFAADWGPGPKIK
FT                   QAFEQSCHCELRLVPLEDGVAILNRLRMEGKNSPADLVLGLDNNLLTAARHSGLFSPSQ
FT                   IDTRGQQIPGGWHDATFVPYDYGYFAFVYDRQQVKNPPSSLKQLVEGPEKWRVIYQDPR
FT                   TSTPGLGLLLWMQKVYGDQAPAAWQKLAQKTVTVTKGWSEAYGLFLKGEADMVLSYTTS
FT                   PAYHIIEEHNDRYATAMFDEGHYLQVEVAGILKHSRQPALAHQFMQFITTPAFQNAIPT
FT                   GNWMYPATAVPLPPAFAALPRPQKTLSFTADDVAQHRAEWIRAWQSALSR"
FT   gene            complement(699990..701645)
FT                   /locus_tag="NT01EI_0708"
FT   CDS_pept        complement(699990..701645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0708"
FT                   /product="HTH-type transcriptional regulator SgrR,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0708"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67929"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR025370"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7Q2"
FT                   /protein_id="ACR67929.1"
FT                   /translation="MATPRLQHQFIRLWQHCQGNGCDTTLAGLAAALNCSRRHVRTLLN
FT                   AMQQQGWLSWKAASGRGKRSRLAFLCSALEVQQRRAEELMEQDHFEQLVQLVGDRDSAR
FT                   QMLLAQLGRSFRQGRHILRILYYRPLLGLQPASPLRRSETHLARQIFSGLTRINEENGE
FT                   LESDLAHHWQPLTPLHWRFYLRPAIHFHHGRELTMADVIASLERLRTLPLFRHIAQVAS
FT                   PTPHVIDIHLLAEDAWLPWLLGSVPAMILPQEWQEMRDFARLPVGTGPYQVVRNTQSQL
FT                   KIRAFDGYFGYRALIDEVNIWVLPEIAEALVHAGVQLQADGSGGDELESRLEEGCYFML
FT                   FDQRSAQMRDPAVRAWLCQTINPIALLNNASHLHQRYWSPAYGLLPRWHHNKMLSDRPK
FT                   PPQLTHLRITFYSEHSEFHALYQALQPLLAAHGVTLEMQEIEYPRWHDGAAESDLWLGS
FT                   ANFYLPLEFSIFAMLFELPLLSHCTGLDLSREARRWREQRLPVAEWSQQLVQRHQLHPL
FT                   FHHWLKLHGQHSIRGVRMNTLGWFDFKSAWFAPP"
FT   gene            701745..701858
FT                   /locus_tag="NT01EI_0709"
FT   CDS_pept        701745..701858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0709"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0709"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67930"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7Q3"
FT                   /protein_id="ACR67930.1"
FT                   /translation="MFLSKGAFHRPAIVDRWFFLFSVGCGGKTGYSVAALM"
FT   gene            701979..703451
FT                   /locus_tag="NT01EI_0710"
FT   CDS_pept        701979..703451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0710"
FT                   /product="transporter, divalent anion:Na+ symporter (DASS)
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0710"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67931"
FT                   /db_xref="GOA:C5B7Q4"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="InterPro:IPR030676"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7Q4"
FT                   /protein_id="ACR67931.1"
FT                   /translation="MDKLTPLKPLPALIALAITLTLWFIIPAPAGVSANAWQLLALFVG
FT                   TIAAIIGKALPIGAVSVVAIALVALTGVTAPGKPAAALNDALSGFSNSLIWLIGISIMV
FT                   SQSLNKTGLGERIGYWFIALCGKRTLGIAYGLALAETSLAPVTPSNTARGGGIIHPIMR
FT                   SIADSFGSYPQPGSTEKIGRYLSLVNYNINPITSAMFITATAPNPLIVNLIAKGTGHDF
FT                   ELTWGAWALAALLPALLSLLLMPLVVYWLYPPQIRHTPDAPRFARERLRALGPISLAEK
FT                   ITLAVFLLLLVLWADIPAWLLGDGWSVNATTAAFVGLAILLCSGVLSWDDLLKCKGAWD
FT                   TVMWFAALVMMATFLGKLGLIAWLSQSVSVLIDGMGMHWVGGMLLLTLVYVYAHYFFAS
FT                   TTAHITAMFAAFFAAGLALGVPPALFALVLAFSSSLMMSLTHYGTGTAPIIFGSGYVTL
FT                   GEWWKTGFILSAVNLALWLSVGSLWWHWLGYW"
FT   gene            complement(703495..704361)
FT                   /locus_tag="NT01EI_0711"
FT   CDS_pept        complement(703495..704361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0711"
FT                   /product="ABC transporter, ATP-binding protein family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0711"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67932"
FT                   /db_xref="GOA:C5B7Q5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7Q5"
FT                   /protein_id="ACR67932.1"
FT                   /translation="MRALFESIGQVIDSIHTVANDIDVADKPGAAPLRLTHGEIRFNTV
FT                   CFGYPAGQILFDRLDLHIRPGEKVALVGRSGAGKSSLMHLLLRFYDLQSGSITLDAQNI
FT                   AEVTQTSLRRQIGMITQDTALLHRSIRENLMYGNPQASEAEMIAACRRAEAHDFISQLA
FT                   DDVGNRGYDTQVGERGVKLSGGQRQRIAIARVLLKDAPILIMDEATSALDSEAEAAIQD
FT                   NLAQMMAGKTVIAIAHRLSTIAAMDRLIVMDHGRIVAQGSHRELLQQNGIYARLWAHQT
FT                   GGFIGND"
FT   gene            complement(704345..705313)
FT                   /locus_tag="NT01EI_0712"
FT   CDS_pept        complement(704345..705313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0712"
FT                   /product="ABC-type multidrug transport family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0712"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67933"
FT                   /db_xref="GOA:C5B7Q6"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7Q6"
FT                   /protein_id="ACR67933.1"
FT                   /translation="MFHWFERLTEPFPSQDPQKPPATLFGFCRHYTRGFERPLCAMALL
FT                   SAAVAVCEVILLRYLGELVDLLSHAERATFWADQRPSLIGMTILVLVVMPLLAWLHSNL
FT                   LHQSILGNYPMAVRWQVHRYLLGQSIAFFQRDFAGRVAAKVMQSAQSVREVVMKMVDLL
FT                   IYILVYLLSVLVMIASVDALLLIPLLLWLATYTLIQIHLLPRLRRIASEQANAQSMMSG
FT                   TIVDTYTHITTVKLFSHDQRESDYARHAMQRYLATVYRQMRTLTGLLFSVDVINYLLLF
FT                   SLAALSIALWQQQARYRHRHQSCPASTGHVQVDYVGGARTV"
FT   gene            705425..706198
FT                   /locus_tag="NT01EI_0713"
FT   CDS_pept        705425..706198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0713"
FT                   /product="ABC transporter, ATP-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0713"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67934"
FT                   /db_xref="GOA:C5B7Q7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7Q7"
FT                   /protein_id="ACR67934.1"
FT                   /translation="MFSLTNLEVVRGGREVLVIEQLTIPTDRLTVILGHNGSGKSTLVS
FT                   LLAGQLRPDGGQIALDGQALSSLSAGALARRVAFLPQKLPTSAGLTVRELVRLGRFPWR
FT                   GMLGRWRREDRQLIDAAMAETGVTPFAETLVDTLSGGERQRAWVAMLLAQASPLLILDE
FT                   PTSALDIQHQYQLMALLSALPRGVLVILHDLNLALRYADHVIALKQGRVAFAGPAAALA
FT                   DERRLSELYQTPIRLTDHPHPAPGAPPHKVAIVCA"
FT   gene            706189..707121
FT                   /locus_tag="NT01EI_0714"
FT   CDS_pept        706189..707121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0714"
FT                   /product="iron periplasmic binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0714"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67935"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7Q8"
FT                   /protein_id="ACR67935.1"
FT                   /translation="MCLIFNFIFRFFAPLALLFSLFSPSAQALTVSDSRGTHQLPAVPT
FT                   RAVVLDWDLLEQTIELGVTPLAATDLDSYREWVAQPPIPAQTQSVGSREEPNLERIAAL
FT                   KPDVILASEMQQALLPRLMQIAPVLYYTNFSAADDHAAVAIAQFRQLAQAFGREAIAEQ
FT                   KLAAMQARFQHLSRALRAAFQGQLPAVTVMRFASTTSTYLYTTNSMPVYVLRQLGISPA
FT                   LTPPPARWGIVRQPIAGLQRVGQGYVLYFLPFHDAARLDAMRLWQAMPFVRGQRVSAVR
FT                   PVWSYGGAMSLQYAAEAMAESLMALAAQK"
FT   gene            707118..709112
FT                   /locus_tag="NT01EI_0715"
FT   CDS_pept        707118..709112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0715"
FT                   /product="ABC transporter, iron chelate uptake transporter
FT                   family, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0715"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67936"
FT                   /db_xref="GOA:C5B7Q9"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7Q9"
FT                   /protein_id="ACR67936.1"
FT                   /translation="MSGAVRLAAPLLLLTLAVASLQWAQPLTLLQQWQLLLAPQQAQSL
FT                   DDILWLYSQLPRLAITLLVGATLGLAGSVMQQLTQNALMSPLTMGTSSGAWLALVLLAA
FT                   FWPGQQAQWGALAAMGGALLAFALIVLIAGLDNMTGLPMVIAGMVINILLGALASGVLL
FT                   LQHPYAQNIFLWGSGDLAQSDWGWVRWLLPRLTPALLLLLFAPRVLELLRLGHQGAQAR
FT                   GVALVPLFFALMLLTIWLVSAAVTAVGLIGFIGLLTPNIVRALGVRTPRGELYASLLGG
FT                   ALLLLLTDALAQGVSLWLGQLLPTGVVAAAIGAPALILFSRRRLSAPDGLGAPLISARG
FT                   RVSAWVSVALTALAALALLGYLTYQPEAAGWPFAWPQAYQWALRWPRALAALSCGGALA
FT                   LAGVLLQRLMYNPLASPDLLGVSSGATLTLVLAMLWCGQTLTALQQWGVGLAGSLAVLA
FT                   ALMALGRRQRYAPASVILSGIALTALLQALVQFCLAQGGQDSYRILQWLAGSTYRVTAA
FT                   QALLLSALTALLLLLALFVSRALTLLSIGRAFSQARGLNGAGAAALLLVLVALLCAIAT
FT                   AAIGPVAFVGLMAPHLAQMLGARTARAQMGLAALLGAATLLWADWLGQVLLYPRAMAAG
FT                   TLVAIVGAAYFLLLLIAGRLTRRRLQRVA"
FT   gene            709224..711389
FT                   /locus_tag="NT01EI_0716"
FT   CDS_pept        709224..711389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0716"
FT                   /product="TonB-dependent siderophore receptor family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0716"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67937"
FT                   /db_xref="GOA:C5B7R0"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR030149"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7R0"
FT                   /protein_id="ACR67937.2"
FT                   /translation="MSSLRLSHMGVGLLGAISLGCTSAAMAEESARPADEITVSGSQVA
FT                   LGDSYEGGQVARTGRLGMLGNSDFMDAPFILTSYTSALIEQQQAASVADVLQNDPTVRV
FT                   AKGFGNFQELYMIRGFPVYSDDMTLNGVYGILPRQFVAAEMLERVEVLRGANTFLNGAA
FT                   PGGSAVGGMVNLVPKRAGHTPLTRVTGGVQGDGQGYAALDVARRFGDDEANGVRVNLVG
FT                   RDGKSAVAREKQRLGALSVGFDHRRDRLQLSADIGYQDHHIDAPRPSVTPGGATLPAAP
FT                   SASKNYAQDWTYADEKQLFGVVRGEYLLNDNTRVWLGAGARQGKEHNLLANPTADGDGG
FT                   LSAFLFENVRQDNVLSADVGVRHDLITGSINHTLTLSAAAYQLRSKNAWAMSSTFSGFG
FT                   TLNDMWSVARPEATFFGGSLSDARETERNSSHSVALADTLGMLEDKIKLTLGGRWQRLE
FT                   TRSYDYDSGALSARYGKNALTPFVGALYQPSLEVALFANYAEALLPSGVAPATSNGVTV
FT                   SNAGQVFAPFRAQQIEAGAKYDNGMFGASVSLFQITRPEFRLDGTTYTDNGEQRNRGIE
FT                   LTLFGKPHERVTMLGGVTLLDARQQKSSPGGQDGKRAIGVPAVQANLNLGWETPFIDGL
FT                   ALEGRAVYTASQYADAANTLSIPAWVRVDLGARYALKLDGHDVTLRARVENLSDKRYWS
FT                   SVGGYPGSNYLVQGNPRTVIVSASYDF"
FT   gene            complement(711429..712031)
FT                   /locus_tag="NT01EI_0717"
FT   CDS_pept        complement(711429..712031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0717"
FT                   /product="3-isopropylmalate dehydratase, small subunit,
FT                   putative"
FT                   /EC_number="4.2.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0717"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67938"
FT                   /db_xref="GOA:C5B7R1"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5B7R1"
FT                   /protein_id="ACR67938.1"
FT                   /translation="MTEFTRHTGIVVPLDAANVDTDAIIPKQFLQKVTRSGFGRHLFHD
FT                   WRFLDEAGERPNPAFVLNQPPFQQGSILLARENFGCGSSREHAPWALTDYGFRVVIAPS
FT