(data stored in ACNUC10821 zone)

EMBL: CP001602

ID   CP001602; SV 2; circular; genomic DNA; STD; PRO; 3032624 BP.
XX
AC   CP001602;
XX
PR   Project:PRJNA36361;
XX
DT   21-JAN-2010 (Rel. 103, Created)
DT   13-JUN-2014 (Rel. 121, Last updated, Version 9)
XX
DE   Listeria monocytogenes 08-5578, complete genome.
XX
KW   .
XX
OS   Listeria monocytogenes 08-5578
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Listeriaceae; Listeria.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-3032624
RX   PUBMED; 20167121.
RA   Gilmour M.W., Graham M., Van Domselaar G., Tyler S., Kent H.,
RA   Trout-Yakel K.M., Larios O., Allen V., Lee B., Nadon C.;
RT   "High-throughput genome sequencing of two Listeria monocytogenes clinical
RT   isolates during a large foodborne outbreak";
RL   BMC Genomics 11:120-120(2010).
XX
RN   [2]
RP   1-3032624
RA   Gilmour M.W., Tyler S., Graham M., Van Domselaar G., Kent H.,
RA   Trout-Yakel K., Larios O., Allen V., Nadon C.;
RT   ;
RL   Submitted (09-APR-2009) to the INSDC.
RL   National Microbiology Laboratory, Public Health Agency of Canada, 1015
RL   Arlington Street, Winnipeg, Manitoba R3E 3R2, Canada
XX
RN   [3]
RC   Sequence update by submitter
RP   1-3032624
RA   Walker M., Reimer A., Tyler S., Graham M., Van Domselaar G., Kent H.,
RA   Knox N., Mabon P.;
RT   ;
RL   Submitted (12-JUN-2014) to the INSDC.
RL   National Microbiology Laboratory, Public Health Agency of Canada, 1015
RL   Arlington Street, Winnipeg, Manitoba R3E 3R2, Canada
XX
DR   MD5; 3eeddec18e6001424e0dda7e47d88846.
DR   BioSample; SAMN02603776.
DR   EnsemblGenomes-Gn; LM5578_rRNA01.
DR   EnsemblGenomes-Gn; LM5578_rRNA02.
DR   EnsemblGenomes-Gn; LM5578_rRNA03.
DR   EnsemblGenomes-Gn; LM5578_rRNA04.
DR   EnsemblGenomes-Gn; LM5578_rRNA05.
DR   EnsemblGenomes-Gn; LM5578_rRNA06.
DR   EnsemblGenomes-Gn; LM5578_rRNA07.
DR   EnsemblGenomes-Gn; LM5578_rRNA08.
DR   EnsemblGenomes-Gn; LM5578_rRNA09.
DR   EnsemblGenomes-Gn; LM5578_rRNA10.
DR   EnsemblGenomes-Gn; LM5578_rRNA11.
DR   EnsemblGenomes-Gn; LM5578_rRNA12.
DR   EnsemblGenomes-Gn; LM5578_rRNA13.
DR   EnsemblGenomes-Gn; LM5578_rRNA14.
DR   EnsemblGenomes-Gn; LM5578_rRNA15.
DR   EnsemblGenomes-Gn; LM5578_tRNA01.
DR   EnsemblGenomes-Gn; LM5578_tRNA02.
DR   EnsemblGenomes-Gn; LM5578_tRNA03.
DR   EnsemblGenomes-Gn; LM5578_tRNA04.
DR   EnsemblGenomes-Gn; LM5578_tRNA05.
DR   EnsemblGenomes-Gn; LM5578_tRNA06.
DR   EnsemblGenomes-Gn; LM5578_tRNA07.
DR   EnsemblGenomes-Gn; LM5578_tRNA08.
DR   EnsemblGenomes-Gn; LM5578_tRNA09.
DR   EnsemblGenomes-Gn; LM5578_tRNA10.
DR   EnsemblGenomes-Gn; LM5578_tRNA11.
DR   EnsemblGenomes-Gn; LM5578_tRNA12.
DR   EnsemblGenomes-Gn; LM5578_tRNA13.
DR   EnsemblGenomes-Gn; LM5578_tRNA14.
DR   EnsemblGenomes-Gn; LM5578_tRNA15.
DR   EnsemblGenomes-Gn; LM5578_tRNA16.
DR   EnsemblGenomes-Gn; LM5578_tRNA17.
DR   EnsemblGenomes-Gn; LM5578_tRNA18.
DR   EnsemblGenomes-Gn; LM5578_tRNA19.
DR   EnsemblGenomes-Gn; LM5578_tRNA20.
DR   EnsemblGenomes-Gn; LM5578_tRNA21.
DR   EnsemblGenomes-Gn; LM5578_tRNA22.
DR   EnsemblGenomes-Gn; LM5578_tRNA23.
DR   EnsemblGenomes-Gn; LM5578_tRNA24.
DR   EnsemblGenomes-Gn; LM5578_tRNA25.
DR   EnsemblGenomes-Gn; LM5578_tRNA26.
DR   EnsemblGenomes-Gn; LM5578_tRNA27.
DR   EnsemblGenomes-Gn; LM5578_tRNA28.
DR   EnsemblGenomes-Gn; LM5578_tRNA29.
DR   EnsemblGenomes-Gn; LM5578_tRNA30.
DR   EnsemblGenomes-Gn; LM5578_tRNA31.
DR   EnsemblGenomes-Gn; LM5578_tRNA32.
DR   EnsemblGenomes-Gn; LM5578_tRNA33.
DR   EnsemblGenomes-Gn; LM5578_tRNA34.
DR   EnsemblGenomes-Gn; LM5578_tRNA35.
DR   EnsemblGenomes-Gn; LM5578_tRNA36.
DR   EnsemblGenomes-Gn; LM5578_tRNA37.
DR   EnsemblGenomes-Gn; LM5578_tRNA38.
DR   EnsemblGenomes-Gn; LM5578_tRNA39.
DR   EnsemblGenomes-Gn; LM5578_tRNA40.
DR   EnsemblGenomes-Gn; LM5578_tRNA41.
DR   EnsemblGenomes-Gn; LM5578_tRNA42.
DR   EnsemblGenomes-Gn; LM5578_tRNA43.
DR   EnsemblGenomes-Gn; LM5578_tRNA44.
DR   EnsemblGenomes-Gn; LM5578_tRNA45.
DR   EnsemblGenomes-Gn; LM5578_tRNA46.
DR   EnsemblGenomes-Gn; LM5578_tRNA47.
DR   EnsemblGenomes-Gn; LM5578_tRNA48.
DR   EnsemblGenomes-Gn; LM5578_tRNA49.
DR   EnsemblGenomes-Gn; LM5578_tRNA50.
DR   EnsemblGenomes-Gn; LM5578_tRNA51.
DR   EnsemblGenomes-Gn; LM5578_tRNA52.
DR   EnsemblGenomes-Gn; LM5578_tRNA53.
DR   EnsemblGenomes-Gn; LM5578_tRNA54.
DR   EnsemblGenomes-Gn; LM5578_tRNA55.
DR   EnsemblGenomes-Gn; LM5578_tRNA56.
DR   EnsemblGenomes-Gn; LM5578_tRNA57.
DR   EnsemblGenomes-Gn; LM5578_tRNA58.
DR   EnsemblGenomes-Tr; LM5578_rRNA01-1.
DR   EnsemblGenomes-Tr; LM5578_rRNA02-1.
DR   EnsemblGenomes-Tr; LM5578_rRNA03-1.
DR   EnsemblGenomes-Tr; LM5578_rRNA04-1.
DR   EnsemblGenomes-Tr; LM5578_rRNA05-1.
DR   EnsemblGenomes-Tr; LM5578_rRNA06-1.
DR   EnsemblGenomes-Tr; LM5578_rRNA07-1.
DR   EnsemblGenomes-Tr; LM5578_rRNA08-1.
DR   EnsemblGenomes-Tr; LM5578_rRNA09-1.
DR   EnsemblGenomes-Tr; LM5578_rRNA10-1.
DR   EnsemblGenomes-Tr; LM5578_rRNA11-1.
DR   EnsemblGenomes-Tr; LM5578_rRNA12-1.
DR   EnsemblGenomes-Tr; LM5578_rRNA13-1.
DR   EnsemblGenomes-Tr; LM5578_rRNA14-1.
DR   EnsemblGenomes-Tr; LM5578_rRNA15-1.
DR   EnsemblGenomes-Tr; LM5578_tRNA01-1.
DR   EnsemblGenomes-Tr; LM5578_tRNA02-1.
DR   EnsemblGenomes-Tr; LM5578_tRNA03-1.
DR   EnsemblGenomes-Tr; LM5578_tRNA04-1.
DR   EnsemblGenomes-Tr; LM5578_tRNA05-1.
DR   EnsemblGenomes-Tr; LM5578_tRNA06-1.
DR   EnsemblGenomes-Tr; LM5578_tRNA07-1.
DR   EnsemblGenomes-Tr; LM5578_tRNA08-1.
DR   EnsemblGenomes-Tr; LM5578_tRNA09-1.
DR   EnsemblGenomes-Tr; LM5578_tRNA10-1.
DR   EnsemblGenomes-Tr; LM5578_tRNA11-1.
DR   EnsemblGenomes-Tr; LM5578_tRNA12-1.
DR   EnsemblGenomes-Tr; LM5578_tRNA13-1.
DR   EnsemblGenomes-Tr; LM5578_tRNA14-1.
DR   EnsemblGenomes-Tr; LM5578_tRNA15-1.
DR   EnsemblGenomes-Tr; LM5578_tRNA16-1.
DR   EnsemblGenomes-Tr; LM5578_tRNA17-1.
DR   EnsemblGenomes-Tr; LM5578_tRNA18-1.
DR   EnsemblGenomes-Tr; LM5578_tRNA19-1.
DR   EnsemblGenomes-Tr; LM5578_tRNA20-1.
DR   EnsemblGenomes-Tr; LM5578_tRNA21-1.
DR   EnsemblGenomes-Tr; LM5578_tRNA22-1.
DR   EnsemblGenomes-Tr; LM5578_tRNA23-1.
DR   EnsemblGenomes-Tr; LM5578_tRNA24-1.
DR   EnsemblGenomes-Tr; LM5578_tRNA25-1.
DR   EnsemblGenomes-Tr; LM5578_tRNA26-1.
DR   EnsemblGenomes-Tr; LM5578_tRNA27-1.
DR   EnsemblGenomes-Tr; LM5578_tRNA28-1.
DR   EnsemblGenomes-Tr; LM5578_tRNA29-1.
DR   EnsemblGenomes-Tr; LM5578_tRNA30-1.
DR   EnsemblGenomes-Tr; LM5578_tRNA31-1.
DR   EnsemblGenomes-Tr; LM5578_tRNA32-1.
DR   EnsemblGenomes-Tr; LM5578_tRNA33-1.
DR   EnsemblGenomes-Tr; LM5578_tRNA34-1.
DR   EnsemblGenomes-Tr; LM5578_tRNA35-1.
DR   EnsemblGenomes-Tr; LM5578_tRNA36-1.
DR   EnsemblGenomes-Tr; LM5578_tRNA37-1.
DR   EnsemblGenomes-Tr; LM5578_tRNA38-1.
DR   EnsemblGenomes-Tr; LM5578_tRNA39-1.
DR   EnsemblGenomes-Tr; LM5578_tRNA40-1.
DR   EnsemblGenomes-Tr; LM5578_tRNA41-1.
DR   EnsemblGenomes-Tr; LM5578_tRNA42-1.
DR   EnsemblGenomes-Tr; LM5578_tRNA43-1.
DR   EnsemblGenomes-Tr; LM5578_tRNA44-1.
DR   EnsemblGenomes-Tr; LM5578_tRNA45-1.
DR   EnsemblGenomes-Tr; LM5578_tRNA46-1.
DR   EnsemblGenomes-Tr; LM5578_tRNA47-1.
DR   EnsemblGenomes-Tr; LM5578_tRNA48-1.
DR   EnsemblGenomes-Tr; LM5578_tRNA49-1.
DR   EnsemblGenomes-Tr; LM5578_tRNA50-1.
DR   EnsemblGenomes-Tr; LM5578_tRNA51-1.
DR   EnsemblGenomes-Tr; LM5578_tRNA52-1.
DR   EnsemblGenomes-Tr; LM5578_tRNA53-1.
DR   EnsemblGenomes-Tr; LM5578_tRNA54-1.
DR   EnsemblGenomes-Tr; LM5578_tRNA55-1.
DR   EnsemblGenomes-Tr; LM5578_tRNA56-1.
DR   EnsemblGenomes-Tr; LM5578_tRNA57-1.
DR   EnsemblGenomes-Tr; LM5578_tRNA58-1.
DR   EuropePMC; PMC2834635; 20167121.
DR   EuropePMC; PMC4609684; 26311854.
DR   EuropePMC; PMC4725271; 26590290.
DR   EuropePMC; PMC4956650; 27499751.
DR   EuropePMC; PMC6558679; 31198443.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00002; 5_8S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00038; PrfA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00522; PreQ1.
DR   RFAM; RF00555; L13_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF00559; L21_leader.
DR   RFAM; RF00615; LhrA.
DR   RFAM; RF00616; LhrC.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01457; rli22.
DR   RFAM; RF01458; rli23.
DR   RFAM; RF01459; rliE.
DR   RFAM; RF01460; rliH.
DR   RFAM; RF01461; rli24.
DR   RFAM; RF01462; rli26.
DR   RFAM; RF01463; rli27.
DR   RFAM; RF01464; rliA.
DR   RFAM; RF01465; rli31.
DR   RFAM; RF01466; rli34.
DR   RFAM; RF01467; rli36.
DR   RFAM; RF01468; rli32.
DR   RFAM; RF01469; rli33.
DR   RFAM; RF01470; rli38.
DR   RFAM; RF01471; rliB.
DR   RFAM; RF01472; rli40.
DR   RFAM; RF01473; rli41.
DR   RFAM; RF01474; rli42.
DR   RFAM; RF01475; rli45.
DR   RFAM; RF01476; rliF.
DR   RFAM; RF01477; rli43.
DR   RFAM; RF01478; rli47.
DR   RFAM; RF01479; rli48.
DR   RFAM; RF01480; rli52.
DR   RFAM; RF01481; rli53.
DR   RFAM; RF01482; AdoCbl_riboswitch.
DR   RFAM; RF01483; rli56.
DR   RFAM; RF01484; rli59.
DR   RFAM; RF01485; rli61.
DR   RFAM; RF01486; rli62.
DR   RFAM; RF01487; rliI.
DR   RFAM; RF01488; rli49.
DR   RFAM; RF01489; sbrA.
DR   RFAM; RF01490; rli51.
DR   RFAM; RF01491; rli54.
DR   RFAM; RF01492; rli28.
DR   RFAM; RF01493; rli37.
DR   RFAM; RF01494; rliD.
DR   RFAM; RF01708; L17DE.
DR   RFAM; RF01749; pan.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01776; RatA.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001602.
DR   SILVA-SSU; CP001602.
XX
CC   On Jun 12, 2014 this sequence version replaced gi:284055817.
CC   Bacteria are available from Dr. Matthew Gilmour at
CC   Matthew_Gilmour@phac-aspc.gc.ca.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3032624
FT                   /organism="Listeria monocytogenes 08-5578"
FT                   /strain="08-5578"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:653938"
FT   gene            188..658
FT                   /locus_tag="LM5578_0001"
FT   CDS_pept        188..658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0001"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66759"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466379.1"
FT                   /protein_id="ADB66759.1"
FT                   /translation="MIFQRLLKTRDTEFYRVIQNRNIDDVFGYLLIHDKREPAEIDDFK
FT                   VFAKSNINKEAFSVNIKKNHIYTMFFHFTDLEEEQEIPKFTKVIRFIEGLLSFQPETSH
FT                   YVDNYLIKEKLIFEYPAEFEKIGEFAKYLVKLSGRKITIPDTTREKYIYLTQ"
FT   gene            826..960
FT                   /gene="rpmH"
FT                   /locus_tag="LM5578_0002"
FT   CDS_pept        826..960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmH"
FT                   /locus_tag="LM5578_0002"
FT                   /product="50S ribosomal protein L34"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66760"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466378.1"
FT                   /protein_id="ADB66760.1"
FT                   /translation="MKRTYQPSKRKRKKVHGFRTRMSTKNGRRVLASRRRKGRKVLSA"
FT   gene            1050..1409
FT                   /gene="rnpA"
FT                   /locus_tag="LM5578_0003"
FT   CDS_pept        1050..1409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnpA"
FT                   /locus_tag="LM5578_0003"
FT                   /product="ribonuclease P"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66761"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466377.1"
FT                   /protein_id="ADB66761.1"
FT                   /translation="MKKKYRIKKNDDFQKVFRRGKSFANRQFVVYTLKQEGSNHFRIGL
FT                   SVSKKIGNAVCRNRIKRYIRQSFHELESQINPENEYIIIARKPAANMDFHEVKKSLIHV
FT                   LKVGRVLKQKPNNSK"
FT   gene            1450..2313
FT                   /locus_tag="LM5578_0004"
FT   CDS_pept        1450..2313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0004"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66762"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466376.1"
FT                   /protein_id="ADB66762.1"
FT                   /translation="MKKKKRFKQKLLIASLVIGLMAVLSGCGYSTDPITSESTGFWSHY
FT                   IVFPLSWTITWFSDLFGGSYAVGIIVVTILIRLLIMPLMIKQLKSQKAMTNLQPKIKEL
FT                   QEKYSSKDNETKQKLQQETMRLYQENSVNPMMGCLPLLIQMPILLGFYQAISRTAEIKT
FT                   DSFLWMQLGNPDPYYILPVVAALTTFLSSKISMMGQTQQNKSMAMIVYIMPVMILFMGI
FT                   TLPSALALYWIIGNIFTVFQTLLINNPFKNKREQEALAAAQVAEDRLKKKAANMKASKK
FT                   GGKKRK"
FT   gene            2310..2930
FT                   /locus_tag="LM5578_0005"
FT   CDS_pept        2310..2930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0005"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66763"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466375.1"
FT                   /protein_id="ADB66763.1"
FT                   /translation="MRDITAQGSNVEEAIQNALATLETTRDKVEVEVLDEGKKGIFGIG
FT                   SRLAMVKVIEKEDGIQVAIDYLLDVATKMGAVITIDVEEVGKDVKLQIKGDSLGMLIGK
FT                   HGQTLNALQYLTQLIANKTTSQYKNIIVNVGDYRERRHETLVILANKMADKALKTKRAV
FT                   HLEPMPSFERKIIHAILSENEQIETHSEGRDPYRYIVIKPVRK"
FT   gene            3015..3446
FT                   /locus_tag="LM5578_0006"
FT   CDS_pept        3015..3446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0006"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66764"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466374.1"
FT                   /protein_id="ADB66764.1"
FT                   /translation="MWQKYQAEHPMITSKFEAWSFGNSARMANELGGLVMDGIKTGTSS
FT                   LFYWYDQGGETMPSVGSHVVLLDGNEEAIGIIKLIGVTIMPFNEVPETFAYLEGEGDRT
FT                   LEYWRKVHTSFFTNECVELGIPFEEDALVVCEEFEVVYK"
FT   gene            complement(3496..4476)
FT                   /locus_tag="LM5578_0007"
FT   CDS_pept        complement(3496..4476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0007"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66765"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466373.1"
FT                   /protein_id="ADB66765.1"
FT                   /translation="MEALNKKLFRLNSKEKIQKSTGTFVPDLPNGSFLKENGSMELLND
FT                   YFFKNKDIYISKHNRFADYPYHTHQFLELNYMYSGSSEQIIEGNKETLHEGELLLLDSG
FT                   CHHSIKATGEKDILINILFRDQQISLEWLTSIKKKNSLLFDFLLHSSVSEQSLKKYIIF
FT                   QSAQIPHIQQILNQIITEYFLEEEFSSRIITLYLPILFTELVRKCDTYLADDLTNSQSS
FT                   TTSTMLEVIKLIESNYRTITLTSAADTLGYNKNYLSNFIKKNTNFTFTELVNKQKMLAA
FT                   NLLIETTSTPIELIIEKVGFSNKTYFYSLYKRTFNLLPNEVRNKK"
FT   gene            4599..5867
FT                   /locus_tag="LM5578_0008"
FT   CDS_pept        4599..5867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0008"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66766"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466372.1"
FT                   /protein_id="ADB66766.1"
FT                   /translation="MAGSSTSKKGTIAVSLTNYLDSGCIVAGASGLTLWATQFGLSSFA
FT                   VGLLGAVSANAFGSAIGALIGGHLADKYGRKFIYTYNMLVYMLGVTIIMFAMNFPMLLI
FT                   GFLITGLSVGAGVPASWTYISEMADPSIRARNIGISQFAWSCGPAIIFTLGIIVSPLGL
FT                   LGNRLLFLSLLIVAFVAWQLQRKLEESKDWEAEQVKMKESGNRLEHPFKTAFSSMVNVK
FT                   SVLFLVGVYLFWNLVAGAMGFFMPFVYETVGGLSNTQANLLQAVLWILTAASTYFGFAK
FT                   FGDRVSHRGLFFVGALMAVASWVVLTFVGMSWVGLWTFVILWGISAGIGAQAFYALWST
FT                   ELFPTKYRGGVQGVMFFLVRGSTGVWSIVFPVILANLGFTVAGTIMIGLLTVSLLIGVI
FT                   WAPKTRGRSLDDITKERYGNTID"
FT   gene            5886..7337
FT                   /locus_tag="LM5578_0009"
FT   CDS_pept        5886..7337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0009"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66767"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466371.1"
FT                   /protein_id="ADB66767.1"
FT                   /translation="MKHYVAVDIGASSGRLILGKLVNEKLQLEEIHRFKNGFTYRDGHE
FT                   RWEIDQLMQEIFIGLEKVKQLGISECVLGIDTWGVDYVLIGASGEKLADPISYRDKRTL
FT                   NAVQNLTSKYPREYIYKKTGIQFMELNTLYQLYVEERDLLERAEKILLIPDYIGYVLTG
FT                   VKVAETTNSSTTQMLNLREQLFDKDLLSHLNIDVEKFAPLTDAGTYLGEVKEDWLKMYD
FT                   IPNCDVVTVATHDTASAVVGTPAEGENWAFLSSGTWSLIGMELSAPINNEAAFKENYTN
FT                   EWGAYGTYRFLKNIMGLWIVQEIARMDDYKHSFAEMAEEAGNYPYFKQIINVNDARFNN
FT                   PENMVDEIRLYCRETGQTVPETIGELTNCVYGSLALYYALELEKMTEITGKKIEKLYIV
FT                   GGGSNVAMLNQLTAKLAGIEVFAGPSEATAIGNLVVQMINQGEIESMRAGRKIIRNSFE
FT                   IGEFSCGDVRFEEIKERFTKVLEFN"
FT   gene            7350..8612
FT                   /locus_tag="LM5578_0010"
FT   CDS_pept        7350..8612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0010"
FT                   /product="L-rhamnose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66768"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466370.1"
FT                   /protein_id="ADB66768.1"
FT                   /translation="MGQETEISKRYQMAKERYQAIGVDTEKALKTLKDIKISMHCWQGD
FT                   DVKGFLNPDGELTGGIMATGNYPGAAHTPKQLRQDLEKAYSLIPGKHKLNLHAIYVDTD
FT                   EKVDLNEIEPKHFTPWVEWAKEQGLGLDFNPTFFSHPMFKDNYTLASPDKEVRDFWIEH
FT                   GKRSRKISEYFGKELGQTSINNFWVPDGIKDCPIDRYTPRKRLMEALDEVFAEKLDEKY
FT                   TQEAVESKLFGLGAEAYTVGSHEFYMGYGITRDKLICLDAGHFHPTEVISNKLSSLALF
FT                   SKGVMLHVSRPVRWDSDHVVIMDDELIEIGRELVRNDLLGITNIGLDFFDATINRIAAW
FT                   VVGTRNTQKSLLKALLEPTADLKKMELENDFTSRMAITEELKDFPFGDVWNYFCEINGV
FT                   PVGLDWLKEVKAYEEDVLLKR"
FT   gene            8625..9446
FT                   /locus_tag="LM5578_0011"
FT   CDS_pept        8625..9446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0011"
FT                   /product="rhamnulose-1-phosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66769"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466369.1"
FT                   /protein_id="ADB66769.1"
FT                   /translation="MTKDIMDAVFIKEMAKTTSNLYRLGWDERNGGNITYLLDEKEVAE
FT                   YLDVKQIIRTIPMDFDGEKLAGKYFLVTGSGKYFKNVEEAPAVNLGVIQVSEDGKAVHL
FT                   LWGYTDGGLPTSELPAHFMSHIARLSVDPENRVVMHCHATHLLAMTFTHELTERAFTRT
FT                   LWQMCTECLVVFPEGVGIIPWLVPGTNEIGEATSEKMKENRLIVWPHHGIYGAGQSMDE
FT                   TFGLIETAEKAAEVYTIVMSQGGIKQAITDEQLKALGERFGVEAKAGYLNN"
FT   gene            9459..9773
FT                   /locus_tag="LM5578_0012"
FT   CDS_pept        9459..9773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0012"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66770"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466368.1"
FT                   /protein_id="ADB66770.1"
FT                   /translation="MERVASIMYLYPGNKEEYKKRHDELWPEMKEALKAHGAANYSIFL
FT                   DEKTDTLFAYVEVEDKAIYDKIAETEICQKWWEYMAPIMKSNPNNSPVAVDLKEVFYLA
FT                   "
FT   gene            complement(9814..11226)
FT                   /locus_tag="LM5578_0013"
FT   CDS_pept        complement(9814..11226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66771"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466367.1"
FT                   /protein_id="ADB66771.1"
FT                   /translation="MEQTDKRKTLALISIMLGAFISLLDTTIVNVALPDITTALHATSE
FT                   TIEWVISGYALAFGLVLILAGRLGDKFGRKNIYIIGITLFLIMSVTAGFADSENSLIIS
FT                   RVIQGLAAGLFFPQINATIMDMYSGKSLGKIFGILGSVIGVGTAIGPLTGGLLIELFGA
FT                   TNGWRAVFFVNVPFVLVTLVLAMLYLPKRTVSTKKISFDLPGVGLLTIALLLLLFPLIS
FT                   NGANDFKPVDYFLMALSIPLFIILYKWSVYQEKKGNQPLIAPNLLKNNQFVSGMLLSLV
FT                   YFAAFTSIFFVLSLTWQTGFNRSAILSGLAISPFALGSVLAASNSYRLIPLLGRKLLML
FT                   GVTLVIVGLGTVSIVFHLNDGAFSAWLLFLPLFIAGIGSGLTIAPLNSFTLSTVTGIDR
FT                   GGASGMFNTAQRIGSSFGIAVVGSVFFRTLGNTAATSKASAFSDSLQMSMYVNIVLLVV
FT                   CFLLVFRLPKNI"
FT   gene            11381..11920
FT                   /locus_tag="LM5578_0014"
FT   CDS_pept        11381..11920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0014"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66772"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466366.1"
FT                   /protein_id="ADB66772.1"
FT                   /translation="MKNRKQMIKTERLFLSEMTLADTEILFGYWSDDSVTRYMNIEPFQ
FT                   SLQPVEEMIRMLRQLEIEGKALRCVIILQATGEIIGTCGFNYIDHENHRAEIAYDLGTR
FT                   FWKRGYATEAVRALMEWGKESFELHRIEAKVDPRNSASIALLEKLGFSEEGLLRDYEKI
FT                   GETYQDVQLFSWIDEI"
FT   gene            12056..14050
FT                   /locus_tag="LM5578_0015"
FT   CDS_pept        12056..14050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0015"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66773"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466365.1"
FT                   /protein_id="ADB66773.1"
FT                   /translation="MTKEYYFIKPELSSPETKQENIDSWLKTQDKTFYDAQIAQERDYC
FT                   FWCNIVETAKPNSRTSYTSMAYTLNEPNMLNSAGKTSFILSEEEVLYIHTLSVVRDGKV
FT                   IDKLDDINVKVLDYVRDENQASFNDEKKVTVLIRDLHLNDIFIVETTIERKYEESSIRN
FT                   DFFRWIYSAPNSYWAYGKYRFELKNETEKKLEANFHYFRDEAGTILEKDKVMVEHNESY
FT                   TIEKEDYIGEDAKELEITPFVDFVTEQTYPQITKTISDIYQKFYQVNLAEFAADIVTEL
FT                   DALPTLDHKIKHAIDFVQKEVYYLYNETEMDGHEPQAAEVTYKTKQGDCKAKTVLLKVI
FT                   LDYLGVNSELILVNYGSDVFLPVYTPSSFNFNHAILKITHNNQVYFIDATMSSDQGFLA
FT                   NRQKNSFMYYLEIKPGAELQKQEPFQDEIPSVEEVVYCDVKDNAAEITFERKLRGGMAN
FT                   GSREMFKNDSNKDIINRYNFAIYSNMTLYKKYEENEVDSHFSNTSIQIVEDNKDLNELS
FT                   IIYKATISDPYIVENKKRYLHFWNWNNFIDDGAEKHFHKDFPYWIDRNVIKTELHLTTD
FT                   KSIDQQERYTRQECDIKSKYLNHRMTKKIHKNGASCYLEYRPYHNLTIKEKDLEEYVEA
FT                   NKEILKSNWGIGIDIIEDGLFKKLGKLFK"
FT   gene            complement(14095..14167)
FT                   /locus_tag="LM5578_tRNA01"
FT   tRNA            complement(14095..14167)
FT                   /locus_tag="LM5578_tRNA01"
FT                   /product="tRNA-Val"
FT                   /note="Cove score: 68.03"
FT                   /inference="ab initio prediction:tRNAscan-SE:1.23"
FT   gene            complement(14189..15214)
FT                   /locus_tag="LM5578_0016"
FT   CDS_pept        complement(14189..15214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0016"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66774"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466364.1"
FT                   /protein_id="ADB66774.1"
FT                   /translation="MASTIYDIAKHAGVSKSTVSRVLNNQANISEESRKKVLAAIDQLN
FT                   YQPSKLARALTSSGFDAIMVISNRSTTTTTGNPFFSEIIQSISTQAELENFDLILQTAK
FT                   NSEDELKKCLSKIQEKMIKGIIMLSSPADEDFFHQLDPYNIPIVVTGKVEGHYKNIYSV
FT                   DTDNFGDSYALTKHLIKQGHQKIACIHAPLDYHVSIDRLAGFRSCLFDHQLDLRNDWII
FT                   DSGYSIEDSYKAALRLMEGPDKPTAVFATDDLKVLSIYKMAADKNLQIPTDFSVIGYND
FT                   KVASSFLSPPLTSIDIPINKLGKKATNLLFRLIHQDKNVPKTTIIQTEMIERESIQKIN
FT                   A"
FT   gene            15439..17139
FT                   /locus_tag="LM5578_0017"
FT   CDS_pept        15439..17139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0017"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66775"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466362.1"
FT                   /protein_id="ADB66775.1"
FT                   /translation="MTNLRKRLSRLYAEDVVDGLAARIETRVQQTQQRKLTRKDQWDEK
FT                   DIVLITYGDQFKEESKKTLTTFKKMYDSYLKSTFEVVHFLPFYPYSSDDGFSVIDYKAV
FT                   NPELGDWEDIKEMEQSARLMFDFVCNHMSAKSDWFKRYLAGDEEFRNFFVEMDPKTDLS
FT                   SVTRPRATPVLTPFQFDSGKVGHIWTTFSEDQIDLNFASPEVLYKMIDVLMFYLEEGAE
FT                   YVRLDAVGFMWKVPGTSSIHLEETHEIVKLFRDLVDIAAPGTIIITETNVPHVDNISYF
FT                   GNGEKEAHMVYQFPLPPLVLHAIHHGNAKFLRNWAKNLELPEGKRTFFNFLASHDGIGL
FT                   NPVRGIIPEAEILALVNDLEEEGALVSYKQNPDGSKSPYEINVTYMDALSKQADTDDLR
FT                   LARFLVAHAVLMSIPGVPAVYVQSILGSRNDYLGVEATSHNRSINRKKYDLAEITAELE
FT                   QRGSLRKATYDALTKLISTRKAESLFHPEIPMEVLESTAELFVVKRSSDAESIILIHNL
FT                   SEKEVSYSLDSGVYTNLYKGSTVTGSDSIKLSGYEFCWLKTKNYREEQK"
FT   gene            17136..18428
FT                   /locus_tag="LM5578_0018"
FT   CDS_pept        17136..18428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0018"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66776"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466361.1"
FT                   /protein_id="ADB66776.1"
FT                   /translation="MKKKSLVLLVVVLVLSAVLAACGGKESSSKEVTIEFMHSSVEKER
FT                   LDVINKLIADFEKENPTIKIKQIPVEEDAFNTKVVTLARSGKLPAVMEVSQDFAKVMDK
FT                   DELIDQDAVKEVIDSVGEDKYYEGATNLVRSEDGKSYIAAPLSGWVQGIWYNKKALADA
FT                   GFEEPKNWADIEKVAKKFTNKADKKYGIAIPTAESTMSEQAFSQFALSNKANVLDAKGN
FT                   VTIDTPEMKEALQYYKDLSAYTMPGSNDVTEIKDAFMNGTVPMAMYSTYILPSVYEEGD
FT                   PKNIGFAIPEEKEKAVYGTVSGLTISAGLDDEQKKATKKFVEYLSQPENMATWVLMSPG
FT                   GAQPVNKEVVEQKAYKENEVIKSFGDLPNEIAASFNDIQVFGLVDGKNLTKMGDITSSG
FT                   IIAQMVNNVTVGGGDVSADLKAAQKKAEEGK"
FT   gene            18503..19384
FT                   /locus_tag="LM5578_0019"
FT   CDS_pept        18503..19384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0019"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66777"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466360.1"
FT                   /protein_id="ADB66777.1"
FT                   /translation="MKTKVYKRSDFKLAMILLAPSFVLLAALVLYPMISNIQISFLDMP
FT                   LNPNIKSVFIGLQNYIDILKDPEFYKSLGLTVAYTALVVVGSTGMGLLVAIFFNREFRF
FT                   RRTARSLIILSYVTPSISLIFAWKYMFNNGYGVINFMTVDVLHMFKEAPLWFDNPVSSF
FT                   FLVTFFAIWRYFPYAFISFLAILQTVDKSLYEAADMDGANIWDKFKIVTLPAIMPVLAT
FT                   VITLRAIWMFYMFTDVYLLTNKVNILGVYLYKTAFAFNDLGKAAAISVILFVIIFVVII
FT                   FARKRVDLNGGK"
FT   gene            19371..20222
FT                   /locus_tag="LM5578_0020"
FT   CDS_pept        19371..20222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66778"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466359.1"
FT                   /protein_id="ADB66778.1"
FT                   /translation="MAVSSKKSKRTKKIAFYTTMVVFLCMTLFPFAIMLMTSFKSSKEA
FT                   ISTNPTFFPKEFTFQHYIDIFNPDIFPFLTYFKNSLVVSIFAAGIAVVLGILGAYALSK
FT                   LRFKGRMTINASFYTVYMFSGILLIVPLFKIISSLGLYDTETALIITMVVQTLPTAVFM
FT                   LKSYFDTIPTDIEEAAMMDGLNRFQIILRIIVPLAISGIVSVFVYCFMVAWNDYLFASI
FT                   FLSSSEKFTLPIGLNTLFSTPDYIWGRMMAASLVTALPVVIMYAISERFIKGNLTDGGV
FT                   KG"
FT   gene            20241..21293
FT                   /locus_tag="LM5578_0021"
FT   CDS_pept        20241..21293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0021"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66779"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466358.1"
FT                   /protein_id="ADB66779.1"
FT                   /translation="MKKLVATAPRVAALVEYNDREVLEDEVKIKVQFASPKHGTEVVDF
FT                   RGISPFIDEEFSPEWNLFVSRETNSARGIVFGEFQLGNMVVGEVVERGSKVTEYALGDI
FT                   VCSYGPIMETVIVKAVDNYKLRKLPKGANWKNAVCYDPAQFAMSGVRDAHVRAGDYVVV
FT                   VGLGAIGQIAIQLAKKAGASVVIGVDPLSHRREIAEKHGADATFDPITTDVGLEVKRLT
FT                   GKLGADSIIETSGNAAALQAALRGIAYGGTISYVAFAKPFPEGFNLGREAHFNNAKIVF
FT                   SRAASEPNPDYPRWDRKRIEETCWELLMNGYLDCSDIIDPVVPFADSAESYMKYVDQQP
FT                   DLSIKMGITL"
FT   gene            21306..22100
FT                   /locus_tag="LM5578_0022"
FT   CDS_pept        21306..22100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0022"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66780"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466357.1"
FT                   /protein_id="ADB66780.1"
FT                   /translation="MKLGTQNQAFFPENIEEKFAYVKEMGFEGFEIDGKLLVENLDEVK
FT                   KAIEKTGLPVSTACGGYDGWIGDFIEERRLNGLEEIKAILEALAEVGGQGIVVPAAWGM
FT                   FTYRLPPMASPRSQAGDFKAVSESLVYLDKIAGETGTKVYLEPLNRYQDHMINLLSDAQ
FT                   KYIDENNLKNVEIIADFYHMNIEEDSIPAALETYKDSIGHIHVADNHRYQPGSGSLDFK
FT                   TSFDQLKKNGYNGFLTFECRVRSENPEQAYKDALAHLKSCLI"
FT   gene            22158..23189
FT                   /locus_tag="LM5578_0023"
FT   CDS_pept        22158..23189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0023"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66781"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466356.1"
FT                   /protein_id="ADB66781.1"
FT                   /translation="MKKRVAIIGAGQVAEKVHAAYYKTRNELELVAVCDPSLERGEEFR
FT                   ANNGFEKHYAKAEEMFAAEKIDIVSICTPNRFHFDNVMLSLANGAAVMCEKPPAMSAAE
FT                   AKAMWELAEAKGAILAYDFHHRFSSEAQFLKRNSALLGEIYCVKATALRRSGVPGWGTF
FT                   TNKEMQGGGPLIDMGIHMLDAAMFVLGFPKVKKVTAKSFQKIGTKKSAGTFGSWDPEKY
FT                   TVEDSLFGFIELENGGLIELDTSFALHIKPESALNVDFFGDLAGGSLYPAEIYTDNAGE
FT                   FQLLEKLGQLDENKHENSMKAFVDSVLGAGKVELAGAKQGYIIQKIVESLYESAEKGES
FT                   VSL"
FT   gene            23186..25363
FT                   /locus_tag="LM5578_0024"
FT   CDS_pept        23186..25363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0024"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66782"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466355.1"
FT                   /protein_id="ADB66782.1"
FT                   /translation="MRKIIEKEFSLNYLNKYGSQMTVGNGYLGVRGALEEEYPEQVRGM
FT                   YVGGIYNRPSGSLSSELVNLPDVTRFQVMLDGETFSMQAGKIHAYERYLDMHTGELVRK
FT                   ITWESSAGKKYQLNFYRFVSKAAKHVIAAKVEIMPLSGVAKVKVKTGIDAQQTNFGTQQ
FT                   LAESSLRIFDEKLMVGEYETIESKQHITIATKVNKKGIFTAKNRQLMTEVEQEIAENQL
FT                   FTLEKISMVKTSLDQVDAELPNTTYAELKRASETLWADFWEHAGVRVESMNDFDQFALD
FT                   FACYHLEIMTPKDDFRCSVGAKGLTGEGYKGHVFWDTEIFIMPFFLYNKPEIAKQLLKY
FT                   RYLHLKEAKEKATKNGYNGALFPWESAFSGNEETPEFAAINIRTGTRQKVASAISEHHL
FT                   VADIAYAVCEYEAATKDAQFMKECGSELLLETAEFWLSRATNRNGRLEILDVIGPDEYT
FT                   EHIDNNTYTNYMAHYNVEKALAWNKDNADFVARAEAFLEKIYLPVANESGLIPQDDTFL
FT                   EKDWINLDKYKAAQGTQGILLDYSRQEVNELQILKQADLVMLFYLFPKMFAPDAVKQNL
FT                   DYYEKRTIHDSSLSKAIHAIVENRTGNRAQAYQFFQEACLIDLGSEPHSSDDGLHAASL
FT                   GAIWLAVVFGFVGIDTSGELLEIAPNLPGEWQSVVFEFSWKGEKILVEIAPNTLQLSKS
FT                   TKSVLELVIYGEKHQLTDTLTIKLDQKDVSL"
FT   gene            25360..26481
FT                   /locus_tag="LM5578_0025"
FT   CDS_pept        25360..26481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0025"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66783"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466354.1"
FT                   /protein_id="ADB66783.1"
FT                   /translation="MKIVIAPDSFKESLTAHEVAEYIKEGFQEIYPDADYHLLPVSDGG
FT                   EGTLEILSKALEAKKMKIDVSGPFSEPVSAQVAFTEGNKKALIEMAEVCGLHLVPTTRR
FT                   DPLQVSTKGVGELILHAMKKGATEIIIGIGGSASNDGGIGMASALGYEFLDAENNIVNP
FT                   IGVNLADIATIRSEKVPAELENITVNIVTDVENLLCGEAGASYVFGPQKGLATTDLATA
FT                   DEAMRHFYQLANPAMVTMPRAGAGGGIGAGLVTFAKANLLSGIDFVIEALQIKTICEDA
FT                   DLVIVGEGKMDGQTAQGKAPVGVAKVVPKETPVFAICGSVGEGLEAVYEVGISAVFPSI
FT                   AKPATLENILKETPNNLRRTARNVAAVWKGRVE"
FT   gene            26478..27140
FT                   /locus_tag="LM5578_0026"
FT   CDS_pept        26478..27140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66784"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466353.1"
FT                   /protein_id="ADB66784.1"
FT                   /translation="MTTALKGVVFDLDGVITDTAHYHYLAWKKTAESIGIEFDEAFNEN
FT                   LKGVSRIDSLLLILRKDGRENDFTEEQIEALAADKNEFYVSLLQEITPADVLPGIKELI
FT                   VDLKKQNLKCAIASVSKNARTVLSALEMEQEFDYIVDAAKITKSKPDPEIFVEACRGLG
FT                   LETSEVVGIEDAQAGIEAINAAGIVSVGVGSGLRDADMTVKSTGLLDLRILEILHSK"
FT   gene            27263..27583
FT                   /locus_tag="LM5578_0027"
FT   CDS_pept        27263..27583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0027"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66785"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466352.1"
FT                   /protein_id="ADB66785.1"
FT                   /translation="MAIIFAKEDDLEEIISSHPKILLNFWAEWCAPCRCFWPTLEQFAE
FT                   MEEGNVQVVKINVDKQRALAQKFDVKGIPNSLVLVDGEIKGAIAGIVSCDELRSRFKSL
FT                   AK"
FT   gene            complement(27639..28238)
FT                   /locus_tag="LM5578_0028"
FT   CDS_pept        complement(27639..28238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0028"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66786"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466351.1"
FT                   /protein_id="ADB66786.1"
FT                   /translation="MTNTFLDSIKVRRSIYALDKNVSVEDSKIEEIIKDAVKYSPSSFN
FT                   SQSSRAVILLGENHDKLWSIVEDTLRAIVPAENFAATEEKVGSFRAGYGTVLFFEDTAV
FT                   IEGLQENFALYADNFPVWSEQSSGIAQHSVWVALANAGIGASLQHYNPLIDDAVKAEWN
FT                   IPASWNLRAQMPFGNIVQEAGEKEFIDDADRFRVFK"
FT   gene            28432..28785
FT                   /locus_tag="LM5578_0029"
FT   CDS_pept        28432..28785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0029"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66787"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466350.1"
FT                   /protein_id="ADB66787.1"
FT                   /translation="MVTAIQKEQVRTAKNAAFLTSRPEVDYLERESFFITLKDAMKREW
FT                   VVRLSYFQEADVSSLRLAPFEYPSAFLGLGEIETQDLVPLEIDVLTEEVILKDIVGYEY
FT                   VIEFRDIIDVELL"
FT   gene            28888..29310
FT                   /locus_tag="LM5578_0030"
FT   CDS_pept        28888..29310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66788"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466349.1"
FT                   /protein_id="ADB66788.1"
FT                   /translation="MRGYYDEISFDVNTTAKKMHLFLLRSIASYDVTPEQWSVLEGIEA
FT                   NEPISQKEIALWTKKDTPTVNRIVDVLLRKELVVREVSTEDRRISLLSLTDKGRKETHE
FT                   LRDIVEASCEKMFAGISRADLEQFTTILKNISTNIE"
FT   gene            29324..30472
FT                   /locus_tag="LM5578_0031"
FT   CDS_pept        29324..30472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0031"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66789"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466348.1"
FT                   /protein_id="ADB66789.1"
FT                   /translation="MENKTRLWTKDYVFLLLGSVLLYIGFMVFMPTLPARIIELGGTQM
FT                   EASLAVGLFSIVALLMRAIAGSWNDKFGPKVLIIVGFLILILTTVNFYWSTAVAALLIL
FT                   RLFHGAGWGIGTTSIATGVSKLVPPSRTGEGIGFYGLTTALGMSLAPIIAILIMNYFSF
FT                   DVLVTFSLVLMVFILILMTQVKIPKSEKIVHQKMKLFEKTALLPAGLCLLMAIPLGGIQ
FT                   TFMMVYGTELGISTTWIYFIGQAIMVLVSRLFAGRLYDTKGHRFVIIPGALSMIIGILI
FT                   LSFATGAISLFIASLFFGLGYGMSQPALQALAVDRAAPHNKGTANGTFLSGMDIGMAVG
FT                   SFGLSIVATYYNYAIMYRTAIIALVVFFAVYWFTLGRKVKNS"
FT   gene            30843..31934
FT                   /gene="serC"
FT                   /locus_tag="LM5578_0032"
FT   CDS_pept        30843..31934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serC"
FT                   /locus_tag="LM5578_0032"
FT                   /product="phosphoserine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66790"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466347.1"
FT                   /protein_id="ADB66790.1"
FT                   /translation="MERVYNFSAGPAVLPVPVLEKVQRELLSYNGSGMSVMELSHRSEL
FT                   FQNILDDAESLIRELMEIPDNYKVLFLQGGASLQFDMVPMNLANGKKAAYVNTGSWAKK
FT                   AISEAKKIQGVEVEVIASSEDRNFSYIPEIPTVSSDAAYLHVTTNNTIEGTAMFDVPDS
FT                   TVPIVADMSSNILSSVYDVKKFGLIYAGAQKNIGPAGLTLVIVREDLIGQVEGLPSMLD
FT                   FKVQAENDSMYNTPPTFAIYVAKLVFEWIKEQGGVAGIEALNRKKAALLYDYIDQSDFF
FT                   SSPVEPSARSLTNVPFVTNSAEFDKAFVKEAEANGFENLKGHRSVGGMRASLYNAFPIE
FT                   GVEALIAFMEKFANARKGGEVRV"
FT   gene            31927..33114
FT                   /locus_tag="LM5578_0033"
FT   CDS_pept        31927..33114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0033"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66791"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466346.1"
FT                   /protein_id="ADB66791.1"
FT                   /translation="MFNIQTFNAIAKEGLKTFDLEKYVIDANQPADGILLRSYNLHDFD
FT                   FPETVKAVARAGAGVNNIPVENCSEKGIVVFNTPGANANAVKELVLASLFVSARPILEG
FT                   TEWVKELPAEDDVEQKVEAGKKAFAGTELAGKKLGIIGLGAIGALVANDALSLGMDVVG
FT                   YDPFVSVDTAWRISKEVERAMTIEEVLATCDYLTVHVPLTDKTRGMFNADTLQLVKDNA
FT                   VLLNFSRGELVDSASVKEALDDGLLRLYITDFATKELLNHKKVHVFPHLGASTEEAETN
FT                   CAKMAAKELQSYLETGSIKNSVNFPNVEMPYNGHPRIGICHKNIPNMVGQITTELGKYS
FT                   LNILDMINRSKNEYAYTLIDIDKETQANLEQLKQDLLAVQGVLRVRVIEPLGVTV"
FT   gene            33203..34444
FT                   /locus_tag="LM5578_0034"
FT   CDS_pept        33203..34444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66792"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466345.1"
FT                   /protein_id="ADB66792.1"
FT                   /translation="MVNIRPFKAIRPIKNLAEKVASLPYDVLNSEEARELGDANKYSFL
FT                   HIDKAEIDLDPAVSPYDPAVYKKAADNLEQFELDGWLGREANPAFYIYQLTMDGRPQTG
FT                   LVVCTSIDDYTNGKIKKHELTREEKELDRIRHVDVCDANTSPIFLTYRGKEAINALVES
FT                   WVNENEPEYDFESFHGVAHKVWAITDAHILEDLSAAFSEVPALYIADGHHRTESAVKVG
FT                   LKRREEFPDAGPEAEFNFFLSVVFPEEQLEILDYNRVVNVPIEVDFLSKVETSFDVEKV
FT                   GKEAFKPEKPKQVGMYLDGNWYKLTAKSEVIPNDVIGQLDVSILQSQVLTPIFGIEDIR
FT                   RDNRIDFVGGIRGLEELTRLVDNGSHSVAFAMYPPTMDDLLGVADAAEIMPPKSTWFEP
FT                   KLLSGLFVHDLESK"
FT   gene            34453..34776
FT                   /locus_tag="LM5578_0035"
FT   CDS_pept        34453..34776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66793"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466344.1"
FT                   /protein_id="ADB66793.1"
FT                   /translation="MKRISYFYSAENESEINLEIWKMFMNQSEAEREIHFDYTGIVFDI
FT                   QLGEVRKVDLPERVQALIDKNGMEALPILVVDDAIYNYGEFSVIDAVEELLDVGVSIQV
FT                   EED"
FT   gene            complement(34821..37376)
FT                   /gene="inlJ"
FT                   /locus_tag="LM5578_0036"
FT   CDS_pept        complement(34821..37376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="inlJ"
FT                   /locus_tag="LM5578_0036"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66794"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466343.1"
FT                   /protein_id="ADB66794.1"
FT                   /translation="MKTTKIVIASLVSLTMVSNPLLTFAATNDVIDNTTEITTDKETSS
FT                   TQPTIKNTLKAGQTQSFNDWFPDDNFASEVAAVFEMQATDTISEEQLATLTSLDCHNSS
FT                   ITDMTGIEKLTGLTKLICTSNNITTLDLSKNTNLTYLACDSNKLTNLDVTPLTKLTYLN
FT                   CDTNKLTKIDVSQNPLLTYLNCARNTLTEIDVSHNTQLTELDCHLNKKITKLDVTPQTQ
FT                   LTTLDCSFNKITALDVSQNKLLNRLNCDTNNITKLDLNQNIQLTFLDCSSNKLTEIDVT
FT                   PLTQLTYFDCSVNPLTELDVSTLSKLTTLHCIQTDLLEIDLTHNTQLIYFQAEGCRKIK
FT                   ELDVTHNTQLYLLDCQAAGITELDLSQNPKLVYLYLNNTELTELDVSHNTKLKSLSCVN
FT                   AHIQDFSSVGKIPALNNNFEAEGQTITMPKETLTNNSLTIAVSPDLLDQFGNPMNIEPG
FT                   DGGMYDQATNTITWENLSTDNPAVTYTFTSENGAIVGTVTTPFEAPQPIKGEDVTVHYL
FT                   DDKGEKLADDEVLSGNLDDPYTSSTKDIPDYTLTTTPDNATGTFTTTSQSVTYVYTKNI
FT                   VAAEPVTVNYVDDTGKTLSPSEILNGNVGDTYNATAKQIDGYTLSAEPTNATGQFTSSA
FT                   QTVNYIYTKNPAPEKGVVEIHYVDEDNKQLNSTTEISGTIGDNYTTEPKTIEGYTLTTT
FT                   PGNATGTFTTGSQTVTYVYTKNIEAAEPITVNYVDANGKTLAPSETLNGNVGDTYKATA
FT                   KQIDGYTLSAEPTNATGQFTSSAQTVNYIYTKNTNTDQPLPTKKPTNTTPTKPSNLKTT
FT                   EVKKASDTLPKTGDSTPWKSALLGVFLSSTALVIWKKKK"
FT   gene            37589..39931
FT                   /locus_tag="LM5578_0037"
FT   CDS_pept        37589..39931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0037"
FT                   /product="amino-terminal domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66795"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466342.1"
FT                   /protein_id="ADB66795.1"
FT                   /translation="MSHLKDYTIGIQHIKQLTSEISLGTKLVFAISGQITIKDSEQKFY
FT                   LQEGDILVLDRNTFYTIEGNEANLFINLTISDTFFAHYYEDYFQHSFKFFSKESDPGRE
FT                   RVVGSLRKSVSELLIASATKKRANKLEAQSALFQILLLLTRFLKKGVPSSARKEVNDKR
FT                   ISRIIREVEERFDEALSLRVFAQKEFLSEAYLSRYFKKTTGLGFLQYLTEVRLKHAIQD
FT                   LLHSAESITEIALKNGFSSQKHFSEVFKFHFELTPSEYRAEHHAETNLLIDNKASELGA
FT                   SIEQIVPSPEILVNLSRLYHDVEPGKELNKAPFEKKKIDITEKTARCLSENMNILTIGE
FT                   LKEVLKANVQKQIITTRDEIGINYIGIRHLFRGSTFLPETETDELVPTSSPYANADLAL
FT                   TFLKQQNLELFIRIEYQDIVGDVAAVFARLDHFLKHCMQVFGREFVSKWHFMFFEPKNT
FT                   YADKEELKKLYLKIYHIIKSRFPAIQVGNFVPFSLSKNEVPERHMWFLDVADKIDFVAY
FT                   NANQNEAVDFSKEDMKSFMISEDYCLSKTRKLKAFLKHHHINKPLMLVNWNTLTGNTRY
FT                   TNGTFFRGALVLKTMLDLAPEVDALGFWINTELHEGDDSQLNISLDGIEMFHFFDGKRP
FT                   AFYAVKFLRRLKGVVVAEGADFIMTKHTDGYQLILMNCANINPRYSVEERFTKEEQKEL
FT                   HIRITGLQAGEYQVCKWQFDRDNGALYSKYWQLNSKYGLDKEILDYIVDASQPTLTVSD
FT                   ETITEDWSFYAYLDINAIHFYEFRSTI"
FT   gene            40142..41329
FT                   /locus_tag="LM5578_0038"
FT   CDS_pept        40142..41329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0038"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66796"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466341.1"
FT                   /protein_id="ADB66796.1"
FT                   /translation="MKEKLFQKLDEKRDRMIEIRRYLHEHPELSFQEENTAKYIADFYK
FT                   EMDCDVRTHVGGNGVVVTIDTGKPGKTLAIRADFDALPIQEETGLAFASKNPGVMHACG
FT                   HDGHTAYMLILGETLIEMKQELTGKLVILHQHAEETPPGGAIQMIQDGALDGIDNVLGI
FT                   HVMSTMKTGEVFYREGAIQTGRSYFKLKVQGQGGHGSSPHLANDAIVAASEFVVAVQTV
FT                   ISRRLNPFDVGSITIGSFDGKGSFNVIKDAVELEGDVRSMSEEARNIIQKEITRIVSGI
FT                   EAMFGVTCELDYKNDYPVLNNDEALTDFVVKSIKGAKIPEITDVVRCEPQPPSEDFAYY
FT                   AKELPSSFFYVGAMPADGHFYPHHHPKFDINEDALLIASKAMGACVVDYLKGENN"
FT   gene            41329..42729
FT                   /locus_tag="LM5578_0039"
FT   CDS_pept        41329..42729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0039"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66797"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466340.1"
FT                   /protein_id="ADB66797.1"
FT                   /translation="MTSTAYKGTNKLIVGIVFGVITFWLFAQSMVNIVPAVQSDLGISS
FT                   DLLSIAISLTALFSGIFIVVAGGMADKFGRVKLTYIGLILSIIGSLLLVVTQGSTLLII
FT                   GRIIQGLSAACIMPATLALMKTYFDGADRQRALSYWSIGSWGGSGICSFAGGAIATYMG
FT                   WRWIFIISIVFALLGMLLIKGTPESKVVQNTKAKFDSFGLVLFVIAMVCLNLIITRGAT
FT                   FGWTSPITITMLVVFLVSAGLFFRVELRQANGFIDFSLFKNKAYTGATLSNFLLNAAAG
FT                   TLVVANTYVQIGRGFTAFQSGLLSIGYLVCVLGMIRIGEKILQRVGARKPMILGSGITA
FT                   VGIALMALTFIPGTLYTVLVFVGFALFGIGLGMYATPSTDSAISNAPEDKVGVASGIYK
FT                   MASSLGGSFGVAISATIYGVIALSGNIDLAAMVGLLTNVGFCVVSLISVAITTPSAKKA
FT                   LELKAAKE"
FT   gene            42745..43935
FT                   /locus_tag="LM5578_0040"
FT   CDS_pept        42745..43935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66798"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466339.1"
FT                   /protein_id="ADB66798.1"
FT                   /translation="MRTQLMNMLQERKDEITQIRRHLHEHPELSFHETETANFIQDFYK
FT                   GKDVEVATEVGNGHAVVVTIKGEKPGKTIALRADFDALPIEEQTELPFKSKNPGVMHAC
FT                   GHDGHTAYLLVLADCLIQLKENIPGTIKIVHQHAEETPPGGAKSVVESGILDDVDQIFG
FT                   IHVFPFGESGQVYYHSGYAMAGRTYFKLKIQGVGGHGSSPHMANDAIVAGAYFVTAIQT
FT                   VVSRRLNPFDTGVITIGSFDGKGSFNVIKDAVELEGDVRYMNTENRDKMDAEIHRIVAG
FT                   MEAMFSVTVELTYTNDYPPLYNDPAVTEQVVASLQKGVGEYLTGISEYDMLSGSEDFAY
FT                   YLQKIPGVFFYIGAKPKNTSIAYFNHHPKFDIDEDALLVAAKSVADVVLDYYKLNG"
FT   gene            44023..45216
FT                   /locus_tag="LM5578_0041"
FT   CDS_pept        44023..45216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0041"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66799"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466338.1"
FT                   /protein_id="ADB66799.1"
FT                   /translation="MNQVKGERHSLIVLLVLFIGYTSVYVDKYTIGISLVTVSQDLGFD
FT                   PSQKGLILSAFFLGYTLFQIPMGYLNNRIGARPVLAISIIIVGLFLVIFGFGYSLLFLV
FT                   VIRFLSGALGHAGYPPSVSNYISLHIPLNKRGFAQSAMLASSGFAAFIGPLLIAQLLLS
FT                   VGWRNTYYWIGFAVILIGFLILIVVPKAPKIDLNTQKEKIKVPFSELLKDKQLWILLLS
FT                   ALFINAANYGLTSWLASYLNEVRGISISEVSYISSLAGLCILIAGVVGGYFISRFFKGK
FT                   EPIIIFVFCVLGAFAVYGVYLFEQLALSVICLCLCNIFLIMAFTTLMGLPHKLFQQSHI
FT                   ATKYAAINSGGVLGGFFAPMIIGDLVNATNSYQSAFLFLALTLLVSGLIVLAIKNHQ"
FT   gene            complement(45263..45994)
FT                   /locus_tag="LM5578_0042"
FT   CDS_pept        complement(45263..45994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0042"
FT                   /product="3-ketoacyl-(acyl-carrier-protein) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66800"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466337.1"
FT                   /protein_id="ADB66800.1"
FT                   /translation="MTNKRVAFILGGSGGIGKAVVQKLVEQNFAVAVHYAGNKAKAETL
FT                   VENIVKSGGEAISVGGDVADEAQMIRAFDFIESQFGGIDVVINTAGIMKLSPIATLDMD
FT                   DFDLIQRTNIRGTFVVSKQAALRVRNGGAIINFSTSVTRTSFPTYGAYVASKAGVESLT
FT                   LILARELRGKDITVNAVAPGPTATPLFLTGKDDKTIDNLAKATPLERLGQPEDIAETVA
FT                   FLAGPARWVNGQVIFTNGGLA"
FT   gene            46155..46682
FT                   /locus_tag="LM5578_0043"
FT   CDS_pept        46155..46682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0043"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66801"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466336.1"
FT                   /protein_id="ADB66801.1"
FT                   /translation="MARLSQEIILNMAEKIIYEKGMEKTTLYDIASNLNVTHAALYKHY
FT                   RNKEDLFQKLALRWLEETSREIFAWTQDAGQTPDDALHDWLWLLADTKKKRYKTDRKMF
FT                   LLYTDYIEQNEELVKNHVAHLAQKAEEVSGRTNQGNAIITAFTYFHNPYFASRWEQAGY
FT                   VDLFEDVWQIVK"
FT   gene            46706..47416
FT                   /locus_tag="LM5578_0044"
FT   CDS_pept        46706..47416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0044"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66802"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466335.1"
FT                   /protein_id="ADB66802.1"
FT                   /translation="MTENTTIAKRILQFNEALANCSFDLPEGYRTVNPYSGDQSELVQK
FT                   ITMAFYQKYYNDTKPRRIILGSSPARRGSAVTGVPFEDAKHIQNETGIFIDKFYINQSS
FT                   SDFLYDVMTEYGGCKPFYTDFYMNFVCPLGIVRMNAKGNEVNCNYYENKKLQEALRPFI
FT                   LESLQNQIDCGIDTSVCYCIGSGENFNFLSKINDEHHFFDTIIPLEHPRFIMQYNSKNK
FT                   DVYMEKYLCALKNQ"
FT   gene            47436..47996
FT                   /locus_tag="LM5578_0045"
FT   CDS_pept        47436..47996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0045"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66803"
FT                   /protein_id="ADB66803.1"
FT                   /translation="MTTNREEEDNMKVDTQKIVNFAIEGVEKFLQENPELTYYAFAFDC
FT                   NAEYAEINLCVNTEKAFAETLARYQNGKYSENYQTEEEIQELKYNTGDWKYQCFDIFYV
FT                   FSEEELTAIFNQIYPNEVDDDYQAWEVYVNELLVTFTESIIKFSETKTFEKINKTVDFK
FT                   FFCIDHDEEVADSMTRMKLLQEK"
FT   gene            complement(48044..48862)
FT                   /locus_tag="LM5578_0046"
FT   CDS_pept        complement(48044..48862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0046"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66804"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466334.1"
FT                   /protein_id="ADB66804.1"
FT                   /translation="MKIHKLTWVLLMGLLLLSSCSTKQPNLYLSANAAAVYSVENGEAL
FT                   YEKKTDKVMPIASLTKLMTAFLVLEAVDNNELSWDEKLNLVRLDDPSAVSLYAITQKRT
FT                   WSVRDLYSAMLTMSANDAAETLGDRLDGANFPKEMNNQAKKLGMSSKTTFVSASGLDVD
FT                   GKSAVSTTKDLFLLSSKLISTHPEVLETTSKPTVTTDKGAKLESTNDLLGSIQGLDGLK
FT                   TGFTDEAGYCFIGTAERGGKRVISIVLDAGTAEKRFKDTEKLMEVGFKGL"
FT   gene            49220..50593
FT                   /gene="trmE"
FT                   /locus_tag="LM5578_0047"
FT   CDS_pept        49220..50593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmE"
FT                   /locus_tag="LM5578_0047"
FT                   /product="tRNA modification GTPase TrmE"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66805"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466333.1"
FT                   /protein_id="ADB66805.1"
FT                   /translation="MEFDTIAAISTPPGEGAIAIIRLSGPEAIQIADRIFYAKNSLSEA
FT                   ESHTIHYGHIKEDGEVIEEVMVTVMRAPRTFTREDVVEINAHGGIVSVNRVLQLLLRNG
FT                   ANLAEPGEFTKRAFLNGRIDLSQAEAVMDLIRAKTDRAMGVAIRQMDGNLSRLIRNLRQ
FT                   EILDALAQVEVNIDYPEYDDVEEMTQRMLLEKTELVRASVEQLLQTASQGKILREGLAT
FT                   AIIGRPNVGKSSLLNQLIQEEKAIVTDIAGTTRDIIEEYVNVRGVPLRLIDTAGIRETE
FT                   DIVEKIGVERSRKALADADFILLVLNQNEELTVEDEALFEAAAGHNYVVVLNKTDLETK
FT                   LDINRVRELAGENPIVSTSLVNDEGLEALEEAIKTLFFAGDIDAGDATYVSNVRHIALL
FT                   HQALEALNGVTTGIQLGMPVDIVQIDMTRAWDLLGEITGDSVQDELLDQLFNQFCLGK"
FT   gene            50618..52507
FT                   /gene="gidA"
FT                   /locus_tag="LM5578_0048"
FT   CDS_pept        50618..52507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidA"
FT                   /locus_tag="LM5578_0048"
FT                   /product="tRNA uridine 5-carboxymethylaminomethyl
FT                   modification enzyme GidA"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66806"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466332.1"
FT                   /protein_id="ADB66806.1"
FT                   /translation="MQTYDAGTFDVIVVGAGHAGVEAGLASGRMGAKTLMLTINLDMVA
FT                   FMPCNPSVGGPAKGVVVREIDALGGEMGRNTDKTYIQMRMLNTGKGPAVRALRAQADKW
FT                   DYQHEMKHTIEKEENITLRQGLVDRLVIEDGVCKGVITNSGAIYYAKTVVITTGTFSRG
FT                   EIIVGELRYSSGPNNQQPSVKLSEHLEELGFELRRFKTGTPPRVKSSTIDYSKTEEQPG
FT                   DDHPRAFSFDTVEMLLDQLPCWLTYTNETTHEIIQANLHRSPMFTATKKGTGARYCPSI
FT                   EDKIVRFSDKPRHQIFLEPEGKNTEEVYVQGLSTSLPEEVQREMLRTIPGLENVEMMRV
FT                   GYAIEYDAVMPDQLWPSLETKLVEGLFTAGQINGTSGYEEAAGQGLMAGINAARKVFEK
FT                   EPVILGRDQAYIGVLIDDLVTKGTEEPYRLLTSRAEYRLLLRHDNADLRLTEIGHEIGL
FT                   ISDERYERFLAKQSAIEAEKERLQKTRIKPTAEVQAMLKEIGSGELKDGILAADLLRRP
FT                   EITYDKIAQIVSRETFVTDEIAEQVEIQIKYEGYIQKSNLQVEKMKRMEDKKIPENIDY
FT                   DAISGLATEALEKLKKIEPLSIAQASRISGVNPADISILLVYIEQGKIAKISK"
FT   gene            52666..53046
FT                   /locus_tag="LM5578_0049"
FT   CDS_pept        52666..53046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0049"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66807"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466331.1"
FT                   /protein_id="ADB66807.1"
FT                   /translation="MKKRWIIATVVLVMIVAGLGVKFYMDEEKLNKEMINVVYSDEAKR
FT                   VFENGLKNLDAEALTGKGVINTYEIDKKSIKQNPMGGINVTLHVNGDSELYVFFTLNKA
FT                   DDKKLIDDGGGNSAKLEKLLDN"
FT   gene            53071..53454
FT                   /locus_tag="LM5578_0050"
FT   CDS_pept        53071..53454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66808"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466330.1"
FT                   /protein_id="ADB66808.1"
FT                   /translation="MKKRWIVLFGIAIMIIFGLGIKFYMDEEKLNKEMIKVIYSDEAKQ
FT                   VFEKRLTNLDAKAFTKEGIIQSYKIDEGSIKSNPMGGIEVRLIINNNSELYASYTMSRN
FT                   NGVLGGGGAIISKELARQTEVKD"
FT   gene            53451..53834
FT                   /locus_tag="LM5578_0051"
FT   CDS_pept        53451..53834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0051"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66809"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466329.1"
FT                   /protein_id="ADB66809.1"
FT                   /translation="MKKKWIIILGIVIIVIFAIGVKFYMDEKRLNEEMMNVIYSDEAKE
FT                   AFDKDLKGMDSKAFTEEGKVHSYEIVRESIRRNPMGGINVELIINNDSEMGIEYTMDKF
FT                   NGQLRCGGASISEKLAKLLGIWK"
FT   gene            53971..54324
FT                   /locus_tag="LM5578_0052"
FT   CDS_pept        53971..54324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0052"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66810"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466328.1"
FT                   /protein_id="ADB66810.1"
FT                   /translation="MTIFGLGVKFYMDEEKLNTEMMNVVCSNEAKEVFNDDIKLIDTKA
FT                   FTKEGLIQSYEVDKESIEPNPMGGIIVALVINKDSALKLTYTLKKNNEELKSGGASISK
FT                   ELTKQLGLLNGYK"
FT   gene            54437..54829
FT                   /locus_tag="LM5578_0053"
FT   CDS_pept        54437..54829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0053"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66811"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466327.1"
FT                   /protein_id="ADB66811.1"
FT                   /translation="MKKRWIIVLGITVITIFGLGVKFYMDEEKLNKEMMNVVYSDEAKQ
FT                   VFEFRLKAADADAFTEKGVIQSYEIDQKSIKKNPMGGINVTLIINGNPELYIKYTMNNF
FT                   NGELSGGASVTSGNLDKLLGDKEGEK"
FT   gene            54826..56109
FT                   /locus_tag="LM5578_0054"
FT   CDS_pept        54826..56109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0054"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66812"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466326.1"
FT                   /protein_id="ADB66812.1"
FT                   /translation="MSQAITDQERVELAQKEYEDYKLKDKVKILKVNGNEQTIGIVSQK
FT                   INNKSTGEQSYIITDKYTPPTASISERSKVKELTILYKGSTAPANGNLNVPKHPDYKDV
FT                   RKDWLSNDIPTAIQITNGGGSTVTPQLKTSAETLKQTMKLYPNAQIYVYGHSLGSMNAQ
FT                   YAIADLDKKDIKRISGGFFYQGPNIYSNLTPKQQDTVKAINALDRLFNFVDRKDLVPIG
FT                   YGIGDPTIGHLIEVESKKAGMVEQHMWGGYQFDEDGNILTDKEGSLRLAKYATAQQLAA
FT                   INIMRTNFSKSGGALSSSEEIFLDAAEGLAITQGMKQTIQGEIKDLKDMFDKAIENAEE
FT                   LWRDTLSDARDIGSHLAESEILAALAWGGVTEPEIVIETVQDCEKSLAEATKIEQEYDK
FT                   LLEQINEAIKSQLKTDQELAKQIGSMYG"
FT   gene            56102..56464
FT                   /locus_tag="LM5578_0055"
FT   CDS_pept        56102..56464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0055"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66813"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466325.1"
FT                   /protein_id="ADB66813.1"
FT                   /translation="MDKQRQLLLKIENLEDDFNRKRRQLDEAMDEAFQEKWRFHQELEN
FT                   LSEQIRYIYQKRDYDASEDLPKAYHLISSIQEEGEWMVKNAVTHLENESEEHQTLYKKQ
FT                   VTAYEEELHQLKKERD"
FT   gene            56469..56735
FT                   /locus_tag="LM5578_0056"
FT   CDS_pept        56469..56735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0056"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66814"
FT                   /protein_id="ADB66814.1"
FT                   /translation="MIDKLRADLLESRKSLEINLIWMFVARQTYAASENRKRMLKMMKR
FT                   DKIEDIKSNCTSYIDGLSTTAKGKWVTKAKASFKENVNKFDNC"
FT   gene            56888..57604
FT                   /gene="gidB"
FT                   /locus_tag="LM5578_0057"
FT   CDS_pept        56888..57604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidB"
FT                   /locus_tag="LM5578_0057"
FT                   /product="glucose-inhibited division protein B"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66815"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466324.1"
FT                   /protein_id="ADB66815.1"
FT                   /translation="MNPEQFQMALAEKGIELSDDQMKQFHDYFEMLVEWNEKMNLTAIT
FT                   DEKEVYLKHFYDSISAAFYVDFTKFDTICDVGAGAGFPSLPIKICFPHLKVSIVDSLKK
FT                   RMTFLDALAEKLGLTDVHFYHDRAETFGQNKAHREKYDLVTARAVARMSVLSELCMPLV
FT                   KKGGSFLVMKAAQAEQELQTAEKAIKLFGGKVEEHFSFSLPVEESERNIYVITKTKETP
FT                   NKYPRKPGTPNKLPIE"
FT   gene            57806..58519
FT                   /locus_tag="LM5578_0058"
FT   CDS_pept        57806..58519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0058"
FT                   /product="N-acetylmannosamine-6-phosphate 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66816"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466323.1"
FT                   /protein_id="ADB66816.1"
FT                   /translation="MGNSVMEKIKGGLVVSCQALEDEPLHSAFIMSKMALAAVQGGAVG
FT                   IRANTAKDIRAIQSEIDVPIIGIYKKDYDDSDVFITPTLKEVREICETGVEIVAMDATT
FT                   RKRPHNEDLKDILSAIRKEFPNTLFMADTGSIEDVYYADSLGFDLIGTTLYGYTEETAN
FT                   KNISDDDFSHLKEVLKSTKRPVIAEGKIDSPSKARQVLTLGCYAVVVGGAVTRPQEITT
FT                   RFTNEIQKIQEERGK"
FT   gene            58521..59522
FT                   /locus_tag="LM5578_0059"
FT   CDS_pept        58521..59522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0059"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66817"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466322.1"
FT                   /protein_id="ADB66817.1"
FT                   /translation="MTKQIKVGVIGVGQMGQYHAEIYQKLPQVELVAICEYNDERRAEM
FT                   AEKFQCKAYKDYHELLANTEIEAVSIVLPDNMHRDCVEEAVKYKKHILLEKPLAKELED
FT                   GKAMYELTKDYDKVFTVGFLLRFDPRFNMIKQRLDNGELGDIIHLYCRRNSPITGPKRY
FT                   IGASDLSMHVMIHDIDYINWYMDSEPVKVIAKSRSVLLKEYGMNDVIYAIVTYENGAIA
FT                   CLEACWVLPENSPTIIDDKLELVGTKGVAYVDSCDHGVRFVSEKGVSYPDSRHWYYTNG
FT                   EVSGDLAEEVMAFINNVANNTKSIITPKEAYDSLRVVDAIERSIAEGKEVSL"
FT   gene            59556..60962
FT                   /locus_tag="LM5578_0060"
FT   CDS_pept        59556..60962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66818"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466321.1"
FT                   /protein_id="ADB66818.1"
FT                   /translation="MSIRVHVQKFGSKLSGMVIPNLGAFMAWGILTAIGVATGSEMLKG
FT                   FIAPMLNYLLPLLIAFAGGRAVHGYRGGVIGTVATMGAIISSDITMFIGAMIMGPLAAW
FT                   ILKKFDERIDGKIPAGFELLVNNFSIGIIGAGLALFSYVAIAPMVEAVTKVLASGVDVL
FT                   INNHLLPLTALIIEPAKVLFLNNAIGQGILSPLATLQLAETGKSVLYLLESNPGPGLGI
FT                   LLGYMFFGKGNSKASSYGASVIHLFGGIHEIYFPFVLMNPILILPLILGGMTGTFILTM
FT                   TNAGLVGVASPGSIITIMMMAAPGDHIKILIAVLCAALVTFITAIPFIKRMGNKDSELQ
FT                   DAAKKMEGLKGKKSSISSVFEAPVDDFNFKNVKRIAYACDAGLGSSAMGATVLQKKIKN
FT                   AGLEDIKVFHIAIHELPTECDVVVTHKSLIDRAKEKQPDAYYVEITDYLGAPEYQELID
FT                   KIVADREQKN"
FT   gene            61025..61681
FT                   /locus_tag="LM5578_0061"
FT   CDS_pept        61025..61681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0061"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66819"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466320.1"
FT                   /protein_id="ADB66819.1"
FT                   /translation="MLKAIVMDFDGIVIDTEVVWYEIFKEWFKTKQNYDLSIEEFLQCV
FT                   GSNVDDLFRELNETKQMDINRQVFEAETQAIFIENSKSLPAKEGVGSFIRGLKERGLKL
FT                   ALATSSQRPKPLYHLERLGLLEYFDAIITAEDVTRIKPEPDLFLEALRVLDVKPSESLI
FT                   VEDSRNGLLAGNSAGVNVLVIPNEVTKHSDLTPNYMERESLAEVDLTEIMAEYNK"
FT   gene            61694..62140
FT                   /locus_tag="LM5578_0062"
FT   CDS_pept        61694..62140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0062"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66820"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466319.1"
FT                   /protein_id="ADB66820.1"
FT                   /translation="MLLDRVTLEDIEVNLKAEDWREAIQMSARLLLERGAIKESYIDGM
FT                   IQSVENNGPYIVIAKHIALAHTRPEFGVIHGGLTFATLADGVAFGSDMFDPVKLIITLA
FT                   ATDSESHLEVLSELAEVLMDEEKVTRLIEANSSQAFYDELTKEG"
FT   gene            62165..63070
FT                   /locus_tag="LM5578_0063"
FT   CDS_pept        62165..63070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66821"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466318.1"
FT                   /protein_id="ADB66821.1"
FT                   /translation="MENYLCVDIGGTSIKYAKFNQEGKRVGELKSCVTPITGGANQIMP
FT                   ALIRIVEQEKTDVAGVCVASAGVVDSVKGKIIYAGYTIPKYTGTEIKAELEHRFNLPCA
FT                   VENDVNAACLGEFWLGGARGCGSVLCLTIGTGIGGAMLLNDKLINGSSFTACEVGYMHL
FT                   SQGRFQDVASTKALIKQVASRKNIEENALNGRQVMEWAYSGDADVLAEIEQWIENLVEG
FT                   VVNLIYIFNPEVIVLGGGLMEEESFFKPRLKAAISTKLISPMFDTADITFAKLGNEAGM
FT                   IGALYHFLNQKEAEKDDDFK"
FT   gene            63054..63860
FT                   /locus_tag="LM5578_0064"
FT   CDS_pept        63054..63860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0064"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66822"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466317.1"
FT                   /protein_id="ADB66822.1"
FT                   /translation="MTILNEIQQNYNRLPNKEKQIAKYILEKSDELKNINIKELAEETG
FT                   TSISTITRFCRHVRCDSFVDLKMRVNTAATMVPSLGYDDLFEEVYSFYHKVIDNTVKLI
FT                   EPAKIREVVQYIQEAKRVYICGVGSSGLTAVEMSQRLIRMGLNVISVNDPHMMIITSSI
FT                   TTKEDFVIGISNSGNTPELVTALKNAKKNKSKVATFTSFENSEMTEISDVTIPVYNTLF
FT                   VSKRYFANSQFSIMYVMDIISMMLLQNESYRDNMEKTINTVTDEFH"
FT   gene            64032..64886
FT                   /locus_tag="LM5578_0065"
FT   CDS_pept        64032..64886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0065"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66823"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466316.1"
FT                   /protein_id="ADB66823.1"
FT                   /translation="MPFSRLFGKKEKNQMDDIVEEGVQRVQELPMDKIFPNQFQPRTVF
FT                   DQDKIDELARTIRIHGVIQPIVVREMEPDYYEIIAGERRFRAVLSLEMEKIPAIIQNLD
FT                   DEEVAAIALIENLQREELTPIEEAKAYRSLLDMQDVTQEALAQRVGKSQSAIANKMRLL
FT                   KLPETVQEAVLIKQISERHARSLLALETEEQQVALLAEIAENHWNVKQTEARIQEILGV
FT                   KKQVATKKTKPKRQAISRDVRIAMNTIKQSVTMVKDNGMDLDFTEEETDDFYQITIQIP
FT                   KKK"
FT   gene            64898..65197
FT                   /locus_tag="LM5578_0066"
FT   CDS_pept        64898..65197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0066"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66824"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466315.1"
FT                   /protein_id="ADB66824.1"
FT                   /translation="MRFLKIIGHAVGVISCLMVLPSFVIAITSAILSFNPLYITYFFTS
FT                   PYARAVAVAEESGWGSGFNILLVNYGAYLIAFGYTFFAIVKIYSWYQIAKEVKK"
FT   gene            65392..66114
FT                   /locus_tag="LM5578_0067"
FT   CDS_pept        65392..66114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0067"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66825"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466314.1"
FT                   /protein_id="ADB66825.1"
FT                   /translation="MAKIIFVKDEQNEFQAYDFLQNLIVEEPLMATLVFQGLLQLETAE
FT                   TRKLSTGKQILPDVHLIIGKSQAYSLQTTRVETTVDQPIQEMKAHFKDKNCRLIYFTAF
FT                   SGDETYYCFVKGYFKDKNPFTDQMSSYREEVKRVFLRRIEAETSIGNADYQFETLKNKA
FT                   LENEGIAHYLESFSASLGKYIFSKRMEKKWSQLDLALKSDLSPVIIGRLEAGDPDLTLR
FT                   MYQKVCTVLGVKATFSVD"
FT   gene            66338..67099
FT                   /gene="parA"
FT                   /locus_tag="LM5578_0068"
FT   CDS_pept        66338..67099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parA"
FT                   /locus_tag="LM5578_0068"
FT                   /product="partition protein, ParA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66826"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466313.1"
FT                   /protein_id="ADB66826.1"
FT                   /translation="MSKVIALANQKGGVGKTTSSVNLSSSLAFLGKKVLLVDIDPQGNA
FT                   SSGVGVNKGEIEHCIYDVLVDDVAIQDVLQKTDLDNLNVIPATIQLAGAEVELVPAISR
FT                   EIRLKKAIDSIRDDYDYVIIDCPPSLGLLTLNALTAADSVLIPVQCEYYALEGLSQLLN
FT                   TIRIVQKHLNEDLQIEGVLLTMLDARTNLGIQVIEEVKKYFQNKVFNTIIPRNVRLSEA
FT                   PSHGKPILLYDAKSKGAEVYLELAKEVVAHG"
FT   gene            67092..67943
FT                   /gene="parB"
FT                   /locus_tag="LM5578_0069"
FT   CDS_pept        67092..67943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parB"
FT                   /locus_tag="LM5578_0069"
FT                   /product="partition protein ParB homolg"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66827"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466312.1"
FT                   /protein_id="ADB66827.1"
FT                   /translation="MAKGLGKGINALFNNVDTNEETVQNIAIKEIKPNPYQPRKIFDAK
FT                   AINELRDSIKIHGVLQPIILRNTDKGYEIVVGERRYRAAKEAKLKEIPAVVRDLTEEEM
FT                   MELSVIENLQREDLSPLEEAESYQFLMKKLSLTQAKLAERVGKSRPYIANFVRLLTLPE
FT                   EVQVMLRDGSLSAGHGRVLLGLKLKKNIIPTAKKAVAQGLTVRQLEDVVNNLNENVSRE
FT                   TIKPARVPIFIRESESQLRDKFGTAVSIKRRDKKGKIEIEFLSDDDLDRILEILDIQFD
FT                   DE"
FT   gene            67956..68156
FT                   /locus_tag="LM5578_0070"
FT   CDS_pept        67956..68156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66828"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466311.1"
FT                   /protein_id="ADB66828.1"
FT                   /translation="MEKKHFDLNDVVEMKKPHPCGTNRFKIIRMGMDIRIKCEGCGHSV
FT                   MIPRREFERKVKKILVKAEQE"
FT   gene            68328..69158
FT                   /gene="bvrA"
FT                   /locus_tag="LM5578_0071"
FT   CDS_pept        68328..69158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bvrA"
FT                   /locus_tag="LM5578_0071"
FT                   /product="transcription antiterminator"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66829"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466310.1"
FT                   /protein_id="ADB66829.1"
FT                   /translation="MLRVKRVFNNNTILVHDSNGLEKIVIGKGISFNKRVGNIISEEAV
FT                   EKTFIVDSPEITERFVQLIKEVPINHLDLTNKIIKDAESELNVTFDELTYLGLADHINY
FT                   AISRYKSGHQIKNALLLEIKKFYPKEFNAAKNSVKTISYYENVKLLEDEAGFIALHFVN
FT                   GQQEGIINNTLITTEVLKKVLLILEDTLSIKLDEESLNYLRFITHLRFFIERINSEGAR
FT                   EKEEPDMIEQVFKLYPKAYASVQIISDYIQETLNCTVYAEELMYLTLHVQRLIK"
FT   gene            69266..71188
FT                   /gene="bvrB"
FT                   /locus_tag="LM5578_0072"
FT   CDS_pept        69266..71188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bvrB"
FT                   /locus_tag="LM5578_0072"
FT                   /product="beta-glucoside-specific phosphotransferase enzyme
FT                   II ABC component"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66830"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466309.1"
FT                   /protein_id="ADB66830.1"
FT                   /translation="MGKYQALSKFILENVGGKENVLSVTHCMTRLRFTLKDDSKVNEDI
FT                   LKKSSEIMTAQFAGGRFQVVIGTHVSDVYNEIQGVTGADKTEEAEVKKTGLNRLIEIIT
FT                   KVITPVLGILTASGLLQGILALLTITNVIDVNDGGYIVLHAMGQAVFYFLPVVLGYTSA
FT                   KAFNLNPYVGMMLGATLVIPELMTNLVTDKALYTLFDGTMFSTPVYNTFFGIPILFPPN
FT                   GYQYTVIPVIFITFLGAKVEKILKKIVPPLLAHNLNSFLTILITFPLAILIIGPVTNVL
FT                   SSLISAGVSGLYEVSPVITSVVVGLLYQPLVIFGLHWPMSAIGINNLAQYGVDYIFPMS
FT                   FTASFAQTAVVLAVYLKTRSRNQKALAIPAMISGMFCIIEPAIYGFSLPVKKRFAFSMI
FT                   GGAVGSLIISIFSVKMYAFAFGVLGFVSFINPANSSLGGLYVAIFATIVTMAVSFSLTF
FT                   FTFKSSEDVVDEETKPLIKQQEVLAPIAGTMQPISSSADETFASKTMGEGVVIFPTGSK
FT                   VVAPAAGVVTTVFPGGHALGITTENGTEILIHIGIDTVELNGEGFDVQVEVGSKVKQGQ
FT                   TLVNVDFEAIENKGYKSEVLVVILNTDDFLDIISEEKTTVKQGGKMLTLIPFNGKATND
FT                   MEVSY"
FT   gene            71188..72171
FT                   /gene="bvrC"
FT                   /locus_tag="LM5578_0073"
FT   CDS_pept        71188..72171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bvrC"
FT                   /locus_tag="LM5578_0073"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66831"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466308.1"
FT                   /protein_id="ADB66831.1"
FT                   /translation="MKTRVFGVLAGGALGDAMGMPTECWSQEKIRAIYPNGVETLLPSD
FT                   ESDAFGRKLAAGSITDDTINVLMIAEMIKKNNGQIRVEDYVAELVEWNANSGVSEFVSG
FT                   PSTLRALKQISEGVPITKTGISGTTNGASMKIAPIGIIANYEDMEDLVSKVHQICLPTH
FT                   NAKIAIQGASAVAAAISYVVRGGNIVDKIWELAYEAIEVASNYGYDFPSASLKFRMDKA
FT                   REIIGEETGPATALKRLYEEIGSGMETIETIPCAFAIVELAKGDPVEAAKLSACIGWDT
FT                   DTIGAISAGICGGMSPTIPENYIEMIERVNNINLTQVSEDLYIHVL"
FT   gene            72319..73785
FT                   /gene="kat"
FT                   /locus_tag="LM5578_0074"
FT   CDS_pept        72319..73785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kat"
FT                   /locus_tag="LM5578_0074"
FT                   /product="catalase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66832"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466307.1"
FT                   /protein_id="ADB66832.1"
FT                   /translation="MTDRKNLTTNQGVPVGDNQNSMTAGRKGPTLIEDYVLIEKLAHFD
FT                   RERVPERVVHARGAGAHGKFVTKKSMKKYTMAKFLQEEGTETEVFARFSTVIHGQHSPE
FT                   TLRDPRGFSVKFYTEEGNYDFVGNNLPVFFIRDAIKFPDVIHSLKPDPRTNIQDGNRYW
FT                   DFFSLTPEATTMIMYLFSDEGTPASYREVRGSSVHAFKWINEEGKTVYVKLRWVPKAGI
FT                   VNLSTEQASQIQAKEFNHASRDLYEAIENGDYPEWDLYVQVLDPKDLDSFDFNPLDATK
FT                   DWFEDVFPYEHVGTMTLDRNPDNIFAETESVGFNPGVLVRGMLPSEDRLLQGRLFSYSD
FT                   TQRHRVGPNYLQLPINSPKAPVANNQRDGHMPFKQQTSSINYEPNSYDTEPKENPAFIE
FT                   PEQEIRGDISGRLIAEKPNNFGHAKEVWDRYSNAERAALVKNIVDDWSQVCEDIKIRNL
FT                   RNFYQVDPEFASRVAAGTGINLEEHVTDLK"
FT   gene            73996..75912
FT                   /locus_tag="LM5578_0075"
FT   CDS_pept        73996..75912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0075"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66833"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466306.1"
FT                   /protein_id="ADB66833.1"
FT                   /translation="MSASKLSLPRWKQIVHMLYLKMEFISGGELGEALAVNPRTIRNDI
FT                   KVINQILTIGGNRIESLPGVGYRLVIGDEKALREALLDDSVGRANMNIVPMFAEDRADY
FT                   IIRYLLLKNDYVKLETLSEELFVSKSTINLDILEVKRKLKENELKVEKRAGYGIRITGA
FT                   ELAIRFCFSRYLLVESTSPLITETEINFFGEVNLEMMEQIVVSNIAKYNIHMTDISVKN
FT                   LIIHIAIAVCRVKDNCYVPATDLEDIEFSMPELRAAQGIIKEIDLSEGIRFPESETAYL
FT                   LLHLSSKNRKSDFNNYREYIIVDKMLAKIKELYGYDFKQDQKMISNIALHLKPAINRIK
FT                   FNMNIQNPYLKNLKANYPLAFELGLVAKEVLEQELKTNVDEAEVGYLAIHFLYGLDKEI
FT                   ESEKQKVLIVCASGLGTSQLLESKVRKEFENTLEIVGVYSFKEYEQSGTMCDFVISTVP
FT                   LRMKLHPFIQVSPFLTKADIRNITALMKQDETKNQFEVDKVFKESLFLISDKKDKEQVL
FT                   VNLASLLLENNIVGEDYLPSLFEREEIVPTYLGNGLAAPHPIEANVQETAIGVCICVGG
FT                   GVKWNEEDQAQVIFMLAVKNKQQQQLATVYELISNLVESPKAMGELKRVTSFEEFMRVL
FT                   QTL"
FT   gene            76062..77357
FT                   /locus_tag="LM5578_0076"
FT   CDS_pept        76062..77357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0076"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66834"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466305.1"
FT                   /protein_id="ADB66834.1"
FT                   /translation="MKKFIEKLSWLSQKLGNQIHLKSMRDAFATILPFIMLAGFMVLIN
FT                   NVIIKPDGFMSAIISSETLTTWQGLGNSIVNGTLGIITILIGASVAYFLAQNRKFENPF
FT                   APALMTIALIVIFIPAVTEIVPIGAEKSVEVAGVLPIALMGSAGMFVGIVTALLATEVF
FT                   IRLSKSEKMKIHISGDSVPPAVIKSFNVLIPTMLTILIFAFISFLVVTLFSLNLYSLIS
FT                   AIIQEPLTFLVTSVPGFLTLMTISQMLYSIGIAGSGILGPIMDPVLLANMQENMTAFAN
FT                   HTEIPHIINTTFRDVFGVMGGGGNTIALLLAIFIWSKRKDYREIATLSAAPGLFNINEP
FT                   VVFGLPIVYNLSLMIPFIISTPLCLCLAYFATKLHMISEVVVMVPWTTPVVASGFLATG
FT                   GDWRAAVFQIFLIGVCVLLYLPFLKANDRIKA"
FT   gene            77372..77671
FT                   /locus_tag="LM5578_0077"
FT   CDS_pept        77372..77671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0077"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66835"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466304.1"
FT                   /protein_id="ADB66835.1"
FT                   /translation="MKNIMLMCNAGMSTSVLVRKMERVVEERNLELTIWAISETDFEKN
FT                   WRKADAILLGPQVNYMKDKVIDTVGDNVSVAVIDIVDYGRMNGEKVLDLAISLL"
FT   gene            77705..79975
FT                   /locus_tag="LM5578_0078"
FT   CDS_pept        77705..79975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0078"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66836"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466303.1"
FT                   /protein_id="ADB66836.1"
FT                   /translation="MAVYLDKEKPVSERVEDLLSKMTLAEKCGQLNQRMYGWEAFSRDG
FT                   ETFQITEKFKEEVTRFEGIGALYGLFRADPWSKMNKDTGVSRKNAGKVANKIQRYVIEN
FT                   TRLGIPVLLAEEVPHGHQALDSESYPVNLARAASFNPELQKQVASAITEEISEKGIHLA
FT                   LASALDILRDPRWGRAEECYGEDPYLAAELTAAITEGFQASGKIAVILKHFAAQGEPIG
FT                   GHNSGPVSIGVRELREIFLDPMRAGIRSGALGVMAAYNEIDGVPCHANKELLTTILREE
FT                   MGFSGIVMADGCALDRLLKLNPDPKKAAKMALEAGVDLSLWDEVFPFLEESVEKGILDE
FT                   KIVDDAVSRVLQVKFQLGLFEQPFVEEDIQEPKSDWRQLNLQAAREGICLLKNDFETLP
FT                   LVGEPKKIAVVGPSIDSLYNQLGDYTAPQNESECVTVLEGIKNLLPKNWEVLSEKGTEI
FT                   REELPDGIQRAEVVAKEADAIVMVLGGSSARNFDMEFLNNGAVSSKGPNMDAGENVDVA
FT                   DITLPQSQLDLFYAMKRTGKPVIVVMIQGRPIAIPEISSTADAILTAWYPGSVGGTAIA
FT                   EVLFGHYNPSGKLPVSIPRSSGQIPIYYNQKAVEYKEDYFDLTGKPLYPFGYGLSYSTF
FT                   EYQDLQIKQESIKISELLGGQSVEVKVTLKNISNVAGEEVVQLYIHDMEASITRRKKEL
FT                   KAFKKVRIAANQTTTVTFKLDKSSFEIWSINNKYEVEPGGIEIFVGGSSDTKLTGRVSI
FT                   IGG"
FT   gene            79981..80289
FT                   /locus_tag="LM5578_0079"
FT   CDS_pept        79981..80289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0079"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66837"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466302.1"
FT                   /protein_id="ADB66837.1"
FT                   /translation="MEGMELASFQIISSVGAARSCIIEAMKLGRQRKFTEAYKKIDEAN
FT                   EFLSEGHKNHVQLIQKEADGGDVQISILFMHAEDQFMTTYTLRDVAYEMIAIWKEMK"
FT   gene            80441..81541
FT                   /locus_tag="LM5578_0080"
FT   CDS_pept        80441..81541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0080"
FT                   /product="translation-associated GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66838"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466301.1"
FT                   /protein_id="ADB66838.1"
FT                   /translation="MALTAGIVGLPNVGKSTLFNAITKAGAEAANYPFATIDPNVGIVE
FT                   VPDHRLNKLTELVKPKKTVPTTFEFTDIAGIVKGASKGEGLGNKFLSHIRQVDAICHVT
FT                   RCFDDENITHVEGRVDPLDDISTINLELILADLETVEKRIGRVEKLSKQKDKDAVAEYN
FT                   VLVKLREAFENDKPARAIEFNEEEEKIVRNLFLLTRKPVLYVANVSEEDVSSPDDNKYV
FT                   QQVREFAESENSEVIVVCARAEEEIAELEDEDKLEFLEALGIEESGLDQLIRSAYTLLG
FT                   LATYFTAGVQEVRAWTFIKGMKAPQCAGIIHTDFERGFIRAEVVAYDALLEYGSEQAAK
FT                   EAGKVRLEGKEYEMKDGDVVHFRFNV"
FT   gene            81819..82328
FT                   /locus_tag="LM5578_0081"
FT   CDS_pept        81819..82328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0081"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66839"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466300.1"
FT                   /protein_id="ADB66839.1"
FT                   /translation="MIQLMVIAFFVVLLVIMPKNNKEERKAAHLLIDKYGIQVAKKNNP
FT                   VRQMALLEVALGISTYRGSRKKTFIFIGGFFVIAFILGYLTYFFGINRNITATIIVGII
FT                   LTLFLIAGTIIMFVIAIRQASSLRTDAWAKILTTIDPQFPVEFLNEKKWQKAFLAQMES
FT                   MNEQLA"
FT   gene            complement(82460..83650)
FT                   /locus_tag="LM5578_0082"
FT   CDS_pept        complement(82460..83650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0082"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66840"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466299.1"
FT                   /protein_id="ADB66840.1"
FT                   /translation="MEKNIETKKINLALLVCLVGFPQISETIYTPSLTEIAKGYGVSLN
FT                   LAQMTLSIYFLAFAVGVFFWGVSSDFLGRRKAMNFGIFIYILGCFACLFSNNITMLFIG
FT                   RFVQAFGASTGSVTTQTILRDNYHGNDRHHLFSKISAALAFSPAIGPLIGGFIGQYYGF
FT                   RVVFLFLVVMGMILLFWSLKRLPETKTVTATSFSVQKIVVTGKKMIFDRYTIAFGVLIG
FT                   IFNGILFSYYSEAPTIFIERFHFNQSQYGFMGCAVATATILGAWLSNWRLKQNSPHKII
FT                   KEGILLALIGTLFLSMVALFPLNIQVIFYIFFISIILVGIGMSLPNCLSLALVKFQEVA
FT                   GTAGAFLSLGYYVIVSLCTFFIGVLHSGSILVFPAFCLVLLLIALLCIKIAARNNP"
FT   gene            84253..84351
FT                   /locus_tag="LM5578_0083"
FT   CDS_pept        84253..84351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0083"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66841"
FT                   /inference="ab initio prediction:Glimmer:3.02"
FT                   /protein_id="ADB66841.1"
FT                   /translation="MKKKVIFSETTTGKKTLLKADRIIYIEGGEIR"
FT   gene            84617..84724
FT                   /locus_tag="LM5578_0084"
FT   CDS_pept        84617..84724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0084"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66842"
FT                   /inference="ab initio prediction:Glimmer:3.02"
FT                   /protein_id="ADB66842.1"
FT                   /translation="MLPVMRAIPDISFLADMCGIALFILLQIGGDLFEN"
FT   gene            84714..85553
FT                   /locus_tag="LM5578_0085"
FT   CDS_pept        84714..85553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0085"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66843"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466295.1"
FT                   /protein_id="ADB66843.1"
FT                   /translation="MRIERILNNNIVSAISEDAQELLILGKGLGFNSKVGDPINESKIE
FT                   KVFELKDDTMDKFKMIVNEIPIQFLEVTDDIVKLFKMKTAKDISDVIYISLSDHLYFAT
FT                   QRLQENVVIENPLSWEVKRFYQEEYAVAKEAAKMVESKLEIELPDAEISNIALHFVNAE
FT                   VDSDMNDVTHIMQLIQEIISIIKYHFNIEFDEESTNYYRFMTHLKFFCQRVIIGETIDE
FT                   MDEFLYQTVKKSRGVIFDCIDKIGVFLEKNYQFTMSHSEQFYLALHIERLLKRKNNQ"
FT   gene            85650..87503
FT                   /locus_tag="LM5578_0086"
FT   CDS_pept        85650..87503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0086"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66844"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466294.1"
FT                   /protein_id="ADB66844.1"
FT                   /translation="MDYNQLAKEILQAVGGKNNVNEVYHCITRLRFQLKDQSKVNEKQL
FT                   KGLDKVMGTNVAGNQFQVIIGNDVPKVFDALAAENPAWKNKETTNKTTRQKGIKGFFSN
FT                   IFDALSGVFAPILPAIAGAGLIKGFMALFVSLGWLATDTETYRILLAIGDGVFYFLPIL
FT                   VAVSAARYFKANMFVALGIGAALLYPDLTALLSAGTTPHFIGLPVTPVTYAYSVIPILL
FT                   AIWIMSYVEKWVDRIIPTSLKLLFVPLITMFIVVPLTLVVIGPLGTFVGDGVSGGINWL
FT                   LNNGGVIGGILIGGAMAIIVMTGMHYAIVPFVISNLAKYGYDKFLPLTYISNMSQAGAT
FT                   FGVFFRAKDKKLKSLAFSTGLTALMGVTEPAMYGINVVYKRPFMASLIGGAAGGGFAMM
FT                   FGVKAYVLTGNGGIPGLPGLVGDTFVYALIAMALAFIVALIFSYIFGIDEQMVEATPVA
FT                   EKIAAGTEILQAPVTGELVKMSQVNDTTFADEIMGKSIAIKPNEGKLYAPANGTIISLF
FT                   KTKHAIAMKSDNGAEILLHVGIDTVKLDGNYFTAHVATGDVVEQGDLLVTFDMEKIAEK
FT                   YDTTTMMVITNTNEYAVVEAKENGIVTKGNQVMELRSEQNE"
FT   gene            87496..88944
FT                   /locus_tag="LM5578_0087"
FT   CDS_pept        87496..88944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0087"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66845"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466293.1"
FT                   /protein_id="ADB66845.1"
FT                   /translation="MSNTKFPDGFMWGGATAANQFEGGYNLGGKGLACADLFTGGTHTE
FT                   PRRITTQLEESTFYPSHEAVDFYHHYKEDIKLMAEAGFKVFRMSINWTRIFPTGKEAEP
FT                   NEEGLQFYEDVFNELKKYQIEPLVTIAHFDIPLALTNEVNGWASRDLIDYYLHFCEVIF
FT                   KRYKHLVKHWLTFNEINTATMEIGNYLSLGIRHAEGDFLHQKDDPKVRYQALHHQFVAS
FT                   AKAVKLGHSINPDFMIGCMIAYMPRYPRTCEPSDVLLAKQTEAMHSHFCGDVHVKGYYP
FT                   FYAKTFFKDNGIELEFDPEDEQILREGTVDFYTFSYYLTLCASNDPAYKNSGKSVIGGA
FT                   ENPYLKTNDWGMQTDPVGLRIALNDLYTRYNIPLMVVENGLGAFDKLEDDGTINDPYRI
FT                   DYFKEHILQMHKAIQDGVDLIGFTIWGCIDLVSASTGEMAKRYGIIYVDKYDDGTGDYS
FT                   RKKKASYYWYKDVISSNGEIGLEE"
FT   gene            complement(88983..91313)
FT                   /locus_tag="LM5578_0088"
FT   CDS_pept        complement(88983..91313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0088"
FT                   /product="bifunctional glutamate--cysteine
FT                   ligase/glutathione synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66846"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466292.1"
FT                   /protein_id="ADB66846.1"
FT                   /translation="MIKLDMTMLDSFKEDPNLRKLLFSGHFGLEKENIRVTSDGKLALT
FT                   PHPAIFGPKEDNPYIKTDFSESQIEMITPVTDSIDSVYEWLENLHNIVSLRSENELLWP
FT                   SSNPPILPAEEDIPIAEYKTPDSPDRKYREHLAKGYGKKIQLLSGIHYNFSFPEALIDG
FT                   LYANISLPEESKQDFKNRLYLKVAKYFMKNRWLLIYLTGASPVYLADFSKTKHEESLPD
FT                   GSSALRDGISLRNSNAGYKNKEALFVDYNSFDAYISSISNYIEAGKIESMREFYNPIRL
FT                   KNAHTDQTVESLAEHGVEYLEIRSIDLNPLEPNGISKDELDFIHLFLIKGLLSEDRELC
FT                   ANNQQLADENENNIALNGLAQPSIKNCDNEDIPLADAGLLELDKMSDFIKSLRPEDTKL
FT                   RAIIEKQKERLLHPEKTIAAQVKQQVTKEGYVDFHLNQAKTYMEETEALAYKLIGAEDM
FT                   ELSTQIIWKDAIARGIKVDVLDRAENFLRFQKGDHIEYVKQASKTSKDNYVSVLMMENK
FT                   VVTKLVLAEHDIRVPFGDSFSDQALALEAFSLFEDKQIVVKPKSTNYGWGISIFKNKFT
FT                   LEDYQEALNIAFSYDSSVIIEEFIPGDEFRFLVINDKVEAVLKRVPANVTGDGIHTVRE
FT                   LVEEKNTDPLRGTDHLKPLEKIRTGPEETLMLSMQNLSWDSIPKAEEIIYLRENSNVST
FT                   GGDSIDYTEEMDDYFKEIAIRATQVLDAKICGVDIIVPRETIDRDKHAIIELNFNPAMH
FT                   MHCFPYQGEQKKIGDKILDFLFD"
FT   gene            91483..92370
FT                   /locus_tag="LM5578_0089"
FT   CDS_pept        91483..92370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0089"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66847"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466291.1"
FT                   /protein_id="ADB66847.1"
FT                   /translation="MKIRNLTKKMDDNLVLKDVSFDLKAGEITALIGRNGVGKTTLFST
FT                   MTGIYLPDEGDVFLDEESIFKHPEVKQQLFFLEDNMNHFNTYSVQTVVKIYRQIYTTFD
FT                   EAFFNELMQQFELPMKAKLMSFSKGRKALFFIILAFSLNVRFLLLDEPLDGLDIIIKKQ
FT                   ILATIKDTVKKRGTSVVIASHRLEELEAIADRVIVLKGASVELDYYLEDMRTDAVKIQV
FT                   AFKTKKIPGFVKNNAQLLYRNGRIYTLLVTENASSFLAELRLEEPVLLEEMSISIEDIF
FT                   TVHLANDKIDYYEI"
FT   gene            92397..93527
FT                   /locus_tag="LM5578_0090"
FT   CDS_pept        92397..93527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66848"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466290.1"
FT                   /protein_id="ADB66848.1"
FT                   /translation="MFNRGLWYREWRNMRWMLLGVVILFFLGITLGLMSDADRWNSQKE
FT                   YYESSEFLKQQKENPEFKTSDEEMKASLTVAYLTVPMYTNFVQDEFVDYMPFMFYFQVE
FT                   MFFTLIKVSVFILGVLAVIFERYTRANRFTASLPYKRTHIVGVKMIMGIATIGLSYLIS
FT                   MGIGLTYFMSHVPKEYIQLDAPKFWVDIVGGLFTYILIFLVAILIGLLIGSPIAAAFVA
FT                   FGVMLLPNVLNPTLDNMYNFIWPHGGDKGMSKLLRFEDYVNVFSPFSFESASFGAVIFS
FT                   VILSVLMVVAILILYKKQHIERSGYLFAFSWVKWPFLVLFSLFVGMTAANLAVTDTELG
FT                   FVGYLAWGIGATIGSFILALYILNKMRGLFQLSKTN"
FT   gene            93598..94260
FT                   /locus_tag="LM5578_0091"
FT   CDS_pept        93598..94260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0091"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66849"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466289.1"
FT                   /protein_id="ADB66849.1"
FT                   /translation="MTTETETIKPQLAELKANLTKRNLQYVMEVEKHLRETHYGEEQQE
FT                   IIVYEMSEKILAEQKKGITARKLFNLTPTEYVVSLDVKAATVEQNTDKWWLVLDGGLLV
FT                   LGAMMLISGISAYFQKNAQTLGIIVLLITAVVGGFAMLILRKYASNMRAGQKGGTIKYL
FT                   LVAVGVIAVWMFVMTIVQVTIPPNINVALSPIVNTVGGAIIIALRFYVKKKKNIPSL"
FT   gene            94360..95094
FT                   /locus_tag="LM5578_0092"
FT   CDS_pept        94360..95094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0092"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66850"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466288.1"
FT                   /protein_id="ADB66850.1"
FT                   /translation="MFSYEVIRQFTETEHHLYRYIMDNRDKVMFMRVRELSEVTHVSPA
FT                   SIVRFTRKLGCEGFSEFKVKLKQEATREVKKKTADTVEVLEEFFERTMNRDYDHVLDAA
FT                   AEIINEADLVVFFGIGTSGILAEYGSRFFSNMKKRTFYIKDPFYPNPGEQFKNKAVMII
FT                   LSVSGETDQVLEQAQNMQQYGSRIISITNTSHNTLAGLSDVNIPYYVTQEMVDKTNITT
FT                   QIPVLFLLEAMAKKNYNQEQEE"
FT   gene            complement(95134..95442)
FT                   /locus_tag="LM5578_0093"
FT   CDS_pept        complement(95134..95442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0093"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66851"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466287.1"
FT                   /protein_id="ADB66851.1"
FT                   /translation="MNEMETVIFGMISQVGSARSSYLEGLRAAREGNFEEAEAKLKEGG
FT                   ETLANGHHEHHKLIQKEASGEKVEIQLLLIHAEDLLITTETLREVVTEFVHVYKKIN"
FT   gene            complement(95435..96319)
FT                   /locus_tag="LM5578_0094"
FT   CDS_pept        complement(95435..96319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0094"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66852"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466286.1"
FT                   /protein_id="ADB66852.1"
FT                   /translation="MKIAAFDIGGTALKMGVVLPHGEIILTKSAEISGSDGDQILAEMK
FT                   LFLAENKDVTGIAVSAPGYVNPKTGLITMGGAIRRFDNFNLKEWLEAETGLPVAIENDA
FT                   NCALLAEKWLGKGQDLDDFLCLTIGTGIGGGIFSNGELVRGGRFRAGEFGYMFSERPGA
FT                   FRPGKYTLNETTTMLVLRRQYAELTGRPLEEITGEEIFAKYDAQDAVSERLINEFYTGI
FT                   CTGLYNLIYLFDPTHIFIGGGITSRPTFIAELKHHMESFGLRDTIIETATHKNQAGLLG
FT                   AVYHFLQEENRHE"
FT   gene            complement(96331..97683)
FT                   /locus_tag="LM5578_0095"
FT   CDS_pept        complement(96331..97683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0095"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66853"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466285.1"
FT                   /protein_id="ADB66853.1"
FT                   /translation="MSMMSKFEHGMERVLVPVANKLNSQRHIAAIRDAFILVFPLIMAG
FT                   SIITLINFAVLSPDGFIAKILFLGKIFPNLADAQAVFSPVMQGSTNIMAILIVFLVARN
FT                   LAIFFKQDDLLCGLTSIGAFFIVYTPYTVVDNASYMTIKFLGAQGLFVAIIVAIITGEV
FT                   FSRLARSPRLMIKMPDQVPPAVARSFKVLIPVIIITILFSVINYLITLVAPEGLNDLVY
FT                   TVIQAPLKDMGTNVFSVIIIGLVSNLLWVLGIHGPNTVAAIRDTIFTEPNLDNLSYVAQ
FT                   HGSAWGAPYPATWAGLNDGFANYGGSGMTLGLLIAIFIASRRADYRDIAKLSLAPGIFN
FT                   INEPVIFGLPIVLNPIMVIPFIITPAINTLIGYFFISTKLIPPVAYQVPWTTPGPLIPF
FT                   LGTGGNWLALLVGLLCLAVATVIYLPFVLVSNKIAASDAAMDKNATASTEQ"
FT   gene            complement(97716..98018)
FT                   /locus_tag="LM5578_0096"
FT   CDS_pept        complement(97716..98018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0096"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66854"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466284.1"
FT                   /protein_id="ADB66854.1"
FT                   /translation="MKKILLVCAAGMSTSLLVTKMKAHATSIGEEIEIEALPVSEASNV
FT                   VDKMDIVMLGPQVRYQKPQVDELVQGRIPVVVIDMKDYGMLNGKAVLEKAFAEIG"
FT   gene            complement(98065..99519)
FT                   /locus_tag="LM5578_0097"
FT   CDS_pept        complement(98065..99519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0097"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66855"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466283.1"
FT                   /protein_id="ADB66855.1"
FT                   /translation="MEHNKLKPFPKDFLWGSASAAYQVEGAWDEDGKGPSVWDEFVRIP
FT                   GTTFKETNGDVAVDNYHRYKEDVALMAEQGLKAYRFSVAWSRVIPHGNGEVNEAGLKFY
FT                   DNLIDELLSYGIEPVVTLYHWDIPQGLQDEYGGWESRKVVEDFTNYAALLFERFNGRVK
FT                   YWVTLNEQNVFISHGYKLAYHPPGVSDDKRMFAANHNANLANASAIAKFRELGTSGKIG
FT                   PSFAYGPSYSIDANPANVLASENSEEFNAHFWMDVYTWGEYPTATWNWLEEHGLAPEIL
FT                   PGDTELLKKGKPDFMGVNYYRSMTHAFNGKDGVGSGKMNTTGEKGTSEETGVPGLYKNT
FT                   NNPYLEKTNWDWDIDPTGLRIGLRRITNRYKLPIMITENGLGEYDSLTEDYKIHDEYRI
FT                   EYIRAHALAIQEAITDGVEMLGYCTWSFTDLLSWLNGYQKRYGFVYVDRDENDEKELKR
FT                   YKKDSFYWYKKTIEANGANLVEEQGK"
FT   gene            100034..101644
FT                   /locus_tag="LM5578_0098"
FT   CDS_pept        100034..101644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0098"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66856"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466282.1"
FT                   /protein_id="ADB66856.1"
FT                   /translation="MTIVAMNEVVKSFTGDIILEKVSLQLEEGERVGLIGRNGEGKSTI
FT                   LKILKGTEGVDSGIVTSKKGAKIGLLEQLSTVDPNIIVEQYLRTSFGELEDLEKELRAL
FT                   EGEMATNASEKLMNRYGDKMALFGELGGYEMDANLNKVVNGLDIGKLLSQSWGDLSGGE
FT                   KTKTALAHLLLQKTDLLLLDEPTNHLDLMAVEWLTVFLQHYSGTVLVVSHDRYFLDEVV
FT                   EKMVELENRELIVYHTNFSGYLKEREERLLREFQDYKDQQKKIKKMQQAIKRLRQWAMQ
FT                   ANPPNDAMFRRAKNMERALERMEKVKRPVLTQKQMQLQFDEAGRSGQEVVVMENLSKSF
FT                   SEKTIIQEVSLQIRQGERVAIIGENGAGKSTLLKIMEGKVVPDDGVIKVGASVKIASLS
FT                   QQMEELNEEMTVLDAFRDKVVVTEGEARQMLAGFMFYGEMVFRKVRNISGGERMRLRLA
FT                   QFINMPVNTLILDEPTNHLDIASREVLEEAIRAFSGTIITVSHDRYFIDQLCSKVIWLE
FT                   NKQLTVYEGNYSYATSKRR"
FT   gene            101702..102232
FT                   /locus_tag="LM5578_0099"
FT   CDS_pept        101702..102232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0099"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66857"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466281.1"
FT                   /protein_id="ADB66857.1"
FT                   /translation="MEITIVKGDITEQEVDVIVNAANSGLLGGGGVDGAIHQAAGPDLL
FT                   KECQEVINRIGSCPAGEAVITSAGDLKASYIIHAVGPIWKDGEHQEANKLASCYWKALD
FT                   LAAGKDLTSIAFPNISTGVYGFPKKLAAEVALYTVRKWAEEEYDTSIKEIRFVCFDEEN
FT                   LKLYNKLINSEVV"
FT   gene            complement(102243..102335)
FT                   /locus_tag="LM5578_0100"
FT   CDS_pept        complement(102243..102335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66858"
FT                   /inference="ab initio prediction:Glimmer:3.02"
FT                   /protein_id="ADB66858.1"
FT                   /translation="MELCQEGFPLLFYSENIVKNVSRETFEKAA"
FT   gene            102520..103986
FT                   /gene="guaB"
FT                   /locus_tag="LM5578_0101"
FT   CDS_pept        102520..103986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaB"
FT                   /locus_tag="LM5578_0101"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66859"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466280.1"
FT                   /protein_id="ADB66859.1"
FT                   /translation="MWETKFAKEGLTFDDVLLVPAKSDVLPNDVDLSVEMAPSLKLNVP
FT                   IWSAGMDTITEAKMAIAIARQGGIGVVHKNMSIEQQAEEIEKVKRSESGVIIDPFYLTP
FT                   DHQVFAAEHLMGKYRISGVPIVNNEKERKLVGILTNRDLRFISDYSTVIKDVMTKENLV
FT                   TAPVGTTLKQAEQILQKHRIEKLPLVDEAGILKGLITIKDIEKVIEFPNSAKDKHGRLL
FT                   AAAAVGITNDTFVRVEKLIEAGVDAIVIDTAHGHSAGVINKISEIRQTFKDVVIVAGNV
FT                   ATAEGARALFEVGVDIVKVGIGPGSICTTRVVAGVGVPQITAIYDCATVAREFGKTIIA
FT                   DGGIKYSGDIVKALAAGGNAVMLGSMLAGTDESPGETEIFQGRQFKTYRGMGSLAAMEH
FT                   GSKDRYFQADAKKLVPEGIEGRVPYKGSVADIIFQLVGGIRSGMGYTGSPDLRHLREEA
FT                   AFVRMTGAGLRESHPHDIQITKEAPNYSIS"
FT   gene            104147..105919
FT                   /locus_tag="LM5578_0102"
FT   CDS_pept        104147..105919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0102"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66860"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466279.1"
FT                   /protein_id="ADB66860.1"
FT                   /translation="MIEQARAILQQNFGYQDFRNGQVDVISKLCAGEDTLAIMPTGGGK
FT                   SLCYQIPALLFDGLTIVVSPLISLMKDQVDALVSEGIAATFINSTLTNREIDIRLDAAF
FT                   SGELKMLYIAPERIETPGFQRLIEQVPISLFAIDEAHCISQWGHDFRPSYLTLCDSLDK
FT                   MTRRPLVIALTATATQAVSDDICRLLKIRADSVVKTGFSRDNLAFQVVKGQDKDKYLID
FT                   YLTKNVTESGIIYASTRKEVERLHSFLQKKGVESGMYHGGMTDLARKDWQEKFLYDDIR
FT                   VIVATNAFGMGINKSNVRFVIHYNIPRNIEAYYQEAGRAGRDGVPSDCILLFSPQDSRI
FT                   QQFLIEQSEMDDERKQNEFAKLRQMTGYGYTEICLQKYIVQYFGDDEPNCGKCSNCLDT
FT                   REATDITILAQQVFSCIKRMGERFGKVLIAKVLTGSADQKVKDWRFDELSTYGLMKDAS
FT                   QKDVLQLIDYLTAEKYLQPTDSQFPSLKLTDRAVSVLRGELKVERKQAKRAEKVKIDVN
FT                   SDLFEKLREVRRELAAKHKVPPYIIFSDETLREMCAYMPQTEDALLEVKGIGAMKRDKY
FT                   GAEFLAVLQQEASK"
FT   gene            105943..108096
FT                   /gene="topB"
FT                   /locus_tag="LM5578_0103"
FT   CDS_pept        105943..108096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="topB"
FT                   /locus_tag="LM5578_0103"
FT                   /product="DNA topoisomerase III"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66861"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466278.1"
FT                   /protein_id="ADB66861.1"
FT                   /translation="MTKTLVLAEKPSVGKDIGRVLGAKQGKNGYLEGGKYVVTWALGHL
FT                   VTLADPERYDSKYKSWNMEDLPILPEKMKLEPIKQTRKQYETVKKLMNRTDITTIVIAT
FT                   DAGREGELVARWIIDYAKIKKPLKRLWISSVTDKAIREGFEHLKPGKAYENLYHSAVAR
FT                   SEADWVVGINATRALTTKYNAQLSCGRVQTPTLAMIQHREEEIRNFKSREYYGITALTE
FT                   QESFTWNNGQTFDKALAEKLVKSLQGENAVITDVSMKEKKTFSPGLYDLTELQRDANNR
FT                   YDFSAKETLNIMQTLYERHKVLTYPRTDSRFISTDIVPTLKERLVACGVGENAKAARQI
FT                   SVKPIKANKSFVDNSKVSDHHAIIPTEQPVSLGDLSDKERKIYDLVVKRFLAVLSDPYI
FT                   YEETSVKAKIGQEEFTLKGKVVKSLGWKSIYGESREPDQLTKMKKGDTIPVKRINLETG
FT                   KTKPPARFNEATLLSAMENPSKYMETTSKALAKTLGETGGLGTVATRADIIEKLFNSFS
FT                   LEKQGKDIQITSKGRQLLELVPEDLKSPELTARWEQKLSKIAKGELDYRKFTAEMRDYA
FT                   KKAVTEIKQNDKKFRHDNITSQKCPDCGKPMLKVKGKRGTMLVCQDRECGHRESVSRTT
FT                   NARCPNCHKRMEMRGEGDKQIFVCVCGHREKLSAFQQRRDKQKNKNVSKTDVAKFMKKQ
FT                   NKQEDEPFNNPMAEALAKLKLDK"
FT   gene            108205..109872
FT                   /locus_tag="LM5578_0104"
FT   CDS_pept        108205..109872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0104"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66862"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466277.1"
FT                   /protein_id="ADB66862.1"
FT                   /translation="MKHNQLIIETDIPAKMRDGVTLYADIYRPADAGEYPVLLTRLPYS
FT                   KSYGLHFIRPNILAEQGYVVIVQDVRGRYTSEGDFVPYIAEVDDGYDTIEWAANLPYAN
FT                   GDVGMFGLSYYGYTQILAAISGNKHLKAIAPIMAQNSMTDVFNDHDGALELGMWETWNL
FT                   ESMLPNMLARTYKTHDELEEAANTLMKNLDNLDTLYQFKPYKDWPAIGQNEMPYFSELL
FT                   NYEPTHDHWRKIDAKSNYDKINVPGLHVAGWYDCFLDKTIANFKNGHLRGLGDKLIIGP
FT                   WTHANFTQIIGDRDFGMAATKWGEANMHARHIEWFNHWLKNEPLPASAPVNYFVMGLND
FT                   WKTAENWPPQNANMTPLYFKNEKVSAEFTPPATSSEAKFSYDPENPVPSNGGGTLHKAL
FT                   HADGPHDQQQIELREDVLCYSTEPLKEAIEVTGPIQVKLWAKTDAPNTDFTAKLVDVFP
FT                   DGTAFNLADGIIRAAKQHGANVQNNINEYTIDLWATSNLFQKGHQIRIEISSSNFPRFD
FT                   PNPNTGDSFINSTESQIANQTIYHSPEYPSHILLPIIR"
FT   gene            110051..111388
FT                   /locus_tag="LM5578_0105"
FT   CDS_pept        110051..111388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0105"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66863"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466276.1"
FT                   /protein_id="ADB66863.1"
FT                   /translation="MKNIIKKTGIVIMAASLAVSGFLVSPKAAQAAEAPNVNANAAIAI
FT                   EESTGKILYSKDADKLMGIASMTKMMDEYLLLEAIDKGKLKWDDKVTISEYAYKVSQDT
FT                   SLSNVPLRLGEEYTVQELYEAMAIYSANGAAIAISEKIAGSEKEFVDAMNKKADELNLG
FT                   EHQFVNATGLNNEDLKGGQQVGGPKDENKMTARGMAKLAKHLINDYPDVLKTASTTKKE
FT                   FRKGTSDQIDMTNWNWLLPGLIYGRKGVDGLKTGTTDYAGMCLTATAVQDGMRVITVVL
FT                   HANGGAPGEHTSARFDETNKMLDYAFNNFKVKEVQKAGSKVKNPSTIAVDKGKEDTVGL
FT                   VTKDAVKLVVPKNGNAPKLNTKVTMKEKTIEAPVKKGTEVGKMEVSLKDGDKLGYVDGK
FT                   QTETIDVLTASDVEKANWFMLSTQAVGSFFTGMGNYVSDGVKGWFN"
FT   gene            complement(111407..111646)
FT                   /locus_tag="LM5578_0106"
FT   CDS_pept        complement(111407..111646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0106"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66864"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466275.1"
FT                   /protein_id="ADB66864.1"
FT                   /translation="MNFNFFVRSGFIGLILLFVIQVLGIIRGLLIQSGFMDGSIDQTLL
FT                   GTKLIIVPIIFFTISVIFFLLWFYKDYQKSRFPN"
FT   gene            complement(111922..113694)
FT                   /locus_tag="LM5578_0107"
FT   CDS_pept        complement(111922..113694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0107"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66865"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466274.1"
FT                   /protein_id="ADB66865.1"
FT                   /translation="MKEFKQISRFFWHYLRGYKPQLFVILIAVVFATYLQVKAPQYIGN
FT                   AVQELGDYVVNLMQTGVDDKSDFIHIIWMLILCYVLLAAATFIQSIIMTGVAGKSTNRM
FT                   RIGLFRKMEKLSIRFFDSRNDGEMLSRFTSDLDDISNTLNQALIQVLSNVALMIGVIIM
FT                   MFQQNVELAFVTLISAPFAIIIATVIIRKARKFVDVQQDELGVLNGYIDEKISGQKIII
FT                   TNGLEEETIDGFVKQNNIVKNATYKGQVYSGLLFPMMQGISLLNTAIVIFFGGWLALNG
FT                   DLERTAALGLIVMFVQYSQQFYMPLTQISSQYSLLQLAITGARRVSEVFAEEEEVEREN
FT                   LQTIDGINKGVKLDHVDFAYDPAKPVLKDVSIDVSKGKMVALVGPTGSGKTTVMNLLNR
FT                   FYNVDGGAILFDDIDIRDIRLDSLRKQVGIVLQDSVLFTGTIRDNIVFGKPEASDDEVI
FT                   NAAKQANIHDFIMNLEKGYETEISDENNIFSVGQKQLMSIARTIITNPSLLILDEATSN
FT                   VDTVTESRIQKAMDNVISGRTSFVIAHRLKTILDADHIVVLHQGEVIEQGNHDELMKAE
FT                   GFYSELYHNQFVIE"
FT   gene            complement(113694..115415)
FT                   /locus_tag="LM5578_0108"
FT   CDS_pept        complement(113694..115415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0108"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66866"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466273.1"
FT                   /protein_id="ADB66866.1"
FT                   /translation="MKVLFHHLKKYKLQATLSTLFVVVMVISQLWQPKLLQQVLDAIMK
FT                   DDMDEISSIGALLIGIAAVGLIAGILNTILSAKVAQGVGADIRESSFRKIQTFSFSNIE
FT                   KLSTGNLVVRQTNDITQVQNLVMLSLQSLTRIPIMFIGAFILAMFTLPELWWVIIVLVV
FT                   LVVLIVVFTFGSMGKHFAIIQKLIDRVNSIAKENLAGMRVVKSFVQEDNEIGRFTTVSD
FT                   KLTRHTIIVGTLFSVMIPAFMLVSNLAIVVSIFFVGDMAADNPEVIGAIASFMNYLMQI
FT                   MMAIIIGGMLMMMASRALISLKRITEVLETEPDITYNENAPEQDLEGTVEFRNVSFKYD
FT                   GDDTPALEDISFKASVGEMVGIVGATGSGKSTLAQLIPRLYDPTEGEVIIGGTNLKDIN
FT                   KKTLRSTVSFVLQRAILFSGTIADNLRHGKKDATAEEMEHASKIAQAKEFIDKQAKLYE
FT                   APVSERGNNFSGGQKQRLSITRGVIGSPKVLILDDSTSALDAKSEKLVKEALNKELDDT
FT                   TTFIIAQKISSVIQADKILVLDKGKLVGVGSHKELLKENETYREIYDTQKGKEVTA"
FT   gene            complement(115576..117282)
FT                   /locus_tag="LM5578_0109"
FT   CDS_pept        complement(115576..117282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0109"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66867"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466272.1"
FT                   /protein_id="ADB66867.1"
FT                   /translation="MSLLRFDFEGDTKIFENPLYELVAYDLAEVLPIMKAAENAQKSGK
FT                   YVAGFVSYEAAPAFRSNLKTKKPSESMPLVWFGIYDNFTDTATETPDSSPLSFKMDTSF
FT                   PEYTEKIEQIKAEIAAGNTYQINYTVRLQSDVPNNFSSQATYETLQQIGKANYTALLST
FT                   SDFEIISASPELFFKWKENLLTTRPMKGTIRRGITEQADLEAHDWLKNDPKNRAENVMI
FT                   VDLLRNDLGMIAVPGSVKVPQLMTLEPYPTVWQMTSTITAETPPETDLTAVFKALFPCG
FT                   SITGAPKARTMEIISELEDSPRGVYCGTIGFLEPNGNAIFNVPIRTIAITDNKATYGVG
FT                   GGIVWDSEAASEFSEIHAKSAILEKATKFSLIECLRIENGELFRTEYHLKRLQTSADFF
FT                   GIPFNREETEKLWTKTAQKNTTGTYKMRFLLHPEGAHDLALTKIDTKNKRITAQLADKP
FT                   VLSNDLFLYHKTTHRKIYEDLKNTQTDETLLWNEQGELTEFINGNIVLGINGCFFTPPV
FT                   TSGLLSGTMRAELLAKNKISEKTLAKKDLLEADYVWLINSVRGFVEVEIKQ"
FT   gene            complement(117279..117851)
FT                   /locus_tag="LM5578_0110"
FT   CDS_pept        complement(117279..117851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66868"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466271.1"
FT                   /protein_id="ADB66868.1"
FT                   /translation="MILIIDHNDSFTYNLYQYFLELQEEVQVVSATSFSLEAFQQIAPE
FT                   MVVLSPGPGSPEDFPISLALLDKIQVPILGICLGHQMIGHFFGAKVVPANVPVHGKTSV
FT                   ISHTGEGLFADLEPAFQVTRYHSLVIDPTTVPVNLKVTAVTEDGVIMGLVHATKPIHSV
FT                   QFHPEAILSENGHAILKNFVRLGRNVK"
FT   gene            117981..118400
FT                   /locus_tag="LM5578_0111"
FT   CDS_pept        117981..118400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0111"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66869"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466270.1"
FT                   /protein_id="ADB66869.1"
FT                   /translation="MKNELEDKILAILEQHQVGVLTSVQGDYPHARYMTFLHDGLTLYT
FT                   PSGKELPKTEEVRRNPHVSVLIGYESPGSAFLEINGLASLEEDESIKERIWENISKEWF
FT                   RGEDSPSFVVIKIVPEQIRILNSDDDGPDTLDLIG"
FT   gene            118708..120018
FT                   /gene="serS"
FT                   /locus_tag="LM5578_0112"
FT   CDS_pept        118708..120018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="LM5578_0112"
FT                   /product="seryl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66870"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466269.1"
FT                   /protein_id="ADB66870.1"
FT                   /translation="MEKNKGGVSMLDVKLLRNNFDEVKQKLQNRGEDLGEFEKFGELDK
FT                   RRRTLIVETEALKSQRNEVSQEIAKLKREKQDADAKIEEMRVVGDRIKTLDIELREIDE
FT                   KLDMILMSIPNIPHESTPVGESEDDNVEIRKWGEVRAFDFEPKAHWDLGTDLDILDFEN
FT                   AAKVTGSRFVFYKKLGARLERALINFMMDLHSNEHGYEEMLPPYMVNRASMTGTGQLPK
FT                   FEEDAFLIEAEDYFLIPTAEVPVTNYHREDILKAEDLPRKYTAFSACFRSEAGSAGRDT
FT                   RGLIRQHQFNKVELVQFVKPEDSYVALEKLTGNAEEVLRRLELPYRVLSMCTADLGFTA
FT                   AKKYDLEVWIPSYNSYREISSCSNFESFQARRANIRFRREPGSKPEYVHTLNGSGLALG
FT                   RTVAAILENYQDADGSVRIPKVLQGYMGGIEKIELPK"
FT   gene            120038..120289
FT                   /locus_tag="LM5578_0113"
FT   CDS_pept        120038..120289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0113"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66871"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466268.1"
FT                   /protein_id="ADB66871.1"
FT                   /translation="MANLSELPNIGKVLEQDLIKAGIKTPAELKDVGSKEAFLRIWEND
FT                   SSVCLSELCALEGAVQGIRWHDLDEAKKSELKKFHQSL"
FT   gene            complement(120343..122070)
FT                   /locus_tag="LM5578_0114"
FT   CDS_pept        complement(120343..122070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0114"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66872"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466267.1"
FT                   /protein_id="ADB66872.1"
FT                   /translation="MDQKKYSWRKFFQLLISAKPANWIIFCALFASVITTVAGLVVPLF
FT                   TKNLIDGFSIASLDVKMIALIVLAFILQAITNGFSIFLLNYMGQKVVATIRERLWKKIV
FT                   HLPVSYFDNTKTGEMVSRMVNDTVVVKELIADHLPQFVTGIISVVGAIIILFFMDWKMT
FT                   LIILVAVPITALVVAPLGQKMFKISKGLQNETANFTGSISQTLSEARLVKASNAETLET
FT                   EAGHQGINRLFGFGIREAKVVAVLGPLIFFVVMGVIVGIIGYGGIRVSAGTMTTGTLIA
FT                   FLLYLFQIIVPVTSFATFFAQLQKAKGATERIADILNETEEDFDAGKKVDVSGKTIRAS
FT                   DISFSYNEGEPILKHVSFDTKPGEVIAFAGPSGGGKSTLFAILERFYQPKTGEILVGDI
FT                   PLSEISINSWRTQIGYVSQESAMLSGTIRDNLCYGLDREITEDELWNVAKLAYADGFIS
FT                   ELPDKMATEVGERGVKLSGGQRQRIAIARAFLRNPNILMLDEATASLDSQSEQIVQQAL
FT                   ANLMEGRTTFVIAHRLSTIVNADQILFIEHGEITGRGTHSELVASHPLYASFAEQMLK"
FT   gene            122400..123089
FT                   /locus_tag="LM5578_0115"
FT   CDS_pept        122400..123089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0115"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66873"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466266.1"
FT                   /protein_id="ADB66873.1"
FT                   /translation="MLFLKELESNLTVSKLMELCFEHPNYKDYCSVISTKKGEVLESLS
FT                   PAGTKVYFVLSGIYGMIVEEDAEMEEESCKECIVRFLQKGDSFGLYHLFYDEWSPHVSM
FT                   QSLGHGEVMEVDSNFLFSIFDKKDENNFFMIKVMAEELREAHTFAKLSFLKKEERIRKA
FT                   ILKCAQTLGTFSDNGILLPREITQEVLARYTNTSREYVAHTVMHLIKEDIIRNRPKPLL
FT                   VMDKTRL"
FT   gene            123232..123876
FT                   /locus_tag="LM5578_0116"
FT   CDS_pept        123232..123876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0116"
FT                   /product="putative translaldolase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66874"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466265.1"
FT                   /protein_id="ADB66874.1"
FT                   /translation="MRFFIDTANVEEIKKANRMGFISGVTTNPSLVAKEGRDFNEVIQE
FT                   ITSIVDGPISGEVVSLEADEMIAEGRVIAKIHPNMVVKIPMTGEGLAAVKVLTEEGIKT
FT                   NVTLVFSATQALLAARAGATYVSPFLGRLDDIGDDGLVLIRDIADIFEIHGIPTEIISA
FT                   SVRHPIHVIECAKAGADIATVPFKVFEQMLKHPLTDSGIDKFLADWEAAKK"
FT   gene            123895..124242
FT                   /locus_tag="LM5578_0117"
FT   CDS_pept        123895..124242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0117"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66875"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466264.1"
FT                   /protein_id="ADB66875.1"
FT                   /translation="MNQTFIVKKEHISQYPNPLFVNKNESIWVFEEDTEYPGWIFCKVK
FT                   SSGKEGWIPKQIIQISNDGKSGTVSEDYSARELNVKPGDKLESNRELNGWVWCVTEENE
FT                   AGWVPRENLEV"
FT   gene            124359..125567
FT                   /locus_tag="LM5578_0118"
FT   CDS_pept        124359..125567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0118"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66876"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466263.1"
FT                   /protein_id="ADB66876.1"
FT                   /translation="MENWKKNLYVVWVGCFLTGTGLNLIMPFLPLYIEELGVHNPDQVS
FT                   MWSGIALSSTFLVSAIMSPIWGKLADQKGRRIMLLRAALGMAIAMILMGLVSNVYQFVG
FT                   LRLLMGIFSGYISTANALIATQVPRHRSGWALGALSTAAVSGVLIGPLIGGALSDTFGV
FT                   RPVFYITGVLLLGSFFLTLFFVKEKFTPVEKKEMRSGKEVFLSLKNPGLIISLFITTMM
FT                   IQIASNSVNPILTLYVRDLAGNAQNIAFISGMIASVPGVAALIAAPRLGRWGDRIGSER
FT                   ILLGALIGSMLLQIPMAFAQNPLQLGILRFLLGLTDGALLPAVQSLLTKNTPREVAGRI
FT                   FGYNQSFQYIGNVIGPLVGSSVAAHFGYGDVFLVVAGFIFINVLISFYFNRKMHGEKGN
FT                   HAN"
FT   gene            125557..125847
FT                   /locus_tag="LM5578_0119"
FT   CDS_pept        125557..125847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0119"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66877"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466262.1"
FT                   /protein_id="ADB66877.1"
FT                   /translation="MPTDLIKLPGIGKKMVLMLNEIGIEEVADLRGKNPLELYEDTCDK
FT                   RGERMDPCVLYTYRCAVYVAETDEAEQDVDLRKWWNWKDKQHTNERNLKNE"
FT   gene            125840..126529
FT                   /locus_tag="LM5578_0120"
FT   CDS_pept        125840..126529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0120"
FT                   /product="NAD-dependent deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66878"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466261.1"
FT                   /protein_id="ADB66878.1"
FT                   /translation="MNKLNEALKKDEHIVFLTGAGVSVPSGIPDYRSKNGLYAGMSSPE
FT                   YMLSHTCLVREPEKFYQFVTENMYYPDAEPNAIHTKMAEIEAEKDVTIITQNIDGLHEK
FT                   AGSKKVVNFHGSLYHCYCQNCGMTVTAKDYLKSDIHTDCGGVIRPDVVLYEEAISESAI
FT                   DQSLTAIRKADLIVIVGTSFRVSPFCNLTDYRNKKARIFAVNKERISLPYPFEMMESDA
FT                   VKVFAEI"
FT   gene            126647..127981
FT                   /locus_tag="LM5578_0121"
FT   CDS_pept        126647..127981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0121"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66879"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466260.1"
FT                   /protein_id="ADB66879.1"
FT                   /translation="MNPDPESQQIILQLILIVVLTMLNAFFASAEMALVSLNKNRVKSQ
FT                   AETGDKKAVMLAKLVDDPSKFLATIQVGITLAGFFSSASAATSIATRLESVFGGSSFAK
FT                   ELSIIVVTIVLSYITLVFGELYPKRLALQKSEKIARVSVRPIMAVGVVLRPFVKFLSFS
FT                   TDILVKLTRMEKNTDNEKMTREEMQLLIETGRRDGVIEVEELQMLRGVFEMDNKYAREV
FT                   MVPRTDAFMIDAETESEELCDALLSENFSRVPVYTGDQDSVLGILHMKDFFAEARKSGF
FT                   ENIDVKGLVKDAYFAQETMFIDDLLKNMQRTRNQMAILMDEYGGVAGIVTVEDLLEEIV
FT                   GEIDDENDVFSDEVKKVDETTFIVEGRMPLDDFNKMFHVELPSRGVDTVAGFVLTLTGT
FT                   IPEEDDKVVVEYGTLRFTVEEMNDARLVSVRVEKDIQTSELGQMA"
FT   gene            128049..129005
FT                   /locus_tag="LM5578_0122"
FT   CDS_pept        128049..129005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0122"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66880"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466259.1"
FT                   /protein_id="ADB66880.1"
FT                   /translation="MPNIKEIAKLAGVSVTTVSRVLNNHPYVAEEKRVRVQAVIDELDY
FT                   SPNRSAMDLARGKTNTVGVIIPYNDHPWFDKIVNGILEVAFKNRYSVTLFPTGYDPKEE
FT                   EKYLMRLKTKQVDGLIITSRANNWDVILPYLAYGPIIACEYVESKEVSCSYIDRVKAYR
FT                   AGFKFLEDEGYKKVAFTAGRASRESTSTYGKINAYEQVFGPVGDNRFLSECYTLEDGLK
FT                   AGEHFFAAGKDWPDAIYANGDEVAAGVMYHVKKLGLRVPEDVAILGQENLPIGKVLEIT
FT                   TLDHNLKKLGENAFTIFEQGKLQRIKVEHELIRRKTV"
FT   gene            complement(129009..130142)
FT                   /locus_tag="LM5578_0123"
FT   CDS_pept        complement(129009..130142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0123"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66881"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466258.1"
FT                   /protein_id="ADB66881.1"
FT                   /translation="MKIVIAPDSFKESATAVEVATAIKKGWTKARPADQISLAPVSDGG
FT                   EGFLTVLSESSEVELFQAEVTNLNGHKIMASYGIHARQETAIIESANTIGLDLIPAADR
FT                   NPAHASSAGVGELILASLDHNVKKIIIGLGGSGTNDGGAGLIQALGVALLDKNKQPILP
FT                   GGIHLQELAYIDASNLNPKLKNIQFQIACDVTNPLLGENGATFVFGAQKGASPDMLVKL
FT                   ENAMQNYGAKLDQFSSQKITTKKGAGAAGGIAAGLMTFLNADLLSGSALVMKLSNMKDK
FT                   MKDADIVIVGEGRMDKQSMMGKIPVQIAQEAKKQGCFVLAIVGSLALENNLAQQHGIDT
FT                   FFPNIPEITDLPTLFENTTKNLERTAENIAKLTLIGK"
FT   gene            complement(130139..131821)
FT                   /locus_tag="LM5578_0124"
FT   CDS_pept        complement(130139..131821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0124"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66882"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466257.1"
FT                   /protein_id="ADB66882.1"
FT                   /translation="MQTELVNQIEVKLRKIYQAAYQPAYLEKMLACAENYSNNTRGSID
FT                   TISEKNVYLIAYGDSIFEKNKHPLQTLNEFLQEYAQDVITDVHLLPIFPSTSDDGFSVT
FT                   DYKQIDEQLGDWDDVQKMSENFRVMLDFVANHMSKSSDWFKRFSDNEAPYNQFFIEKDS
FT                   QFDYKNVTRPRTSPLFHKYENGKELWTTFSEDQLDLNVRNIDCLVALTDVLLFYASKQA
FT                   TSIRLDAIGFLWKTSGTTCMHLPETHEIISLWRLLIDELYPNLQIITETNVPHEENISY
FT                   FGDGENEANMVYQFPLPPLVLHTFTCHDTTKLSKWAKSISQVSDTATYFNFLASHDGIG
FT                   MRPATGILSDEEINSLVQKAVQNGGQVSYKDNADGTQSVYELNINYGEALQNLDEDTTE
FT                   ELVTKKIIAAHSILLTLQGVPAIYYHSLLGSKNDLVGYEESGINRRINREKLEKNQLVH
FT                   ELKTDTYRKTIFTSLKKLVQIRRNHTAFSPFATQEILDLGPDVFAIKRESEGECIYGII
FT                   NVTSHDISKKVAFSGTNLLANQPVTSELELTAYEVVWIKKAVQ"
FT   gene            complement(131823..134471)
FT                   /locus_tag="LM5578_0125"
FT   CDS_pept        complement(131823..134471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0125"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66883"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466256.1"
FT                   /protein_id="ADB66883.1"
FT                   /translation="MKKNKIVHVVAHSHWDHEWYFTMEDSNILLIENLDYLLNVLETKD
FT                   SFASYSFDGQMSVIERYLDIRPENKARVQKLIQDRRLFVGPWYTQTDSLLVKTEAVIRN
FT                   LLYGYKMGEEFGHSMSIGYSPDIFGQHAYLPAIYKSFNMEHSIFQRGVYNDQVQEDLNF
FT                   HWTSPDNKSIPTNNIFFGYGPGKFLSSEKSYVETRLLPILDRLAEMNTHTDVLLLPAGG
FT                   DQVLVRENFPEIVTELNEMDLGYTFILSDYEAFMNDAWTSTFPNEITGELLACQKSRIH
FT                   HTCRSERYDIKRLNYLVENRLVNILEPLATMANKFGIKYPKPWLDIIWKKLFDSHAHNG
FT                   IGASNSDDANHDIVVRLTSALRMTNGLINLLKKQITKAVSQEMGDENIALLFNTNPVAE
FT                   ERTAKLTLFTPEKSFQLFSGDAEVTFSVVHQEKLDGGRKVIVTAKGEKEVAVPDYYRTE
FT                   IYLKSGLIPALGYKTLQVKAVTTEMDQLISISKQTIENEKIIVQFENGKINLLNKEQQS
FT                   IINDLIRFENVADAGDSFDFSPLEGDQAIYIETSELLTVEKNHLYSKMMLKHTAVVPKD
FT                   LEARAQKTSTETFEILTEIELFDGEEFVRVRHTIDNKVKDHRIRALIKTNLAEPKFSYA
FT                   DQGYSLMKRSVTNPYLANWREDKFVEAPVPIFPVENIVAVSEEDATLALLVGGIKEYEI
FT                   LPKTAEIALTLFRSNGLLGKDDLMWRPGRASGINNKVVPTPDGQMLEEMIFEYAVYVQP
FT                   EKLNEQTLYAQSNIFEGHTETYHLQNLNTFEERLERFEVDYPIDRLPAQNSIFELDNPN
FT                   VFMSTCKKSWDGTGTIIRLFNPSDKEETVRWTTNASSFEVSLAEEKIAELKENTICIPK
FT                   KGFATILLEGE"
FT   gene            complement(134532..136490)
FT                   /locus_tag="LM5578_0126"
FT   CDS_pept        complement(134532..136490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0126"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66884"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466255.1"
FT                   /protein_id="ADB66884.1"
FT                   /translation="MKLSDITSEPLIFLDKDWRTKEEVFDGLIDALHNQGVLSDKNEFK
FT                   KAVLEREKISETGLEKGFAIPHGKSKAVKKAAFAFARINQPINSWGSIDPTNEVKYIFL
FT                   LAIPENEAGSTHLELLAALSKRLLDPAFIESISTAPTVNEFMHVLDSEQQEDEKVDYNR
FT                   KIVAITACAAGIAHTYMAAEALELAGKELGIEVIVEKQGANGIEDRITPEILKGAEAVI
FT                   FATDITAKDKERFAGMPFIQRRVAEPLRSGKEMIETVLSKPDGYVKADTDGTEQQFDNN
FT                   KSSIFSQIYRGILTGISYMLPVIVAGGLMIGIGQLGATAFGLEKVIGNPEYATNSNQLI
FT                   VIFHYLGLYGNMIMKFMYPVFGAFLAYSIADRPGLAPGFIGGAFAAGLHYTFWGVDGGI
FT                   PSGFFGVLILGIIAGFVAKFLNEKIKLHKNLQAMKPMFLIPGITVLVLFFVNYYVVDPV
FT                   FGGLNAWLQELIIQNQDASAVLLSTIIACLTAFDLGGPVNKAAGAIAIGLAADGIFPLT
FT                   ARVLAIVIPPIGLGLATVLDKYVVKRRVFDENLRVAGTTSIFLGFIAIGEGAIPFMLQN
FT                   PLITIPINMIGASLGAVTAVLLGAVQWLPLPAIWGWPLVENFWAYAIGLIVGIAFITFA
FT                   NIFVRYGLITRKENKIK"
FT   gene            136656..137408
FT                   /locus_tag="LM5578_0127"
FT   CDS_pept        136656..137408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0127"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66885"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466254.1"
FT                   /protein_id="ADB66885.1"
FT                   /translation="MSATSLYRLFAPQIEFLSPAEKQVFFYIDNHISIIEKMSLTSLAE
FT                   STNVSTTTVIRMCHKLKLSGFSELKFLLHSDKTETKPLSKDYSSTFLEKIRLGIEQLPK
FT                   KEIEQVATRIAYAPKIYIACLGMTKTLGEYFSKSLVTSKKNVVFTYDSFIIDILPQIVE
FT                   RDDLIIIISESGGTENTLSLAEHLKYNLSNVIAIVNNPNAQISQYVETIIYASSEEFGE
FT                   DSFKHHHAPLLIVIDLILNIFEQQKKLI"
FT   gene            137492..137860
FT                   /locus_tag="LM5578_0128"
FT   CDS_pept        137492..137860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0128"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66886"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466253.1"
FT                   /protein_id="ADB66886.1"
FT                   /translation="MKLDGVCKINSALGMEYQFGEFYIDRDYLVFDQDFSLGMKKRQTF
FT                   PVAKLGHMALVREEEEIMLTFSCDNIEFEINGNSHDNLREFRDLLQNKGTDSSAIQKAE
FT                   NKKKARYTTHHYHNFAKS"
FT   gene            137874..138485
FT                   /locus_tag="LM5578_0129"
FT   CDS_pept        137874..138485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0129"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66887"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466252.1"
FT                   /protein_id="ADB66887.1"
FT                   /translation="MYKAIIFDVDGTILDTERAVLHSLQAVLAEEGLSYELDELRFVLG
FT                   ITGAAAVEQLNILDQEKVLDKWIEREATFIEEVEVFEGIHKVLHAIPESGVVTSKNALE
FT                   MEKGFYPFNIQDHFQAIVCASDTENHKPHPDPLLKGLEILGREPHEVLYVGDSSYDMKC
FT                   AHAAGAHFGLALWGAKTTDGFEQAELVFEKPEDILAYVSK"
FT   gene            complement(138528..138932)
FT                   /locus_tag="LM5578_0130"
FT   CDS_pept        complement(138528..138932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66888"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466251.1"
FT                   /protein_id="ADB66888.1"
FT                   /translation="MTTLENSVIFDKGELITNDYFIGNTYLKMLVPEDTVYNCPIGNVT
FT                   FEPGARNNWHKHDGGQILLVTGGIGYYQEEGQPAQLLKEGDVVTIPKDMKHWHGAMKDS
FT                   WFVHLAISTNVELGGTTWLEPVSDEHYNNL"
FT   gene            complement(139272..139388)
FT                   /locus_tag="LM5578_0132"
FT   CDS_pept        complement(139272..139388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0132"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66889"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466250.1"
FT                   /protein_id="ADB66889.1"
FT                   /translation="MTKNNISFYVVDASEELTMNIKEASEKKWRFCRYNSLL"
FT   gene            complement(139473..140354)
FT                   /locus_tag="LM5578_0133"
FT   CDS_pept        complement(139473..140354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0133"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66890"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466249.1"
FT                   /protein_id="ADB66890.1"
FT                   /translation="MHIKILKNRYPNIVVSKNPIKSSSDTISFFEEPYYFTIPKSNLSE
FT                   EEAMLLHTLFPEPLPTFPKESTQFWFDLLFGNSEMAITNEKDTYRITQFHIKTTTTKSM
FT                   LQEWQKALLSFFSPEAELIMFSPNYGVIIEKSTGSLLGEEELVAVAGTLENDFYIQSTF
FT                   FMGLFHPLNDRLRGLFAEERAIFNHNNREVVQTVASESLKVIALRMKESLITNELNDLF
FT                   HQDDTWIPLIHTLFKNQGNISLTAKELFMHRNTIQYRLDKFYEQTNLSLRKMDGLLLAY
FT                   LSTLQTNNSNHE"
FT   gene            140524..140973
FT                   /locus_tag="LM5578_0134"
FT   CDS_pept        140524..140973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0134"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66891"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466248.1"
FT                   /protein_id="ADB66891.1"
FT                   /translation="MADRQESLAKAIAIIHRSESTFKNKKLLETGLNIGQLRYLWTLYK
FT                   EDGISQESMAKRFMVDKASVTRHIKRLEELGMIRREIDAKDRRIQRIFVTETGFQMHDL
FT                   IEEVTAEWSALLTANFSEKEKDDLMHLIGRLSDNAIMAVEGGEVE"
FT   gene            140970..142322
FT                   /locus_tag="LM5578_0135"
FT   CDS_pept        140970..142322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66892"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466247.1"
FT                   /protein_id="ADB66892.1"
FT                   /translation="MKEQSKRLGEDSIPSLMARLSIPAFIGMFVMGMYNIVDTIFVSYG
FT                   VGPSGVAALSIAFPVQMILMAMAAMFGIGGASIISRSLGAGEQKHADKVFHQVIWLVLI
FT                   SSIFIAIVTFIFLDPLITLFGAPADIHDIASDFLSLILLGAVFQTFAMAMNNIVRSEGN
FT                   AKTAMLTMIISAILNMILNPIFIMGFGMGVRGSALATVIAQAVGAIWLLIYFLSGKSTL
FT                   SLKGFSFRMDFPLIRRIMAIGFPSFIMMSAGSIVTVAVNWMLNIYGGTMAIAVYGIANR
FT                   IASFVIMPINGVTQGMQPIVGFNYGSRQFERVMKAVKVSMIAATVMSLIAWGLVEIFPG
FT                   LLVRIFSNDPELIAQGTTAVRFMLLAAPTIGFQIVCGGLYQALGRARISFIISLMRQII
FT                   CLVPLLLILPHFFGLDGIWYAFPLADLGAFTVCLVIMSKTWRRIFKNPEIV"
FT   gene            142380..142823
FT                   /locus_tag="LM5578_0136"
FT   CDS_pept        142380..142823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0136"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66893"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466246.1"
FT                   /protein_id="ADB66893.1"
FT                   /translation="MAKMYPYLAFENAKEALGYYEEVFGATNISRLPVSEEQSEMFGLP
FT                   KENLENTTVHGGFTVLGANLFCSDSFGKEVKPSNQISIMLDSNSEDPAAVADADAFFEK
FT                   VSSSGRVTVTLPFEEQFWGGKMGQFVDEYGISWMIHTQPYSKL"
FT   gene            complement(142844..143305)
FT                   /locus_tag="LM5578_0137"
FT   CDS_pept        complement(142844..143305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0137"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66894"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466245.1"
FT                   /protein_id="ADB66894.1"
FT                   /translation="MEIKQIKAKDTQDIRHRVLRPEQPEENAIYPNDDMEGTFHLGAFE
FT                   KDVLLGVASFYPEKSTVIMNPAQYRIRGVATERRMRLKGLGTALLAEGEAEIWTRGADI
FT                   IWCNARIVAVGFYEKHGYRKVGKSFVIPGIGEHYLMKKVNPNKKVDQDN"
FT   gene            complement(143359..144093)
FT                   /locus_tag="LM5578_0138"
FT   CDS_pept        complement(143359..144093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0138"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66895"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466244.1"
FT                   /protein_id="ADB66895.1"
FT                   /translation="MEPLFSIGEMAKKSQLSIQRLRYYDKIGLLVPAFTDPTSGYRYYK
FT                   TAQEEQLNLIQALQYMGFSLQELKQYLDKNTMESLPDLLIKYQQKLKDEEARIARKKWL
FT                   IDRYQGLLKRETDSTKLLTAARLLLTEPLLTPVHVDILNDPDFHQEVQKTVSHLGLSKS
FT                   YQQFPGYCVLDGQTYLFIELDHSIGAPGERRLLSSERQAFVTPQNWKTPSENENYLLQE
FT                   TVAWINQELVRGYSYETKLTFE"
FT   gene            144173..144892
FT                   /locus_tag="LM5578_0139"
FT   CDS_pept        144173..144892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0139"
FT                   /product="putative 6-phosphogluconolactonase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66896"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466243.1"
FT                   /protein_id="ADB66896.1"
FT                   /translation="MKIIVEKDYENMSKTTMQLLLGKMYQDKKVHLAITAGSTPKRMYE
FT                   LMVEEMKEKAPLKNVSYYNFDEIPIGDEKYGVTIANLKAMYFDPAGIPEEQIHMLDTKN
FT                   YVEHEARLKEVGGLDAILIGIGEDGHFCGNLPGVTKFGDETRLVSVQSRPDMFDILLGE
FT                   VGGDVEKVPEYYVTMGPKSVMHAKEVILFANGKKKAAIIKKALQGPVTEDIPSSIFQLH
FT                   PNFTVVLDEEAASELNM"
FT   gene            complement(144934..146511)
FT                   /locus_tag="LM5578_0140"
FT   CDS_pept        complement(144934..146511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66897"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466242.1"
FT                   /protein_id="ADB66897.1"
FT                   /translation="MNSENLIAPELYNITDEIAKFSSEKTALIWKNEHNETKTWSYRHL
FT                   LEQANKFANVVKDAGIKKGDHVIVMTPRLLETYAIYMGLWKAGAIIIPASELLKAHDLE
FT                   YRIHHANVKAIVSYNGMTAEFDKIESIPSVSKKIIVGEKLSGWDHYETLMEAASTEFER
FT                   VETSRDDACLLAFTSGTTGNPKGVVHIHGWGYAHIRIAADHWLDIHEDDIVWATAGPGW
FT                   QKWVWSPFLSVLGKGATGFIYNGRFIPEKQLRLLEEEKINVLCCTPTEYRLMAKVNNLR
FT                   EHDLSSLRSAVSAGEPLNREVIQVFQDNFDIKVRDGYGQTESTLLIGTLVDTPIRPGSM
FT                   GKPIMPEYMAIIDADGNPVGVGEIGDIAMRRDFPALFKEYYKEPERLQKAIRGDYFVSG
FT                   DRAIRDEDNYYWFQGRNDDIIISSGYTIGPFEVEDALTHHPAVKEVAVVASPDEIRGTV
FT                   VKAFIVLKDGYEGTEDLVHELQTFTKEQTAPYKYPRRIEFVEALPKTDSGKIRRVELRD
FT                   AEFASVHG"
FT   gene            146706..147176
FT                   /locus_tag="LM5578_0141"
FT   CDS_pept        146706..147176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0141"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66898"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466241.1"
FT                   /protein_id="ADB66898.1"
FT                   /translation="MERAFFMQQALEEAEKARDIGEVPIGAVVVLDGEIIGRAHNLRET
FT                   SQNAVTHAELLAIQDACKHQNSWRLSGAELYVTLEPCPMCSGAILLSRIEKVYYGAKDP
FT                   KAGTAGSLMNLLQDDRFNHTCEVEAGLMESESSEMLKSFFQELRKRNKLNRS"
FT   gene            147558..148964
FT                   /gene="cydA"
FT                   /locus_tag="LM5578_0142"
FT   CDS_pept        147558..148964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydA"
FT                   /locus_tag="LM5578_0142"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66899"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466240.1"
FT                   /protein_id="ADB66899.1"
FT                   /translation="MDKLFLARFQFASTTIFHFLFVPLSIGLVFMVALMETLYVVKGKE
FT                   IYKKMSKFWGHIFLINFAVGVVTGIIQEFQFGMNWSDYSRFVGDVFGAPLAIEALLAFF
FT                   MESTFIGLWIFGWDKLGKKLHLACIWLVSIGTIMSSFWILAANSFMQHPVGFEFKNGRA
FT                   EMNDFLQLITNGQLLVEFPHVIFGAFATGAFFIAGVSAYKMLKKQDVAFFKRSFQIAMV
FT                   MAVIGGFGVAFSGHSQAQYLVKTQPMKMAATEGIWEDTADPAPWTMIAKINPEEKKNEW
FT                   EVNVPYALSFLSYGTLTGSVEGMNTLQKQYEEKYGEGDYIPPVKTAFWSFRIMVGAGML
FT                   MILFALIGIVLAWKKKLVNAKWYLRFMIPMIGFPFLANSMGWIMTEIGRQPWVVFGYMK
FT                   TADAVSPNVSSGQILFSIIAFSTIYTILAILLVYLFIREIKKGPDGHKPEKAEISVDPF
FT                   DKGDESFVTK"
FT   gene            148951..149964
FT                   /gene="cydB"
FT                   /locus_tag="LM5578_0143"
FT   CDS_pept        148951..149964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydB"
FT                   /locus_tag="LM5578_0143"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66900"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466239.1"
FT                   /protein_id="ADB66900.1"
FT                   /translation="MSLNELWFLLIAILFIGFFFLEGFDFGVGMSTRFMARNALERRVL
FT                   VNTIGPFWDANEVWLLTAGGAIFAAFPNWYATMFSGYYIPLVFLLLALIGRGVSFEFRG
FT                   QKDSPLWIKTWDWVIFFGSILPPFLFGVLFASLIQGMPINSDMDMYAGFFDYITVFSVW
FT                   GGVTITLMCLLHGLLFITLRTEEDIQDRARRMAKRVWFITVPALVIFVVLAYFNTDMFQ
FT                   VRPVLVPLMIGIVVVMYVLSALFIWKDRDILAFTFGGLGIVFTIATIFVSLFPRVMISS
FT                   INSAFDLTIENAASGQYSLSVMTIVAVTLLPFVLGYQIWSYYVFRKRVSSKEKMTY"
FT   gene            150006..151688
FT                   /gene="cydC"
FT                   /locus_tag="LM5578_0144"
FT   CDS_pept        150006..151688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydC"
FT                   /locus_tag="LM5578_0144"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66901"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466238.1"
FT                   /protein_id="ADB66901.1"
FT                   /translation="MMILAVFTLVQGAAIIVMAITLARAITDLFHEHPFQSVTIQIGLF
FT                   AGAYFLRHFLNVWKKQIVYRYAAKLAKTMREELLDSLFALGPRFARAEGTGKVVTMVME
FT                   GVADFRNYLELFLPKMMNMAIIPAMIWVYIAFQDWTSAFILMITLPILIVFMIILGLAA
FT                   KKQADSQFETYRVLSNHFVDSLKGLETLKYLGLSHDHEGKIASVSSRYRKATMKTLRVA
FT                   FMSSFALDFFTMLSIALVALFLGLGLIDGNMNLPIALSVLILAPEYFLPVREVGSDYHA
FT                   TLDGQEAGRVIQGIIDQAKAEKPEMDALPLTTFAENTEFSFENITVKHGADDADSLHKA
FT                   SFTVKGFEKIGIIGATGAGKSTLIDVLSGFLTPTSGEFHWNGKSGASLASTDWQTQVTY
FT                   IPQHPYLFHDTIAGNIRFYHPNSTEDEMKKAAESAGLNKLVAGLEDGYETLVGEAGRML
FT                   SGGQEQRVALARAFLTDRPVVLMDEPTAHLDIETEYELKKPMLDLFEDRLVFFATHRLH
FT                   WMLEMDRIIVLDHGAVVETGTHEELLSRKGFYYNLVKAQLEEV"
FT   gene            151685..153427
FT                   /gene="cydD"
FT                   /locus_tag="LM5578_0145"
FT   CDS_pept        151685..153427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydD"
FT                   /locus_tag="LM5578_0145"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66902"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466237.1"
FT                   /protein_id="ADB66902.1"
FT                   /translation="MMRKSSWIIPYIKENRGLFLLVIFLGTLTFASAGALMFTSGHLIS
FT                   KSSLMPESIMAVYISTVGVRAFGIMRSVSRYVERLSSHSLVLRILEKMRVRLYRLLEPQ
FT                   ALLLKSRYKTGDILGLLAGDIEHLQNFYLTTMLPAIVSLVLYAGVVIALGAFSIPFAAL
FT                   FVLLIGLLVLVLPWVSLLYARGKNAYLKQGRNSLYQKFTDAVFGISDWKFSGREKTFIS
FT                   NYEKDEADMLRTENKQFHFVNWRDFFSQLVVGFMVIVMVYWSTAESRDGAFSGTMIAAF
FT                   VLAIMALAEAFVPVSSAISDKSLYQDSLARLDKIEDPALPTFEEETKEIERINTENVVL
FT                   KAENLTFAYDEKSPEILNGFDFTLQQGEKVAIIGRSGTGKSTFLKLVQGALLPTAGKVT
FT                   MNDVEVEKLRPQIPELTSMLNQKAHLFSTTVLNNIRLGNQDASDEEVYEAAKKVQLHDF
FT                   IMSMPDGYHTQMSEMGERFSGGERGRIALARILLQNTPIVILDEPTVGLDPITERDLLA
FT                   TIFETLADKSLIWVTHHLVGAEKMDRVLFLEEGKTLMEGPHAELMAEEPRYKRLYQLDR
FT                   PIEL"
FT   gene            153568..154515
FT                   /locus_tag="LM5578_0146"
FT   CDS_pept        153568..154515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0146"
FT                   /product="pepdidoglycan bound protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66903"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466236.1"
FT                   /protein_id="ADB66903.1"
FT                   /translation="MKKFHGLILTALVTCLIIPFSLAASAETNENGNNSTPTEEKTTDT
FT                   TENIITEEKTEPAEPTKDTTVTPPQKSKVQTTIDITDSQEVYSYEQNSKIDLKDFTATL
FT                   TDYTDTKLTNYRLAANSKLSTAQTGIQEVTLLGDNEDGKTTAVKLNYLVKEKTAQLTIT
FT                   DMNFDLETKIFTGKTKPFASVYMSSPADENFGEGTTTADKDGYFYAEWATTPKQITAYA
FT                   FDESGNYSEEVTYQVPAKKQNEAVVTAPDKVKKIETKNAVKSATTKPTDVTKVTKDDKT
FT                   DLPSTGDKGTEWIFVVAGVIVILVAVLLLRKRKK"
FT   gene            154558..155496
FT                   /locus_tag="LM5578_0147"
FT   CDS_pept        154558..155496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0147"
FT                   /product="GW repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66904"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466235.1"
FT                   /protein_id="ADB66904.1"
FT                   /translation="MKKLLSGLIVVLMVSLLGHSFNAEAASYEKIIYDKAVNLKGVVNQ
FT                   SKRNDGINSKMYKTSSSVKYLGSAKKYDKKTLIITREGKTARAKWYYCKLGNTTIGWID
FT                   SRAFTNIGKPTIADTVPALWNSKKAIITTKPKSTTATTYFFQKNSAGNWYEVRHFTSHI
FT                   GKWGFDPKFSEKSSGTPVGVYRTGIAFGQKGNPGTKLTFRAITNRSYWISNSNDKAYNT
FT                   WQERNSSSSADEKMKIPQYKYGMEVKYNAKRVKGKGSAVFYHVDSPKYNYTLGCVAQSE
FT                   ANTKEVLKFADKNTLIVLGEESRIKTFYGIN"
FT   gene            155612..157126
FT                   /locus_tag="LM5578_0148"
FT   CDS_pept        155612..157126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0148"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66905"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466234.1"
FT                   /protein_id="ADB66905.1"
FT                   /translation="MTSKPYIMGVDIGTSSTKAVLFNQRGEVIFRQATHYELITDETGK
FT                   AEESPTEIFDAVLTSIQAVMKNINTEELAGISFSSAMHSLIMVGSNGELLTECITWADG
FT                   RSSETLEKVKRDNYLFQLYEATGTPIHPMSPFAKICWLKEEKPTLFKRTEKFVDIKSYI
FT                   LYRLFGVWVMDESLASGTGLYNIMEHDWEFEAMEIVKLTPDFLPKVVPETYQLAGVKKE
FT                   YAELMGIPENLPFIIGGSDGALANIGIQATGQNDVTITVGTSGAVRKLTDQFQIDSRGR
FT                   TFCYGAGDGYFIAGGAVNNGGKVVEWGLQQFGSEAEISRRDFASFIAKIEEVPPGAAGL
FT                   LFQPYLLGERAPFWTNDIRGGFVGLTINHTKAHFIRAILEGVAFNLAEVYEAVSAPDDI
FT                   IYVTGGISAHDAWCKLLADILNREIRVPHTIEGSSLGAAIIGMRSLGILKDLNLKHTLP
FT                   IKAVYHPSENVLKYAELRLIFKQVTTQLMSSYSQLNSWQKKFDINS"
FT   gene            157184..157279
FT                   /locus_tag="LM5578_0149"
FT   CDS_pept        157184..157279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0149"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66906"
FT                   /inference="ab initio prediction:Glimmer:3.02"
FT                   /protein_id="ADB66906.1"
FT                   /translation="MNKKIVWIALTLVGICVVGTIIAAIMSVYLR"
FT   gene            157824..158465
FT                   /locus_tag="LM5578_0150"
FT   CDS_pept        157824..158465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66907"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466232.1"
FT                   /protein_id="ADB66907.1"
FT                   /translation="MQQLKSKKKWLPALIVAVFVGIIVILAIMFGFFQRQEVFDKYEVA
FT                   YEIDGKLYEVFPISATDIGVDKKSKDKNLYFRVNSYYNIDYLFRLAYKQYEINEPSTNK
FT                   YYSGLIDYSVADNAYVTQKDVYITNNESYATYDFFDKNGKKIYTYNPEETSNDDYIVRI
FT                   KPTILQGYEKSDIGSYDDYLNITALFKDKLGMDVNVRIDEDKEMVIFSIK"
FT   gene            complement(159037..159192)
FT                   /locus_tag="LM5578_0151"
FT   CDS_pept        complement(159037..159192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0151"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66908"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466231.1"
FT                   /protein_id="ADB66908.1"
FT                   /translation="MAVKRDMPEESKNSKVVKKEHFSIVFPDDIKEPATVEEKKKQDAE
FT                   KKTDDN"
FT   gene            159635..160999
FT                   /locus_tag="LM5578_0152"
FT   CDS_pept        159635..160999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0152"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66909"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466230.1"
FT                   /protein_id="ADB66909.1"
FT                   /translation="MNGLTAFLEKYFVPVAAKIGSQKHLVALRDAFISTMPITMAGSIA
FT                   VLLNAFFRDFPTDWGWTGFVEAMQPLIDINGYVYNGTLAIVSIIFAFSLGYNLSKAYEV
FT                   DRLAGGLVSLAAFVMNLTVTVSLDAVKAAIAASNANFDVATLPKEFAGIYGFFSLSQVN
FT                   GTGLFTAMIFGFISTIIYAKLMRRNIIIKMPDSVPPAVSKAFAAIIPALVALYVVGIID
FT                   WAFFKITNMDVITWISKTIQEPLLSLSQGYGAVLLVTFLVQLLWFFGIHGPNVLAPVLE
FT                   SLWGTAQLQNISAAQDGAKLPFEWVRGSFDAYVWMGGSGGTLVLIIALLMFSKRADART
FT                   VAKLSLAPGIFNINEPIMFGLPIVLNTIYLIPFLIAPMVMVTIAYFATTLGIVGPVKIA
FT                   VVWVMPPLLNSFLATGGDWMAPVISLINMVVAFLIWVPFVITANRVGVPEEEMKA"
FT   gene            161134..161355
FT                   /locus_tag="LM5578_0153"
FT   CDS_pept        161134..161355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0153"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66910"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466229.1"
FT                   /protein_id="ADB66910.1"
FT                   /translation="MIILNCPMKRDYITELLETHDKDGVTFKKIAEQGMKLTFETNIED
FT                   EEKAAKIAKETIKATEIGSVLYFQVSVG"
FT   gene            161358..161540
FT                   /locus_tag="LM5578_0154"
FT   CDS_pept        161358..161540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0154"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66911"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466228.1"
FT                   /protein_id="ADB66911.1"
FT                   /translation="MKIVNALFIISIGLIIIMFSPSYGKDGMASVPLLVTGLAVVLIGC
FT                   VFIVLKIRKDKKEKN"
FT   gene            161558..162022
FT                   /locus_tag="LM5578_0155"
FT   CDS_pept        161558..162022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66912"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466227.1"
FT                   /protein_id="ADB66912.1"
FT                   /translation="MNVTQKLYISQKECFDTLVSSAIYDVKNATGKTLQVRKLEGYKYQ
FT                   RTMSNGALATTKIVKVQPNELYQFETSSRVNTHTTTYTIKSTSETTCEVTYNELIETEK
FT                   ALNKMNNIIVGFMFGFFRKKRVKNLLKSIELSVINESKQKQEKLAAKSEQ"
FT   gene            162313..164052
FT                   /gene="dnaX"
FT                   /locus_tag="LM5578_0156"
FT   CDS_pept        162313..164052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="LM5578_0156"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66913"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466226.1"
FT                   /protein_id="ADB66913.1"
FT                   /translation="MAYQALYRVFRPQSFQDVVGQEHVTKTLKNAIVQNKTSHAYLFSG
FT                   PRGTGKTSAAKIFAKAINCEHGHDGEPCNECEICKGTTDGSIPDVLEIDAASNNGVEEI
FT                   RDIREKVKYAPTVAKYKVYIIDEVHMLSTGAFNALLKTLEEPPKHVIFILATTEPHKLP
FT                   LTIISRVQRFDFKRITTQDIIGRLKFILEEEKIPYDEKALMIVARAAEGGMRDALSLLD
FT                   QVISYGSEEVTVEDALEITGSVAQNLLTKLVSAAFDGDAAEAISTLTALLAEGKDPVRL
FT                   VEDLLVFFRDVLLYQKAPNLEETMERALIDDDFVALAKRADSLKVYEFVKILNTAQQQM
FT                   RFSNHPGIYVEVALVQLTQAGQSVAGGGNVPADAASGSDVSDLKRQMEQMHQEIQTLKK
FT                   QIASGAGAAPADKPTQNRGGSKKAINNGKQFKAPIGKINHVLGEAKKENLQLIRGCWGE
FT                   LLSMLMASQAALLNDAEPVAASQDTFVLKFKHEIHCQMAMDNPNFVETITSSIARLTQV
FT                   NYTFIGIPEDQWADVRENFLHSHGSDADAEDGANPEAKKPAEDPFVAEAAKLVGEDLLE
FT                   IKD"
FT   gene            164082..164399
FT                   /locus_tag="LM5578_0157"
FT   CDS_pept        164082..164399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0157"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66914"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466225.1"
FT                   /protein_id="ADB66914.1"
FT                   /translation="MRGMGNMQGMMKQMQKMQKEMAKAQADLEAQEFTGTAGGGMVTVK
FT                   ATGKRVITDVVINEEVVDPEDIEMLQDLVLAATNDVLKQIEDTTSQTMGKFTQGLNIPG
FT                   M"
FT   gene            164508..165104
FT                   /gene="recR"
FT                   /locus_tag="LM5578_0158"
FT   CDS_pept        164508..165104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="LM5578_0158"
FT                   /product="recombination protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66915"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466224.1"
FT                   /protein_id="ADB66915.1"
FT                   /translation="MHYPEPITKLIDSFMKLPGIGPKSAARLAFYVLDMKEDDVLDFAK
FT                   ALVDAKRNLSFCSVCGHITDKDPCYICADTSRDRSVICVVQESKDVIAMEKMRDFHGLY
FT                   HVLHGTISPMDGIGPEDINIPDLLKRLQDDTIEEVILATNPNVEGEATAMYISRLLKPS
FT                   GIKVTRIAHGLPVGGDLEYADEVTLSKAMEGRREV"
FT   gene            165119..165364
FT                   /locus_tag="LM5578_0159"
FT   CDS_pept        165119..165364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0159"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66916"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466223.1"
FT                   /protein_id="ADB66916.1"
FT                   /translation="MESRSNKFGRKKNKKIGKLHKSYDAYLMELIEVTQENWHKQKVLM
FT                   RKSFEYDPNLEYEEKKAEARYFYLFKEARTRQLKNK"
FT   gene            complement(165410..166252)
FT                   /locus_tag="LM5578_0160"
FT   CDS_pept        complement(165410..166252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66917"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466222.1"
FT                   /protein_id="ADB66917.1"
FT                   /translation="MTLSFSDTYRLNNGIEMPRHGFGVYKLTDEARMRTALETAVDVGY
FT                   RLFDTASFYHNEKELGDFFASSGLKRDEFFVTTKMWNTEQGYDETLRAFEKSQKKLQLD
FT                   QIDLYLVHWPKQDTFFDTWRAVEKLYDEGLVRAIGVSNFEAHHLDRLRTSANVLPVVDQ
FT                   LETHPHFPNHLLHRYLEELHIVHQAWSPLGRGGVLQEQILIDLAEKHGKSPAQIVLRWH
FT                   LQNNISIIPKSETPSRIRENAAIYDFELSEADMRQVERLNTGERVSHAPDVMYVRSEI"
FT   gene            complement(166373..167212)
FT                   /locus_tag="LM5578_0161"
FT   CDS_pept        complement(166373..167212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0161"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66918"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466221.1"
FT                   /protein_id="ADB66918.1"
FT                   /translation="MTTQAIILDIDGTLLNDDKQISPETKKALITAQENGVKLILASGR
FT                   PTTGMHVYAEQLEMEKHHGLLVSYNGAKVVDCATNEELFNQALTVEEGKAVLEHMKQFE
FT                   VKVMIDKEDYMYTNDVYDCYVPYRGEEINIIQYESRGGNFKLCEKDDLAAFLDYRLSKI
FT                   LTAGDPAYMQKNYQAMMAPFKDTLNCVFTADFYFEFTAQGIDKAKALDTVLTPMGIHAE
FT                   NIVAFGDGHNDITMVEYAGTGIAMQNAVVELKAAASSVTLSNNEDGIAHVLNSLIPS"
FT   gene            complement(167331..168182)
FT                   /locus_tag="LM5578_0162"
FT   CDS_pept        complement(167331..168182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0162"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66919"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466220.1"
FT                   /protein_id="ADB66919.1"
FT                   /translation="MNILIKIRELTNLTNSEKELANYILVNPKKTLQFKPKELAAAAFV
FT                   SAATIYRLINKLGLNGIGELKIEIASSLRETNAEKDINYDYPILESDTPYQIMTNLNQI
FT                   YKGTIDETLNNADPEELVKIGEKLINAKTIDVYAASANLFFAQNFKFQMQEIGVLVNVP
FT                   EEDYIQSLSAANSDENHIAIVVSYGGRSRTLQRVVKILSENNVDIILITSMQDNPLVEF
FT                   ATHKIYMASAENHYNKVSSFSTRQSLLSIFDTLYSIYFNQNYEKNIQYKTTNYQKMNTE
FT                   LE"
FT   gene            complement(168288..168662)
FT                   /locus_tag="LM5578_0163"
FT   CDS_pept        complement(168288..168662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0163"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66920"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466219.1"
FT                   /protein_id="ADB66920.1"
FT                   /translation="MTKPYGVVIISHSKDVAKGVHDIIKEIAPDVSITHAGGTEDGRIG
FT                   TSFDAVNEAIESNEADKVYTFYDLGSAKMNIETVEEISEKEIILFNAPILEGAYATAAQ
FT                   VQMDEKPEVIAANLKTIEIK"
FT   gene            complement(168666..169262)
FT                   /locus_tag="LM5578_0164"
FT   CDS_pept        complement(168666..169262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0164"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66921"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466218.1"
FT                   /protein_id="ADB66921.1"
FT                   /translation="MTYDKDWALRWLNDFGERVQENKQLLSDLDQAIGDGDHGINMARG
FT                   LSELKKVFTEKEPADLKDVFKTAGMTMVSKVGGASGPLYGTAFLNMSKAVDADTIDAVG
FT                   LTKVIEAGLEGIEKRGKSHAGEKTMIDVWEPVVHALHQEDLTDDVVDAALQKTKDLKAT
FT                   KGRASYLGERSIGHLDPGAYSSALLFHAMLQTEVS"
FT   gene            complement(169284..170273)
FT                   /locus_tag="LM5578_0165"
FT   CDS_pept        complement(169284..170273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66922"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466217.1"
FT                   /protein_id="ADB66922.1"
FT                   /translation="MKKILNGTDQVVEQMVEGLVKSHADVVHRVEGTRVIARNDKRPGK
FT                   VGLVSGGGSGHEPAHAGYVGRGMLSAAVCGDVFTSPTPDQIYEGIKAADQGAGVLLIVK
FT                   NYTGDVMNFEMAADLADADDIKVEQIVVDDDIAVEDSTFTTGRRGVAGTVLVHKIIGAA
FT                   AEAGASLDELKALGEKVIASVKTLGVALSPCTVPEVGHPGFELGDDEIELGIGIHGEPG
FT                   FTREKIMPSASLAKQLYERISNESKLLAGDKVVVLVNGMGATPLMEQYVFANDVHELLK
FT                   NAGVQVAKTLVGDYMTSLEMAGLSLTILKLEDEKWVDMLKLPVDTIAW"
FT   gene            170457..171836
FT                   /locus_tag="LM5578_0166"
FT   CDS_pept        170457..171836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0166"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66923"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466216.1"
FT                   /protein_id="ADB66923.1"
FT                   /translation="MRNQSKMPLVERLDAHAKSCPISLHVPGHKSGAIYPDAWQKLLKW
FT                   DVTEITGMDDLHHPEDVILEAEELLAECYGSKKSYFLVNGTSGGNVAVIMATLKRGEKV
FT                   LVPRDAHKSILHGIELAGGEPIFLTPATNKEVGVASGVTTELLEETLHNHPDVKLCIFT
FT                   YPSYYGTTFNLQKCIRIAHDFGAVVFVDEAHGAHFLTSSEFPKSAVELGADVVVQSAHK
FT                   TLPALTMGSYLHVVNDLPIFEKLAYYLQVFQTSSPSYLIMASLDAARKYVATYTAADVE
FT                   AFWKMRARWIKWLTKNKFEVILPDDPLKIIVRKTGYTGYELQAIFEESSYFPELADESQ
FT                   VLLILPLIKKGIDFTPISRIHSPMKKEIAKEPCEMSTPCASGLALTYEEMHARATEFVL
FT                   LDEATTRVSAETISLYPPGIPAIIRGEGITEKHIRELKNIRTRHYQGGEKLAENYIRVF
FT                   R"
FT   gene            171889..172515
FT                   /locus_tag="LM5578_0167"
FT   CDS_pept        171889..172515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0167"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66924"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466215.1"
FT                   /protein_id="ADB66924.1"
FT                   /translation="MKAIFITLEGPDGSGKTTVGTLLNQKMTEAGIDFIKTREPGGSPI
FT                   SEKVRNIVLGIGNEEMDPKTEVLLIAGARRQHVVETIRPALAAGKSVLCDRFMDSSLAY
FT                   QGAGRDMNMEQVLQVNLYAIEDTLPDRTYYLDVPAEVGLARIAANKGREVNRLDKEDIT
FT                   YHEKVQAGYEKVINMFPERFMRVDATKTPEEITETILADILRQLA"
FT   gene            172623..172952
FT                   /locus_tag="LM5578_0168"
FT   CDS_pept        172623..172952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0168"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66925"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466214.1"
FT                   /protein_id="ADB66925.1"
FT                   /translation="MKLIFAIVQDQDSNRLSDALTKGNFGATKLATTGGFLKAGNTTFI
FT                   IGTEDERVEDALAIIKENCKAREQMMTPSASLGVTVDTYVPYPIEVQVGGATVFVMPVE
FT                   SFHHF"
FT   gene            complement(173189..174961)
FT                   /locus_tag="LM5578_0169"
FT   CDS_pept        complement(173189..174961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0169"
FT                   /product="autolysin"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66926"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466213.1"
FT                   /protein_id="ADB66926.1"
FT                   /translation="MQKTRKERILEALQEEKKNKKSKKFKTGATIAGVTAIATSITVPG
FT                   IEVIVSADETAPADEASKSAEANTTKEAPATATPENTAKQTVEPQQTETKEQTKTPEEK
FT                   QAATNQVEKAPAEPATVSNPDNATSSSTPATYNLLQKSALRSGATVQSFIQTIQASSSQ
FT                   IAAENDLYASVMIAQAILESAYGTSELGSAPNYNLFGIKGAYNGQSYTKQTLEDDGKGN
FT                   YYTITAKFRKYPSYHQSLEDYAQVIRKGPSWNPNYYSKVWKSNTTSYKDATKALTGTYA
FT                   TDTAYATKLNDLISRYNLTQYDSGKTTGGNSGSTGNSSNTGNTNTSNAKIYTVVKGDSL
FT                   WRIANNHKVTVANLKAWNNLKSDFIYPGQKLKVSAGSTTSDTNTSKPSTGTSTSKPSTG
FT                   TSTNAKVYTVVKGDSLWKIANNNKVTIANLKAWNNLKSDFIYPGQKLKVSAGSTSNTNT
FT                   SKPSTNTNTSKPSTNTNTNAKVYTVAKGDSLWRIANNNKVTIANLKAWNNLKSDFIYPG
FT                   QKLKVSAGSTTNTNTAKPSTNNPSNSTVKTYTVKKGDSLWAISRQYKTTVDNIKSWNKL
FT                   TSNMIHVGQKLTIK"
FT   gene            175123..175689
FT                   /locus_tag="LM5578_0170"
FT   CDS_pept        175123..175689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66927"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466212.1"
FT                   /protein_id="ADB66927.1"
FT                   /translation="MITNESIMDATLCMMAKHGIKGSTTRQLAEAAGINEATIFKKFKS
FT                   KDNLIHMTLEVQFESMKAEINQFFDKDFESAKVFLRQASQFISDIYEKYRDFMVISVRE
FT                   MGSKDMEFIDPSIVEYLYERVNEKVKEMVPSKNSAQEADAISLILNSVILLIMVEKVRD
FT                   DIYKRPPTITTTADSLADVLLKLLK"
FT   gene            176244..178814
FT                   /locus_tag="LM5578_0171"
FT   CDS_pept        176244..178814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0171"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66928"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466211.1"
FT                   /protein_id="ADB66928.1"
FT                   /translation="MKKLHGKMQGNNLLKESQMGREKVLEKLGVMETGLTNVEVTERLA
FT                   EFGPNQTVEEKKVSNLRLFIRAFNDPFIYILAMLMVVSYLTDDMEATVIMALMILASGI
FT                   LGFIQTSRAERASYALKNMVKNRVNVIRNGSMDLVMQDAIVPGDLIEISAGDIIPADAR
FT                   VISATDLLINQSALTGESIPAEKFVEDKRADPEIFERENLLFMGTDVLSGHGRAVVLRT
FT                   GSSTFFGSLSIAATERRGDTSFDKGVKSISKLLFYFMMVMVPIVFMINGLMKGNWLEAF
FT                   LYAVAIAVGLTPEMLPMIVSTNLAKGAINMSKKKVIMKELSAIQNIGAMDILCTDKTGT
FT                   LTEDKLELIKYIDSAGETSESVLKMAYLNSYFQTGWKNVLDHAVIAKLDESTASGWKKV
FT                   GEIPFNFDRRRLSVVVENRAETRMITKGAVEEMLTVCTHKEFGGAVSTLSESEKSELQD
FT                   MCAEMNRSGIRVIAVAYKTGKVGEAFTKTDEEQMIIAGFLGFRDPVKASTKEAIAHLFK
FT                   NQINVKVLTGDNEIVTKRICQEVGIPANGFLLGADIEELSDEELTRELRKYHIFAKLTP
FT                   MQKSRIIGLLKKAGHTVGFLGDGINDAPALRKADVGISVDTAADITKDASSVILLEKSL
FT                   TVLNDAVMEGRNVFGNILKYLKMTASSNFGNVFSVLVASAFIPFLPMLSLHLLLQNLLY
FT                   DFSQLTLPWDKMDRSFLKKPHQWEQKGMLRFILCIGPVSSIFDIATFLIMWFVFSANTV
FT                   AEQALFHSGWFVVGLLTQTLVVHMIRTEKIPFIQSLAAAPVMIATLSVMALGIIIPFTG
FT                   FGHSIGFVSLPGSYFPWLILILVGYMATMQLVKTIYIRKFREWI"
FT   gene            178815..179945
FT                   /locus_tag="LM5578_0172"
FT   CDS_pept        178815..179945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0172"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66929"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466210.1"
FT                   /protein_id="ADB66929.1"
FT                   /translation="MRAGRVLFVTYLLLAIWSLLLVYSTSYGVAVMRYKVEPSYFFHRQ
FT                   LLFYGLGFLGLLVCSRINVQLFYLRRTLRLLAGSLIGLLILVLLTGSAANNAQRWLSIA
FT                   GVTFQPTEMVKLLLILVIATVFLKKGCGVRVQYWLLGFLFLTVGLVFLQPDLGTALILG
FT                   VIGVALFLTSGVGLTRLVRVAIWSFGLLLLVAMLIYFFHPDFFSSAKLGRFAFLDPFKL
FT                   DNLDASYQLRNGYYAIGSGGIFGNGLGGSIQKLGYLPEPHTDFIMTVIAEELGVFGVIW
FT                   TIFLLMALSFTALYIAISSHFIFDSMVCIGVASWVSVQMFLNLGGVSGIIPLTGVPLPF
FT                   ISYGGSSVVMLSCAVGFVLAAARRNVLAKTREVVYL"
FT   gene            179942..181051
FT                   /locus_tag="LM5578_0173"
FT   CDS_pept        179942..181051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0173"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66930"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466209.1"
FT                   /protein_id="ADB66930.1"
FT                   /translation="MKRDVLYNRIILSVFLLSLVSCVAIYFAQQTNQYNTNFLGMQLVF
FT                   LAIGTLTCFGVSRLPIEFLRHHAIWLYVIMVITLLGILIPNPLVQNINGATRWYRFAGL
FT                   SFQPSEVVKSIFIFVLAHFAVKYQAQKWKQLGILTVLTGIVLLLIMKQPDLGTTIVYGV
FT                   TALAIILLAIKSTKLMVGIITLILTAATVGMYVVVYHISLLEKIGFHAYQFSRIQTWLD
FT                   PTTDPDAVYQLNLSMKAVGSGMMTGSSGTNAYIPESHTDMIFSTIGHQFGFVGVSLLLI
FT                   LFMVLIHQLIMAALLMKNTFSSLVLAGFAVSFAFNIFENIGMTVGLMPLTGIPLPFISY
FT                   GGSAVLGNFIAVGVVLAIIRSDADLIEEK"
FT   gene            181216..181749
FT                   /locus_tag="LM5578_0174"
FT   CDS_pept        181216..181749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0174"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66931"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466208.1"
FT                   /protein_id="ADB66931.1"
FT                   /translation="MKEFLFFAVFTFIMTIGVGVINASASEIENPDNIQEAEVETFDLN
FT                   GNIAQEKEIVLEDGTEGTLGVMPIIDERPLLKGTYSLANGTSTWKIYWYSGVYNCSFNA
FT                   KINVSKGKGKITSAYNPWYQFYSPGLDVKKSKLSKTSSGSSASYVFDCKNKISNWNVTL
FT                   KASVSGKKLTTSFK"
FT   gene            complement(182204..182506)
FT                   /locus_tag="LM5578_0175"
FT   CDS_pept        complement(182204..182506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66932"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466207.1"
FT                   /protein_id="ADB66932.1"
FT                   /translation="MDLEQTIMSLIVFGGNAKSDAMLAIDSAKKGDFAQADEQIAQAEQ
FT                   ALLEAHHSQTKLIQGEARGEKTEVSLLLVHAQDHLMNAITFKDLAKEIVDLYKNK"
FT   gene            complement(182543..183850)
FT                   /locus_tag="LM5578_0176"
FT   CDS_pept        complement(182543..183850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0176"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66933"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466206.1"
FT                   /protein_id="ADB66933.1"
FT                   /translation="MNGFIAFMEKYFIPYAAKIGGQRHLVAIRDGFITTMPLMILGSFA
FT                   VLINNFPIPAYQKFMNNLFGEGTWQAFGGNVWNGTFAILALLIAFTVAYNLAKSYDKDP
FT                   LSSAVVSVATFFTIGAIAPGADGIANTGGLGSTGLFLALIIAILSTEIFTRLSGSPKLI
FT                   INMPDGVPPAVSRSFAALFPAMITVSIFGLITAFFQAAGVTNLVISFYELVQEPFMGLA
FT                   NSLPAALLLAFVSAFLWFFGLHGANIIDPFMQTINIPAIEANVKALEAGKELPYIVNKP
FT                   FFDSFVNLGGTGATIGLIIAIFIVARKHKAYMTVSKLSAAPGIFNINEPMMFGLPIVLN
FT                   PIMFIPYILAPLVLVTVAYFATAIGWVPACTIVTPWTTPPIIGGALATQSIAGGVLAAV
FT                   NLGLSILIFLPFAKIAQIQELRREKEALAAEGVTAE"
FT   gene            complement(183986..184291)
FT                   /locus_tag="LM5578_0177"
FT   CDS_pept        complement(183986..184291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0177"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66934"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466205.1"
FT                   /protein_id="ADB66934.1"
FT                   /translation="MKTIMLVCSAGMSTSLLVTKMEKAAAEKGLEAKIFAVAEAEAANH
FT                   LDEIDVLLLGPQVRFLEGNMKKKLEPKGIPLAVINSVDYGMMKGDKVLEQALDLMK"
FT   gene            184632..186317
FT                   /gene="kdpA"
FT                   /locus_tag="LM5578_0178"
FT   CDS_pept        184632..186317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpA"
FT                   /locus_tag="LM5578_0178"
FT                   /product="potassium-transporting ATPase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66935"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466204.1"
FT                   /protein_id="ADB66935.1"
FT                   /translation="MKYIVMQDVFFVVLLLVLAVPLGIYMYKVMIGEKVFLSRVLEPVE
FT                   RFGYRLMGVSEVGMSAKRYAVSVLAFSAVGFVFVMAVLMLQGFLPLNPEGMKGLSFSLA
FT                   FNTAASFVSNTNWQAYSGETALSYFSQSIGLTVQNFVSAATGIAVLFAVIRGFIWKKQK
FT                   TVGNFWQDLFRVTLYILLPLSLILALLLVSQGVVQSFADYSVVETLENGAKQLIPLGPA
FT                   ASQIAIKQLGTNGGGFFGANSAFPFENPSSFTNLIEMLAILLIPVALVVMFGRAVKDSK
FT                   QGRAIMTAMMIVFVIGVVAITISEQFAGPSYQGVATSGSMEGKEVRFGVGGSSLFAAST
FT                   TAASNGAVNAMHDSLTPLGGLVPMFFMQLGEVIFGGVGSGLYGMIGFIILTVFIAGLLV
FT                   GRTPEYLGKKIEPYDMKMVCLLILVPPLLTLFGTAVAVMMPSVQASVSASGAHGFSEVL
FT                   YAFTSMGNNNGSAFAGFAADTTFTNMVGAVMMLLARFIPLVAALYLAQNMAGKSSVAAS
FT                   SGTLSTKNGMFIGLLIGVVVLVGALSFLPALALGPIADFFTTFK"
FT   gene            186329..188374
FT                   /gene="kdpB"
FT                   /locus_tag="LM5578_0179"
FT   CDS_pept        186329..188374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpB"
FT                   /locus_tag="LM5578_0179"
FT                   /product="potassium-transporting ATPase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66936"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466203.1"
FT                   /protein_id="ADB66936.1"
FT                   /translation="MMEKGIWKDALIQSTKKLSPKLQVKNPVMLLVYVGAILATSLYFL
FT                   GFFGISDEKSGYTLAIALILWFTVLFANFAEAIAEGRGRAQADSLKMARKDVLARKLKN
FT                   VDDKTDVIEVASNDLKKGDIVYVLANEQIPMDGEVIEGAASVDESAITGESAPVIRESG
FT                   GDRSAVTGGTTLVSDWLVVRVTAVSGESFLDKMIAMVEGASRKKTPNEIALQILLVTLS
FT                   IIFLAVSATLLPFTEFASKQAGAGSAISITNVIALLVCLAPTTIGALLSSIGIAGMSRL
FT                   NQANVLAMSGRAIEAAGDVDVLLLDKTGTITLGNRKASEFLPVDGVTEQELADAAQLSS
FT                   IADETAEGRSIVVLAKERFDIRGRDFAEMHAEFVPFTATTRMSGIDYQENTIRKGAADA
FT                   VRAYVTANGGTYPKECDAIVSKVAGAGGTPLVVVRNNQVLGVIYLKDIVKNGVKERFLD
FT                   LRKMGIKTIMITGDNPMTAAAIAAEAGVDDFLAEATPEAKLELIREYQREGHLVAMTGD
FT                   GTNDAPALAQADVAVAMNTGTQAAKEAGNMVDLDSSPTKLIDIVRIGKQLLMTRGALTT
FT                   FSVANDLAKYFAIIPVLFYGIFPQLEALNLMGLTSPTSAILSAIIYNAVIIIVLIPLSL
FT                   KGVKYREMPAGKLLSRNMLIYGLGGLIAPFIAIKLIDMLLTVLGIV"
FT   gene            188389..188961
FT                   /gene="kdpC"
FT                   /locus_tag="LM5578_0180"
FT   CDS_pept        188389..188961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpC"
FT                   /locus_tag="LM5578_0180"
FT                   /product="potassium-transporting atpase c chain"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66937"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466202.1"
FT                   /protein_id="ADB66937.1"
FT                   /translation="MKRFMQIWKPAVIGFLLLTLVCGVLYPGVVTVFAGVAFHDKANGS
FT                   IIEEKLADGTTGKVGSAEIGQTFTKPEYLIGRAASDGVATNLNPTSEEQKQLVEKRIAW
FT                   WHKLDPTNNRVIPMDLVTASASGVDPDISEAAAAYQVDRISRERGISTKEVKEIIAEHT
FT                   SNRLLGFWGEPTVNVLQVNLALDRLKM"
FT   gene            188977..191667
FT                   /locus_tag="LM5578_0181"
FT   CDS_pept        188977..191667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0181"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66938"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466201.1"
FT                   /protein_id="ADB66938.1"
FT                   /translation="METNRPSPDALLVNLQEETDSSVGKLKIYFGFAAGVGKTYAMLSD
FT                   AKDQLAAGVDVVAGYIEPHARVETLRMLEGIPIISPKAINHKNIALKEFDLDEALKRKP
FT                   ELILVDELAHTNAAGVRNKKRFQDVEELLQAGIDVYTTVNVQHIESLNDIVEGITKVAV
FT                   RETIPDYVFDEADRVKLIDIEPDELLKRLEQGKIYQPERAQTAMQNFFTRENLKLLREI
FT                   AMRKAADRISHEYDQTGVYPEKRASSKWLVCIGTSPSSAKLIRWTARTAEAFRAPWTAL
FT                   YIENEENDYMTKAEKKCLRETMELAERLGAEIVTLAGHDIAETVAEYARLTGVTNIVVG
FT                   KSRRRMGLRSLFEEDFEDRLITHLDNVDMHIIPSSHPKAKKRRMKMRFKSFLTWHDMAK
FT                   MVLLLALATAICVGLSEFGIGDQNVIMVYILSVLIISRVTSGYVYGVLGSIIGVMLFNF
FT                   FFTSPLYTFNTIQAGYPVTFGIMLLVALITSALTVRIKTQASLAVERERRTEVLYEINK
FT                   QLLVTRNLKGIINLTNEYILHLFSRSVIFYSADPAKSNEGIFVQAEGKEDASALLSADE
FT                   EAVAHWVFKNKKRAGAGTDTLMGAFGYYMPVMSQGKVLGVIGVSCSPEEGPLTQDNRIF
FT                   LRMISSQVALALERQYLSEEQRQIVIESAKEKMRSNLLRAISHDLRTPLTGIIGASSAL
FT                   LEKEDELDKETERNLIRGIKDDSGWLIRMVENLLSVTRISEGLVSLERAPEAVEEIVGE
FT                   AVGRIKKRFRDRTIHVKVPRDLLMVPMDGTLIEQVLINLMENALRHGGTGAEVWVDVTK
FT                   TKQSAIFSVRDNGKGIPENRLADLFDTFAVEARERSDMSRGLGLGLSICMSIIRAHDGT
FT                   LEAKNNKHGGATFWFTLPLDGGDGK"
FT   gene            191664..192359
FT                   /locus_tag="LM5578_0182"
FT   CDS_pept        191664..192359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0182"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66939"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466200.1"
FT                   /protein_id="ADB66939.1"
FT                   /translation="MNSKRLVLIVEDEDGISNFISAVLTASDYSVIKAVNGKEALEQTA
FT                   SHSPDVVLLDLGLPDMEGLDVLRDIRVWSKVPIIVVSARDHEREKVTALDLGADDYITK
FT                   PFGTSELLARIRTALRHIQPSSKESPNDHIIRIQDLYIDDDRRLVKMDDTEIHFTPIEY
FT                   KILLLLARHAGKVLTHDFIIREIWGPYPSENQALRVNMSNIRRKIEKNPAEPAYILTEV
FT                   GVGYRMAEE"
FT   gene            192400..193212
FT                   /locus_tag="LM5578_0183"
FT   CDS_pept        192400..193212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0183"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66940"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466199.1"
FT                   /protein_id="ADB66940.1"
FT                   /translation="MHKTIRSVDVYYEKYGEGIPIIMIHGFAPDSQLMIGCMEPVFDKE
FT                   SSFSRIYLDLPGMGKTENYDSIQNADHVLTLLLEFIEAVIPGEQFVLAGESYGGYLTRG
FT                   IAAKMPDRVLGVLLICPVIYPEKERRTLPEQKVMYQDDTFVQSLSKEDRAYFSKSGVIL
FT                   TARNWNRFLAEVMAGMINADGEFLDRLSANYELSFDPDEKVQFDVPALFLFGRQDDHVG
FT                   YADGLTLLEKYPHASIAILDFAGHNLQIEQPKIFTTMVQDFLFRVKPE"
FT   gene            complement(193214..194470)
FT                   /locus_tag="LM5578_0184"
FT   CDS_pept        complement(193214..194470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0184"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66941"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466198.1"
FT                   /protein_id="ADB66941.1"
FT                   /translation="MRHVVIFCASILNRFFASVECVKRRLNPLEAYLVVMSNAERAGGL
FT                   VLAATPKMKQEHHIKTGSRMYELPTWDKRIIIAPPRMKLYLKVNAMIQAIFRRYVPAEF
FT                   IHVYSIDECFLDVTGSHLLFGSTEEIVRKIQRDILEELRLYVTVGIGDNPLLAKLALDN
FT                   VAKNRDDGIAEWRYEHVPETIWKIRHLDDVCGIGRRTAVRLQKMGIFNMYQLSQTPPQV
FT                   LKNVMGVVGEQLYYHAHGIDYSLLNEKYVPVSKSYGKSQILEKDYHVPAEVEIVIREMV
FT                   EEVAMRLRQNHVDTAVIHLSVGYSKYSIKKGFSHQAKIPPTSSSHALIPYFLQLFRRYD
FT                   EREPVRSIAISCGKITLKTGLQLNLFEDFTQTLNHEQLEITVDKIRSRYGFKSLMHASS
FT                   LLNGATGLKRSEMVGGHKG"
FT   gene            complement(194483..194824)
FT                   /locus_tag="LM5578_0185"
FT   CDS_pept        complement(194483..194824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0185"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66942"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466197.1"
FT                   /protein_id="ADB66942.1"
FT                   /translation="MSYQDRGMKKWGGFLLSEHTEAMQNAEPTLVWKEAMTTEFIESVL
FT                   ASAMTHQSMLVIQKKPLGPEASPENDIIGRISGVENNTIYIKNSEGIIPLSFSAIRNVE
FT                   ERSVEKWYK"
FT   gene            complement(195019..195516)
FT                   /locus_tag="LM5578_0186"
FT   CDS_pept        complement(195019..195516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0186"
FT                   /product="ribose-5-phosphate isomerase B"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66943"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466196.1"
FT                   /protein_id="ADB66943.1"
FT                   /translation="MYNEGIDYTAGGEKMTVSKVAIASDHGGIELRKSIISYLESVGIS
FT                   YEEFGPETPESVDYPGLAITVSEKVVNQEVDRGILVCGTGIGMSIAANKVKGIRCALVG
FT                   DTFSAHATREHNDTNVLALGARVIGPGLAEDIVKIWLETEYEGGRHANRVGQITAYEDS
FT                   HA"
FT   gene            complement(195520..195990)
FT                   /locus_tag="LM5578_0187"
FT   CDS_pept        complement(195520..195990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0187"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66944"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466195.1"
FT                   /protein_id="ADB66944.1"
FT                   /translation="MSAYKRILVGVDGSNEAEAALRRAVQFAKMDGATLGIGFVADVRR
FT                   IAPLIDYEQTYAKKAKAYGEELVEMYKKEAEKAGVAHVETFVHFGTPKTTFNKKITRNF
FT                   EPDLILVGATGLSATEQFILGSVSEYTAAHAPCDVIIVHAKPWRNRKTVEKL"
FT   gene            196106..196912
FT                   /locus_tag="LM5578_0188"
FT   CDS_pept        196106..196912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0188"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66945"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466194.1"
FT                   /protein_id="ADB66945.1"
FT                   /translation="MAKLETFYPIVATPKRAGYKEYLPSAALTGYIRCFWEADDKNFPG
FT                   NNLVVPDLCADIIFTIDSKTGLVTDAIFVGVSDASFESDDESNTELFAVRFYAWSLFLF
FT                   VEQDLTGSMNRVKEPEEMFAGFVSFFQERFAEMTTNSERIALLEEFLLRKLMMLGKQVH
FT                   PDFLNSIDKLLQNPNQFALGAVSVRQLERLFQKHMGLAPKQTAKLIRFQKVLQALYENP
FT                   SVPGAELAYLHGFTDQAHLIKQFKRYSNHTPEEMKQIFLQNVANIQ"
FT   gene            196958..197326
FT                   /locus_tag="LM5578_0189"
FT   CDS_pept        196958..197326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0189"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66946"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466193.1"
FT                   /protein_id="ADB66946.1"
FT                   /translation="MINEFVCTNISTQDPAALVAFYHEKLGIPIVFEGYDNYDGAKLGF
FT                   SEKAPGIIVWNNSKWGEASESKVEFVFSCDTNLDEMYRELQTAGVETPEPRVAEWGGRE
FT                   LNLLDPDGNKIMILEPAQ"
FT   gene            197323..197685
FT                   /locus_tag="LM5578_0190"
FT   CDS_pept        197323..197685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66947"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466192.1"
FT                   /protein_id="ADB66947.1"
FT                   /translation="MSDEFAWIREEISGLKGVQYSFKEEWGAERYHVLDQLMAMRGTNK
FT                   DGHPILTLKCDAEKSEQLRAENPAIVPGYYMNKRVWISVLLEEERDKDLIRALIQHAYS
FT                   EAKNKLPKYKQAELFD"
FT   gene            197759..198571
FT                   /locus_tag="LM5578_0191"
FT   CDS_pept        197759..198571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0191"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66948"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466191.1"
FT                   /protein_id="ADB66948.1"
FT                   /translation="MDINMFILYFFIYSVLGWAWEEVFCSISEKKIVYRGFLYGPYCPI
FT                   YGFGVTAVLMMILPFQNNLWALFIFSMIICTVIEYVTATILEALFHTTWWDYHNWPLNV
FT                   KGRICLPISIFWGFACIIVVRFLHPLVTEFADWILSWGGWIIPALIVILMLIDTIKSVT
FT                   SMLSFQRALAEFNEKLNAQANELKASVKERAKEFEEGLLKKQENVDMKIAEIEAKRKQD
FT                   KELAASMRKLKFNERRMLKSFPKMKVKRAAPFKNLNKSLLRVDKLKRK"
FT   gene            198940..201009
FT                   /locus_tag="LM5578_0192"
FT   CDS_pept        198940..201009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0192"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66949"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466190.1"
FT                   /protein_id="ADB66949.1"
FT                   /translation="MYLDERSNSLLKELLRHPDTSSTNLQAKFGLTRRQVDYSFQKINN
FT                   WLEEQTYPKIHRAANGRFIVEPDLFQIIGEEDGEKTDWYIPSEKERASLIILMLTTGSE
FT                   ELSLNHFISELEVSKNTVLRDLKLVQKTLDKFNLEVKYSRMRGYLIDGDEWNQRTALIY
FT                   AAEHIIESFGGEEYLQDFMQVDEARIKELREKLEQVEHHLNLHFIDNKMQILPYILEAV
FT                   FRRMKKGQTITTSFLIDYNELSDTREYGAAEIFIEEEPNMPEAERMYITLQLLTSNVLP
FT                   KQYLKSEETHKLRLALEQVLSEFEKKACIQLVDKESLLEKLFAHIKPAYYRIKYHLTTD
FT                   YSILDKIDQEFQAVHYIVKESLAPLERFIGSKVPENESIFITLFIGGHLIESTEKLQTR
FT                   LKAVVVCPNGLSISRLMEKTLRSLFPEIFFYQAMSIREFEQTKLGYDIVFSAVPLSTDK
FT                   KFFLINQLMDGKERLELRRRVMRSVYLVDEVNISVDQLMKTISKFADIKDAARLEKVLA
FT                   DYLMPVPEENTSKHEGKSSLADLLEVTRITRKKSVKDWHEAIYHAALPLLSAGVVEPAY
FT                   VEEMKRQYPAPIMNIILRNTIAIPHAETEKGVNSLGMSLLYLEEGLPLEGGKELHFIVV
FT                   IAAIDKNAHFTALLQLMELSENKKELKKLADAANTEEMHQIIKNFTDLETKKTM"
FT   gene            201043..201507
FT                   /locus_tag="LM5578_0193"
FT   CDS_pept        201043..201507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0193"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66950"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466189.1"
FT                   /protein_id="ADB66950.1"
FT                   /translation="MDLVQFLKKGMVWVQSDIEKQEDLFQMVAESGKSEGYVTDDFLTR
FT                   LTDREQTFPTGLKLDGYGVALPHTDPECVTEQFIAVITVKDGIPFKLMEDAGQTVEANL
FT                   IFVLGLNEPHSQLAVLQQLMGTIQDKDNVAALLRAKDEDEVKQILETIAV"
FT   gene            201565..201846
FT                   /locus_tag="LM5578_0194"
FT   CDS_pept        201565..201846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0194"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66951"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466188.1"
FT                   /protein_id="ADB66951.1"
FT                   /translation="MGQFKILVACGAGIATSTVVTDRVERLVKENNVDAEVKQIKISEA
FT                   ASMQDGADLIVSTTILPTTYKIPAIIATSYITGMGMEELDEEILAHLK"
FT   gene            201908..203179
FT                   /locus_tag="LM5578_0195"
FT   CDS_pept        201908..203179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66952"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466187.1"
FT                   /protein_id="ADB66952.1"
FT                   /translation="MDTLLSGVQYVLNLGPTVILPIMIFFIALIFRVPAKKALRSAITI
FT                   GIGFVGINLVISLLSSNLGPAAQQMVERFGLNLTIIDAGWPAAAAASWASPVAAILIPI
FT                   CLVVNLALIFFKVTKTLDIDIWNYWHFIAAGATGYIVTGGNWWFAILCAIIYEIAVLWM
FT                   ADRTQPMVEEFYGLKGISLPTGSTAAFGFIGIPVGWLIAKIPGIKNIHVDPETIQKRFG
FT                   IFGEPMMMGLILGIAIGILAGYDVGAVAQLGMSMGAVMFLMPRMVKILMEGLIPISESA
FT                   REFMKSRFKGRELYIGLDAALSIGHPANISTGLILVPITLFLAVIIPGNKVLPFGDLAT
FT                   IPFYVSFVVASRKGNILHSVLAGTVVIALALLMATDFGLVHTEMMKGVYEFPKGATQVS
FT                   TLDMGGNFFNWVILKFSQAWAAIF"
FT   gene            203216..204268
FT                   /locus_tag="LM5578_0196"
FT   CDS_pept        203216..204268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0196"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66953"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466186.1"
FT                   /protein_id="ADB66953.1"
FT                   /translation="MRAAVLYENNVIKAEQIDEATCGKDQVRVEVKAVGICGSDIHKMQ
FT                   TRWKYPLPAVMGHEFAGVITEIGSEVTNVAIGDRVAGIPLEPCMECNYCKAGDFALCDN
FT                   YRMVGSHFHGGFAENVVMKANNVISIGDLDFEEGAMIEPLAVSMHGVLGIQPRLGDTVI
FT                   VFGIGTIGILVVQCLLLAGVKDIIAVDISDKKLADAREFGCKYTINPKNEDLKERVFAY
FT                   TNGLGADIALECAGSKITQEQCLLVTKKKGKVGFLGIAYADVLLHEEAFENIFRRELTL
FT                   KGFWNSYSAPFPGEEWRTSIEFVKQGRIKLKPLISHRYKLEETKEAFDMILSREHDYNK
FT                   VMILPQKGDD"
FT   gene            204270..205301
FT                   /locus_tag="LM5578_0197"
FT   CDS_pept        204270..205301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0197"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66954"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466185.1"
FT                   /protein_id="ADB66954.1"
FT                   /translation="MKAVVKTNPGYDQMELKDVEEPQVYGDKVKIKVAFTGICGSDIHT
FT                   FKGEYKNPTTPVTLGHEFSGVVVEVGPDVTSIKVGDRVTSETTFETCGECIYCKEHDYN
FT                   LCSNRRGIGTQANGSFAEFVLSREESCHVLDERISLEAAALTEPLACCVHSALEKTTIR
FT                   PDDTVLVFGPGPIGLLLAQVVKAQGATVIMAGITKDSDRLRLAKELGMDRIVDTLKEDL
FT                   AEVVLGMTGGYGAERVFDCSGAVPAVNQGLPLTKKKGDFVQVGLFAEKKNAIDEESIIQ
FT                   REIAYIGSRSQKPSSWILALDLLANGKIDTDKMITKVYGLDDWREAFEAVMAGNEIKVL
FT                   VKS"
FT   gene            205496..205936
FT                   /locus_tag="LM5578_0198"
FT   CDS_pept        205496..205936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0198"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66955"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466184.1"
FT                   /protein_id="ADB66955.1"
FT                   /translation="MKLTIGCDHGGRRLKDAIVKHLREKDIEVVDIGTYTDESVDFPSY
FT                   AEEVANQVVSGQSELGILCCGTGIGMSIAANKVDGIRAAVVSDTFSARATREHNNSNIL
FT                   CLGERVIGEGLALLLVDTWLEASFAGDRHKRRLDKITELERK"
FT   gene            205945..206619
FT                   /locus_tag="LM5578_0199"
FT   CDS_pept        205945..206619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0199"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66956"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466183.1"
FT                   /protein_id="ADB66956.1"
FT                   /translation="MRKIAASIMCADQLHLGDELQRLESAGVELLHCDVMDGVYVNNLA
FT                   LGPEYLEIVRNNTEIPLDIHLATITPLKYIDMFGPVKPEYISFHVEVAEDVSEIIRKIR
FT                   SYNVKPSIAINPETPIEAIYPYLDDVEMVLMMTVNPGFAGQKFQTDVLQKLHDLKAKLA
FT                   GKIHAPLIEVDGNINKETVGLMRDCLPDIYVLGTSALFHDRDKTSYAERLVHIWSNVEK
FT                   HV"
FT   gene            206653..208668
FT                   /locus_tag="LM5578_0200"
FT   CDS_pept        206653..208668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66957"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466182.1"
FT                   /protein_id="ADB66957.1"
FT                   /translation="MKKTLDRQAVDTIRSLSIDMIEKANSGHPGMPMGAAPMAYMLFAK
FT                   HLVFNPANPEWFNRDRFVLSAGHGSALLYSMLHLFGYDVKMEDLKQFRQLDSLTPGHPE
FT                   FGWTAGVDATSGPLGQGIGMAAGMALAESHLAAEYNQPNYPIVDHYTYAICGDGDLMEG
FT                   VASETASLAGHLGLGKLIVLYDSNDICLDGDLSATFSENAADRFRAYGWQVLRVEDGNN
FT                   LAAIQEKIVQAKLETSKPTLIEVKTVIGYGAPTKAGSSASHGAPLGEKEANGAKEHYEW
FT                   AEEPFTVPAEVRDYLRNYKARGEKLEGAWNTMLANYKKEFPELARQLDRVLAGEVAADW
FT                   NANLPTFEAGTNVATRSASGKMINAIAAELPELFGGSADLGCSNKTFIDASPAYSIQDP
FT                   AGKNIWFGVREFAMGAMLNGMALHSGLRVFGSTFFVFSDYVRPAMRMAALMQLPVTYVF
FT                   THDSIAVGEDGPTHEPIEQLASLRAMPGLTVIRPADAKETRAAWEIAATNTNGPIALVL
FT                   SRQDLPVLENDQEEVDAGIEKGAYIVAPANSSKPDAIIIATGSEVSLAIEAKAELAKKD
FT                   IDVSVVSLSSWERFEKTTDAYKESILPKEVTARFAIEAGATFGWKEFIGSEGDMLGIDH
FT                   FGASAPAKDLFNAYGFTPENVADRVEAVIAKAGVRV"
FT   gene            208665..209309
FT                   /locus_tag="LM5578_0201"
FT   CDS_pept        208665..209309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0201"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66958"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466181.1"
FT                   /protein_id="ADB66958.1"
FT                   /translation="MTFVAPSLLAADYMNMANSIKEAEDAGADYLHIDVMDGHFVPNLT
FT                   FGIDMVEQIGKTATIPLDVHLMLSNPENYIEKFAAAGAHIISVHIEAAPHIHRVIQQIK
FT                   AAGCKAGVVLNPGTPASVLDAVLADVDLVLQMTVNPGFGGQAFIDSTIKNMRYLDNWRR
FT                   ENHGSYVIEVDGGVNAETAEKCKQAGVDILVAGSYFFGATDKAACIQGLKK"
FT   gene            209443..209922
FT                   /locus_tag="LM5578_0202"
FT   CDS_pept        209443..209922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0202"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66959"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466180.1"
FT                   /protein_id="ADB66959.1"
FT                   /translation="MTQLTFRNGTEQDTKLILRFITELATHEGIEKDVVATESGLHKAL
FT                   FQEKSAEVIIAEYEDAPVGFALFFHNFSTLLGKKGLYLEDLYIIPEMRGKGFGTQFFSY
FT                   LSKLALARDCGRFEWWCLNENKSGMDFYEKIGAEKMSEWTVHRLTKAEMEKLSNL"
FT   gene            209937..211334
FT                   /locus_tag="LM5578_0203"
FT   CDS_pept        209937..211334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0203"
FT                   /product="deoxyguanosinetriphosphate
FT                   triphosphohydrolase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66960"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466179.1"
FT                   /protein_id="ADB66960.1"
FT                   /translation="MKWDKLLNDKRRRESGVTRSKNTDVRSAFENDFQRIVMSASFRRL
FT                   QDKTQVFPLEKSDFVRTRLTHSMEVSTIAKSMGNMVTHTIQEENLDQDFTKDHAEKIPE
FT                   ILACAGLLHDMGNPPFGHFGEESIREWFRDNLATITYKNKSLAEILTPQMKEDFYYFEG
FT                   NAQVLRVVSKLHYLFDQYGLNLTFATLNAVIKYPVSSLKVNKKQIKSKKLGYFYADESL
FT                   FNEITTATEALDNRHPLTYLLEVADDIAYLNADLEDGVKKGIVNITQILKGFEEVEEHN
FT                   KVTAACYNELKKKSERYEGQEESFIVQQWLASNVRGQLINRSLEVFYENYDAIMAGTFN
FT                   DSLIDASSAEQLVQILQSLSFTYIYQDKGIVESEIAGNEIISKLLETFIPAVIYYDSET
FT                   PERQTAKDKRLLTLISDNYLGCYRKNAEGESETMKLYLRLLLVTDFICGMTDSYAKDLY
FT                   QRLNGLS"
FT   gene            211527..211940
FT                   /gene="rpsL"
FT                   /locus_tag="LM5578_0204"
FT   CDS_pept        211527..211940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="LM5578_0204"
FT                   /product="30S ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66961"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466178.1"
FT                   /protein_id="ADB66961.1"
FT                   /translation="MPTINQLVRKPRQSKIKKSTSPALNKGLNSFKRELTDVNSPQKRG
FT                   VCTRVGTMTPKKPNSALRKYARVRLSNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLP
FT                   GVRYHIVRGALDTAGVENRGQSRSKYGTKKPKK"
FT   gene            211971..212441
FT                   /gene="rpsG"
FT                   /locus_tag="LM5578_0205"
FT   CDS_pept        211971..212441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="LM5578_0205"
FT                   /product="30S ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66962"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466177.1"
FT                   /protein_id="ADB66962.1"
FT                   /translation="MPRKGPVAKRDVLPDPIYNSKLVTRLINKMMVDGKRGKSQAILYS
FT                   AFDIIAQETGKDPMEVFEQAMKNIMPLLEVKARRVGGANYQVPIEVRADRRSTLGLRWL
FT                   VNYARLRGEKTMEVRVAREIMDAANNTGASVKKREDTHKMADANRAFAHYRW"
FT   gene            212507..214594
FT                   /gene="fus"
FT                   /locus_tag="LM5578_0206"
FT   CDS_pept        212507..214594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fus"
FT                   /locus_tag="LM5578_0206"
FT                   /product="elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66963"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466176.1"
FT                   /protein_id="ADB66963.1"
FT                   /translation="MAREFSLEKTRNIGIMAHIDAGKTTTTERILFYTGRIHKIGETHE
FT                   GASQMDWMEQEQERGITITSAATTAQWKGYRVNIIDTPGHVDFTVEVERSLRVLDGAVA
FT                   VLDAQSGVEPQTETVWRQATTYGVPRVVFVNKMDKIGADFLYSVGTLHERLAANAHPIQ
FT                   LPIGAEDTFEGIIDLIEMNALYYEDDLGNDPHIKEIPADLKDLADEYRGKLVEAVAELD
FT                   EELMMKYLEGEEITKEELKAGIRKGTLNVEFYPVVCGTAFKNKGVQPMLDAVLDYLPAP
FT                   TDVPAINGVLPDGEEAARHADDSEPFSSLAFKVMTDPYVGRLTFFRVYSGTLNSGSYVQ
FT                   NSTKGKRERVGRILQMHANHREEISIVYAGDIAAAVGLKDTTTGDTLCDEKEQIILESM
FT                   EFPEPVIQVAIEPKSKADQDKMGQALAKLAEEDPTFRAETDQETGQTLISGMGELHLDI
FT                   LVDRMRREFRVEANVGDPQVSYRETFRKSAQVEGKFVRQSGGRGQYGHVWIEFGPNEEG
FT                   KGFEFENAIVGGVVPREYIPAVQAGLEGALDNGVLAGYPLIDIKAKLYDGSYHDVDSNE
FT                   MAFKVAASMALRNAAKKCDPVILEPMMAVEVVIPEEYLGDIMGNITSRRGRVDGMEARG
FT                   NAQVVRAFVPLANMFGYATHLRSGTQGRGVYTMQFDHYEEVPKSIAEEIIKANGGNNKE
FT                   D"
FT   gene            214703..215890
FT                   /gene="tuf"
FT                   /locus_tag="LM5578_0207"
FT   CDS_pept        214703..215890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tuf"
FT                   /locus_tag="LM5578_0207"
FT                   /product="elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66964"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466175.1"
FT                   /protein_id="ADB66964.1"
FT                   /translation="MAKEKFDRSKPHVNIGTIGHVDHGKTTLTAAITTVLAKKGYADAQ
FT                   AYDQIDGAPEERERGITISTAHVEYQTDSRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVSAADGPMPQTREHILLSRQVGVPYIVVFMNKCDMVDDEELLELVEMEIRDLLTEYEF
FT                   PGDDIPVIKGSALKALQGEADWEAKIDELMEAVDSYIPTPERDTDKPFMMPVEDVFSIT
FT                   GRGTVATGRVERGQVKVGDEVEVIGIEEESKKVVVTGVEMFRKLLDYAEAGDNIGALLR
FT                   GVAREDIQRGQVLAKPGSITPHTNFKAETYVLTKEEGGRHTPFFNNYRPQFYFRTTDVT
FT                   GIVTLPEGTEMVMPGDNIELAVELIAPIAIEDGTKFSIREGGRTVGAGVVSNISK"
FT   gene            216045..218111
FT                   /locus_tag="LM5578_0208"
FT   CDS_pept        216045..218111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0208"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66965"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466174.1"
FT                   /protein_id="ADB66965.1"
FT                   /translation="MVQFDARNMALLESLVVANVYLAPENLQEELGISKRTLQYDVEKI
FT                   NKELDNIGLDGIQSVRGQGYYLLEEEKTTIKEILENREASHKVFSASERRIRILFFLLV
FT                   TDARVIIDTINECNEVSRNTSLQDIKQLKLALKQFNLELAYDRKNGNMVLGDERSIRQF
FT                   FIHYCMNNEEIATADQLLDLMKINPMIKNQELFPKLDMIFEILAVTEKKIGIRYTDEVI
FT                   ERIGIMIFFFKERMKRNCYLNEKEEHEVESFGIAQEIYQQLQQSENFKINHAEITYLGK
FT                   LLLGASRLNDDAAAEGKLDLIVEKIIAEFERLACVNFEDHRNLKKDLLLHLQPAYYRLK
FT                   FQIEWINPLRTDIKQSYSDVYEITKKSLEPLEDLLGEAIPEDEIAYVTILFGGYLSRKN
FT                   NTLVERKKLLIVCSKGVGTSRMIERQLSQLLGERVEILEPISIREFEKGLYAPDFIVST
FT                   LPIMEQKAPVFIVSPILTEAQKQQLMKVIAPHILQKDSDARMLSSVLDVVDQYAKVEDR
FT                   EKLAAKLKSVLFQVQSDSQLEKSPSLDELLPQERIIFRESVTDWQEAIRVASKPLQQEG
FT                   YISKNYQHAMIENIEKLGPYIVIAPGIALPHASVDDGAYRVGMSLLRLDKTVSFSSKAK
FT                   DQVKLIIVLASIDSYTHINALSQLTNLIMKHHLLEQIEQAESAAEIAAMLTIK"
FT   gene            218305..218739
FT                   /locus_tag="LM5578_0209"
FT   CDS_pept        218305..218739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0209"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66966"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466173.1"
FT                   /protein_id="ADB66966.1"
FT                   /translation="MSFLNKELVNLHGTAKNADEAIVQAGELLVNAGYVSEQYVEKMVE
FT                   SYHENGAYFVIAPQIAIPHARPTDGVENSAVSLVVLKDGVNFGHAANDPVRLVFGLAAT
FT                   SSEAHLKVIQKIVSLLSNNDNIEKMIHSEDYQAIGELVEG"
FT   gene            218742..219014
FT                   /locus_tag="LM5578_0210"
FT   CDS_pept        218742..219014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66967"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466172.1"
FT                   /protein_id="ADB66967.1"
FT                   /translation="MKILAVCGLGQGTSLILRMNVETVLRDMGVDADVEHIDVSAARSM
FT                   NVDIIVTSQELAETLGTDTSAKVVIVNNYFDNAEIKNALSAAINS"
FT   gene            219041..220339
FT                   /gene="ulaA"
FT                   /locus_tag="LM5578_0211"
FT   CDS_pept        219041..220339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ulaA"
FT                   /locus_tag="LM5578_0211"
FT                   /product="ascorbate-specific PTS system enzyme IIC"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66968"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466171.1"
FT                   /protein_id="ADB66968.1"
FT                   /translation="MEIITWIANNFFGTPAILLGFIVLLGLLLQKKNLSQVISGTFKAI
FT                   IGFLIINAGAAVITGSLGIFEPMWKEVFGLETPPLAGFLGQEAFNAKFGSAVTLAMTLG
FT                   FLVNVLLARFTPFKYIYLTGHMMFWTTTIFAGITVQAVGGDIPFWGLVLFLAVIMGLYW
FT                   TLQPAITQPFLRKITGNDNVALGHTSSSVAILSALLGKVFGNKKNDAEHINLPKKLEFL
FT                   RDSNVITALTMGILFVVGAVILMVKKTPGAEKLIAEAGNQSFIVYSIVQSFTFAAGIAI
FT                   VLVGVRMFIGEIVPAFNGIATKLVLGAKPALDAPIVYPYAPNSVIIGFVGAFIGAIIWL
FT                   VVLGNTVGYVFVPTMIVLFFHGAVAGVFGNSTGGVRGALIGGFLTATVVAWGQYIMVTF
FT                   FINTTVPDTAMWAADSDMFILGPIVSMLAKLFF"
FT   gene            220409..221401
FT                   /locus_tag="LM5578_0212"
FT   CDS_pept        220409..221401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0212"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66969"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466170.1"
FT                   /protein_id="ADB66969.1"
FT                   /translation="MSFIRTFYGDIAPEQLGFTYSHEHIVCVPAYWQERNADDLLLDDK
FT                   EKSQLDVQDFADLGGKTIVDATAVDYGRRVLDVAQISKETGIQIVGTAGFNKSFLWDGK
FT                   IKPELKPIIGDFETYYEWIENTSTEKLTEFVVNEVENGLEGTPYKAGQVKFGTGYNMIT
FT                   PLEEKTIRAVARAHHETKAPIHSHTEAGTMALEQIEILKQENIPLEYLSIGHMDRNLDP
FT                   YYHKQVAKTGAFMSFDGIAKIKYAPESARIAAILYLVSEGFEDQILVSGDTARKTYYKH
FT                   YGHGPGLEYIAKKWVPRFIDEANEKGFEGEKLVKKFFVDNPARCFTFKK"
FT   gene            221414..222163
FT                   /locus_tag="LM5578_0213"
FT   CDS_pept        221414..222163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0213"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66970"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466169.1"
FT                   /protein_id="ADB66970.1"
FT                   /translation="MLYADENSFDIGAKITKTKPVILPIGAVEAHGPHLPLGTDNILAS
FT                   EYSAKIAAETDGFVLPVLPYGQVWSLQDFPGSLTLSNETVTKVVVEIGESLYKQGFRLF
FT                   VPVSGHLGNMAALKDAARELYAKFPDMVILHIFYPNIQKLAMDVREGKANHHTYIHACE
FT                   IETSLMLYLSPENTDMSRAIDDPPILPIDADFTPTPWQTFTKTAVLGEATLATAEKGEY
FT                   LIEKTLKTCVELIKLEQEKIRKSTEME"
FT   gene            222123..222842
FT                   /locus_tag="LM5578_0214"
FT   CDS_pept        222123..222842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0214"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66971"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466168.1"
FT                   /protein_id="ADB66971.1"
FT                   /translation="MNKKKFENLPKWNNFALFNFLAKDKENSLEVMVAARGFAVPGIVA
FT                   TNYETAEEAANVVKELQTTAEVISVGLGGGGDWQNWRDVLHIARLAPNSHINQPIETAG
FT                   LTNGLLPETYTNALVRPTGKVGIVKLSSGDEITAEEAVDYCLSANIPSIKFMSIEGTKY
FT                   LDELVYLTKIAADKGIYGIEPAGGIGADNILEITTAIKSTGIPFYMPHIFGKTIDKATG
FT                   RTKPEEIEKIFAALEGN"
FT   gene            222843..223586
FT                   /locus_tag="LM5578_0215"
FT   CDS_pept        222843..223586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0215"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66972"
FT                   /protein_id="ADB66972.1"
FT                   /translation="MINNYVDITVRLLENILDNEADYVKEAGAKVAKSIENDGVIHLFG
FT                   CGHSHILTEEVFYRAGGLAAIHPILHEPLMLHEGAAASSVLERKNDYAKTFMVEEDIRP
FT                   GDIMIVLSTSGRNPVPIDVAEIAREKGAFVIVITSLQYSASQKSRHTSGKRLSDAGDIV
FT                   IDNGAVKGDAVLKSANFDIAFAPTSTVTGAVILQSIFAEAIEKMVNDNFTPPVFISGNV
FT                   ENADAHNQALVDKYKERIPLLGMNL"
FT   gene            223665..224477
FT                   /locus_tag="LM5578_0216"
FT   CDS_pept        223665..224477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0216"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66973"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466167.1"
FT                   /protein_id="ADB66973.1"
FT                   /translation="MLTTRKALYYLDKGKTKEAIRLLETCWKQEVTTENKRDIFTATVL
FT                   LSDVLYQSGEHFPEIYQQLMSILEEMQDLEAVEFEREKAKQIFAELDEYFSEVGTFFQG
FT                   DSLAELWLEFDYENDYKDVYPTPQRVAAIEAELGYKLPKSYIYLMRHTQNGGIVSTGSV
FT                   PTTEPSSWSENCVAITGIMGIGNQGISALNGMHNTNFWIEEWGYPDVGLAIADCPSAGH
FT                   DMVFLDYRNCGKTGEPAVVHIDQEADYKIMKLADNFEAFILSLYREEY"
FT   gene            224505..225491
FT                   /locus_tag="LM5578_0217"
FT   CDS_pept        224505..225491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0217"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66974"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466166.1"
FT                   /protein_id="ADB66974.1"
FT                   /translation="MDSAYVFDSEQATKLLMKNYELVKTSGVSFIDKRIRFLIARLFAG
FT                   NNEVVNPERFNEINKEIKRQLGMFTALNGNVRASLVGLLMANNNASRESVQQVIANYNT
FT                   LIQAGFQRTEYTYFAAYLLLESENPTKTAQKAKTIHQLFKKDHPFLTKSEDVTTAVFLA
FT                   NLPEENTTKLAEVTEYYFQEFAAKGFRKNDSLQFLATTGTLLYGEKDSKFIRRVDNIVE
FT                   ELRQKGIKVKPIHYSSIGILAFVMDGRKIDSGLVNLIDELQQQPGLRFGREFVTALAIS
FT                   LYTEKQSGQMSKEQLEGLMVNVHILIAMEQAAAVSAAAAASAAAASS"
FT   gene            complement(225536..226867)
FT                   /locus_tag="LM5578_0218"
FT   CDS_pept        complement(225536..226867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0218"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66975"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466165.1"
FT                   /protein_id="ADB66975.1"
FT                   /translation="MIRFFKIVTPILLSISLVACSSASGKTEKITAPIEKDRNLSMVVT
FT                   TDVHYFAPSLTDNGKAFEKYVAAGDGKQLAYSDEITDAFLADVESKKTDVLIISGDLTN
FT                   NGEKTSHEELAKKLTQVEKTGTQVFVVPGNHDINNPWARKFEKDKQLPTDTISPTDFSK
FT                   IYSDFGYEDAISTDEFSLSYLAAPSSKVWLLMLDTAIYKTNMQQGNPTTEGGLTAGTLD
FT                   WIKESSALAKKNGAKLIPVLHHNLTDHNDVIQKGYTINYNQQVIDALTEGAMDFSLSGH
FT                   IHTQNIRSAKSTDGKEITDIVTNALSVFPHKYGNITYSAKNKNFTYQSQKLDMEAWAKA
FT                   QGSTDENLLNFDQFDYETFYNSGYDKAMMDLMTDESYDKYNQADKEKMADTMGLNNMYF
FT                   FAGTAPPKSDGMALWDSAPNSFLKDYVLSSSNPPKKSNDYYVSP"
FT   gene            complement(226957..227937)
FT                   /locus_tag="LM5578_0219"
FT   CDS_pept        complement(226957..227937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0219"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66976"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466164.1"
FT                   /protein_id="ADB66976.1"
FT                   /translation="MQLHAMWDEYPALSKDLQEVLQTIEKNIQIRDKHVEQNVKDLIHA
FT                   GGKLLRPAFALLSAQAGPDYDKDRAVSIAAALEVLHMATLIHDDVVDDSPLRRGIPTIH
FT                   SKYGRNYAVYTGDYLFCICFKILSAHASSVENIEFNSKNIEKILMGELDQMRTSYKMNV
FT                   TVREYLTRISGKTAQLFALSCYSGATGSKATRMTVAKCYNIGHYLGMAFQIIDDVLDYT
FT                   STDEGLGKPVLNDMKQGIYSLPLIYAMKGHLAEFEPLLSQKLDMTDEASEQVLALISKY
FT                   KGVEQAFKLAKKYTNKALREIKKLPAGAYREDMYRLTKNILDRDI"
FT   gene            complement(227959..228501)
FT                   /locus_tag="LM5578_0220"
FT   CDS_pept        complement(227959..228501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66977"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466163.1"
FT                   /protein_id="ADB66977.1"
FT                   /translation="MTKNRRLVYIALLAAQAVVISLLERAIPFPFAFAPGAKLGLANII
FT                   TCISLYTLSAKDTFMIICIRLVLSTLLGGTISTFMYSAAGAILSFLGMWLVQQLGPKRV
FT                   SIIGVSVTGGILHNVGQLVIASWIAGTWSVMLYLPVLSFIGILSGIAVGIAANYLLKNV
FT                   QTLRMFADAKQSQAAQK"
FT   gene            complement(228534..228968)
FT                   /locus_tag="LM5578_0221"
FT   CDS_pept        complement(228534..228968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0221"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66978"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466162.1"
FT                   /protein_id="ADB66978.1"
FT                   /translation="MKKYLSMVKRWDIIIILSLCILSFLPIAIFSYVKANEPAPTSGKK
FT                   ELVAVISVDNKEYKTVTLTGHKGTESFDVKQPDGHTNTIEVSGEEIRISKANCNDQVCV
FT                   RTGAIDKQGDTVVCLPHKLVIEVKASDGSSGDSDDPIISS"
FT   gene            complement(229144..231030)
FT                   /locus_tag="LM5578_0222"
FT   CDS_pept        complement(229144..231030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0222"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66979"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466161.1"
FT                   /protein_id="ADB66979.1"
FT                   /translation="MPEKNIVLIGAGYAGVHAAKKLAKKYKKDKDVNITLIDRHSYHTM
FT                   MTELHEVAGGRVEPTAIQYDLRRLFNRTKVNLVTDNVTHVDHDKKVVTTEHGSYPFDYL
FT                   VLGMGGEPNDFGTPGVGENGFTLWSWEDSVKLRNHIEETVTKASREQDVEKRKAMLTFV
FT                   VCGSGFTGIEMVGELLEWKDRLAKDNKIDASEIKLVVVEAAPTILNMLERRDADKAERY
FT                   MVKKGIEIMKNAAIVEVKPESIVLKSGEELPTSTLIWTAGVRANSDTKDYGMESARAGR
FT                   LKVNQYMEAEGLKDVYVVGDLAYFEDEEGKPTPQIVEGAEQTALTAAKSIIVEMSGTGE
FT                   KEPFQGKYHGVMVSIGAKYGVAHLGGMHLSGWFAILMKHMVNLYYFFGIRSGYYMWQYI
FT                   MHEFFHIKDHRNIFRGWTSRYGNVLWVLPLRVYLGWFWIDEALSKIYGETTWDKVSITN
FT                   LKPLFNGIGSDSWLTATTSKMPFEWLQTAATSGASQAAGDAAGAAATNVTTPILSHMPG
FT                   WFQWIMELLMPNLDVALVMQKVVPFVELAIGLAMVVGLFTWLVSIGSAGFLVMFTLSAM
FT                   LGWDKFWALPASIALLNGAGRTFGLDYWAVPWFQKHLGHWWYGKPRSVYRDK"
FT   gene            231478..232377
FT                   /locus_tag="LM5578_0223"
FT   CDS_pept        231478..232377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0223"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66980"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466160.1"
FT                   /protein_id="ADB66980.1"
FT                   /translation="MKLKKVAMGITVVMASSLLLVGCGSSDDSSKDKKSTDTKQTETKK
FT                   TAKTDGTMTDGTYKLEEKNFDDKGWKGFMSIEVKDGKITKANYDYKNKDGKLKSEDADY
FT                   EKAMKDKVGTGPQEYLKQLSDSLVKNQSAASVEVVSGATHSSDAFINYANQLIQAAQKA
FT                   DTTTISINNLAKMEDGTYKLEEQNYAHGYRVVFSMDVKDGKITKSDYNYVDKDGKLKSD
FT                   DADYEKNMKAKSGTGPKEYIPALNKSLVEKQDVAAVDTVSGATNSSNQFKIYAAQLQNA
FT                   AQNGNTDTIKVYNLVEAE"
FT   gene            232541..233623
FT                   /locus_tag="LM5578_0224"
FT   CDS_pept        232541..233623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0224"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66981"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466159.1"
FT                   /protein_id="ADB66981.1"
FT                   /translation="MKKWKIIISVIILALVVSACGNSSKETKSEPSDSKKLMDQPYSKT
FT                   DFLMGTVVTLKIYDKGKEDVLDKGFDRIKDLAAKITTSDSEKTSEVDKINEQAGKKPVK
FT                   VSEDVYYLIQEGLKYSENSGGSFDITIGPLTSLWHIGFSDARKPSQAEIDAVLPLINYK
FT                   DVKMNDKDQTVYLEKEGMELDLGAIAKGFITDETLKVFKENKVTTSIIDLGGNIYVQGN
FT                   NPNGNKWNVGIQDPFSPRGSVIGKIPESNMSIVTSGIYERYLEVDGKTYHHILDPKTGY
FT                   PFDNDIAGVSIVSKKSIDGDGLSTATFSKGIKGGMDYIEQFEGVDAIFISKEKKVYETS
FT                   GLKGQFELTDKDFQMDTLKK"
FT   gene            233705..234664
FT                   /locus_tag="LM5578_0225"
FT   CDS_pept        233705..234664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0225"
FT                   /product="1,4-dihydroxy-2-naphthoate octaprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66982"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466158.1"
FT                   /protein_id="ADB66982.1"
FT                   /translation="MSIPSFLKLVEIQTKIASVFPFMLGTLFVVYQYDMFKPINTLIFF
FT                   GSMLIFDLTTTAINNYMDYRKATDNHDYDYRTTSNVIGQEQIPVRTVIITIFLMFFIAT
FT                   GLGVWLVFRTDLLVLLIGFVCFCIGILYTFGPVPLSRMPLGEIFSGVTMGFGIFFLAVY
FT                   VNAYDAGIANLLWQGEMVTIQFNLIEIIRIGVVSLPCIFTIANIMLANNLCDLDEDIRN
FT                   HRYTLPYYIGRKMGVLLFNTLYYASFLAVVVSVAINFLHPIMLLSLITIYPVYRNLVKF
FT                   NKEQIKSKTFVIGIRNFVLINATLTILMAVSVVLQQLT"
FT   gene            234684..235484
FT                   /locus_tag="LM5578_0226"
FT   CDS_pept        234684..235484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0226"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66983"
FT                   /db_xref="GOA:D2NWE2"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR024919"
FT                   /db_xref="UniProtKB/Swiss-Prot:D2NWE2"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466157.1"
FT                   /protein_id="ADB66983.1"
FT                   /translation="MIEKLILGRFVPGESLIHGLDARTKLLAGFYYIGILFLANNWWTY
FT                   ALMVLFTLMVVQMTGIKLKVFIKGVKPLIWLILFTVVMQILFASGGTIYFDWGPFTISS
FT                   FGLLNGVFVFLRFVLIIIMSTVITLTTTPMNLTDAIAYILRPFAVLKVPVNDIALMISV
FT                   ALRFIPTLMGETDKIMKAQRARGVDFGEGNLFEQMKVVVPIFIPLFVSSFNRAEELADA
FT                   MEARGYQGGEGRTRFRILHWHFGDLIAACVMILLTAGLVILRTS"
FT   gene            235845..236153
FT                   /gene="rpsJ"
FT                   /locus_tag="LM5578_0227"
FT   CDS_pept        235845..236153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="LM5578_0227"
FT                   /product="30S ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66984"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466156.1"
FT                   /protein_id="ADB66984.1"
FT                   /translation="MAKQKIRIRLKAYDHRILDQSAEKIVETAKRSGASVSGPIPLPTE
FT                   KSIYTVLRAVHKYKDSREQFEMRTHKRLIDIVNPTPQTVDSLMRLDLPSGVDIEIKL"
FT   gene            236188..236817
FT                   /gene="rplC"
FT                   /locus_tag="LM5578_0228"
FT   CDS_pept        236188..236817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="LM5578_0228"
FT                   /product="50S ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66985"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466155.1"
FT                   /protein_id="ADB66985.1"
FT                   /translation="MTKGILGRKVGMTQVFTENGELIPVTVIEAAQNVVLQKKTVETDG
FT                   YEAVQIGFEDKRAILSNKPEQGHVAKANTTPKRFIREFRDVNLDEYEIGAEVKVDVFAE
FT                   GDIIDATGVSKGKGFQGVIKRHGQSRGPMAHGSRYHRRPGSMGPVAPNRVFKNKLLPGR
FT                   MGGEQITIQNLEIVKVDVEKNVLLVKGNVPGAKKALVQIKTATKAK"
FT   gene            236843..237466
FT                   /gene="rplD"
FT                   /locus_tag="LM5578_0229"
FT   CDS_pept        236843..237466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="LM5578_0229"
FT                   /product="50S ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66986"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466154.1"
FT                   /protein_id="ADB66986.1"
FT                   /translation="MPKLSLLKQDGTNAGEITLNDTVFGIEPNEKVVVDVILSQRASLR
FT                   QGTHKVKNRSEVRGGGRKPWRQKGTGRARQGSIRSPQWRGGGVVFGPTPRSYAYKLPKK
FT                   VRRLAIKSILSSKVNEEKLVVLEGLTFDAPKTKEFAAFLKNISVDTKALIVVAGESENV
FT                   ELSARNLQGITVIPAESISVLEVAKHDKLIITKAAVEKVEEVLA"
FT   gene            237466..237750
FT                   /gene="rplW"
FT                   /locus_tag="LM5578_0230"
FT   CDS_pept        237466..237750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="LM5578_0230"
FT                   /product="50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66987"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466153.1"
FT                   /protein_id="ADB66987.1"
FT                   /translation="MDARDIIKRPVVTEESTSILDDKKYTFEVDTRATKTQVKYAVEEI
FT                   FDVKVAKVNVMNYKGKLKRMGRYAGYTNKRRKAIVTVTADSKEIQFFEV"
FT   gene            237791..238624
FT                   /gene="rplB"
FT                   /locus_tag="LM5578_0231"
FT   CDS_pept        237791..238624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="LM5578_0231"
FT                   /product="50S ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66988"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466152.1"
FT                   /protein_id="ADB66988.1"
FT                   /translation="MAIKKYKPTTNGRRHMTSSDFAEITTSTPEKSLLRPLKKKAGRNN
FT                   QGKLTVRHHGGGHKRQYRVIDFKRNKDGIPGRVATIEYDPNRSANIALINYADGEKRYI
FT                   IAAKGLEVGQTIYSGAEADIKVGNALELKDIPVGTVIHNIEMKPGKGGQLVRSAGTSAQ
FT                   VLGKEGKYVLIRLNSGEVRMILATCRATIGQVGNEQHELINIGKAGRSRWMGKRPTVRG
FT                   SVMNPNDHPHGGGEGKAPIGRKSPMSPWGKPTLGYKTRKKNNNSDKFIVRRRKKK"
FT   gene            238670..238990
FT                   /gene="rpsS"
FT                   /locus_tag="LM5578_0232"
FT   CDS_pept        238670..238990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="LM5578_0232"
FT                   /product="30S ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66989"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466151.1"
FT                   /protein_id="ADB66989.1"
FT                   /translation="MRSQLPDYAKGGSVMGRSLKKGPFVDDHLMKKVEAAAESEKKQVI
FT                   KTWSRRSTIFPTFVGQTIAVYDGRKHVPVYVQEDMVGHKLGEFAPTRTYRGHAGDDKKT
FT                   KR"
FT   gene            239011..239367
FT                   /gene="rplV"
FT                   /locus_tag="LM5578_0233"
FT   CDS_pept        239011..239367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="LM5578_0233"
FT                   /product="50S ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66990"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466150.1"
FT                   /protein_id="ADB66990.1"
FT                   /translation="MASEVTSAKAVAKTVRIAPRKARIVIDLIRGKQVGEAIAILKYTP
FT                   RSASPIIEKVLKSAIANAEHNYDLDINNLVVEEAFVDEGPTLKRFRPRAQGRASAINKR
FT                   TSHITVVVSEVKEG"
FT   gene            239371..240027
FT                   /gene="rpsC"
FT                   /locus_tag="LM5578_0234"
FT   CDS_pept        239371..240027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="LM5578_0234"
FT                   /product="30S ribosomal protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66991"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466149.1"
FT                   /protein_id="ADB66991.1"
FT                   /translation="MGQKVHPIGMRIGVIRDWDSKWYAEKDYADFLHEDLRIRDYVAKR
FT                   LSDASVSRVEIERAANRVNITIHTAKPGMVIGKGGSEVEALRKNLNELTQKRVHINIVE
FT                   IKRADLDAKLVAENIARQLEGRVSFRRAQKQAIQRTMRAGAKGIKTQVSGRLGGADIAR
FT                   AEHYSEGTVPLHTLRADIDYAWEEADTTYGKLGVKVWIYRGEVLPTKKNNVEGGK"
FT   gene            240030..240464
FT                   /gene="rplP"
FT                   /locus_tag="LM5578_0235"
FT   CDS_pept        240030..240464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="LM5578_0235"
FT                   /product="50S ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66992"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466148.1"
FT                   /protein_id="ADB66992.1"
FT                   /translation="MLVPKRVKYRREFRGNMRGRAKGGTEVAFGEYGLQAVEASWITNR
FT                   QIEAARIAMTRYMKRGGKVWIKIFPHKSYTSKPIGVRMGKGKGAPEGWVSPVKRGKIMF
FT                   EIAGVPEDVAREALRLAAHKLPVKTKIVKREEIGGEANES"
FT   gene            240454..240645
FT                   /gene="rpmC"
FT                   /locus_tag="LM5578_0236"
FT   CDS_pept        240454..240645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="LM5578_0236"
FT                   /product="50S ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66993"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466147.1"
FT                   /protein_id="ADB66993.1"
FT                   /translation="MKANDIRDLSTTEIQDQEKALKEELFNLRFQLATGQLENTARIRE
FT                   VRKAIARMKTIVRERELA"
FT   gene            240673..240936
FT                   /gene="rpsQ"
FT                   /locus_tag="LM5578_0237"
FT   CDS_pept        240673..240936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="LM5578_0237"
FT                   /product="30S ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66994"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466146.1"
FT                   /protein_id="ADB66994.1"
FT                   /translation="MADRNQRKVYTGRVVSDKMDKTITVVVETYKKHGLYGKRVKYSKK
FT                   FKAHDENNIAKTGDVVRISETRPLSATKHFRLLEVVEEAVII"
FT   gene            241016..241384
FT                   /gene="rplN"
FT                   /locus_tag="LM5578_0238"
FT   CDS_pept        241016..241384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="LM5578_0238"
FT                   /product="50S ribosomal protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66995"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466145.1"
FT                   /protein_id="ADB66995.1"
FT                   /translation="MIQQESRMKVADNSGAREVLTIKVLGGSGRKTANIGDVVVCTVKQ
FT                   ATPGGVVKKGEVVKAVIVRTKSGARRQDGSYIKFDENACVIIRDDKSPRGTRIFGPVAR
FT                   ELRENNFMKIVSLAPEVL"
FT   gene            241422..241733
FT                   /gene="rplX"
FT                   /locus_tag="LM5578_0239"
FT   CDS_pept        241422..241733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="LM5578_0239"
FT                   /product="50S ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66996"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466144.1"
FT                   /protein_id="ADB66996.1"
FT                   /translation="MHVKKGDKVKVITGKDKGKSGKVLAAFPKKDRVLIEGINMVKKHT
FT                   KPSNVNPQGGILNVEAPIHVSNVMLLDPKTGEPTRVGYEVKGDKKVRVAKKSGEVIDK"
FT   gene            241760..242299
FT                   /gene="rplE"
FT                   /locus_tag="LM5578_0240"
FT   CDS_pept        241760..242299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="LM5578_0240"
FT                   /product="50S ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66997"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466143.1"
FT                   /protein_id="ADB66997.1"
FT                   /translation="MNRLKDQYLKEIVPALMSKFNYDSVMEVPKIDKIVINTGVGDATA
FT                   NAKVLDSAVEELALITGQKPVITKAKNSIAGFRLREGMPIGAKVTLRGERMYDFLDKLV
FT                   TVSLPRVRDFRGVSKKAFDGRGNYTLGVREQLIFPEIDYDQVSKVRGMDVVIVTTAKSD
FT                   EESHELLTQLGMPFQK"
FT   gene            242330..242515
FT                   /gene="rpsN"
FT                   /locus_tag="LM5578_0241"
FT   CDS_pept        242330..242515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="LM5578_0241"
FT                   /product="30S ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66998"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466142.1"
FT                   /protein_id="ADB66998.1"
FT                   /translation="MAKKSMIAKQKRTPKYAVQAYTRCERCGRPHSVIRKFKLCRICFR
FT                   ELAYKGQIPGVKKASW"
FT   gene            242546..242944
FT                   /gene="rpsH"
FT                   /locus_tag="LM5578_0242"
FT   CDS_pept        242546..242944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="LM5578_0242"
FT                   /product="30S ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADB66999"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466141.1"
FT                   /protein_id="ADB66999.1"
FT                   /translation="MVMTDPIADFLTRIRNANMVKHDKLELPASKIKKEIAEILKREGF
FT                   IRDVEYIEDDNAGTIRVFLKYGATGERVITGLKRISKPGLRVYAKSTEVPKVLNGLGIA
FT                   IVSTSQGVLTDKEARAKQVGGEVLAYVW"
FT   gene            242975..243511
FT                   /gene="rplF"
FT                   /locus_tag="LM5578_0243"
FT   CDS_pept        242975..243511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="LM5578_0243"
FT                   /product="50S ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67000"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466140.1"
FT                   /protein_id="ADB67000.1"
FT                   /translation="MSRIGKKTIVIPAGVTVTLNGSTATVKGPKGELVKEFNPEITIKI
FT                   EGNEINVSRPTDNKNHRALHGTTRAILNNMVVGVSEGYEKKLELIGVGYRAQKQGDKLV
FT                   LNVGYSHPVEFVAPKGVDIEVPANTQVIVKGYNKEHVGELAANIRAVRPPEPYKGKGIR
FT                   YEGEHVRRKEGKTGK"
FT   gene            243530..243910
FT                   /gene="rplR"
FT                   /locus_tag="LM5578_0244"
FT   CDS_pept        243530..243910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="LM5578_0244"
FT                   /product="50S ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67001"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466139.1"
FT                   /protein_id="ADB67001.1"
FT                   /translation="MREEVSRVITKIDKNKVRKKRHARVRSKISGTESRPRLNVFRSNK
FT                   NIYAQIIDDVNGVTLASASNLDKDFGSAESKVDAASKVGELVAKRASEKGITSVTFDRG
FT                   GYLYHGRVKALAEAARENGLEF"
FT   gene            243932..244435
FT                   /gene="rpsE"
FT                   /locus_tag="LM5578_0245"
FT   CDS_pept        243932..244435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="LM5578_0245"
FT                   /product="30S ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67002"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466138.1"
FT                   /protein_id="ADB67002.1"
FT                   /translation="MPEQIDGNKLDLEERVVTINRVAKVVKGGRRFRFTALVVVGDKNG
FT                   HVGFGTGKAQEVPDAIRKAVEDAKKNMVLVPTVDTTIPHTVVGHFGGGEILLKPASAGS
FT                   GVTAGGPVRAVLELAGVADVSSKSLGSNTPINMVRATIDGIKQLKNAEDVAKLRGKTVE
FT                   ELLG"
FT   gene            244452..244631
FT                   /gene="rpmD"
FT                   /locus_tag="LM5578_0246"
FT   CDS_pept        244452..244631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="LM5578_0246"
FT                   /product="50S ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67003"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466137.1"
FT                   /protein_id="ADB67003.1"
FT                   /translation="MAKLEITLKRSLIGRPQPQRKTVQALGLGKTNSVVVKEDNPAIRG
FT                   MITKVSHLVDVKEV"
FT   gene            244687..245127
FT                   /gene="rplO"
FT                   /locus_tag="LM5578_0247"
FT   CDS_pept        244687..245127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="LM5578_0247"
FT                   /product="50S ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67004"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466136.1"
FT                   /protein_id="ADB67004.1"
FT                   /translation="MKLHELKPSEGSRKERNRVGRGTGSGNGKTSGRGHKGQKARSGGG
FT                   VRLGFEGGQLPLFRRIPKRGFTNINRKEFAIVNLDVLNRFEDGTEVTPELLVETGIIRN
FT                   EKSGIKILSNGNIEKKLTVKANKFSAAAKEAIEAAGGKTEVI"
FT   gene            245127..246422
FT                   /gene="secY"
FT                   /locus_tag="LM5578_0248"
FT   CDS_pept        245127..246422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="LM5578_0248"
FT                   /product="preprotein translocase subunit SecY"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67005"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466135.1"
FT                   /protein_id="ADB67005.1"
FT                   /translation="MFQTLVNFFKVADIRKKILFTLAMLVIFRIGTFVPVPGVNAAALQ
FT                   SSMDGGILGFLNTFNGGALKNFSIFAMGVMPYITSSIIVQLLQMDVVPKLTEWSKQGEM
FT                   GRKKLNQLTRYMTIGLGLVEAFGMAYGFNRMSSAGLVIEPSIGRYAIIAIVLTTGTMFL
FT                   MWLGEQITVKGVGNGVSIIIFAGIVARIPDGVRQLYVSQIENAGDQLFLHVLTLVGVGV
FT                   AILAIVVAVIFFQQALRKIPIQYSKRVAGAKQSGAQATHLPLKLNSAGVIPVIFASAFI
FT                   ITPQTILTFFDQSNDVVKVLKDVFDYTKPIGMILYVALIVAFTYFYAFIQVNPEKVADN
FT                   LKKQGGYIPSKRPGRETQAYLTSVLYRLTFVGAIFLSAVAILPTIGTTVFSLPQSLAVG
FT                   GTSLLIVIGVALDTTKQLEGQLVKRNYRGFIK"
FT   gene            246482..247129
FT                   /gene="adk"
FT                   /locus_tag="LM5578_0249"
FT   CDS_pept        246482..247129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="LM5578_0249"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67006"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466134.1"
FT                   /protein_id="ADB67006.1"
FT                   /translation="MKLVLMGLPGAGKGTQAEQIVEKYNIPHISTGDMFRAAMKNNTEL
FT                   GRKAKSFMDNGDLVPDEVTNGIVRERLSEDDAKDGFLLDGFPRTVEQAQELENILSDLG
FT                   TELDAVINIDVEKDVLMKRLTGRWICRTCGKTYHEIYNPPKVPGKCDLDGGELYQRDDD
FT                   KKETVEKRLNVNMKQTKPLLDFYSEKGKLHNINGEQEIKDVFVDVEKILASF"
FT   gene            247515..247733
FT                   /gene="infA"
FT                   /locus_tag="LM5578_0250"
FT   CDS_pept        247515..247733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="LM5578_0250"
FT                   /product="translation initiation factor IF-1"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67007"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466133.1"
FT                   /protein_id="ADB67007.1"
FT                   /translation="MAKEDVIEVEGVVQETLPNAMFNVELENGHKVLATVSGKIRMHYI
FT                   RILPGDKVTVELSPYDLTRGRITYRFK"
FT   gene            247837..247950
FT                   /gene="rpmJ"
FT                   /locus_tag="LM5578_0251"
FT   CDS_pept        247837..247950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="LM5578_0251"
FT                   /product="50S ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67008"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466132.1"
FT                   /protein_id="ADB67008.1"
FT                   /translation="MKVRPSVKPMCEKCKVIRRKGKVMVICENPKHKQKQG"
FT   gene            247969..248334
FT                   /gene="rpsM"
FT                   /locus_tag="LM5578_0252"
FT   CDS_pept        247969..248334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="LM5578_0252"
FT                   /product="30S ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67009"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466131.1"
FT                   /protein_id="ADB67009.1"
FT                   /translation="MARIAGVDVPREKRIVISLTYIYGIGKQTAKEVLAEAGVSEDTRT
FT                   RDLTEEELGKIREILDRIKVEGDLRREVNLNIKRLIEIGSYRGMRHRRGLPVRGQNTKN
FT                   NARTRKGPSKTVAGKKK"
FT   gene            248357..248746
FT                   /gene="rpsK"
FT                   /locus_tag="LM5578_0253"
FT   CDS_pept        248357..248746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="LM5578_0253"
FT                   /product="30S ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67010"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466130.1"
FT                   /protein_id="ADB67010.1"
FT                   /translation="MARKTNTRKRRVKKNIESGIAHIRSTFNNTIVMITDTHGNALAWS
FT                   SAGSLGFKGSRKSTPFAAQMAAESAAKSAQEHGLKTLEVTVKGPGSGREAAIRALQAAG
FT                   LEVTAIKDVTPVPHNGCRPPKRRRV"
FT   gene            248856..249800
FT                   /gene="rpoA"
FT                   /locus_tag="LM5578_0254"
FT   CDS_pept        248856..249800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="LM5578_0254"
FT                   /product="DNA-directed RNA polymerase subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67011"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466129.1"
FT                   /protein_id="ADB67011.1"
FT                   /translation="MIEIEKPKIETIEISDDAKYGKFVVEPLERGYGTTLGNSLRRILL
FT                   SSLPGAAVTSIQIDGALHEFSVIEGVVEDVTTMILNIKKLALKIYSDEEKTLEIDMQGP
FT                   GVVTAADINYDSDVEILNPDLHIATLSDNAKFHVRLNATRGRGYTPADQNKRENMPIGV
FT                   LPVDSIFSPVIRVNYQVENTRVGQSTNYDKLTFDVLTDGSISPEEAVSLGAKILSEHLS
FT                   IFVNLTDEAQKAEIMIEKEESHKEKVLEMTIEELDLSVRSYNCLKRAGINTVQELADKS
FT                   EDDMMKVRNLGRKSLEEVKVKLADLGLSLRNEN"
FT   gene            249817..250224
FT                   /gene="rplQ"
FT                   /locus_tag="LM5578_0255"
FT   CDS_pept        249817..250224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="LM5578_0255"
FT                   /product="50S ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67012"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466128.1"
FT                   /protein_id="ADB67012.1"
FT                   /translation="MGYRKLGRTSSQRKALLRDLATDLIVFERIETTEARAKEIRKVVE
FT                   KLITSGKKGDLHARRQAAAFIRHEVVEVVQVDAKGKDGSTVKKNRPVYALQKLFDDVAP
FT                   RYAERQGGYTRILKKGPRRGDGAPMVIIELV"
FT   gene            250432..251526
FT                   /locus_tag="LM5578_0256"
FT   CDS_pept        250432..251526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0256"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67013"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466127.1"
FT                   /protein_id="ADB67013.1"
FT                   /translation="MRPLTDSQIAQNRLHNSGLLQSKFPTAEEATRALFGIQSQYQQFG
FT                   EISLFNRVDNLTKENLQITYDKKDLIKIWGQRMTVHMYAPDDWFYVHDVYAHKNNWSRK
FT                   HTDSLGHDLDDLLAEMEELLLRDEKVPKEAFAALFGDHAKELMTWGGVFIQGSLDGKLF
FT                   CVPESPKTRFYSHRSRIDSKSHEEWLNIERNQTGLETMIDRYFSAYGPATIQDFKHWSG
FT                   LRNSEYMTTLEKQLENYFCYIGEDGKTYYSKTETHDEQEMDTPLLLGKFDPLFVSYAKK
FT                   NWLANEKETSLIWRIAGQIEAVLIINGQFFGTWRYKVSGEKIIFNFYLSKKLTKKSQKI
FT                   VEIEAMKLAGFLHKKYQGSIFELI"
FT   gene            complement(251565..252455)
FT                   /locus_tag="LM5578_0257"
FT   CDS_pept        complement(251565..252455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0257"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67014"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466126.1"
FT                   /protein_id="ADB67014.1"
FT                   /translation="MKNFVTSERSIFEMEKSTEPAIRVKDGSVVKIKTKDHFNGQIHAK
FT                   QLHYGELDWKQFSPTTGPIYIEEARPGDLLAITIEKIELLGTEVFLLNGPNIGITDDLL
FT                   TSNSTRCYKVENNQIIYSEDIHIPIRKTIGLLKTEELNPSKVPTKNGGLLDSSKITEGA
FT                   TIFLPVEKYGASLHVGNVRATTGFGKITATSAEAPAEVTLRLQILKNRTAPTPTIIHYH
FT                   NLICLASDFTIEKATQKTMHNMITLLTESDKMTTEDALFLISLQADFQVCKLCKPNITT
FT                   SIKLPLDYFPEMPFL"
FT   gene            complement(252574..253236)
FT                   /locus_tag="LM5578_0258"
FT   CDS_pept        complement(252574..253236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0258"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67015"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466125.1"
FT                   /protein_id="ADB67015.1"
FT                   /translation="MLADFILRLVVAGLLGAIIGLDREIRAKEAGFRTHFLVSLGSALI
FT                   MIVSQYGFSQIATMQNVSFDPSRVAAQVVSGIGFIGAGTIIIQKKFVRGLTTAAGLWAT
FT                   AGIGLAIGAGMYWVGIAATLLTLIGLEFLSIIFKSFAFHTTAIIYSTDKQENLVKVTDQ
FT                   IKQNKQQIVSYSSEKELIGESLFIRVNIVVKTKNKNDEYELFHFIQTLPNVTVEKME"
FT   gene            253367..254206
FT                   /locus_tag="LM5578_0259"
FT   CDS_pept        253367..254206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0259"
FT                   /product="cobalt transporter ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67016"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466124.1"
FT                   /protein_id="ADB67016.1"
FT                   /translation="MAESFVRLEHVFYKYEDTEKYAVKDVSISAQKGEWVALVGHNGSG
FT                   KSTIAKLLNGLLFPEDGLIKIGHFVLSEKNIWDIRRQVGMVFQNPDNQFVGATVQDDVA
FT                   FGLENHGVPHDTMVERVESALNEVGMQSYALHEPARLSGGQKQRVAIAGVLALQPDVII
FT                   LDEATSMLDPRGRAEVMETIRIMREQEEITVISITHDLDEVLFADRVIVMNNGEVHSEG
FT                   TPKEIFQQADAMREIGLGVPFIIELQEKLVAGGFETGSTVLSEGALLDQLWKLNSNN"
FT   gene            254182..255048
FT                   /locus_tag="LM5578_0260"
FT   CDS_pept        254182..255048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0260"
FT                   /product="cobalt transporter ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67017"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466123.1"
FT                   /protein_id="ADB67017.1"
FT                   /translation="MEIKLEQLGYCYQKNSPFEKRALLDVNVSFDSGSYSAIIGHTGSG
FT                   KSTLLQHLNALLMPTEGKITVGDREIVAGVKQKKLRDLRKKVGIVFQFPEAQLFEETVE
FT                   KDICFGPMNFGVSEEDAKLRAKKVIYEVGLTEEILSRSPFELSGGQMRRVAIAGVLAMD
FT                   PEVLVLDEPTAGLDPHGREEIMEMFYNLHKEKGLTTVLVTHSMEDAARYAEKIVLMKAG
FT                   TVLQIGTPREIFAKPDELVDLGLSVPDVVRFQGLFERKFDVKLTKTCLTIDELTTEMAP
FT                   YLAKGGA"
FT   gene            255051..255848
FT                   /locus_tag="LM5578_0261"
FT   CDS_pept        255051..255848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0261"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67018"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466122.1"
FT                   /protein_id="ADB67018.1"
FT                   /translation="MMDKMILGRYIPGNSWLHRIDPRAKITAVMAFIAIVFLANNWLTY
FT                   ALMFVYVLYLVLTSKVPFLFFIKGLQPIFWLILITLLLQVFFTKGGTVLVDLGLLQITT
FT                   LGLANGAMMFCRFVLIIFMTTLLTLTTSPIELTDGLEKILAPFRLVHLPVHELALMLSI
FT                   SLRFIPTLMDETEKILKAQKARGVEFTSGKWSDRIKAIIPLLVPLFISAFKRAEDLAIA
FT                   MEARGYRGGKGRTRFRLLRWRFADTFLLISLAVLSGLLFWLRS"
FT   gene            255854..256600
FT                   /gene="truA"
FT                   /locus_tag="LM5578_0262"
FT   CDS_pept        255854..256600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truA"
FT                   /locus_tag="LM5578_0262"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67019"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466121.1"
FT                   /protein_id="ADB67019.1"
FT                   /translation="MTRYKAIISYDGSGFYGYQVQPNTRTVQAEIEKALTKMHKGKTVR
FT                   VTASGRTDTGVHAKGQVIHFDSELDITAEKFQKALQVMTPFDISFLTVEEVPDDFHARF
FT                   GTVGKEYRYVVKRTKIFDPFSRNFALHYPYELDISKMKLASKRLIGEHDFTSFCSARTE
FT                   RDSKVRTLYSIDFYEEDDETLVIAFQGNGFLYNMVRILTGTLLDAGQGRISPDDISEAL
FT                   LARDRQKLISKTAPPQGLYLWRVDYE"
FT   gene            256795..257232
FT                   /gene="rplM"
FT                   /locus_tag="LM5578_0263"
FT   CDS_pept        256795..257232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="LM5578_0263"
FT                   /product="50S ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67020"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466120.1"
FT                   /protein_id="ADB67020.1"
FT                   /translation="MRTTYMAKPGEVERKWYVIDATGVSLGRLSSEVASILRGKNKPQF
FT                   TPHIDTGDFVIIINAGKIGLTGKKATDKIYYRHSQYPGGLKSRTAGEMRTNNPEKLLEL
FT                   SIKGMLPKNSLGRQLFKKLHVYGGSEHEHAAQQPEVYELRG"
FT   gene            257254..257646
FT                   /gene="rpsI"
FT                   /locus_tag="LM5578_0264"
FT   CDS_pept        257254..257646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="LM5578_0264"
FT                   /product="30S ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67021"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466119.1"
FT                   /protein_id="ADB67021.1"
FT                   /translation="MAQVQYYGTGRRKSSVARVRLVPGDGKIVINNRDWEDYIPFAALR
FT                   EVIKQPLVATETLGNYDVLVNVHGGGYTGQAGAIRHGVARALLQVAPEYRPALKSAGLL
FT                   TRDSRMKERKKPGLKGARRAPQFSKR"
FT   gene            complement(257841..258710)
FT                   /locus_tag="LM5578_0265"
FT   CDS_pept        complement(257841..258710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0265"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67022"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466118.1"
FT                   /protein_id="ADB67022.1"
FT                   /translation="MKKRGLLLVSVLMLFIFLTVACGSSEDNEESGEISTKEIELTVDD
FT                   PIIPTDENGEATIEGTVDPKSKLTIDGKAVKKDDSGRFTYTYSLTNDNVAEVDVKLLAV
FT                   RKNYKDEKYTITITNNSKAYNDNMVKQEAIQKEEAEKAEKERKEAEEKAKQEEEAAAAK
FT                   AATTDENTPSDDTVYGTLASKDTLTKEGDAFYKDEALDVLYSTVENDEIFQVLIQLGDE
FT                   STIRKDLDKNHLTELARDYMESDATLIQTVSDESFVYESPSINKTYTVNYMLNDEGYVI
FT                   AVYVTQAK"
FT   gene            259434..259856
FT                   /locus_tag="LM5578_0266"
FT   CDS_pept        259434..259856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0266"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67023"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466116.1"
FT                   /protein_id="ADB67023.1"
FT                   /translation="MNIKQAADMFGLTVDTLRYYERVGVIPPVHRNESGYRDYKTSDLN
FT                   WVYLVKNLRNAGLSVESLIEFATLAQLRETQNVEAAQKQVLVDQLKELDEKLAEMKKVR
FT                   ELLVYKIDSYDSHIAQFKAGELNADNVEKLWERDKF"
FT   gene            259878..260729
FT                   /locus_tag="LM5578_0267"
FT   CDS_pept        259878..260729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0267"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67024"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466115.1"
FT                   /protein_id="ADB67024.1"
FT                   /translation="MKTVKLNNGVEVPILGFGTYQITDAAEAEQAVKDAIKTGYRHIDT
FT                   AQSYMNEEAVGRGIAASGVDRKELFITTKIWVENVSYKGVMSSFDRSLKRLGLDYIDLL
FT                   LIHQPFNDVYGAWIAMEELQASGKIRAIGVSNFSPDRVIDLAAFNEVTPQVNQIEVNPF
FT                   QQQTENLAILRKEGVAIEAWAPFAEGKNDIFNNPVLTKIGAKYGKSAAQVILRWLVEQD
FT                   IIVLAKSVKPERMAQNLAIFDFELTEADKEEIAGLDQGESQFFSHADPEMVKWMASRKL
FT                   NV"
FT   gene            complement(260771..262297)
FT                   /locus_tag="LM5578_0268"
FT   CDS_pept        complement(260771..262297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0268"
FT                   /product="GW repeat-containing surface protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67025"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466114.1"
FT                   /protein_id="ADB67025.1"
FT                   /translation="MDRKFIKPGIILLIVAFLVVSINVGAETGGSRTAQVNLTTSQQAF
FT                   IDEILPAAQDGYRDGKLLTSVTLAQAILESNWGESGLSQNSNNLFGIKGTYKGKSVSMG
FT                   TMEASGSTTANFRVYPSWKESIEDHTALITENARYQDAVDETDYRKALQAIKDGGYATD
FT                   PDYVSKLVAIIERYNLDKYDVIYDKIESNQSLAAIGTVAENKKQEVIWSAPYNTENANK
FT                   IGTLENYSGRNLEISWEAKTEKGLWYFIRENNKDIGWINSNALKISYHQKEDENVHLTK
FT                   YVDDLSAHVYRLPSPEKQFDNGTIAKYDRKALEADKKITRGGYAWFRISEGEKVIGWVR
FT                   ADKLNDRLYDRITEQTSYDGYALVSKSATDNVWTAPFNTKNAEKLAPLADYNNEKLEIV
FT                   TRAKAGNTLWYQFKVDGKLVGWASEKDLNVFYTPAKEEPVKQVAYVKDPTAKLYNKPVE
FT                   STSTNPKAVGFYYGKLLAVDKTATILGEDWLHLKDSQNSLGWIKAIDINS"
FT   gene            262566..263594
FT                   /locus_tag="LM5578_0269"
FT   CDS_pept        262566..263594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0269"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67026"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466113.1"
FT                   /protein_id="ADB67026.1"
FT                   /translation="MLNEQQITRLLYRLQDPVLEASLEETEGVLEVQVLEETANIKIAL
FT                   ADPAVETDHFVHNIEELLTQFGVNEINIELEYLPAAVIDRIFQARDNILSEASETKFLA
FT                   IASGKGGVGKSTVSANLAIALAQQGKKVGLLDADIYGFSIPVLLGTTESPHKENGQIIP
FT                   VETHGIQMISMDFFVEQGEPVIWRGPMLGKMIKMFLEEVRWGKLDYLLIDLPPGTGDVA
FT                   LDIHTLIPKCNELIVTTPHYAAASVASRAGYMAAKNNHKIIGVIENMSYLTLADGQVLK
FT                   VFGQGGGEKVAADLETQLLIQLPIEQPEPNGNGYVSALFNSSSTSGKAYKTLAEKIIPY
FT                   LS"
FT   gene            263612..263704
FT                   /locus_tag="LM5578_0270"
FT   CDS_pept        263612..263704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67027"
FT                   /inference="ab initio prediction:Glimmer:3.02"
FT                   /protein_id="ADB67027.1"
FT                   /translation="MTKGKNLGIFINVADADKTLSQQKKLTFEN"
FT   gene            263875..265429
FT                   /locus_tag="LM5578_rRNA01"
FT   rRNA            263875..265429
FT                   /locus_tag="LM5578_rRNA01"
FT                   /product="16S ribosomal RNA"
FT                   /inference="similar to DNA sequence (same
FT                   species):RefSeq:NC_003210.1"
FT   gene            265557..265630
FT                   /locus_tag="LM5578_tRNA02"
FT   tRNA            265557..265630
FT                   /locus_tag="LM5578_tRNA02"
FT                   /product="tRNA-Ile"
FT                   /note="Cove score: 92.91"
FT                   /inference="ab initio prediction:tRNAscan-SE:1.23"
FT   gene            265677..265752
FT                   /locus_tag="LM5578_tRNA03"
FT   tRNA            265677..265752
FT                   /locus_tag="LM5578_tRNA03"
FT                   /product="tRNA-Ala"
FT                   /note="Cove score: 92.94"
FT                   /inference="ab initio prediction:tRNAscan-SE:1.23"
FT   gene            265925..268855
FT                   /locus_tag="LM5578_rRNA02"
FT   rRNA            265925..268855
FT                   /locus_tag="LM5578_rRNA02"
FT                   /product="23S ribosomal RNA"
FT                   /inference="similar to DNA sequence (same
FT                   species):RefSeq:NC_003210.1"
FT   gene            268936..269045
FT                   /locus_tag="LM5578_rRNA03"
FT   rRNA            268936..269045
FT                   /locus_tag="LM5578_rRNA03"
FT                   /product="5S ribosomal RNA"
FT                   /inference="similar to DNA sequence (same
FT                   species):RefSeq:NC_003210.1"
FT   gene            269665..270183
FT                   /locus_tag="LM5578_0272"
FT   CDS_pept        269665..270183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0272"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67028"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463761.1"
FT                   /protein_id="ADB67028.1"
FT                   /translation="MICQRCGENKAVIALQQLNELGKVESLYLCENCATDEALSSEKDL
FT                   VKAMDTFSEVALDFLTLLQKEENTQKEVVCENCQLSFEEFLKTNRVGCPECYSAFEAQL
FT                   VPIIGRVQNGYKKHIGKVPAEVERAEGVQNEISRLQEKLAQLVKNEEFEEAAVVRDEIK
FT                   ALKAGGEDK"
FT   gene            270180..271202
FT                   /locus_tag="LM5578_0273"
FT   CDS_pept        270180..271202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0273"
FT                   /product="ATP:guanido phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67029"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463762.1"
FT                   /protein_id="ADB67029.1"
FT                   /translation="MNVFEPRLSSWLENAGDDDDVVLSSRIRLARNLKDEQFPIYEQKE
FT                   EIVDNIAEVFDDNFILIKMNQISLLQKALLVEKHLISPYMMNKSEYGAVLLNEEENVSI
FT                   MLNEEDHLRIQCMTPGLRLFDALEAALQIDGYVEEKLSYAFDKEFGYLTSCVTNIGTGM
FT                   RASVMVHLPGLVTTKRIKSVIEAIRSLGFVVRGIYGEGSMPASNIFQVSNQVTLGKTEA
FT                   EIVEDLTQVMEQIIMQERVARTTLKQKFHIALEDRVFRSYGLLMNCRIISMKEATDAIS
FT                   DIRLGVELGFFEHISRQKMNELVLFSQPAFLRREAGRDMDELEEKVIRAKVIREILGDK
FT                   "
FT   gene            271231..273693
FT                   /gene="clpC"
FT                   /locus_tag="LM5578_0274"
FT   CDS_pept        271231..273693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpC"
FT                   /locus_tag="LM5578_0274"
FT                   /product="endopeptidase Clp ATP-binding chain C"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67030"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463763.1"
FT                   /protein_id="ADB67030.1"
FT                   /translation="MMFGRFTQRAQKVLALSQEEAMRLNHSNLGTEHILLGLVREGEGI
FT                   AAKALYELGISSEKVQQEVEGLIGHGEKAVTTIQYTPRAKKVIELSMDEARKLGHTYVG
FT                   TEHILLGLIREGEGVAARVLSNLGISLNKARQQVLQLLGGGDATGAGRQTNTQATPTLD
FT                   SLARDLTVIAREDNLDPVIGRSKEIQRVIEVLSRRTKNNPVLIGEPGVGKTAIAEGLAQ
FT                   QIVRNEVPETLRGKRVMTLDMGTVVAGTKYRGEFEDRLKKVMDEIRQAGNVILFIDELH
FT                   TLIGAGGAEGAIDASNILKPPLARGELQCIGATTLDEYRKYIEKDAALERRFQPIKVDE
FT                   PTVEESIQILHGLRDRYEAHHRVAITDEALEAAVRLSDRYISDRFLPDKAIDVIDESGS
FT                   KVRLKSFTTPKNVKEMENNLSDLKKEKDAAVQGQEFEKAASLRDKEQKLKKSLEETKAN
FT                   WQEKQGLDHSEVTEDIVAEVVASWTGIPVAKLAETETNKLLNMEKLLHERVIGQDAAVK
FT                   AVSLAVRRARAGLKDPKRPIGSFIFLGPTGVGKTELARALAESMFGDEDSMIRIDMSEY
FT                   MEKFSTARLVGAPPGYVGYEEGGQLTEKVRQKPYSVVLLDEIEKAHPDVFNMLLQVLDD
FT                   GRLTDSKGRVVDFRNTVIIMTSNIGAQEMKQDKSMGFNVTDPLKDHKAMEHRVLQDLKQ
FT                   AFRPEFINRIDETIVFHSLQEKELKQIVTLLTAQLTKRLAERDIHVKLTEGAKSKIAKD
FT                   GYDPEYGARPLKRAIQKEVEDMLSEELLRGNIKVGDYVEIGVKDGKLEVRKKDAPKKKT
FT                   TSKKVKAK"
FT   gene            273839..275212
FT                   /locus_tag="LM5578_0275"
FT   CDS_pept        273839..275212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0275"
FT                   /product="DNA repair protein RadA"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67031"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463764.1"
FT                   /protein_id="ADB67031.1"
FT                   /translation="MAKAKRTTKFVCQACGYESAKWMGKCPNCNEWNQMVEALEPSKKS
FT                   RSAFNHTGEPSKATPITQIASETEKRVETNMPELNRVLGGGVVPGSMVLVGGDPGIGKS
FT                   TLLLQVSAQLTLTNKKVLYISGEESIKQTKLRAERLQVSGDNLYVYAETNLEAVQETID
FT                   FVKPDFVVIDSIQTVYHPDVTSAAGSVSQVRECTATLMRIAKMQNIAIFIVGHVTKEGA
FT                   IAGPRLLEHMVDTVLYFEGERHHAYRILRAVKNRFGSTNEMGIFEMRDVGLVEVANPSE
FT                   VFLEERLEGASGSTVVASMEGTRPVLVEIQALVSPTMFGNAKRMATGIDYNKVSLIMAV
FT                   LEKRVGLMLQNQDAYLKAAGGVKLDEPAVDLAVAVSVASSYRDKPTRSTDCFIGELGLT
FT                   GEIRRVARIEQRVQEAAKLGFKRIFIPKNNEGNWKIPKDVQVVGVETIGEALKKALPD"
FT   gene            275346..276419
FT                   /locus_tag="LM5578_0276"
FT   CDS_pept        275346..276419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0276"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67032"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463765.1"
FT                   /protein_id="ADB67032.1"
FT                   /translation="MLTWVIRVCFLILGGTTGVFSLPALWVKLGIGHILLINNPYTDAL
FT                   IGALIFYLITFWAVKYVEAALNWLEEKLAKIAIATLVYGGLGLFVGLVIAFFASNALSQ
FT                   TNIPLLNSVVPVILTLVLGYLGFRIGISRRNEFGNFVNNRNAKKRTPEEEKTEEKSKKT
FT                   YKILDTSVIIDGRIADILTTGFLDGTVVIPLFVLAELQHIADSSDTLKRTRGRRGLDIL
FT                   NRIQKEDAIQVEMYEGDFEDTPEVDSKLVKLAKVMGGIVVTNDYNLNKVCEFQNVPVLN
FT                   INDLANAVKPVVLPGEKMTVLMVKDGKEHNQGVAYLDDGTMIVVEDGRKFINETIQVEV
FT                   TSVLQTSAGRMIFAKPS"
FT   gene            276439..277137
FT                   /gene="ispD"
FT                   /locus_tag="LM5578_0277"
FT   CDS_pept        276439..277137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispD"
FT                   /locus_tag="LM5578_0277"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67033"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463766.1"
FT                   /protein_id="ADB67033.1"
FT                   /translation="MNYELVFLAAGQGKRMNAQKNKMWLELVGEPIFIHALRPFLADNR
FT                   CSKVIVVCQEEERKHVKELMSQLNVAEHRIEIVKGGSERQYSVAAGLERCGTERVVLVH
FT                   DGARPFITLDIIDRLLIGVEQSKAAICAVKVKDTVKRVVNGVVQETVDRENLWQVQTPQ
FT                   AFELPILRKAHQLARKEQFLGTDEASLVERIPCPVAIVQGSYYNIKLTTPEDMPLAKAI
FT                   LGELGGIAND"
FT   gene            277130..277603
FT                   /gene="ispF"
FT                   /locus_tag="LM5578_0278"
FT   CDS_pept        277130..277603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispF"
FT                   /locus_tag="LM5578_0278"
FT                   /product="2-C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67034"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463767.1"
FT                   /protein_id="ADB67034.1"
FT                   /translation="MIRIGQGYDVHKLAYDRDLIIGGVKIPYEKGLLGHSDADVLLHAI
FT                   TDAIIGAIGAGDIGHFFPDTDMTFKDADSAELLEEIWQKVEADGFRLGNLDATIIAEKP
FT                   KMAPYVEQMKLRIAELLHADSAQVNVKATTTEKLGFTGREEGIASLAVVLLEK"
FT   gene            277622..279076
FT                   /gene="gltX"
FT                   /locus_tag="LM5578_0279"
FT   CDS_pept        277622..279076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="LM5578_0279"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67035"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463768.1"
FT                   /protein_id="ADB67035.1"
FT                   /translation="MSETKRVRVRYAPSPTGFLHIGNARTALFNYLFARHNDGDFIIRI
FT                   EDTDAKRNIADGEESQMTNLKWLGMDWDEGVDVPGKYGPYRQSERQSIYEPLIQELLDK
FT                   DLAYKCYCTEEELDVEREKQKANGEMPRYSGKCRHLTKEQQAEKEAQGFKPSIRFKVPA
FT                   NETITFNDMVKDDVSFESNGIGDFVIAKKDGIPTYNFAVAVDDHLMEISHVLRGDDHIS
FT                   NTPKQILIYNAFGWEPPIFGHMTLIVNESRRKLSKRDGSIIQFIEQYRDLGYLPEALFN
FT                   FIAMLGWSPEGEEEIFSKEEFIKMFDPKRLSKSPALFDNVKLTWVNNQYVKKLPLNDVV
FT                   ELSLPHLQKAGVVSAELNQAELDWVHKLVSLYHEQMSYGAEIVPLSEMFFADAESITFD
FT                   EEETVPTVISAFKKELEALEVLEAAEVKAAIKRVQKETGVKGKGLFMPIRIVTTGEMHG
FT                   PELPLAIEVLGREKVLNRLDTWLKNN"
FT   gene            279474..280088
FT                   /gene="cysE"
FT                   /locus_tag="LM5578_0280"
FT   CDS_pept        279474..280088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysE"
FT                   /locus_tag="LM5578_0280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67036"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463769.1"
FT                   /protein_id="ADB67036.1"
FT                   /translation="MPTRLKEDIATIIKNDPATKSFFDAFLTNPGLHALWWHRMANFFY
FT                   RHKMVLFGKVLSQTARFWTNIEIHPGATIGRRLFIDHGAGIVIGETAEIGDDVTIFHGV
FT                   TLGGTGKDCGKRHPTVGDGALVSAGAKVLGPVEIGAGARIGAGAVVLKDVPPGATVVGI
FT                   PAKVVRLNGRTVGHAVPKMDELTLRIAELENIVEKLLKEKE"
FT   gene            280095..281510
FT                   /gene="cysS"
FT                   /locus_tag="LM5578_0281"
FT   CDS_pept        280095..281510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="LM5578_0281"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67037"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463770.1"
FT                   /protein_id="ADB67037.1"
FT                   /translation="MSIQIFNTLKREKQPFKPLKDGEVKMYVCGPTVYNYIHIGNARPI
FT                   IVFDTVRRYFTYRGYDVKFVSNFTDVDDKLIRAANELKLTVPEVADRFIGAYFDDVDQL
FT                   NVAKASVNPRVTENMDEIIQMISTLIEKGYAYESAGDVYFQTKKFKDYGKLSGQELSEL
FT                   QHGARVEYNERKQDELDFTLWKAAKPGEIFWESPFGNGRPGWHIECSALAKKYLGDTID
FT                   IHAGGQDLVFPHHEDEIAQSEAATGKTFANYWMHNAFLNIDGEKMSKSLGNFITLHDVL
FT                   KDNDPNVIRFFMLSVHYRKPITLNDAILEDAKNGLERLMIAYQNIDHRIQTDDGEYVEE
FT                   AHEDEWLEQLTELKQAFEDDMDDDFNTANAITTFHELAKRANIYLAKETVSINVLREFL
FT                   SMMRLFAEVLGLKLENTQSDSLDDSEVEALIEERLQARNERNFARADEIRDILKEKNII
FT                   LEDTAQGTRFRRG"
FT   gene            281514..281924
FT                   /locus_tag="LM5578_0282"
FT   CDS_pept        281514..281924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0282"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67038"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463771.1"
FT                   /protein_id="ADB67038.1"
FT                   /translation="MAEVKEYKQLNGLALAYMGDAVYEKFIREYLLAAGKTKPNQLHKT
FT                   ATKFVSAKGQAVALKAMIAEGFLTEEEDRIAKRGRNAKSYTVPKNTDPGTYSMSTSFEA
FT                   VLGYLYLAGDVDRLQEWMEKALEIVEKGVETN"
FT   gene            281924..282679
FT                   /locus_tag="LM5578_0283"
FT   CDS_pept        281924..282679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0283"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67039"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463772.1"
FT                   /protein_id="ADB67039.1"
FT                   /translation="MEQENEQEWIGGRNPVLEVLRSDRDIHKIYVQEGSQKGVLKQVLT
FT                   LAKERKIQVQFVPKQKIEKVVSGAHQGVAAQVAAYQYAELDDLFAAAEAKDEMPFFIIL
FT                   DELEDPHNLGSIMRTADSVGAHGIIIPKRRSVGLTQTVAKASTGAMEYVPVVRVTNMVR
FT                   TMEELQKRGLWIFGTDAKGSSDYRTMDVDMPLAIVIGSEGFGMSRLVREKCDFLVHLPM
FT                   RGKVTSLNASVAASLLLYEVYRKRFPLEK"
FT   gene            282682..283194
FT                   /locus_tag="LM5578_0284"
FT   CDS_pept        282682..283194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0284"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67040"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463773.1"
FT                   /protein_id="ADB67040.1"
FT                   /translation="MEQILLVDGYNVIGAWPELSYLKDRDLEAARDKLVEWMAEYQSYT
FT                   GYRVVVVFDAQFVRGVKRKSKKYQVEVVFTHEDETADEYIEQKAIEWKNVRTQIMVATS
FT                   DYTEQWAIFGQGALRISSRELLFEIQEMSKQIGKKIKRIQEEMPKSNLNLDSDVISQLE
FT                   KWRRGEE"
FT   gene            283275..283880
FT                   /gene="sigH"
FT                   /locus_tag="LM5578_0285"
FT   CDS_pept        283275..283880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sigH"
FT                   /locus_tag="LM5578_0285"
FT                   /product="RNA polymerase factor sigma-70"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67041"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463774.1"
FT                   /protein_id="ADB67041.1"
FT                   /translation="MDNSVNQEELAMLELARSGDTEALEYFFSKYQSVIYWKSTQYFLQ
FT                   GAERDDLIQEAMIGLFKAIRDYDKTKEASFRSFAEMCINRQLLSAVKRASRQKNIPLNN
FT                   SVSLDTPMAEDDVDWTLLDVISEKAAETPEDFLIKNEDLTHVARQLEQVTSEFEKEVLK
FT                   QYLEGKSYQEMALFFNKKEKAIDNALQRVKKKMMKQLE"
FT   gene            284153..284332
FT                   /gene="secE"
FT                   /locus_tag="LM5578_0286"
FT   CDS_pept        284153..284332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="LM5578_0286"
FT                   /product="preprotein translocase subunit SecE"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67042"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463776.1"
FT                   /protein_id="ADB67042.1"
FT                   /translation="MSAIAKFFRNVSSEMHKVTWPTRKELLTYTVTVVITVVLFALFFM
FT                   LIDFGIEQIIKLIV"
FT   gene            284462..284995
FT                   /gene="nusG"
FT                   /locus_tag="LM5578_0287"
FT   CDS_pept        284462..284995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="LM5578_0287"
FT                   /product="transcription antitermination protein NusG"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67043"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463777.1"
FT                   /protein_id="ADB67043.1"
FT                   /translation="MEKNWYVVHTYSGYENKVKANLEKRVESMGMSDKIFRVIVPEEEE
FT                   TEVKNGKTKTIKRKVFPGYVLVEIVMTDDSWYVVRNTPGVTGFVGSAGSGSKPTPLLPE
FT                   EADRILKSMGMVEKRAEADFEIGETVMVKEGPFADFSGKVDEMDNDKGKAKVMVNMFGR
FT                   ETPVEVDFNQIEKL"
FT   gene            285050..285520
FT                   /locus_tag="LM5578_0288"
FT   CDS_pept        285050..285520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0288"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67044"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463778.1"
FT                   /protein_id="ADB67044.1"
FT                   /translation="MDKAKQIYLEFKREADFLELDFPLFLGDGPGFGELCMDYSEQDGY
FT                   MLYGYERGKRNSEFKTTDFDEFKYEVFLHICWYMGMEFELRHRKEDIERDDNILETDTR
FT                   KIAFEKTLQLLKMVNPAWIDKAAIGYSNYLNLWRKNKNVYFDKEAMQFKVNL"
FT   gene            285647..286072
FT                   /gene="rplK"
FT                   /locus_tag="LM5578_0289"
FT   CDS_pept        285647..286072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="LM5578_0289"
FT                   /product="50S ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67045"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463779.1"
FT                   /protein_id="ADB67045.1"
FT                   /translation="MAKKVIKEVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNAR
FT                   TADQAGLIIPVVITVFEDRSFTFITKTPPAAVLLKKAAKVEKGSGEPNKTKVASVTRAQ
FT                   VQEIAETKMPDLNAANVESAMLMVEGTARSMGITIQD"
FT   gene            286112..286801
FT                   /gene="rplA"
FT                   /locus_tag="LM5578_0290"
FT   CDS_pept        286112..286801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="LM5578_0290"
FT                   /product="50S ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67046"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463780.1"
FT                   /protein_id="ADB67046.1"
FT                   /translation="MAKKGKKYQDALKQIDANKVYTAEEAVELAKKIDFAKFDATVEVA
FT                   FRLGVDPKKADQQIRGAVVLPNGTGKTQRVLVFAKGEKAKEAEAAGADYVGESEFVEKI
FT                   NQGWFDFDVIVATPDMMGEVGKLGRVLGPKGLMPNPKTGTVTMDVTKAVNEIKAGKVEY
FT                   RVDKAGNVHAAIGKVSFDAAKLVENFRTVNDVLQKAKPAAAKGTYVKNLSVTTTFGPGI
FT                   KVDPASL"
FT   gene            287049..287549
FT                   /gene="rplJ"
FT                   /locus_tag="LM5578_0291"
FT   CDS_pept        287049..287549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="LM5578_0291"
FT                   /product="50S ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67047"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463781.1"
FT                   /protein_id="ADB67047.1"
FT                   /translation="MSKVLEAKQSAVEEIKTKLSASASTVIVDYRGLNVGEITDLRKQL
FT                   RDAGIEFKVYKNSLTRRAVEANGYEGLEGALTGPNAIAFSNEDVVAPAKILNDFAKDHE
FT                   ALEIKAGVIEGKVASLEEIKALATLPSREGLLSMLCNVLQAPVRGLAIATKAVADQKEG
FT                   QEA"
FT   gene            287628..287990
FT                   /gene="rplL"
FT                   /locus_tag="LM5578_0292"
FT   CDS_pept        287628..287990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="LM5578_0292"
FT                   /product="50S ribosomal protein L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67048"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463782.1"
FT                   /protein_id="ADB67048.1"
FT                   /translation="MALNIEEIIASVKEASVLELNDLVKAIEEEFGVTAAAPVAVAAAG
FT                   GAAAEQTEFTVELASAGDSKIKVIKVVREITGLGLKEAKELVDNAPKALKEGIAKDEAE
FT                   EIKAKLEEVGANVEVK"
FT   gene            288148..288324
FT                   /locus_tag="LM5578_0293"
FT   CDS_pept        288148..288324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0293"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67049"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463786.1"
FT                   /protein_id="ADB67049.1"
FT                   /translation="MAIKSISKSELEVMSVGLYKADKDSVASLLGGTTDPKNVSLKETV
FT                   KQFEAQGFKKKES"
FT   gene            288439..289044
FT                   /locus_tag="LM5578_0294"
FT   CDS_pept        288439..289044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0294"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67050"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463787.1"
FT                   /protein_id="ADB67050.1"
FT                   /translation="MTNNHYYTNDETIKHNRKTWQVMLKGFNMSFTSDNGVFSKNTVDF
FT                   GSKLLIESFELETKTGKILDVGCGYGPMGLTVAKAFPDSQIEMVDVNLRALELAKENAG
FT                   INKTTNTHIYESSVYDNVTANDYQAIISNPPIRAGKKVVHAILEGAYDHLQETGELWIV
FT                   IQKKQGGPSAEKKMEEVFGNVETVAKDKGYFIFKSVKN"
FT   gene            289391..290569
FT                   /locus_tag="LM5578_0295"
FT   CDS_pept        289391..290569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0295"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67051"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463788.1"
FT                   /protein_id="ADB67051.1"
FT                   /translation="MLTLKGKYNEAKVFTDNVDDNTIGEIITLCNQPFAKDSKIRIMPD
FT                   THGGKGCVIGTTMTIQDKIVPNLVGVDIGCGLYVVKLKPGKLKMDFDKLDKVIRERVPS
FT                   GSKTHDKPVDQFDLEGVVAPIHLGWAARSIGTLGGGNHFIEVNQGSDGIYLVIHSGSRV
FT                   LGKEIAEYHQEVAYKRLDILRKELKLDATAAKKRGNLEMANNLNGEREQVKLDYDLSYV
FT                   TGSDLNHYLNDMEIAQKFAARNRYIMAETILKAMKWNKAVVSAFDCVHNYIDIDNRMLR
FT                   KGATSAQLGEQIIVPLNMRDGSILATGKGNADWNYSAPHGAGRMLSRSKAKAQISLESY
FT                   QAAMKDVWTTSVSKKTIDEAPKAYKSAKQLLADVEDTMEIQEIIKPLYNFKA"
FT   gene            290714..291709
FT                   /locus_tag="LM5578_0296"
FT   CDS_pept        290714..291709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0296"
FT                   /product="transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67052"
FT                   /protein_id="ADB67052.1"
FT                   /translation="MNKVTKIGDVAEKTGYSITTISRAINGNPNVSDKTKKKIFAAMKE
FT                   LNYYPNNIAQQFRGQGTKMIGVVISFITNPFFAYLVDAIERYLSHRGYQVVMLQTLENP
FT                   AKELQFIEMLQKKQLDGLIMANLENDTEEIKSLVESGKIVLCNRYLGNENLTIINIDET
FT                   KAAYQATNYLIKCGYKRIAYCTGGIKNKNDYRFKGFMQAVTENGLSFDESLYFEKLLTI
FT                   EDGEKLLVNILEEKSTIPDAIFSNGDTVAAGILYAAKKYGIAVPEELGIIGFDNQPIAE
FT                   VLNPALTTIEQPIKELGEYSAQVLLANLQGTSVPVAPDLETKLIIRETTK"
FT   gene            291847..293073
FT                   /locus_tag="LM5578_0297"
FT   CDS_pept        291847..293073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0297"
FT                   /product="maltose/maltodextrin transport system
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67053"
FT                   /protein_id="ADB67053.1"
FT                   /translation="MKKLLLSISIIVGLSLLASCGVEKEYKPDIKVNEKNVSLKVWVDL
FT                   NQGDFYRKVVDDFKKEHPDKNYDITVIESESGRAQEYVQKDPEAAADVFITPNDRLGQL
FT                   VESGAVYQLTKYTDDIKKNNTPTSIQAATYQDKMYGFPVTAEAMFMYYDKRVFSEDDIK
FT                   TFSGITSKGKLGINLAEAGADYRETPWFIANGTYLYGENGEDPYGTTFNTPEGVQVLNW
FT                   IGELKNNPNVVAVNADEISALRSGKINAVFSGVWNKDAIREVLGENMGVAVYPKADFGS
FT                   GQVDMMAFQGSGIYCVNAFTKSPLDAMELADYITNADVQEKAFKELGKIPSNLEARSSS
FT                   TIEKDDVAKAVIDMTSGKHSVLMPKIPEMNVFWQHMNPLLVDTYKGKIKKADYPEALDK
FT                   LVKDITPAK"
FT   gene            293091..294428
FT                   /locus_tag="LM5578_0298"
FT   CDS_pept        293091..294428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0298"
FT                   /product="maltose/maltodextrin transport system permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67054"
FT                   /protein_id="ADB67054.1"
FT                   /translation="MMVKKNYFNIFKNGSVSTRLSYVIMGAGNLAHKQIAKGLLFLFSE
FT                   LAFLFFLVFYGITLIQGMATLGTVNQSWNFDKSLGIMVRTPGDNSMLMLIYGIMTVVIC
FT                   VLFIFLYLANIRSASQVEGFQRENKKIPTFKEDLKSLLDNKFHVTLLTIPMIGVVVFTI
FT                   MPLVYMISLAFTNYDHEHLPPRNLFGWVGFVNFKNVLNGDISSTFFPVLGWTLIWALLA
FT                   TATCFFFGVLLALLINHKGVKFKKFWRTIFVITMAVPPFVSLLVMQNLLHAAGPLNTML
FT                   LNWGIIAEPIPFLTDALLAKVSVIFVNMWIGIPVTMLIATGILMNLPKDQLEAARMDGG
FT                   NSFHLFRYITFPQILTVMLPSLIQQFIGNINNFNVIYLLTGGGPSNSNFYGAGDTDLLV
FT                   TWLYKLTVEAADYNLASVIGIVTFILSAAFSLFAYTRTNSYKEGSN"
FT   gene            294430..295260
FT                   /locus_tag="LM5578_0299"
FT   CDS_pept        294430..295260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0299"
FT                   /product="maltose/maltodextrin transport system permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67055"
FT                   /protein_id="ADB67055.1"
FT                   /translation="MKRATVWPNLLLIVLGCIWIFPIIWIVLTAFRAESGQFVSYIFPK
FT                   EYTLDHFAYLFENHENFPFMLWVKNTMIVAVCSCLLSTFITVSMAYVLSRLRFRFKKMM
FT                   LKTALVLNMFPAFMSMIAVYYILKAFGLTQSLTALVLIYSSTAALTFYIAKGFFDTIPK
FT                   SLDESAMMDGATKLSIFTKITLPMSKPIIVYTALMAFMLPWMDFIFAKVIMGDNVPKYT
FT                   VSIGLYSMLNQTTANTMYTTFAAGCILIAVPITILFIYLQKYYVEGITSGAVKG"
FT   gene            295275..296972
FT                   /locus_tag="LM5578_0300"
FT   CDS_pept        295275..296972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0300"
FT                   /product="oligo-1,6-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67056"
FT                   /protein_id="ADB67056.1"
FT                   /translation="MEITETKEWWKESVVYQIYPRSFQDSNGDGIGDIRGIIERLPYLK
FT                   DLGINVIWLCPVYKSPMDDGGYDISDYYEIDPMFGTMSDMDELIEKAEKLGIKILMDLV
FT                   VNHTSDEHEWFEKAIADPKSKYRDYYIFREGVNGNPPNNWRSYFGGSAWEAVPGEENMF
FT                   YLHAFSKKQPDLNWENIVVRNECIQMINWWLEKGLGGFRIDAILNLKKRIEYGTFPADG
FT                   EDGLVFIGHWILNQPGIEEWLKEIDERTFKKHNAFTVAEADVPEERLSEFIGENGHFRM
FT                   VFDFSYTDIDTPETGEWFKNSEWTVKELKEKIITNELVTQRNGWGAKYLENHDQPRSIN
FT                   KYLPQEYQDDRSKKMLGTLFMMLHGTPFIYQGQEIGMSNTRMESIDDYNDIATHDQYHR
FT                   AILSGMSPEEALEGMYRRSRDNSRTPMQWNNQKNAGFSDSDEIWLKTNPNYLDINVEQE
FT                   QIDDNSVLNFYKKLIHLRSDSSKYKEVAVYGELLPVESSDEVIAYKRKTDDAELLIVVN
FT                   FSDSENQLCVEGTYEQVLANVALPEIVENVLEIPKYTGAVFSRILEVD"
FT   gene            296973..298415
FT                   /locus_tag="LM5578_0301"
FT   CDS_pept        296973..298415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0301"
FT                   /product="sucrose phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67057"
FT                   /protein_id="ADB67057.1"
FT                   /translation="MQIKNKAMLITYSDSLGKNMEELSKVMETCFEDAIGGIHLLPFFP
FT                   STGDRGFAPSDYTTVDSDLGSWEMIEKLGEKYYLMFDFMINHISRESLFFQDFKKEHLN
FT                   SKYKDMFIRINDFFPPGRPNEKDLDLIYKRKDKAPFQEVEFADGETELVWNTFGEEQID
FT                   LDVTAEVTKEFIRQTIKNMAAHGCSILRLDAFAYAIKKLDTNDFFVEPEIWDLLDEVKV
FT                   EAAKYDMELLPEIHEHYSIQMKIANHDYYIYDFALPMVMLYSLYSGRVERLAKWLEMSP
FT                   MKQFTTLDTHDGIGVVDARDLLTDEELDYTSAELYKIGANVKKIYSSGKYNNLDIYQIN
FT                   STYYSALGDDDKSYLLARVIQCFAPGIPQIYYVGLLAGKNDIDLLEETKEGRNINRHYY
FT                   TMDEIENEVKRPVVKALCNLLRFRNTSEAFDLEGSIEIETPSSNEIVIIRKNKTNKIAA
FT                   TLKANLSTKTFQISENERNILI"
FT   gene            298972..302526
FT                   /gene="rpoB"
FT                   /locus_tag="LM5578_0302"
FT   CDS_pept        298972..302526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="LM5578_0302"
FT                   /product="DNA-directed RNA polymerase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67058"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463789.1"
FT                   /protein_id="ADB67058.1"
FT                   /translation="MSGHSGHDVKYGRHRTRRSFARISEVLELPNLIEIQTASYQWFLD
FT                   EGLREMFRDISPIEDFAGNLSLEFIDYDLGEPKYSVEESKNRDANYAAPLRVKLRLINK
FT                   ETGEVKDQEVFMGDFPLMTEMGTFIINGAERVIVSQLVRSPGVYFNGKLDKNGKKGFGS
FT                   TVIPNRGAWLEYETDAKDVVHVRIDRTRKLPVTVLLRALGFGSDQEIIDLIGDNDYLRN
FT                   TLEKDNTDNAEKALLEIYERLRPGEPPTVDNARSLLVSRFFDPKRYDLASVGRYKINKK
FT                   LHLKNRLFNQTLAETLVDPETGEIIASKGDILDRRNLDQIIPNLENGVGFRTLRPTDGV
FT                   MEDSVLVQSIKIYAPNDEEKEINIIGNAYIEENVKHITPSDIISSISYFFNLLHGVGDT
FT                   DDIDHLGNRRLRSVGELLQNQFRIGLSRMERVVRERMSIQDMTTITPQQLINIRPVVAS
FT                   IKEFFGSSQLSQFMDQTNPLGELTHKRRLSALGPGGLTRERAGYEVRDVHYSHYGRMCP
FT                   IETPEGPNIGLINSLSSFAKVNKFGFIETPYRRVDPETNRVTDKIDYLTADEEDNYVVA
FT                   QANSKLDEQGTFTEEEVMARFRSENLAVEKERIDYMDVSPKQVVSVATACIPFLENDDS
FT                   NRALMGANMQRQAVPLMHPEAPFVGTGMEHVSAKDSGAAVTAKHDGIVEHVEAREIWVR
FT                   RVSLVDGKEVTGGIDKYTLRKFVRSNQGTCYNQRPNVAEGDRVVKGEILGNGPSMDSGE
FT                   LALGRNVLVAFMTWDGYNYEDAIIMSERLVKDDVYTSIHIEEFESEARDTKLGPEEMTR
FT                   DIPNVGEDALRDLDERGIIRVGAEVKDNDLLVGKVTPKGVTELTAEERLLHAIFGEKAR
FT                   EVRDTSLRVPHGGGGIVLDVKIFTREAGDELPPGVNQLVRVYIVQKRKIHEGDKMAGRH
FT                   GNKGVISRILPEEDMPFMPDGTPVDIMLNPLGVPSRMNIGQVLELHLGMAARALGIHVA
FT                   TPVFDGANEEDVWSTVEEAGMARDAKTILYDGRSGEAFDNRISVGVMYMIKLAHMVDDK
FT                   LHARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTIKSDDVVGR
FT                   VKTYEAIVKGESVPEPGVPESFKVLIKELQSLGMDVKMLSADEEEIEMRDMDDDDFTNQ
FT                   NDAFNIVQPENAAAEKTE"
FT   gene            302697..306302
FT                   /gene="rpoC"
FT                   /locus_tag="LM5578_0303"
FT   CDS_pept        302697..306302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="LM5578_0303"
FT                   /product="DNA-directed RNA polymerase subunit beta'"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67059"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463790.1"
FT                   /protein_id="ADB67059.1"
FT                   /translation="MLDVNNFEYMKIGLASPDKIRSWSHGEVKKPETINYRTLKPERDG
FT                   LFCERIFGPMKDWECSCGKYKRVRYKGVVCDRCGVEVTKSKVRRERMGHIELAAPVSHI
FT                   WYFKGIPSRMGLVMDMSPRALEEIIYFASYVVTEPGDTPLEKKQLLSEREYRVYREKYG
FT                   KGFSAGMGAEAIKKILADIDLEKETNDLKEELKSAQGQRRTRAIRRLEVMEAFRNSGNN
FT                   PSWMVLDVLPVIPPEIRPMVQLEGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPNIIV
FT                   QNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSG
FT                   RSVIVVGPNLKMYQCGLPKEMALELFKPFVMKELVGRGLAHNIKSAKRKIERMAPEIWD
FT                   VLEEVIREHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVH
FT                   VPLSAEAQAEARILMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLEREKAVGEGTIFK
FT                   DINEAQLAYQNGYVHLHSRIAVFAGSIPNERFTDEQRNQLLITTVGKLIFNTILPKSFP
FT                   YINEPTKFNLEIETPAKYFVDTTTDVRAHIAAQELIDPFKKKILGNIIAEVFKKFHITE
FT                   TSKMLDRMKDLGFKISTKAGMTVGIADILTLEEKHEILEKAHDTVEKITKSFRRGLITD
FT                   DERYERVIAVWNAAKDEIQGKLILSLDRLNPIFMMQDSGARGNISNFTQLAGMRGLMAD
FT                   PSGRIVELPITSNFREGLTVLEYFISTHGARKGLTDTALKTADSGYLTRRLVDVAQDVI
FT                   IREDDCGTDRGLTIKAIREGTEIIEPLEERLEGRYSRKTIRHPETKEVIARENDLITEA
FT                   IATQIVDAGIEEVTIRSAFTCNTKHGVCKKCYGKNLATGTEVEVGEAVGIIAAQSIGEP
FT                   GTQLTMRTFHTGGVAGDDITQGLPRIQEIFEARNPKGQAIITEVGGEVVSIEEGRDRQQ
FT                   EITIQGTDDRRSYNIPYTARLRVEEGTIVERGEALTEGSVDPKALIRVRDVLSVQEYLL
FT                   AEVQKVYRMQGVEIGDKHVEVMVRQMLRKIRVMDTGDTNILPGTLMDIHTFTEANREAI
FT                   LSGSQPATGRPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKRDELLGLKENVI
FT                   LGKLVPAGTGIGRYRKLKSEVIKETAEVTDEITNI"
FT   gene            306379..306924
FT                   /locus_tag="LM5578_0304"
FT   CDS_pept        306379..306924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0304"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67060"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463791.1"
FT                   /protein_id="ADB67060.1"
FT                   /translation="MITHVIWDMGETLNTVPNTRYDHYPLDTYPEVVLRKDAKETLEKV
FT                   KQLGFKQAILSNTATSDTEVIKRVLTNFGIIDYFDFIYASNSELQPGKMEKPDKTIFDF
FT                   TLNALQIDKTEAVMVGNTFESDIIGANRAGIHAIWLQNPEVCLQDERLPLVAPPFVIPV
FT                   WDLAYVPEALLLLNKVST"
FT   gene            306990..308450
FT                   /locus_tag="LM5578_0305"
FT   CDS_pept        306990..308450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0305"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67061"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463792.1"
FT                   /protein_id="ADB67061.1"
FT                   /translation="MTEVKKQFPKGFLWGGATAANQVEGAYDVDDKGLSTADMVKFIPK
FT                   EERTRDLELDVSKAEIEAIIAGKVEGRFPKRDGVDFYHHYKEDIALFAEMGFKTFRLSL
FT                   NWARIFPNGDDKEPNEKGLEFYDKVFDELLKYDIEPLVTLSHYETPLNLTLKYNGWADR
FT                   RVIGFFTNYAETVFKRYKNKVKYWLTFNEINVISLSAYTGGGVLLEDAKNPLELSYQAG
FT                   HHQFVASALATKLAHEIIPGSQVGCMLARMATYPATNNPDDILKAQYENQQNLFFTDVH
FT                   ARGEYPSFMNRFFQENDIHIVKEVGDDEILKAHTVDFISFSYYMSLSATASPEGDRSAG
FT                   NLMGGVKNEYLESSDWGWQIDPKGLRWTLNDLYSRYELPLFIVENGLGAYDTVEEDGKI
FT                   HDDYRIDYLRKHIEQMKEAIADGVDLMGYTSWGPIDLVSASTSEMSKRYGFIYVDQDDW
FT                   GKGTLERSRKDSFFWYKKVIETNGEDLD"
FT   gene            308724..310196
FT                   /gene="inlG"
FT                   /locus_tag="LM5578_0306"
FT   CDS_pept        308724..310196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="inlG"
FT                   /locus_tag="LM5578_0306"
FT                   /product="internalin G"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67062"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463793.1"
FT                   /protein_id="ADB67062.1"
FT                   /translation="MKQRKTSVLHVLLVVTAILGISLWVNASHGMKAQAESIAQPAPIN
FT                   EIFTDPALADEVKTELGKTSVTDEVTQTDLNQITKLEADDKGINSIEGIQYLTNLNMLG
FT                   VSSNQITNITPLANLTNLDSLYLGDNKISDVTPLSGLTQLTFVQLSINQIKDVTPLANL
FT                   TKLNYLDLRENQISDASPLVNMTDLTVLHLEKQQITAAPVVYQTNIVAPDILKNAYGEV
FT                   VPPTTISNNGTFASPNITWNLDSFTSEVSYDFNQKITLGDNGKVTFAGTVVQPIVEAPV
FT                   NYITTFDVDGTTTTENVVVDTLITEPAEPTKEGYTFSGWYDAETGGNEWDFAVDKMPAT
FT                   NMTLYAQFIINSYTATFDVDGETTNQKVDYQALLQEPTAPTKDGYTFVGWYDAKTGGTE
FT                   WDFATSKMPTSDITLYARFTKNPSSDNSQTAPGKDDKNDKDKLTIKANDSADATSTKLP
FT                   KTSDDSSMIPTILGTLFIGGAILILRKKTTNI"
FT   gene            310334..311980
FT                   /gene="inlC2"
FT                   /locus_tag="LM5578_0307"
FT   CDS_pept        310334..311980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="inlC2"
FT                   /locus_tag="LM5578_0307"
FT                   /product="internalin H"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67063"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463794.1"
FT                   /protein_id="ADB67063.1"
FT                   /translation="MKKRWNSVFKLVLMVTAILGFSLYVTTSQGVEVRAESITQPTAIN
FT                   VIFPDPALANAIKIAAGKSNVTDTVTQADLDGITTLSAFGTGVTTIEGVQYLNNLIGLE
FT                   LKDNQITDLTPLKNLTKITELELSGNPLKNVSAIAGLQSIKTLDLTSTQITDVTPLAGL
FT                   SNLQVLYLDLNQITNISPLAGLTNLQYLSIGNAQVSDLTPLANLSKLTTLKADDNKISD
FT                   ISPLASLPNLIEVHLKNNQISDVSPLANTSNLFIVTLTNQTITNQPVFYQNNLVVPNIV
FT                   KGPSGAPIAPATISDNGTYASPNLTWNLTSFINNVSYTFNQSVTFKNTTVPFSGTVTQP
FT                   LTEAYTAVFDVDGKQTSVTVGANELIKEPTAPTKEGYTFTGWYDAKTGGNKWDFGVDKM
FT                   PAENITLYAQFTINSYTASFDNDGKLTTQKVTYQSLLEEPAAPTKTGYTFKGWYDAKTG
FT                   GTKWDFATGKMPAGNITLYAQFTKNDSPNPNDPTPNTPTGNGDGTSNPSNSGGNTTLPT
FT                   AGDENTMLPIFIGVFLLGTATLILRKTIKVK"
FT   gene            312188..313891
FT                   /gene="inlD"
FT                   /locus_tag="LM5578_0308"
FT   CDS_pept        312188..313891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="inlD"
FT                   /locus_tag="LM5578_0308"
FT                   /product="internalin H"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67064"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463794.1"
FT                   /protein_id="ADB67064.1"
FT                   /translation="MKRNKTALRILVTLAVVMAISFWVGTSSKEVQAAEIGQPTPINEI
FT                   FTDENLANAIKTTLSKPSTASAVSQVELDSVRDVTAESSNIASLEGVQYLNNLDTLVLN
FT                   NNKITDLNPLAGLSKLNILEASNNQLSDINALSNVTNLHQLRLDGNQIKQLNGVSNLIN
FT                   LETIELSNNQITAISPVSGLKNLVGLGIDNNKISDLSPISGLSKLNHLTADSNQISDLR
FT                   PLSNLAAMEVMRLDGNQISDVTPIANLANLNYVFLAENQISDISSLQPLFNSPNFFGIT
FT                   LDNQKITSEPVLYQQELVVPNNIKDEMGALIAPATISDNGVYASPNINWNLPNYTNQVS
FT                   YTFNKQLAYGSFSGTVTQPLHNAYTATFDVDGVKTNEAVEETKLLQEPIAPTKEGYTFT
FT                   GWYDAKTGGNKWDFATDKMPAEDITLYAQFTINSYTATFDIDGKLTTQKVTYQSLLEEP
FT                   VAPTKDGYTFTGWYDAKTGGTKWDFATGKMPAGNITLYAQFTKNDNPNPDDPTTNTPTG
FT                   NGDGTSNPSNSGGNTTLPTAGDENTMLPIFIGVFLLGTATLILRKTIKVK"
FT   gene            314100..315599
FT                   /gene="inlE"
FT                   /locus_tag="LM5578_0309"
FT   CDS_pept        314100..315599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="inlE"
FT                   /locus_tag="LM5578_0309"
FT                   /product="internalin E"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67065"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463795.1"
FT                   /protein_id="ADB67065.1"
FT                   /translation="MKRNKTALRILVTLAVVLAITFWVGMSSKEVQAAVIEHPTPINEI
FT                   FTDPVLTDNVKTLLGKADVTDEVTQTDLDSVTHLSAKSAGITTIEGLQYLTNLSELELI
FT                   DNQVTDLNPLTNLTKITELRLSGNPLKDVSALAGLKNLKTMDLIYTDITDVTPLAGLSN
FT                   LQVLNLDINQITDITPLAGLSNLQFLSFGSTQVSDLTPLANLSKLTTLNAMNSKVSDVS
FT                   PLTGLSNLTEVYLEENQISDVSPLAKLPNLSIVTLTNQTITNQPVFYQNKPIVPNVVTG
FT                   LSGELIAPDTISDNGTYTSPNLTWDLNSFINSVSYTFNQSVTFKNTTAPFSGTVTQPLT
FT                   EVYAVVFDVDGEQTSAMVGVNELINEPTAPAKEGYIFDGWYDAKTDGNKWDFGIDKMPA
FT                   SDITLYAKFTENEEPNASSPINVEPNDNNSDNAEPNASSSNNVQENGTNEGINNLNSSG
FT                   EDKVNIKLPITGDELNVLPIFVGAVLIGIGLVLFRKKRQTK"
FT   gene            315735..316874
FT                   /locus_tag="LM5578_0310"
FT   CDS_pept        315735..316874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0310"
FT                   /product="succinyl-diaminopimelate desuccinylase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67066"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463796.1"
FT                   /protein_id="ADB67066.1"
FT                   /translation="MDQQKKIQILKDMINIDSTNGHEEQVANYLQKLLAEHGIESEKVQ
FT                   YDVDRASLVSEIGSSNEKVLAFSGHMDVVDAGDVSKWKFPPFEATEHEGKLYGRGATDM
FT                   KSGLAAMVIAMIELHEEKQKLNGKIRLLATVGEEIGELGAEQLTQKGYADDLDGLIIGE
FT                   PSGHRIVYAHKGSINYTVKSTGKNAHSSMPEYGVNAIDNLILFYNEIEKYVASIHATNE
FT                   ILGDFIHNVTVINGGNQVNSIPEKAELQGNIRSIPEVDNETLKRRIVEIVNELNKKEHV
FT                   KLELLFDYDKQPVFSDRNSSLVNVARDVAKGIIKEEIPLLGISGTTDAAEFTKAKKQFP
FT                   VIIFGPGNETPHQVNENVSIDNYLEMIDVYKRIAIEYLS"
FT   gene            317022..317438
FT                   /locus_tag="LM5578_0311"
FT   CDS_pept        317022..317438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0311"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67067"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463797.1"
FT                   /protein_id="ADB67067.1"
FT                   /translation="MVKKEERLGVLLWFRFSRFYNRNMKLTNQNLRAAGISTAQFDCIA
FT                   QIGLDKEITQQQLAEKLVVTKGNVTQLLAKLEQLGYITRTKTGREKHITLTEKGQACYR
FT                   ENVPKQEAFQQAQFDKLTRDEQKELLKLLKKLGE"
FT   gene            317445..318404
FT                   /locus_tag="LM5578_0312"
FT   CDS_pept        317445..318404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0312"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67068"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463798.1"
FT                   /protein_id="ADB67068.1"
FT                   /translation="MKLTGIHHVSIFTANARANFDFYTKIMGLRLVKKSVNQDDPYTYH
FT                   LYYGDEIGSPGTALTFFEVPNMAKNHPSRNAISGLSLRVPSDEALHYWDKRLDEHRIFH
FT                   SKPIDQFGRKIIRLKDTDGLPVNLISDETSTQVTEVTPWEDSPVPAEYAIRGLGPVRFS
FT                   VFKKEKTDRLLTKILGFERIGAYEDDDKLVTVFKTGNVGLGGEVHVESRPDLEQGNLGA
FT                   GGIHHVAFRVPTDGDLIGWTEMIQDLGYKNSGYVDRFYFHSLYFRESNGILIELATDEP
FT                   GFQTDFTKEHGTYVDLPPHLEERREDILAHLKPLDTDK"
FT   gene            318476..319111
FT                   /locus_tag="LM5578_0313"
FT   CDS_pept        318476..319111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0313"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67069"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463799.1"
FT                   /protein_id="ADB67069.1"
FT                   /translation="MAEGLRTIYFVRHGKTEWNMTGQMQGWGDSPLVAEGIDGAKAVGE
FT                   VLKDMQIDAVYTSTSKRTQDTAAYILGDREIEIRPLEELKEMGFGTWEGIRVTEIDEKH
FT                   PEERAKILHSPETYKAEVNGGETYYELAERLLEGVEKIIADNPNGNILVVSHGMSLTLL
FT                   LYLLQGGTIEDHRKEAPRILNTSISIVEYQNGEFSLKKINEIGHLDLK"
FT   gene            319195..321081
FT                   /locus_tag="LM5578_0314"
FT   CDS_pept        319195..321081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0314"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67070"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463800.1"
FT                   /protein_id="ADB67070.1"
FT                   /translation="MKRIVKIFLHYLLGILGIILISCVPAIFSKVTSWSSSTYWEALKS
FT                   IFTAIFHPTKWEISYQGSAEVFHVSLADFITGPYFYSMKIIVASLVISALIAYLLVIAT
FT                   FRGPKWLRRGLSGFLSILQAFPDFSFIFLIQMAVVYIYQQTGVFTLNFYSLNGEQIYAA
FT                   PIVCLSIIPTVLFYKMMMLLMENEWQADYIQLARGKGLNDRAILLRHATPNMMQSLFYQ
FT                   SKTIVWFILSAYLVVEFLFGIEGVLYYLLAGFSPLNIFLVLALVFTPFYFFYALIDLWI
FT                   SRGKNTESANVTRIPLHWNSFQKTFTEKVNLKSKWRNIVVTTGQLLKRPSFSIPLVTLS
FT                   ILLIASLIYGLMGDKINSLKFISDATGRVTDMAPFKPNAQVWLGTDQAGNSILDQLLVG
FT                   IKYTLLIAVIIATLRVVIGYILAVPLAFFSKLRTRNFVQATADGMHYLPLSLLVFIIMV
FT                   NEFISYSGVFETSLFTRIIFQILIMVVIVLPITTNRISSEISQVLKKEFVLSALVFGGN
FT                   ARWILTKHINPQIWSKLILIWIEQLIQTLQMFVHLAIFGIFIGGAIMGADDGMLNPVIP
FT                   ELSGLIANAKFVFANHQFWIILPPLVVFMILILCFQMMANSLLKREEDSKKA"
FT   gene            complement(321095..321724)
FT                   /locus_tag="LM5578_0315"
FT   CDS_pept        complement(321095..321724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0315"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67071"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463801.1"
FT                   /protein_id="ADB67071.1"
FT                   /translation="MAEYQSQLARIQAKITALKEKDPDLNLFGSENHTYKLNQPLSNQT
FT                   LTEFENEHQITLPQDYRAFLEQIGNGGMGPYYGLETLVDGLCASLDYKDEKYGVQTLSE
FT                   PFPHTDDWNAPGYKEGMSDEDYDAWQELCFQDKEVFGLLRIANFGCGVSINLVVNGPSY
FT                   GEIWVDDRNNDNGVYPDFYFGNEERLGFLEWYELWLDKSIEEFEKA"
FT   gene            complement(321728..323164)
FT                   /locus_tag="LM5578_0316"
FT   CDS_pept        complement(321728..323164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0316"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67072"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463802.1"
FT                   /protein_id="ADB67072.1"
FT                   /translation="MEHQKRSPFPKDFLWGSASAAYQIEGAWDADGKGKSVWDEYVRIP
FT                   GTTFKGTNGDVAVDHYHRYKEDVKLMADAGLKAYRFSIAWTRIFPNGKGEVNEAGLKFY
FT                   DNLIDELLKYDIEPLVTLYHWDIPQALFDEYGGWESRQVIEDFTNYSTTLFKRYGDRVK
FT                   YWVSLNEQNIFVGMGYGQALHPPKVSDPKRMYAVNHIANLANASVIKAFHEIVPDGKIG
FT                   PSFAYTPHYPIDTDPKNVQAADDAEELNSYFWMDMYAFGRYPKAVWKYLEENDIAPVIE
FT                   DGDMELLASAKPDFMGVNYYQSATVAYNPLDGVGQNNEMNFTGKKGSTKETGVPGVYKK
FT                   VVNPFVKTTNWDWTIDPKGLQIALRRINSRYALPILITENGLGEFDKLVDGEVNDDYRI
FT                   DYLSAHATAIRDAISDGVDMLGYCTWSFTDLLSWLNGYQKRYGFVYVDRDVEDDAPMTR
FT                   IPKKSYYWYKQVIETNGADL"
FT   gene            complement(323285..324097)
FT                   /locus_tag="LM5578_0317"
FT   CDS_pept        complement(323285..324097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0317"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67073"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463803.1"
FT                   /protein_id="ADB67073.1"
FT                   /translation="MYKLIAIDIDGTLLTDDHKVTDEVKEAIRQAKLKGVKVVLCTGRP
FT                   LVGVENYLTELELREEGDYVISFNGAFVQDTFTKEVISHLTLGIDDLKEIYQVSLDSNL
FT                   HMHFFDDKALYTPNREIGKYTIVEAYLTGSQLIYKEIENVPEDFIMSKAMFIEEAPELE
FT                   VGIAKIPESFREKYHLVRSTPFYLEILNRDASKGNAVKELSEKLGIKQSEVICIGDQEN
FT                   DVTMLEFAGLGIAMGNAPERIKQLADYTTASNNDSGVAKAIQKFVLDK"
FT   gene            324233..324736
FT                   /locus_tag="LM5578_0318"
FT   CDS_pept        324233..324736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0318"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67074"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463804.1"
FT                   /protein_id="ADB67074.1"
FT                   /translation="MKRNYHVKFLNEKDVELAEAVCAASEDYYLIEQNKPASKSDALKI
FT                   ITEIPDGKTRFDKFVLAVLDENEKPIGLVDIVSDYPRKGRWFIGLLLLTPDARHNGLGK
FT                   VLHQTIKEWANDGGADSLALGVLAENEKGRGFFEYLGYTKEETKQASYGGKEQEVSIFT
FT                   LAIK"
FT   gene            complement(324773..325435)
FT                   /locus_tag="LM5578_0319"
FT   CDS_pept        complement(324773..325435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0319"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67075"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463805.1"
FT                   /protein_id="ADB67075.1"
FT                   /translation="MAYPFNHKEFVAMMEQYNLKSNSITIPEHTILNDLVTENRDCVYL
FT                   LKSGILAGYIDFDNDKIYSIFTSNFFMGYYTIFDNSSLVLTYQTLTECELIIYKKKDIE
FT                   YSLSLFPENFSFQYTIMRTIAKHGYYKSLLQYRDKKDQLAFVFEMLVKILDIPVEDGVA
FT                   VLPKSISTTVIKNYCTLSKAFFYSQLKELKEAGIISKVKLQWRINMEALLEKNNSIN"
FT   gene            complement(325694..326536)
FT                   /locus_tag="LM5578_0320"
FT   CDS_pept        complement(325694..326536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67076"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463806.1"
FT                   /protein_id="ADB67076.1"
FT                   /translation="MKKGILNVLLVFALIAGLSVPSSMQVEAAAPTIKVHFIDVGQGDA
FT                   IYIKAPSGEDILIDAGNKGKGKTVVNYLKKLKVKDIEIMIASHSDADNIGGLPEVMNNI
FT                   KVKNLYAPKSTNTTAAYKNFVNTAKKKKLTIKTAKAGVKLPVKGVNAQFVGPVKTYGKT
FT                   DRNNWSAVLHVAYKKNTFLFTGDAQTKAENDMIKAKKTLRADVLKVSTQGSKAATSKAF
FT                   VNVVKPKYAIISVGKNGYGHPTSQTVNTLKKAKAKVYRTDRNKTVVVTGNGSSYSIGK"
FT   gene            complement(326553..327374)
FT                   /locus_tag="LM5578_0321"
FT   CDS_pept        complement(326553..327374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0321"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67077"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463807.1"
FT                   /protein_id="ADB67077.1"
FT                   /translation="MTKKYLICSDIDGTLLRQDQTVSKKTRDLIQTLEKDGHIFSISTG
FT                   RMYRSAREVGFQVSSSGHVIASNGSYAAIRDEQLLKTTLEEKAIRSTYDIMSDFDLPLF
FT                   FFSTNTLFYTKEPPAFFQNLADKSRLDTGHNSFSLVSINEKGIFDENMHQFLNAIVVAE
FT                   EDASKLTEVRAALNEANGIRVLSSHHNNLEILPANSDKKTAVEALGKHYNIPRERIITF
FT                   GDGENDIGMLQYAGTGVAMANASDNVKAAADHLTDTNEADGVYKFLKEFIS"
FT   gene            327488..328462
FT                   /locus_tag="LM5578_0322"
FT   CDS_pept        327488..328462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0322"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67078"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463808.1"
FT                   /protein_id="ADB67078.1"
FT                   /translation="MMGNLNWAILGPGSIAHEFAEGMRGMNREIYAVGARSLEKGQAFA
FT                   SQYGIENVYDDFDKMLADPAIDVVYIATPHSNHYEFIMKSLHNGKHVLAEKAITVSSKE
FT                   LNEINVLAKEKGLIVKEAMTIFHMPLYKKLREIVESGAIGKLKIIQVAFGSAKEKDPKN
FT                   RFYNMDLAGGALLDIGTYALSFARYFLSETPDEVLTTMKKFETGVDEQSGILLKNNEEE
FT                   LAVVSLSFRAKMPKRGVIACEEGFITVDEYPRASRATVTHTATGKVEEIEVGETSKALE
FT                   YEITAMEESIATGENMTYQLTNDVIAIMSDVRTQWGIKFPFEK"
FT   gene            complement(328501..329601)
FT                   /locus_tag="LM5578_0323"
FT   CDS_pept        complement(328501..329601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0323"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67079"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463809.1"
FT                   /protein_id="ADB67079.1"
FT                   /translation="MAQLSLEHIYKIYDNKVTAVSDFNLEIDDKEFIVFVGPSGCGKST
FT                   TLRMIAGLEEISKGELSIDGKVMNNVAPKDRDIAMVFQNYALYPHMTVYDNMAFGLKLR
FT                   KMPKDDIKKRVEHAANILGLTEYLKRKPSALSGGQRQRVALGRAIVRDAKVFLMDEPLS
FT                   NLDAKLRVQMRAEITKLHQQLDTTMIYVTHDQTEAMTMATRIVIMKDGVIQQVGSPKQV
FT                   YDHPVNMFVAGFIGSPAMNFFKGRLEGSNFIGDDFTIEVPEGKLKLLKDRGFDGKNIVF
FT                   GIRPEDIHDEPIVIEANPGYTFKATTIVAELTGAEFMLHSRVGTHEFVARVDARSEHQP
FT                   NEVLTLAFEMSKSHFFDPETEDNLTD"
FT   gene            329892..332042
FT                   /locus_tag="LM5578_0324"
FT   CDS_pept        329892..332042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0324"
FT                   /product="anaerobic ribonucleoside triphosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67080"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463810.1"
FT                   /protein_id="ADB67080.1"
FT                   /translation="MYVEQLNEQMVIKRDGRKASFDLIKIRNAVEASMKAINLEDETFL
FT                   EEILLEVVSELPNKADMTIDEIQHCVENTLMKSTYPDVARAYIEYRHDRDHERENITDM
FT                   HKSVEKLLQKDKTVVNENANKDATVFNTQRDLTAGAVAKSYALKYMLPKHVSNAHLKGE
FT                   IHFHDLDYSPYHAMTNCCLIDIEGMLSKGFTIGNANVESPKSIQTATAQIAQIIANVAS
FT                   SQYGGCSVDRIDEVLSVYARLNFEKHKKDATEWVVPEKQEGYAAEKTRKDIYDAMQSLE
FT                   YEINTLYTSNGQTPFVTLGFGLGEDWFAREIQKAILKVRIGGVGKDKHTAIFPKLVFSI
FT                   RRGTNLNAEDPNYDIKQLALECSSKRMYPDVLNYDSLVRLTGDFKVPMGCRSFLPAWEN
FT                   ENGEHVNAGRNNLGVVTLNIPRIAIQSGGDKERFWEIFHERMKTVKDALLFRLNRVRQA
FT                   RPENAPILYKYGAFGKRLQDGENVDQLFNKERSTISIGYIGLYEAATVFYGGEWEGDKE
FT                   AKNFTLDIVKELKAYADNWKDEYGYWFSVYSTPSESLTDRFNRLDKEKYGVIKDITDKD
FT                   YYQNSFHYDVRKKITPFEKIDFEKDYPEFCSGGFIHYCEYPKMVHNTKALEAVWDYSYD
FT                   RVAYLGTNTPIDKCYECDFEGEFVPTEEGFKCPSCGNTDPEKADVVKRTCGYLGNPMKR
FT                   PMVHGRHVEISNRVKHMENLGE"
FT   gene            332035..332586
FT                   /locus_tag="LM5578_0325"
FT   CDS_pept        332035..332586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0325"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67081"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463811.1"
FT                   /protein_id="ADB67081.1"
FT                   /translation="MNNPKPCEWKSNELSRGYIADYKAFNFVDGEGVRCSLYVSGCPFH
FT                   CEGCYNKAAQSFKYGKPYTKELEDDILKDIGHESVQGLTLLGGEPFLNTATCLSVVKRI
FT                   RATYGETKDIWSWTGYTWDEMMQETADKLELLSLIDVLVDGRFEQKLFDPNLAFRGSSN
FT                   QRIIDVQKSLAAGEVVLYEL"
FT   gene            complement(332844..333515)
FT                   /locus_tag="LM5578_0326"
FT   CDS_pept        complement(332844..333515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0326"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67082"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463812.1"
FT                   /protein_id="ADB67082.1"
FT                   /translation="MDALFNYKEFVRLSHEGNIKYEKLKVPKHTDLVDTASQRNNHVYL
FT                   IVEGFVSISMNPQSNSIYTVLGKGSFVNYYSLFQGNVDDFLFTTISPCTIYKYSFKDLE
FT                   YFLSMFPENFGFQFFIMRDLARHAFFKSLFAETSSSDKLELSFSNMGKLHGTLYEKDSV
FT                   ILPKEMRTSTIAAYSNLSKSSFYKQLTLLKEHGKIWKKGKEWIVKDKGLYNYVKVRQFD
FT                   D"
FT   gene            complement(333677..334456)
FT                   /locus_tag="LM5578_0327"
FT   CDS_pept        complement(333677..334456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0327"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67083"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463813.1"
FT                   /protein_id="ADB67083.1"
FT                   /translation="MWKLALCQTDVVFKYPDANYARIEKAIVEAAKNGADIAVLPEMWN
FT                   TGYALNELAGVADLNGERTKEFLATLSEKHQIAIIGGSVSISEGNKFSNTMYAFDKYGG
FT                   LLSSYKKVHLFQLMNEHLYLEAGNDKNLFRLDGVSCAGFICYDIRFPEWIRKHTSEGSE
FT                   VIFVSAQWPAERVTQWEQLLIARAIENQAFVVAVNRVGDDPNNHFNGHSLVIDPLGNIV
FT                   AHGGEDEGNIYAEIDLNLVAETRGIIPVFTDRRPELY"
FT   gene            complement(334428..334520)
FT                   /locus_tag="LM5578_0328"
FT   CDS_pept        complement(334428..334520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0328"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67084"
FT                   /inference="ab initio prediction:Glimmer:3.02"
FT                   /protein_id="ADB67084.1"
FT                   /translation="MFQYGLATKLVLFLKEKGSEEHVEVGIMSN"
FT   gene            complement(334546..335208)
FT                   /locus_tag="LM5578_0329"
FT   CDS_pept        complement(334546..335208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0329"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67085"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463814.1"
FT                   /protein_id="ADB67085.1"
FT                   /translation="MSLFFEEWGPILWQGFLETLTMTGITLVISLAIGLPLGVFLTLTR
FT                   KGGQSENLVAYSILNWVINILRSLPFIILLFLMIPVTRFVVGTTIGIQGVIMPLVVFTA
FT                   PYIARLMESALLEVDRGVVEAYQAMGISTPKIIWSVVIREARSGIVLGLTIATIGLIGA
FT                   TAMAGLVGAGGLGTIAYQYGFQRFEPTVMYTTIIILIIMVQALQSFGNFLSRRLKKD"
FT   gene            complement(335205..336221)
FT                   /locus_tag="LM5578_0330"
FT   CDS_pept        complement(335205..336221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67086"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463815.1"
FT                   /protein_id="ADB67086.1"
FT                   /translation="MIELHQVSKSFNVNGKTVEAVKNVSITVEKGEIFGVVGYSGAGKS
FT                   TLVRCINLLERPDAGQVVIDGKNLSTLSSKELRVARRKIGMIFQGYNLLKTATVYDNIA
FT                   KPLKLEGVPKNEIETRVNKYLSIVGLEDKRNNYPSQLSGGQKQRVAIARALAHEPEILL
FT                   SDEATSALDPETTEAILQLLLKINAELGITIFLITHELDVIQRICDRVAVMENGHLVEQ
FT                   GTVLDIFTKAKHATTKRFVGSEASFDIPQDLLEKYVATGKLVSLHFIGDEADEPALALV
FT                   SRKFDVLPSILAGGIDHLKNGTLGKLLVHLKGDEVEYSKAISYLKESGVVVEEVELL"
FT   gene            complement(336236..337057)
FT                   /locus_tag="LM5578_0331"
FT   CDS_pept        complement(336236..337057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0331"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67087"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463816.1"
FT                   /protein_id="ADB67087.1"
FT                   /translation="MKKLTKGLGILLASSLVLGLAACGGGSDDKALSTEKITIGTTAGP
FT                   HQQIAEEVQKLAKKDGLEIKIKTFDDYNTPNTALNDGDLDANNYQTIPFLEQQKKDKGY
FT                   KLDVAFKTVAFPMGIYSNDIKDLKNLKKGDKIAVPNDPSNEYRGLKLFEDAGVIKLKDG
FT                   VEEKATKKDIAENPLDLEIVELEASQIPAQLDEVAAAAINTNFAMGAGLSINKDAIYHE
FT                   PTKDNPYPNVFVVRSANKDDEVVKTLEKYYHSDEVKAFIEKEFNGSVVPAF"
FT   gene            337439..338620
FT                   /locus_tag="LM5578_0332"
FT   CDS_pept        337439..338620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0332"
FT                   /product="transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67088"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463817.1"
FT                   /protein_id="ADB67088.1"
FT                   /translation="MKISKRLQNLPDQFFSSLVEKVGKKVAEGHDVINLGQGNPDQPTP
FT                   KHIVEAMKTASEKPLNHKYSLFRGKQELKQAAADFYAREYNVTIDPNTEVAILFGTKTG
FT                   LVELPMCLMDPGDTMLLPDPGYPDYLSGVVLGEVQFEKMPLIAENDFLPDFTKIPEDIA
FT                   EKTELMYLNYPNNPTGAVATADFFEETVAFAKNHNIVVAHDFAYGGIGFDGKKPISFLE
FT                   TNGAKEVGIELYTLSKTYNMAGWRVGFAVGNSEVIEAINLIQDHMYVSLFPGIQDAAIE
FT                   ALTGDQACVRELTARYENRRDAFISACREIGWEAVAPAGSFFAWMPVPEDFTSSEFADY
FT                   LLEEVSVAVADGSGFGEFGEGYVRIGLLMDEERLEEAVTRVSKLHLFDKVTQQ"
FT   gene            338833..339546
FT                   /locus_tag="LM5578_0333"
FT   CDS_pept        338833..339546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0333"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67089"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463818.1"
FT                   /protein_id="ADB67089.1"
FT                   /translation="MAEKKILVVDDEKPIADIVKFNLNKEGFDVYCAYDGDEALELVEE
FT                   VQPDLILLDIMLPGRDGIEVCREVRKKYDMPIIMVTAKDSEIDKVIGLELGADDYVTKP
FT                   FSNRELIARVKANLRRHSQVSSSTAEEEENSELEIGSLIIHPDAYVASKRGETIELTHR
FT                   EFELLHYLAKHMGQVMTREHLLQTVWGYDYFGDVRTVDVTVRRLREKIEDNPSHPAWLV
FT                   TRRGVGYYLRNPEQE"
FT   gene            339731..341563
FT                   /locus_tag="LM5578_0334"
FT   CDS_pept        339731..341563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0334"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67090"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463819.1"
FT                   /protein_id="ADB67090.1"
FT                   /translation="MHKMRFFQSVQFKLVIMYLLLIIVAMQVIGAYFVRELEGQLEKNF
FT                   QDSITNSITLLDYNAREEIIKNSDNSVKLQNDIRELLVDYSRASSNLIEVRIVDDKGKI
FT                   LGTSNLNNQGIVGQKSNDPLVKRTLSLGTTSEDKIYKDESNKNNRVWVNVSSIKNKGQV
FT                   IGAIYLVADIESVYKQVDDITNIFITGTLIAMIITAVLGILLSRTITKPIVEMKRQAYA
FT                   MARGNYSRKVKVYGVDEIGELADSFNTLTKRVQEAQAMTEGERRKLSSVLAYMTDGVIA
FT                   TDRRGKVILINTPAEKMLRVKHESANGRSIIDVLDIGDTYQFEDLMEVDGSLTMDRSTL
FT                   DKPYVLRANFSVIQRETGFNNGVIAVLHDITDQEKVDQERRDFVSNVSHELRTPLTSMH
FT                   SYLEALSDGAWEDKEIAPRFLEVTQNETERMIRLVNDLLKLSRMDGGREQLEKSFVNFT
FT                   DFFNHIIDRFEMMKKETIMFKRHIPREPVIIEIDEDKVMQVLDNIISNANKYSPDGGRI
FT                   SFYLKKFEDEIEVSIADEGLGVPDEDLANVFDRFFRVDKARSREMGGTGLGLAIAREVI
FT                   EAHGGRIWAERNKNKGTIIKFTLPYSDLPEDDWE"
FT   gene            341560..342882
FT                   /locus_tag="LM5578_0335"
FT   CDS_pept        341560..342882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0335"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67091"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463820.1"
FT                   /protein_id="ADB67091.1"
FT                   /translation="MMKKTGFRSFILTILVVLSIVLSYFIWKGQPDYEAINVKEVEKTT
FT                   IDKTMTTSQVFKPYKLAVNANENNYQSLDADLLNELMAQGKAFSFSEVVLASKKSSEDY
FT                   EKLIHKNGTIEIIFPNNIPFSIFAQIFQVEGEGLESAFFNRIVFDINKTDTGLHSVYFT
FT                   NDDQENIYQSSLQNKDIDKIEKIVKKNESKLTQNDKLISNKRNLFLSSEKTKLNRKKYI
FT                   IDSLEINLFTSALFQDSGTVKSEGNTYTDGSSVIEMDTDNKVLEYVNPSQERTNPEDLS
FT                   SVKRAGLIQDSFNFVNDHAGWTGDGAYYFTGYAAESATTNFSLFIDNLQVYNENGMADI
FT                   SVTEGLEAVYKYMRPFFRLDTDVPGEKKEVTLPSSYSVYSALAQNPNVKAEEIEDIVPG
FT                   YHMTRSESSGMNRLVTLEPTWLYKYHDKWFIFQPDAEKAGE"
FT   gene            342885..343724
FT                   /locus_tag="LM5578_0336"
FT   CDS_pept        342885..343724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0336"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67092"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463821.1"
FT                   /protein_id="ADB67092.1"
FT                   /translation="MDWRKTQMIFIVTLLILNVFLAVIFFNKQLSDDPDTLGNETLEER
FT                   LKADNISHPDLSTKPTSGSIFTTERAAFTTKDVSDLTGQAITLKDNNKQIYSVLQTPVK
FT                   AGKKGSNPEFQKFMESDVYRGESYQFWNYDKDARTLTFNQLINNNMVLFDEAGQITFYL
FT                   DQDDRVISYEQTWMSKQDDLKDKTNLMSATDALEAVYQHGELKQDSDVVSATFGYYTTV
FT                   QLPSGNVYFPVWCFEVKHSGETNYVLVNAKDEQVINQSENKSTTEPGAELSSRQKAK"
FT   gene            343844..344674
FT                   /locus_tag="LM5578_0337"
FT   CDS_pept        343844..344674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0337"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67093"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463822.1"
FT                   /protein_id="ADB67093.1"
FT                   /translation="MFANKILTEKDTDQIRFSILASGSSGNATLVETGDQKILIDCGLS
FT                   GKKMEGLFAQVGRDMNDLDAILITHEHSDHIKGLGVLARKYKLPIYANAKTWKAMDNMI
FT                   GEVSSDQKFQFDMETVKNFGSMQVESFGVSHDAIEPMFYIFHKGNKKFVMITDTGYVSD
FT                   RMKGHIAGADAYLFESNHDVEMLRMGRYPWNVKRRILGDEGHVSNEDAAIAMSEVITDQ
FT                   TKRIYLGHLSKDNNMKELARMSVTQTLMAEGIDVGGKLEIFDTDPDNATSIFTI"
FT   gene            344772..346274
FT                   /locus_tag="LM5578_0338"
FT   CDS_pept        344772..346274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0338"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67094"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463823.1"
FT                   /protein_id="ADB67094.1"
FT                   /translation="MDEKEKNLNENSENESTPKREVEDTLHTPESAQPVQETPIVEGVT
FT                   PEGEKFAGATEDAAEASSTNAFFEEASNKESEPARPAPGPRRAGTTGGGAVPPNRVNNG
FT                   GSGNGNGEPPKRGKHFIGYFLTALIGVIIGGLIIFFVAWDNGDNADTTSNSNNKATKVE
FT                   KVSVDTTSDVTKAVDKVQDAVVSVLNYQSSSSLDGTTTSEQEASSGSGVIYKKANGKAY
FT                   IVTNNHVVADANKLEVTFTNGKKSEAKLLGTDEWNDLAVLEIDDKNVTTVAAFGDSDSL
FT                   KLGEPAIAIGSPLGTEFSGSVTQGIISGLNRAVPVDTNGDGTEDWEADVIQTDAAINPG
FT                   NSGGALINIEGQVIGINSMKISMENVEGISFAIPSNTVEPIIEQLETKGEVERPSLGVS
FT                   LRDVDTIPETQQKNILKLPDSVDYGAMVQQVVSGSAADKAGLKQYDVIVELNGQKVTNS
FT                   MTLRKILYGNDVKIGDKVKVKYYRDGKEKSTDIKLEAAKTTT"
FT   gene            346949..347428
FT                   /locus_tag="LM5578_0339"
FT   CDS_pept        346949..347428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0339"
FT                   /product="SPOUT methyltransferase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67095"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463824.1"
FT                   /protein_id="ADB67095.1"
FT                   /translation="MNIQIVTVGKLKEKYLVQGIAEYLKRLSAYAKVTIVEVPDEKAPE
FT                   VLSDAEMKQVKDKEGARILAKIPDDAHVIALAIDGEMKSSEEFAADLDKLATYGKSKVT
FT                   FVIGGSLGLSEAVLKRSNERISFGRLTLPHQLMRLVLVEQVYRAFRIVRGEPYHK"
FT   gene            complement(347460..348323)
FT                   /locus_tag="LM5578_0340"
FT   CDS_pept        complement(347460..348323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67096"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463825.1"
FT                   /protein_id="ADB67096.1"
FT                   /translation="MDIENMKAFNKVAELKSISAAANELHHLQSNMSNKIKNIEKQFQT
FT                   QLFFRHSNGVELTKEGEKIYQQFKKMILLWEETIDIINNEEETISIGITQSSLPMEFNT
FT                   IIKEFYQQFPNKKLSIVSGSTSELIPKIANRELTIAYVAELEKENLFQDSQIISQTLSW
FT                   DKLVFAGNTAGKSVQKILAEERLYVFSKQCYSYRALATLINDFNIPNVSISEINIPETL
FT                   VEICNNELGIGIIPESIALNYHFLNYETLPTEYAALRKTLIYHADHTISNGEKWLIEKS
FT                   KPAFKS"
FT   gene            348442..349179
FT                   /locus_tag="LM5578_0341"
FT   CDS_pept        348442..349179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0341"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67097"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463826.1"
FT                   /protein_id="ADB67097.1"
FT                   /translation="MNTTIQQLVKHVSVREFKNERLSDETKQHLLTAARSASSSHFVQS
FT                   FSILEITDEKLRKELAEITNSASYVNQTGTFYVFVGDLYRQSKLLLENNRTLDGLRNME
FT                   SLLVSVIDATIAAQNMVIAAESLDLGICYIGGIRNDIGKVAELLNLPPFTIPVFGLTVG
FT                   VPEYKNQVKPRLLLENQVGENQYPHEQFTDLKAYEELTKDYYALREKNQHQTSWGDKNV
FT                   EFFEEIRRPEIASFLKKQGFTLD"
FT   gene            349390..350028
FT                   /locus_tag="LM5578_0342"
FT   CDS_pept        349390..350028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0342"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67098"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463827.1"
FT                   /protein_id="ADB67098.1"
FT                   /translation="MKFLKKYGFYFLLLGVLSDFLTPYILGIFYPELNQMTRVMSVFGD
FT                   VASPVRGAFLVWSVVSGVFFVLALPAIYQSVVKTSRTLAILLASAIGLYGIGDCIFTGL
FT                   FSIDTEQASWTFSTWVHNIGSGLGYAGFLIFPLFLVILYRKTGDKTRSNVYLVLLIVSL
FT                   LSAGVYGLARIPAVNDLPVLNKIGFCQRISFFFNYLPIVVFGIDRIRKP"
FT   gene            complement(350033..351904)
FT                   /locus_tag="LM5578_0343"
FT   CDS_pept        complement(350033..351904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0343"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67099"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463828.1"
FT                   /protein_id="ADB67099.1"
FT                   /translation="MTISERQRSLLEKLNDSQKTVTAKALSEMLGVSSKTVRNDIMQIN
FT                   QSFSSTIIASKAGKGYFLTPNEQLSQMNLTKNNENLHFELLRHIIEQDHTNFYDLADQF
FT                   FISESTLARIIKELNIVIAEKDESLCIIRKNNELLTEGGEEEKRRIFNLFLNQEIENHQ
FT                   LSLDKYADYFDYCNLKQLSELIIAYHKKHEFFMNDFSTISFILHIAVLIERISMGSYIE
FT                   RTALLEQDKTSLEMAAHLAETLEKELQINIPTQELSYIARLYSGKLTTTSTIDAQVFGS
FT                   VVTRLLEAVDQNFHIDFSADEKIATYLVAHISALYKRANHKQYLTNPLTEELKNKFPFI
FT                   YNVSVYASAFIQKELAITFPDDEIAYIALHFLSASETINHGKKRKILLVTPYGAGSQRL
FT                   IHNQLKKIPDFSIDLLVSQSIFDIKQFTLDKEIHLILTAEPLNLTTDIPVYHYDLLLTE
FT                   SDLQKIKHILETKQKTESISRKFFKKELFFPKQNFKSKEETITFLCEQLTAFDYCAPDY
FT                   VAKVFEREQLSSTCYGNYYAIPHAIQRSAKKNAVAVCSLDKPIDWGGNRVKLVLLLTMK
FT                   EERDNSFEELFGQLVTILNERSFVKKLAKQEDFQQFIELCEQKTLDS"
FT   gene            complement(352003..353316)
FT                   /locus_tag="LM5578_0344"
FT   CDS_pept        complement(352003..353316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0344"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67100"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463829.1"
FT                   /protein_id="ADB67100.1"
FT                   /translation="MRFNTISEKMDQYISPLANKLSQQRHLKATRDAFMSMLPITLFGS
FT                   IPIILKAAPVTDDTKNGFLLAWANFAEKYDLILNWISGITLGAMSLYICVGITYYLCKH
FT                   YHEDFLRPLMFSIAGFFMLVLNPIKMGWDGKEVDISFLDGRGILLSIFVAIVTVEGYHW
FT                   MRKKNVGRITMPDSVPASLSETFAALVPGIILMTFFSIIFIIFNLLDTTAIQFLYEKMA
FT                   PSFKAADSLPFTILSIFLVHLFWFFGVHDAALAGILGPIRDGNLSINAAEKMAGQDLTN
FT                   IFTTPFWTYFVIIGGSGSVLALAFLMMRSKSKQLSTVGKVGFLPSIFGISEPLIFGTPL
FT                   MLNPIFFFPFIFTSVFNGVITYLCMYFGIVGKTFAVFSWQMPAPIGAFLSTMDWRAIVL
FT                   VFILIFLNGLMYYPFLKVYEKNLVALEKEAEEENIAAN"
FT   gene            complement(353321..353611)
FT                   /locus_tag="LM5578_0345"
FT   CDS_pept        complement(353321..353611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0345"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67101"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463830.1"
FT                   /protein_id="ADB67101.1"
FT                   /translation="MKNIMLVCNAGMSTGMLAKKIEAASGNTLNVTAYSESEYTDYLDG
FT                   VDLVLIGPQIRFLMPQIKQAVSVPVHAISPVKYGIMDGKGVYEDIQKLIGG"
FT   gene            complement(353628..355019)
FT                   /locus_tag="LM5578_0346"
FT   CDS_pept        complement(353628..355019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0346"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67102"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463831.1"
FT                   /protein_id="ADB67102.1"
FT                   /translation="MNNNFLWGGATASYQCEGAWDVDGKAESMWDYYLHEAGLENGDVA
FT                   SDHYHRYEEDIRMMKEGGQNSYRFSLSWPRIIKNRQGDINLKGIEFYQNLLDTCKKYDI
FT                   EPFVTLYHWDLPQYWEETGGWLDHDVCAAFEHYAKVCYDHFGDKITNWTTFNEPKWFVA
FT                   NGYKIGNYPPGYQDTQKTMIAAYNVMYASALGVKAFKKGGYPGQIGIVHSYTPVNGVDE
FT                   SIETKIAMRYADNYCNNWILDTAALGEFPVDLIAELAKSHDISFMKTDELQTIKQNTVD
FT                   FIGLNYYSRTLVKPYTGGETQLQFNHSGKKGESKVLIKNWFEQVKDPANETTEWDTEIY
FT                   PKGLQDGLIEAYERYQLPLYVTENGIGVREDVSVPQVDDAYRIAFMNDHINAIFNAIDA
FT                   GCDVRGYYAWSPFDLYSWKNGVEKRYGLVAVDFENNQIRKPKASYYWFKEMIESQGKLI
FT                   KRREF"
FT   gene            complement(355012..355353)
FT                   /locus_tag="LM5578_0347"
FT   CDS_pept        complement(355012..355353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0347"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67103"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463832.1"
FT                   /protein_id="ADB67103.1"
FT                   /translation="MTDSNELTTELDSMAIILHAGNAKSCAFEALKEVKLQNIEAFTQK
FT                   ITEAKDEIKLAHRAHAELLRKLSSENRMREVDLLLVHAEGHLSSTDIAVEMIRELGEIY
FT                   QWKWSLSNE"
FT   gene            355517..355804
FT                   /locus_tag="LM5578_0348"
FT   CDS_pept        355517..355804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0348"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67104"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463833.1"
FT                   /protein_id="ADB67104.1"
FT                   /translation="MMKKTVHGWEIISNLDVRVYQDEAGGVAILVDRDNFGDQVPVLLN
FT                   FGDDGVDIKAHSHLTKSVRVSLDKKVRIEWHDEYFEERTQAMECIEVERD"
FT   gene            355840..356394
FT                   /locus_tag="LM5578_0349"
FT   CDS_pept        355840..356394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0349"
FT                   /product="putative secreted, lysin rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67105"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463834.1"
FT                   /protein_id="ADB67105.1"
FT                   /translation="MSKKLVSIIFLGICLLLVGCGKEVVDSKYTGKWKLESSGIGMSDG
FT                   SNYKETDAAGKVSLDLDIDAEGNVKELYIDDAVAITNSYKLKKKGDDEYQYDGTLISKK
FT                   VYSYETESDKENVETMLKFLKSKDNVKITKNEQKGDEYHIDVKADEKDFVFSLEMQSGK
FT                   LIFKKVDTKEKVLIKETYKKN"
FT   gene            356600..357865
FT                   /locus_tag="LM5578_0350"
FT   CDS_pept        356600..357865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67106"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463835.1"
FT                   /protein_id="ADB67106.1"
FT                   /translation="MNLVALLKYMQENYGEQRTNYPMAGNEVAKKFKQGVKTAFETTLL
FT                   GEDYEISASIGTGGWANVPWIAVHDKEISTSVQEGVNLVYLFTNDYQGVYLSLNQGYTY
FT                   VNKNYKNTKLTLGKIARFWQGNLSTLKSENGFTIDPINLGRKESRYTNLVKGYESCNIY
FT                   SKYYDIKDLEETDNDLLSQDLLQMLTVFKELKGHLMLDDKKGIEATIDFIINNGTFNEL
FT                   SEKAKSEKIVEIEKKRKLVLGKEETHSRNSVVKEEKVPYITKRDYAKEAIRNTEKGLQG
FT                   EYLVINYEKERLIKNSITKPYADKINHVAESGDGHGYDIISYDINPDAPNEVIEIYIEV
FT                   KTTTGNRDAPFYLSDNELNVARIKGELYKIYRVYDYNTVPKLKIIDNLFDETLEIKPIN
FT                   YIVKGVNQNDKHTKNQLPKNTL"
FT   gene            357822..358910
FT                   /locus_tag="LM5578_0351"
FT   CDS_pept        357822..358910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0351"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67107"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463836.1"
FT                   /protein_id="ADB67107.1"
FT                   /translation="MTNTLKTSYQKTPYKLGGNGPRNVGVLTEALQNIDDNLESDIYGN
FT                   GAVIEDFETKIAKILGKQSAVFFPSGTMAQQIALRIWADRKENRCVAYHPLSHLEIHEQ
FT                   DGLKELQQITPILLGTSNRLLTIDDIKSLREPVSSVLIELPQREIGGQLPAFEELEEIS
FT                   EYCHEQGISLHLDGARLWEITPFYQKSAEEICALFDSVYVSFYKGIGGIAGAILAGNDD
FT                   FVQEAKIWKRRYGGDLISLYPYILSADYYFEKRIGKMAEYFEAAKGLAERFNSCSGVKT
FT                   VPEVPVSNIFHVYFEKSADEVGAILTKIQDETGVGISGYLQEKSADVCAFEVSVGDAFA
FT                   EIPVEILDGVFKQLEADLPCQN"
FT   gene            358898..359683
FT                   /locus_tag="LM5578_0352"
FT   CDS_pept        358898..359683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0352"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67108"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463844.1"
FT                   /protein_id="ADB67108.1"
FT                   /translation="MPKLIIDADDFGLSKAINHGIIESYKTGITTSTLLMPNLETAEHA
FT                   ITLAKDHPDLFIGQHTNFLLGKPCADPAEIPSLVDENGEFHRSKYYRANPELKFQYEDV
FT                   RTETIAQMERFKALTGHYPEHIDCHSIGDETVDQAFFDIAHEFGIHTTLKYSGDKKWPD
FT                   QEGYLPITKLLESGALPYTNGGVSVENFLNDDFGLLKLAPNEIAEMHFDVGFLDQFVLD
FT                   NSSYTLMRCRELATICDVRVRDWLLENGFELITFGDLQR"
FT   gene            359906..360580
FT                   /locus_tag="LM5578_0353"
FT   CDS_pept        359906..360580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0353"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67109"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463845.1"
FT                   /protein_id="ADB67109.1"
FT                   /translation="MFVHGFQEEVGDLWQETLLHPFVRSLADGTLEKEAFYYYLLQDDY
FT                   YLSHFEKVIEKSIAQAGTAELATEMREVQVRLQQSELLMREQFYPRVGLTERDFSERKP
FT                   APTAYHYTSHLYRMADFGSFGVTIAALLPCYALYADIGKMYEGARSSEPFYQELLDSYV
FT                   DENYQKVVLQQKRLVEQAASMADARELALMKQAFQISVEMEWAFFDMAYKKQNWRGSVN
FT                   YV"
FT   gene            360573..361382
FT                   /locus_tag="LM5578_0354"
FT   CDS_pept        360573..361382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0354"
FT                   /product="hydroxyethylthiazole kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67110"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463846.1"
FT                   /protein_id="ADB67110.1"
FT                   /translation="MFDFMTLEKVQERGPLVHNITNIVVANDSANGLLAIGASPIMASA
FT                   KEEMDELAKMADVLVINIGTLDGELVTAMKIAGRAANVAGTPVVLDPVGVGATSYRRKV
FT                   VQELLAEIQFTAIRGNAGELAAIAGEAWEAKGVDAGVGSADVLTIAEKVANEWSTVVII
FT                   SGEVDVISDGTRFAKVANGSALLPRITGSGCLLSAVCGSFIAVQDDAFRASVEACASYA
FT                   VASEYAELELERNLPGSFRPQFLDALASWSVEKTRAKAKIQESGERK"
FT   gene            361379..362182
FT                   /locus_tag="LM5578_0355"
FT   CDS_pept        361379..362182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0355"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67111"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463847.1"
FT                   /protein_id="ADB67111.1"
FT                   /translation="MIFPQVLTIAGSDSGGGAGIQADIKTFQERKTFGMSVITAITAQN
FT                   TLGVKAVHKIPVEMIREQCDAIAEDFQVSAVKTGMLADAEIIREVARNIRLHNFPSIVI
FT                   DPVMIAKGGTALLENEATQVLKDELLPLGTIITPNIPEAEEILGEKITTKAEIEQAAKK
FT                   IFDLGVKAVVIKGGHSEMSEAADFYYDGETTKWLTSERFDTPHTHGTGCTFSACIAAEL
FT                   AKGNSLLDSVVVAKEFITSAIKYPLGIGHGHGPTNHFAYRLEDGK"
FT   gene            362179..362823
FT                   /locus_tag="LM5578_0356"
FT   CDS_pept        362179..362823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0356"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67112"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463848.1"
FT                   /protein_id="ADB67112.1"
FT                   /translation="MRAELAVYFIAGTQDIVRGTLPSVLEEALKAGITCFQYREKGAGS
FT                   LQTASERKEMALECQKLCAKYQVPFIINDDVALALEIGADGIHVGQTDEAIRQVIASCS
FT                   GKMKIGLSVHSVSEAKEAERLGAVDYIGVGPIFPTISKADAEPVSGTAILEEIRRAGIT
FT                   IPIVGIGGINETNSAEVLTAGADGVSVISAITQSDDCHSVIKQLKNPGSPS"
FT   gene            complement(362849..364264)
FT                   /locus_tag="LM5578_0357"
FT   CDS_pept        complement(362849..364264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0357"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67113"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463849.1"
FT                   /protein_id="ADB67113.1"
FT                   /translation="MHTNTGFPADFLWGGAAAANQFEGAYNVDGKGLSVQDVTPKGGFG
FT                   HITDGPTPDNLKLEGIDFYHRYKDDVKLFAEMGFKVFRTSIAWSRIFPNGDETEPNEAG
FT                   LQFYDDLFDELLAHNIEPLITLSHYETPLHLSKTYDGWVNRKMIDFYENYVRTVFNRYK
FT                   GKVKYWLTFNEINSILHAPFMSGGISTSPDKLSQKDLYQAVHHELVASALATKIGHEIM
FT                   PEAQIGCMVLAMPTYPLTSHPDDIIAVMEAERKNYFFSDVHVRGTYPGYMKRYFRENNI
FT                   ELDVTEEDLEILKNTVDFISFSYYMSTTETADESKRKAGAGNILGGVQNPYLEASEWGW
FT                   QIDPQGLRVVLNEFWDRYQKPLFIVENGLGAIDQLEKDENGNYTVNDDYRINYLSAHLS
FT                   QVKEAIKDGVDLMGYTSWGCIDLVSASTAEMKKRYGFIYVDRNNDGTGTLNRYKKKSFD
FT                   WYKNVIATNGEDL"
FT   gene            364539..365198
FT                   /locus_tag="LM5578_0358"
FT   CDS_pept        364539..365198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0358"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67114"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463851.1"
FT                   /protein_id="ADB67114.1"
FT                   /translation="MGSAFSAILSPAVGILISPFPIVGLILILLSNKARINSIFYTVGW
FT                   IVGNIAIFFIGLFLMSSAVSSSGDQSTLVKVVLIVLGALLILLGAHDFTKRPKNGEKAA
FT                   TPKWFEKMSNIKPGGAMIFAFVLSAVNPKNMLLSLTAGVSVGALNLSGGQETTATIIFG
FT                   IIACCSIYVPTIAFLLAGSKLNNVLDSTRKWLIQNNSVIMAVLFLFIGLSVISKAF"
FT   gene            365382..365774
FT                   /locus_tag="LM5578_0359"
FT   CDS_pept        365382..365774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0359"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67115"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463852.1"
FT                   /protein_id="ADB67115.1"
FT                   /translation="MFDKLMGKAAIVTESSYGIERFLDEDEQIIQIFKFIRDEVIITSK
FT                   GIFNIDAQGITGKKVEYKFFPKKALKYVSIETAGTLDRDFDLKIGVDGNTVVTQNTSFS
FT                   APISLKVHKNDTEMGFALYKMIKGML"
FT   gene            complement(365939..366592)
FT                   /locus_tag="LM5578_0360"
FT   CDS_pept        complement(365939..366592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67116"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463853.1"
FT                   /protein_id="ADB67116.1"
FT                   /translation="MFSVTTFNIRFDDTSERKKSWELRKTLTKSLLDKYQWDFMGVEEP
FT                   LLPQMRDMKEMQDWDYFGVGRDDGFEKGEFTAVFYNSTRFTLLQEGHFWLSETPDVPSI
FT                   HSTAMFPRICVWGKFADSDGKQFYIFNTHLDHISEEARLFASQLLLKKAATIAENSPVI
FT                   ILGDFNTEPDTPTYNFITKKYQDAQLISQKHAKGPIGSFHDFRPLRPINELGKN"
FT   gene            366747..367229
FT                   /locus_tag="LM5578_0361"
FT   CDS_pept        366747..367229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0361"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67117"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463854.1"
FT                   /protein_id="ADB67117.1"
FT                   /translation="MLRKGRWLLILLLLIVLVALSACEDSGNGDVSGVPAKREKQHFPP
FT                   NDTKKGWIELLATDGISSQGDLPCVYEEAESVEKLEIHMKELSTASLTYIYIDGYIVQM
FT                   EQGGDELSFQIQLSKTELRKGIHELAVVQYQENNPETKKVEFLKRAKYEVKQIKND"
FT   gene            367490..368392
FT                   /locus_tag="LM5578_0362"
FT   CDS_pept        367490..368392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0362"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67118"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463855.1"
FT                   /protein_id="ADB67118.1"
FT                   /translation="MGSYGELIREIRLSKGLTQKEVYTGIISRSYAIGFEKGKHEITLS
FT                   LFEEILKRIMVPLDEFFFIYRDFSSTEDDSFWIDFVELSGKNDVVGMQVLLDKITLERT
FT                   EQTEVRKAILHTRIQTINHYLRTNVFDESNISDEYKKIIHDYLWKMQTWTLEEVRIFAN
FT                   SVAFFEEEVQIHFYQIMLKAYEKYRYYDRGRMLFCHLFANLIDELIIHNKINYANLVLE
FT                   KLKEASETNGSFNSAFYRIVANYYQGAIWMKEGEVEKGYRQAKRAIQTWKELHYEAIAD
FT                   LYSVVLKQFLEKENIQVED"
FT   gene            368556..369428
FT                   /locus_tag="LM5578_0363"
FT   CDS_pept        368556..369428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0363"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67119"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463856.1"
FT                   /protein_id="ADB67119.1"
FT                   /translation="MISYGELIRQIRQSKKISQKEVYTGVISKSYAIEFEKGTHAISSL
FT                   LLEKIVAKLMVSMEEFFLMYHQEELPEKEDFWEAYARTCKTDEASAWESLYQKISLEKG
FT                   KVNQVKSAAIKLELDHIKGKQVADKKAVQILENYLIEAVFWTLQDIFLFTRMMHYLPLK
FT                   SRVPFYYKLLNTLDRYRHFERGRSILQSALASIMDDFIEKNEIEYMELMIKSLEKISED
FT                   CDGTYSKILCMYYRGIVRWGEGEEREGGEEIEQAVAILRALGYENKAIEYETMYREFAR
FT                   KNNDIKMME"
FT   gene            369735..373676
FT                   /locus_tag="LM5578_0364"
FT   CDS_pept        369735..373676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0364"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67120"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463857.1"
FT                   /protein_id="ADB67120.1"
FT                   /translation="MNNNEPFIKEIETETGKTRANITQTDLEAITALRVTGASDIPANI
FT                   DMLTHLTLLKAVQGTISSVPNSVGNLKELKILNLNTNHLSTFPTIVYQLPKLEELQLND
FT                   GTIEEIPATITNMASHLKFLTVNNNRLVKVPTIIFSTNWSNSSTGELDLFTTGNQIVTD
FT                   IPANYVSNFNNGQNMLEFYDGQFQKQDQLTTTPGYTIDVPVGTDFNQLTPDKTKLALTS
FT                   GRTLLAQHEFEYYDDGSSSLIHNGVAAAPGQATIFIKSKFSTQSNKFARTQVTVNIAAL
FT                   NGGPITVKHEDTKGQELAPPVILNGKDGDPYTTTQKTFPGYTLVATPANQNGTFTLNPA
FT                   TVNYVYSANDYKLTSTFKDAQGQELKAPVVDTKDYHIQDNYTTTAATIPGYSLVSTPAN
FT                   QNGTFGAGNVTVNYVYKKDDYTLTSTYKDTNGQELKAPVVDATTYHYQDTYTTTAAVFP
FT                   GYTLVATPTNATGTFGSSNITVHYVYQANGYQLTSTFKDQQGKTIAPDDVDAKTYHVND
FT                   PYTTTAKTIAGYTLVTTPTNNQGNFGTSDITVDYVYKAEDYTLTSTYKDAQGKELKPPV
FT                   VDSKKYHIQDNYSTSAATIPGYTLVATPANETGTFHTSDVTVNYVYKLTDLKLTSTYKD
FT                   AQGTELKPPVVDSKTYHIQDNYATTAAVIPGYTLVATPANQSGTFGSTDIQVNYVYQAV
FT                   AYKLTSTYKDQQGNDLALPKVDSKTYHIQDGYTTSDIAIPGYTLVAAPTNQTGTFGASD
FT                   VTVNYVYKANDYTLTSTYKDAQGKELKTPVIDSQKYHINDTYTTTGATIPGYTLVAAPA
FT                   NQTGTFGAANVTVNYVYQADDYTLTSTYKDANGKELKAPVVDSKTYHTKDNYSTSAATI
FT                   PGYTLVAAPANQTGTFNTSNVTVNYVYKANEYTLTSTFKNVQGTELKPSIVKKGFIIQD
FT                   GYASSGVTIPGYTLVATPSNKKGTFGASNVTVNYVYKANGYALITTYKDTQGNDLKPLA
FT                   IDTKTYNINDPYTATALNIPGYTLTTTPANEKGVFGASDETVNYVYKANDYTLTTTYKD
FT                   ANGKELQAPKVDAKTYHIQDTYKTTAAVIPGYTLVATPKNDQGTFGANNVTVNYVYQTN
FT                   DYTLTSTFKDTQGNELKAAEVDAQKYHIHDTYTTKAAVIPGYTLEKTPTNETGTFNASD
FT                   IQVNYVYKANDYQLTSTFKDQQGNEIALPTVDAKTYHIHDAYTTKARLIPGYSLVAAPK
FT                   NQIGAFGTSDVTVNYVYKKDAIIKPITQAKPTILTIKTPASKVIKTKVVKQTLPKTGDD
FT                   DAGLLNLLRLIGLVLILGVFLAVGSKKLR"
FT   gene            373814..374494
FT                   /locus_tag="LM5578_0365"
FT   CDS_pept        373814..374494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0365"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67121"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463858.1"
FT                   /protein_id="ADB67121.1"
FT                   /translation="MLEKKYQIHLQNHYDATSRQVQKKEIKVLKKRKNLLIGEVFPYQI
FT                   CLESTMEYSRFMLWFEKEVQKIVKELWNQHFIIKLTLSQLHFRETILFLEHLKDFSKRI
FT                   TIEFIGEDTPEIKKHFSVQEQEAFFIGKLRMLKKWKFIISKHIEGCSVEQTLAFTPCLH
FT                   EIKYTMSQQARMEENIIDLHMFIDFWEYWATHKKLKFVVEVKEEDFITKSLMHKKVHVQ
FT                   FENA"
FT   gene            complement(374678..376579)
FT                   /locus_tag="LM5578_0366"
FT   CDS_pept        complement(374678..376579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0366"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67122"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463861.1"
FT                   /protein_id="ADB67122.1"
FT                   /translation="MKLSKILTIIVLSATVTSSLPIPMVKAESTTANEMKTENQLLKTD
FT                   LKETPKEKTPNNNLKNQLVQAGTKTYNDYFPDDNLAKEVAETMNKNADESVTVEELAKV
FT                   TKLDARSQGIEDSTGIEYLTGLEVLNLEDNQLKSIDVSKNLNLKELTCSNNPLANLDVS
FT                   KNLALEELTCENNELTQLDVSQNTALEYLYCPRNQLTKLDVSKNSALRYLACDVNQLTN
FT                   LDVSKNPALTNLGCTKNQLTDLDVSQNPNLSTLVCSDNQLTNLDVSQNQSLAYLTCDNN
FT                   KLKNIDIDQNLALIELSCENNQLTNLDTTQNLALEILYCDDNQLTDLDVRKNVNLLILF
FT                   CNNNQLTNLAVGETIAKVRCNNNQLKDISFLPDYFTDDNDDYQAMDQTLVSPTQTTQNN
FT                   TLVYAVPTDLLDKDGNIVSIIKPESGGIYDAATRTITWENLPDNGEVSYTFENEDYGRF
FT                   SGRVTVPYTGKETISISSDDEISYKEGTTKTEAAFLADIHASVTPATETITSNFADVVD
FT                   FQTPGKYVVTLSVTGSDVTKDVTVYVTAEPSEDNPVAPTPPKDKDNTDVNNEQSPGNDK
FT                   DGTDVNSRKSTDKQPVKVVEKQLPKTGDITSLSLLLAGIVCLSFGILFFIKRKKKTV"
FT   gene            377075..377410
FT                   /locus_tag="LM5578_0367"
FT   CDS_pept        377075..377410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0367"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67123"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463862.1"
FT                   /protein_id="ADB67123.1"
FT                   /translation="MIYYICALYTFISALVSFGFSLDALLKSRKVNGDALINAKYAVSR
FT                   SLSLLIVALGLFIFKSDAFLVALSLVMIGAQLFDGIIGIKISTFKTVGPLLTAVGNVIM
FT                   LILFLTI"
FT   gene            377839..383175
FT                   /gene="inlI"
FT                   /locus_tag="LM5578_0368"
FT   CDS_pept        377839..383175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="inlI"
FT                   /locus_tag="LM5578_0368"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67124"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463863.1"
FT                   /protein_id="ADB67124.1"
FT                   /translation="MKKKFSIVIISVLLLGYLAPFDTLLVGADETTVSEDTAVKTAEAD
FT                   SATEGIESETSSDDETAEEPKEAKEAEASKETTEKEEKAKTEEPASNIKTEINTDKSQL
FT                   KQTSLKAAVPAGSTYNSLFPDDNLAKKLAVIITGNAAATGNESVDSAALLAISQLDLSG
FT                   ETGNDPTDISNIEGLQYLENLTSLNLSENNISDLAPLKDLVNLVSLNLSSNRTLVNLSG
FT                   VEDLVNLQELNVSANKALEDISQVASLPVLKEISAQGCNIKTLELKNPAGAVLPELETF
FT                   YLQENDLTNLTSLAKLPKLKNLYIKGNASLKSLETLNGATKLQLIDASNCTDLETLGDI
FT                   SGLSELEMIQLSGCSKLKEITSLKNLPNLVNITADSCAIEDLGTLNNLPKLQTLVLSDN
FT                   ENLTNITAITDLPQLKTLTLDGCGITSIGTLDNLPKLEKLDLKENQITSISEITDLPRL
FT                   SYLDVSVNNLTTIGDLKKLPLLEWLNVSSNRLSDVSTLTNFPSLNYINISNNVIRTVGK
FT                   MTELPSLKEFYAQNNSISDISMIHDMPNLRKVDASNNLITNIGTFDNLPKLQSLDVHSN
FT                   RITSTSVIHDLPSLETFNAQTNLITNIGTMDNLPDLTYVNLSFNRIPSLAPIGDLPNLE
FT                   TLIVSDNNSYLRSLGTMDGVPKLRILDLQNNYLNYTGTEGNLSSLSDLTNLTELNLRNN
FT                   VYIDDISGLSTLSRLIYLNLDSNKIEDISALSNLTNLQELTLENNKIENISALSDLENL
FT                   NKLVVSKNKIIDISPVANMVNRGAIVTASNQTYTLPTVLSYQSSFTIDNPVIWYDGTLL
FT                   APSSIGNSGNYKDGKITWTNMTATSSSTLFNFNRLKDGLTFSGTVTQPYKSAAKVTADA
FT                   EQTYTIGDTISEEQFLKDVNAKSSDGAPVTSDFATVVDLNTFGEYEVTLTSEKDGIQGD
FT                   SCKVIVKVLHGAPVISADQTISYDKHATITEKQFLEDIHASTDLDTAITTNFSTAVNLN
FT                   KGGDYTVALNSENEDGVKAETVYVTVTVNKDPAPIISAKTEITYDKFSKKTEAAFLDDI
FT                   DADTNDGSIVTSNFATAVNLDKAGDYTVTLNSINSDGVAGTPTAIIVHVEKEKIATIST
FT                   NTAQQYEKYAKINETQFLKDVHASINASPTTAVLESDFETVVKLDVPGTYTVTITATNE
FT                   DGGVSAPKEVSVIVRKIPAPEITADKEITYPKFDEVSEAEFLNDIHATISDKNVAITSN
FT                   FSTDVNLNKAGDYTVTLNATNEDGVKATPVEVIVHVQQGERPVITADATISYDKFANIT
FT                   EAKFLEDIHATSSDGQSSTVITSNFQTATNFKTAMNYTVTLNAVNEDGISAEPVAVTVT
FT                   INKEPAAALKADAEVSYAKNEAVTESDFFKDVHLEGTEAPSTAKATSNFDSVVDRSKTG
FT                   DYTVTINATNEDGAVSTPIEVIVHIEAESAPVITANAEVKYNKHEQTDERRFLYDSEAK
FT                   IDEANVEIKTDFAEKVDINKVGTYTVTLTATNEDGQAANPVEVSVIVSDAAAEKVNVKY
FT                   VDENGSEISAAETLTGNLDETFSIDAKSIAGYKCDATLSGVFSTVEQTVVFHYKAIKPG
FT                   VVTIKYEDTNGKAVAEDKQITGEVGDDFEAEAQTVSGYSCRAIASGKITEEPQTITFTY
FT                   STATPSKKSGEITVQYVDESGKKLADSKKVTGNIDDSYSVEAKAIEGYSVVGDDSAKGV
FT                   FTEKSQTVTFKYKKNTQVSKDDPKVKGKTNQPSSTDTKLKVDNNSLPATGDTENMILAV
FT                   LIGFNMLIVASIFLFRKPKTNQ"
FT   gene            383396..383923
FT                   /locus_tag="LM5578_0369"
FT   CDS_pept        383396..383923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0369"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67125"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463864.1"
FT                   /protein_id="ADB67125.1"
FT                   /translation="MMNKMIIYSSQYGTSKQYATELSQKKAIPMYSVESIPESIVEADE
FT                   IIYVGSIYMGKVLGFDKFSKKYKTLSSKLIVISAGMYDPTRKENTDNIELTVKENLQKT
FT                   NFLLKDIFCLKGKLDTQQLRMKHKILVNALYKSAKRKKESDLNDNERDIVRAYEGDSQI
FT                   DLNKLDGVLDRL"
FT   gene            384171..384566
FT                   /locus_tag="LM5578_0370"
FT   CDS_pept        384171..384566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67126"
FT                   /protein_id="ADB67126.1"
FT                   /translation="MRYEAKIISENPNIEEELKIKIKDIELLCFVEEYKCSVEVGQEYI
FT                   VELEMVVFDDLDIEKSTLQAKEITQLADSFAYFIRGVFHHSSKKIYSGIEVDLADEDIS
FT                   DFWYLENQFVALNVDRFNIDVIEKVNK"
FT   gene            384702..384821
FT                   /locus_tag="LM5578_0371"
FT   CDS_pept        384702..384821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0371"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67127"
FT                   /inference="ab initio prediction:Glimmer:3.02"
FT                   /protein_id="ADB67127.1"
FT                   /translation="MDKVLDVGLFTTSGLLEGYEHLVGCYISGMILKQMNWGL"
FT   gene            384926..385156
FT                   /locus_tag="LM5578_0372"
FT   CDS_pept        384926..385156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0372"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67128"
FT                   /protein_id="ADB67128.1"
FT                   /translation="MKQCPVCENYTIEANYDICEVCYWEYDVVAQEYPDEIIEANNISL
FT                   KQAKINYAKFCAVEEKYITLVRKPRQDELPK"
FT   gene            385235..385462
FT                   /locus_tag="LM5578_0373"
FT   CDS_pept        385235..385462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0373"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67129"
FT                   /protein_id="ADB67129.1"
FT                   /translation="MEYEQMADSLAYGEEYNFYYKNEEYWLSKNQEGHYLTKVSDGETQ
FT                   EFKTSEDLLGTARINGKLIIEIWEDIQSQF"
FT   gene            385631..386011
FT                   /locus_tag="LM5578_0374"
FT   CDS_pept        385631..386011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0374"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67130"
FT                   /protein_id="ADB67130.1"
FT                   /translation="MKKLTTEQSFEYYLSSLCMLGMHTINLSDEEIEYEIFEELAIDYP
FT                   AALSPYTRELLVDNDIIDRELSLLSKQLQTKLFELDGGILWNVKALRTTPEWKEVLRLS
FT                   DEIKGLIHQQWTDEELDYLLGK"
FT   gene            386240..386458
FT                   /locus_tag="LM5578_0375"
FT   CDS_pept        386240..386458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0375"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67131"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463870.1"
FT                   /protein_id="ADB67131.1"
FT                   /translation="MQPPKKEAEKMEERFEKVYTQGKLNIMEIWVDKETGVQYVYHLVG
FT                   YAGGMSPLLDVDGKPLLADLSKLNDAE"
FT   gene            complement(386556..386888)
FT                   /locus_tag="LM5578_0376"
FT   CDS_pept        complement(386556..386888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0376"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67132"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463871.1"
FT                   /protein_id="ADB67132.1"
FT                   /translation="MKKNTPEALIDLFEELKNLFETDTSLNNQNSSQLQEILTTAIIRV
FT                   KKASQTVELEARSVYQNIHTLCFVEKIHLNPEEANVLKEIEKIALSKGFWGGMNTLNVT
FT                   NQFPSN"
FT   gene            complement(386954..388951)
FT                   /locus_tag="LM5578_0377"
FT   CDS_pept        complement(386954..388951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0377"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67133"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463872.1"
FT                   /protein_id="ADB67133.1"
FT                   /translation="MSRIDEQMVNSIRVLSMDMIEKANSGHPGLPMGAAPMAFSLWKNH
FT                   LKFNPEHPTWFNRDRFVLSAGHGSAMLYSLLHLFGYDLPMSELKNFRQTGSKTPGHPEF
FT                   GHTVGVDATTGPLGQGFAMGVGMAMAEAHLGAKFNQPEFPVVDHNTYVLCGDGCLMEGI
FT                   SYEAASLAGHLKLGKLVVLYDSNDISLDGDLNESFSEDIELRFRAAGWQTLRVDDGNDL
FT                   DALDAAIHLAKTEKSRPTLIEVKTVIGYGSPGKAGKSAAHGSPLGEKELKLAKEAYDWQ
FT                   MPPFELPKTVENQKEFYHSKGRASESSWLRTFNAYKQKYPALAESLQHLMDDNLTADWD
FT                   AELPVFDENADKPVATREVSGIILQELEKKLPNLFGGAADLASSNKTHLKASERFAPGN
FT                   YAAKNISFGVREFAMGAAVNGMTLHGGVQAFGATFFVFSDYLRSAIRSAALMGIPSTFI
FT                   MTHDSIAVGEDGPTHEPIEHLASFRAMPGLHVIRPADGNETVEAYRFAFTQKEQPTMLV
FT                   LSRQNLPILPNSAAKAKTGLAKGAYILADSPLDKLDIILLASGSEVHLMTAVRDNLAKK
FT                   GFGARVVSMPSFDLFDKQSPEYKESILPKAVKKRFAAEMGASYGWHKYLGDTGEILAID
FT                   SFGMSGPGDELAERFGFTVENLTELALKQL"
FT   gene            complement(388953..389609)
FT                   /locus_tag="LM5578_0378"
FT   CDS_pept        complement(388953..389609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0378"
FT                   /product="putative translaldolase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67134"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463873.1"
FT                   /protein_id="ADB67134.1"
FT                   /translation="MKFFLDTASVSEIKRISELGLVDGVTTNPTIIAKEGRPFEEVIKE
FT                   ICSIVDGPVSAEVIGLEADKMVEEARILAKWAPNVVVKIPMTEEGLKAVHTLTAEGIKT
FT                   NVTLIFTVSQGLMAAKAGATYISPFLGRLDDIGTDGMILIKNLKKVLDNYGLKAEIISA
FT                   SIRHIGHLEEAAEAGAHIATIPGSLFPKLWSHPLTDKGIEGFLKDWEAFSQKEGN"
FT   gene            complement(389656..390420)
FT                   /locus_tag="LM5578_0379"
FT   CDS_pept        complement(389656..390420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0379"
FT                   /product="short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67135"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463874.1"
FT                   /protein_id="ADB67135.1"
FT                   /translation="MTFKGFDKDFNITDKVAVVTGAASGIGKAMAELFSEKGAYVVLLD
FT                   IKEDVKDVAAKINPSRTLALQVDITKKENIEKVVAEIKKVYPKIDILANSAGVALLEKA
FT                   EDLPEEYWDKTMELNLKGSFLMAQIIGREMIATGGGKIVNMASQASVIALDKHVAYCAS
FT                   KAAIVSMTQVLAMEWAPYNINVNAISPTVILTELGKKAWAGQVGEDMKKLIPAGRFGYP
FT                   EEVAACALFLVSDAASLITGENLIIDGGYTIK"
FT   gene            complement(390444..390890)
FT                   /locus_tag="LM5578_0380"
FT   CDS_pept        complement(390444..390890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67136"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463875.1"
FT                   /protein_id="ADB67136.1"
FT                   /translation="MKIAIGCDEMGYELKQTLITRLKEKNIEFTDFGSFEDEKVLYPSI
FT                   AEKVALEVKNNDYDRGILICGTGIGMAITANKIHGIRAAQIHDSYSAERARKSNDAHIM
FT                   TMGALVIGPSLAVSLLDTWLDSDFSGGRSQAKVDLMEEIDQKNR"
FT   gene            complement(390897..391661)
FT                   /locus_tag="LM5578_0381"
FT   CDS_pept        complement(390897..391661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0381"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67137"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463876.1"
FT                   /protein_id="ADB67137.1"
FT                   /translation="MRKPLVGINMKNYINTRAQTSEWLEATIPLLGNFSDVDTFIFPSM
FT                   GTLETTANLLAGTSFGFGPQNMAPEKSGPLTGEFSVESIIDLSANYVEIGHAERKNLFH
FT                   EKTSEIAKKIKLALDEKITPVVCVGEGIRANDTNELKNALKKQIEALFDTIQVTQFKNV
FT                   VLAYEPEWAIGKANSADTDYIESAHQALREIIRELGGDETLVRIIYGGSVSKENAAEIV
FT                   RQKNVDGLFVGRFGHKPQNFADIVSIVSKTKG"
FT   gene            complement(391665..392315)
FT                   /locus_tag="LM5578_0382"
FT   CDS_pept        complement(391665..392315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0382"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67138"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463877.1"
FT                   /protein_id="ADB67138.1"
FT                   /translation="MSELVMDSAFFGHVLQDMGALIEKERDYLTGLDSDIGDGDHGINL
FT                   SIGFREVNKQLDELLAVSPDIATLLKKSGMILLGKVGGASGPLYGSFFMKCGADIPGKT
FT                   EVNFDELCGMIINGAAAVQHRGKAELGDKTMMDAFLPGVEVLQNRDANAEPIETFSTFV
FT                   DAMHAGAQSTIPLIAKKGRALRLGERAIGHLDPGSESSWMLMNIILENLKKAV"
FT   gene            complement(392337..393332)
FT                   /locus_tag="LM5578_0383"
FT   CDS_pept        complement(392337..393332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0383"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67139"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463878.1"
FT                   /protein_id="ADB67139.1"
FT                   /translation="MRRLVNDGYEAVEEMLAGYVAAQGKYVDFAENDKRVIVSKQMSEE
FT                   PRVRIIVGGGSGHEPLFLGYVGKDFADAAVVGNINTSPSPEPCYNAVKAVDSGKGCLYM
FT                   YGNYAGDVMNFDMGAEMAADDGIRVETVLVTDDIYSAEKVEDRRGVAGDLIVFKAAASA
FT                   AAKGLDLDAVKQAAEKANANTFSMGVALSSSTLPVTGKAIFEMKEGEMEVGMGIHGEPG
FT                   IKRTSIEPADKVVDQIMGYLIEEMKLTSDEEVHVLINGLGGLPVMDQYICYRRVDEILK
FT                   EKGVHIHNPLVGNYATSMDMIGMSITLVRLDDELKDLLDTPCDTPYFKVD"
FT   gene            complement(393354..393695)
FT                   /locus_tag="LM5578_0384"
FT   CDS_pept        complement(393354..393695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0384"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67140"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463879.1"
FT                   /protein_id="ADB67140.1"
FT                   /translation="MSIGIALATIAGGFLFPFAIRMMWGKMVDEWGAIGGWMAAAFIVG
FT                   TVWTINHGIPKSMIYQSGTVWVDMAVAAGIGVFTASLLTGGKFSKSIVNLAAAVVGGVV
FT                   GGFLLSLFL"
FT   gene            complement(393711..394142)
FT                   /locus_tag="LM5578_0385"
FT   CDS_pept        complement(393711..394142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0385"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67141"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463880.1"
FT                   /protein_id="ADB67141.1"
FT                   /translation="MKFFRGMIGFCIAGMIVMSVWTPLAENYGIFGGYLAAFIIIGPMW
FT                   FMNHYVGLIENDEDAAFVDMAVGIGICGIMRDVFMQGGGELVSSLPTIGLVAIGAVLAG
FT                   IVAAAIEKDMAKKQEAKQEKTEPGMNIKEEERLNENQLV"
FT   gene            complement(394227..394604)
FT                   /locus_tag="LM5578_0386"
FT   CDS_pept        complement(394227..394604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0386"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67142"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463881.1"
FT                   /protein_id="ADB67142.1"
FT                   /translation="MISIVLVSHSQKITEGLQEMIVEMVGDTVHIISSGGTGDGRLGTN
FT                   AIMIADNIATCTNSEHIYIFCDIGSAILSAETALELLDTDLLEKTTIIDAPLVEGAFTA
FT                   AVQSLVNPSKEAILQELTNVH"
FT   gene            394787..395551
FT                   /locus_tag="LM5578_0387"
FT   CDS_pept        394787..395551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0387"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67143"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463882.1"
FT                   /protein_id="ADB67143.1"
FT                   /translation="MFPFERQNKIIHLLDQNSKITVPELSRILDVSISTIRNDLSSLEE
FT                   SGMIKKVHGGAVLLKSEEKFTNFNDRIIRNIEEKEAIAKEAATLVKNNQTIILDASSTA
FT                   LALAKELHGFSRLTVITSGLYTAIELKDNPNISVILTGGIVTTNSFTLEGILGANLIEN
FT                   IHADLCFMSAKGFTMEEGLTDFNIYETELKRLLAKRTNKLIALLDHTKMGVISTASITS
FT                   AENIDLLITDNKINKALYKKFQDAGLPVKVAE"
FT   gene            395617..396030
FT                   /locus_tag="LM5578_0388"
FT   CDS_pept        395617..396030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0388"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67144"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463883.1"
FT                   /protein_id="ADB67144.1"
FT                   /translation="MDYVITTELPSAEEFVQLRVDTGLSFRAIEASRKALLKSVYFVGL
FT                   RSKENGKLIGMGRLVGDGIMFIVSDIAVFPSFQGKGFGKVIMTHIKDYIEANLDKTACV
FT                   TLLADVPAHGLYKQFGFRESAPASIGMIYQVGN"
FT   gene            complement(396076..397602)
FT                   /locus_tag="LM5578_0389"
FT   CDS_pept        complement(396076..397602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0389"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67145"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463884.1"
FT                   /protein_id="ADB67145.1"
FT                   /translation="MTIKKYEPLNLYTNFKKSAERYPEMPIHFDEELVTFPELGLHTTY
FT                   KKCEEAIIQKAAHLHKFGVRKEEKVIVYKSAKFDSYILAVAISYIGAVPIMVSPHLPAS
FT                   TIDIFVNRLDQPWLLFDSETSDKSHQLNNLPDSRLINAEQLFKAPLDGYTCEQEELPKD
FT                   MIAYMTHTSGTTGVPKLIAHSANSMGWRTKYQRRILNFIKPRGLVAFHISPVHSRFNIG
FT                   VSSLMSLGFPLLPIANPSKANVEKVLREYKPYVLETHPNHFVQWASLAREKPDVFQSIK
FT                   FYHSTFDAINKETMAVFLRTSEYKKPLFLQIYGQSECGPMILRGHTLQSIETLNARDMG
FT                   IGVPGLTEVRIVDQDGNPVPAGVSGNIQMLSKGRALTYYKEEARFEENVYGPWWDSGDY
FT                   GMKDEKGRLFLQDRQVDLVETIDSTLAIEDKLLDTLTFLDEVVIIRGENGSPQPIIAVH
FT                   NDGEMNWDAWWKAVSDLPHMNEPMVMKYDEIPRTATMKVQRLQMERELKK"
FT   gene            397839..399359
FT                   /locus_tag="LM5578_0390"
FT   CDS_pept        397839..399359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0390"
FT                   /product="fumarate reductase flavoprotein subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67146"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463885.1"
FT                   /protein_id="ADB67146.1"
FT                   /translation="MKKRLATTIIMLLSLALIIAGCGNNDTSKSDTAKTKEKEKTEVTS
FT                   GASKTSYTDPSELKDKYDIVIVGAGGAGMSAALEAKAKGMNPVILEKMPLAGGNTMKAS
FT                   SGMNASETKFQKEEGINDSNDKFYEETLKGGHGTNDKAMLRFFVDNSASAIDWLDSMDI
FT                   KLNNLTITGGMSEKRTHRPEDGSAVGKYLVDGLLKNVQEQKIPVFVNADVKEITQKDGK
FT                   VTGVKVKLNNKDEKTISSDAVVVTTGGYGANKDMIEKERPDLKGYVTTNQEGSTGDGIK
FT                   MIEKLGGTTVDMDQIQVHPTVQQDKSYLIGEAVRGEGAILVSQEGKRFGNELDTRDNVT
FT                   ASINKLPEKSAYLVFDSGVKDRVKAIAQYEEMGFVEEGKTIDELAGKINVPKEELTKTL
FT                   DTWNASVKNKKDEAFGRTTAMDNDLSKAPYYAIKIGPGIHYTMGGVKINTNTEVLDKDG
FT                   KPITGLFAAGEVTGGLHGENRIGGNSVAEIIIFGRQAGDKSAEFVKAQ"
FT   gene            399533..400549
FT                   /locus_tag="LM5578_0391"
FT   CDS_pept        399533..400549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0391"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67147"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463886.1"
FT                   /protein_id="ADB67147.1"
FT                   /translation="MLKMGFIGNGKSTNRYHLPFILERDNIEVKTIYNRNPKTATWDKI
FT                   EGVHYTTDLDELLKDPEIQLITISTTQSSHFDYAKMVLENGKNVLVEKPFMMTYAEAKE
FT                   IFELAKERGLLVQCYQNRRFDSDFLTAQKVIESGKLGELLEVEMHYDYFRPEIPESVHE
FT                   FKFYDSYLYGHGCHTIDQVLSYFGKPDNIHYDVRQLLGEGRMNDYFDLDLYYGVTKVSV
FT                   KSSYFRIKARPSFVLYGKKGMFTKETKDRQEEHLKLFYMPSNPDFGIDLPEHYGTLTYV
FT                   DDAGVWHEEKVISEVGDYGRVYDGLYEAIVNGKPKQVTDEETLLQMEILEKGVEACK"
FT   gene            400748..401194
FT                   /locus_tag="LM5578_0392"
FT   CDS_pept        400748..401194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0392"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67148"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463887.1"
FT                   /protein_id="ADB67148.1"
FT                   /translation="MNISNLINEDRIIFDNRIQTKQLLFEKVAEVLVKEGSITNSKKFI
FT                   RDLYNREEETSTGIEAGFGIPHAKSKYVKEPLIVFVHSGIIIDYFGLDDSPIECSFIIG
FT                   VPKKATDVHLQILSELSRKLMNDEFREKLKNSKNGNEIKTILSN"
FT   gene            401208..402602
FT                   /locus_tag="LM5578_0393"
FT   CDS_pept        401208..402602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0393"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67149"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463888.1"
FT                   /protein_id="ADB67149.1"
FT                   /translation="MKIVGVTACPTGIAHTYMSAEKLTITAEALGYEVKIETQGAKVEN
FT                   VLTKEDIATADYVILAVDKEIDTSRFAGKKIKKVSTSRAIKEADVVIDETVSGKGLISL
FT                   EAKSSDVSSEQPSKASLYNHFMNGVNYMLPFVIAGGILIAISFAFGIDASNPDSDSYNA
FT                   LAAAFSKIGGDTAFGLMVPALAAGIAVSVAGRAGFAPGLVAGTLATVGGSGFLGGMIGG
FT                   ILAGYVAHFFANKVNVTKSLASIYQLIVVPLLGITIVGLAMVFIIDTPIAWVLNALTGW
FT                   LNGLGETSGVVFGLLIGVMMAADMGGPINKSISTFSIGLMSAGVTAPIAACMAAGMVPP
FT                   LGLALATLLFKNKFTKEEKTAGNSCWVLGASYITEGAIPFAVADPLRVIPSLMLGSATA
FT                   AAISMGAGVTSMAPHGGIWVMFIPNVINHLFIYLLAIAAGTVVTAISVGLLKTPLNKRK
FT                   NKEEMI"
FT   gene            402602..403462
FT                   /locus_tag="LM5578_0394"
FT   CDS_pept        402602..403462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0394"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67150"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463889.1"
FT                   /protein_id="ADB67150.1"
FT                   /translation="MLYTMKDLLAVGKEHQFAVPAFNICSFDMLKAIMEEVEANNAPVI
FT                   LEIHPDEIEYLGDNFVATVREYAYRSKVPVVIHMDHGGTIKDVMRAIRNGYTSVMIDAS
FT                   RASYEENVALTTQVVELAHKVGVSVEAELGTIGNNGSAEGGADTIIYTDPDQAEDFVSR
FT                   TGIDTLAVAIGTAHGLYPKDKKPELNMPLLKELNKRLDIPFVLHGGSGNPDKEVRESVQ
FT                   YGVRKVNLSSDLKSVFFEEVRRVLVDNPAMYEPNQVYPSANEKVKDVVRHKLDILNTTG
FT                   QADKY"
FT   gene            403519..404289
FT                   /locus_tag="LM5578_0395"
FT   CDS_pept        403519..404289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0395"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67151"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463890.1"
FT                   /protein_id="ADB67151.1"
FT                   /translation="MLSTAKERQLKIVNRLKVEQFMRIIDLVEFVNYSEATVKRDLVEL
FT                   EKEGLVRRTRGGAMIIDNKKIDLPYLMKMNERSNETSKIRIADIAKSLIRDDMVIFLDS
FT                   SSTSLHLIDVLSKFDGLQIITNGVMTASMLSEFTNARVSILGGSILTKRYTVNGAKAYN
FT                   DALTYNADIAFVSCRGIDYDKGATETHEGEALIKQAFRRQSSSLVLLVTEEKVGHKFMH
FT                   QSLACHDIDYLITDFKLDPDVEEQFKTHQITCLY"
FT   gene            complement(404273..404500)
FT                   /locus_tag="LM5578_0396"
FT   CDS_pept        complement(404273..404500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0396"
FT                   /product="putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67152"
FT                   /protein_id="ADB67152.1"
FT                   /translation="MYKIFSFVSLILSMLCFMGLQVLNVIQKNVILLSLFDSQDFNDIH
FT                   FFGSLLVVPVLFLILAIIFAYLSIKSNTNK"
FT   gene            complement(404629..405348)
FT                   /locus_tag="LM5578_0397"
FT   CDS_pept        complement(404629..405348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0397"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67153"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463891.1"
FT                   /protein_id="ADB67153.1"
FT                   /translation="MSLTGHLKELRTRLLIILLSFFLAFFVGLFVSKPLILFLQKDDLP
FT                   KEVILHVFKVTDAFQIYIEMAFVIGLVLVFPVILYQLWAFVKPGLHASEQRITLRYIPI
FT                   TFLLFLFGVVFSYLITFPFILKFMFQFAAELGVETTIGLATYFQFLLQIVLSFGVLFEL
FT                   PMVIMLLTRLSLITPNGMRHSRKYAYFCLLIIAAFIAPPEILSHLMITVPLIGLYEISI
FT                   VVSGLTVRRMDKEMNNV"
FT   gene            complement(405360..405539)
FT                   /locus_tag="LM5578_0398"
FT   CDS_pept        complement(405360..405539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0398"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67154"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463892.1"
FT                   /protein_id="ADB67154.1"
FT                   /translation="MIGPGSIALIVGAALVIFGPKKLPELGRAAGDTLREFKNATKGMM
FT                   DDSKEETKKEDPRP"
FT   gene            405848..407332
FT                   /locus_tag="LM5578_0399"
FT   CDS_pept        405848..407332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0399"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67155"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463895.1"
FT                   /protein_id="ADB67155.1"
FT                   /translation="MAQKLLGRFALLLGIFAVVLTIGFSDVTAAEKPNIDKPVKALQQT
FT                   ETAVEAADYDKAKDLFQEDKLWWSQNKQTVKEKSYDLAGQIDRQIAEISLGILNNDKQQ
FT                   AMDGITSLHNLLKTYQDGTYTDNEGNTNITLSSYIAKLTATKKLIDEKDWAKAATQIQD
FT                   LKTEWLAVEGDVVSQSQAAYDNTERDLMLLDAYINDPAKQAKTADVLDGMTEELKPFAD
FT                   VTYTWFDAALIPFREGLEALLIIATLLTYTKRTKTRTAKRWIIGGTAAGLVVSLALGMI
FT                   VAFWLSALAFGDNNNLINGWAGLIASIMMLYVSYWLHRNSDITRWNNYMEGKSNQALSN
FT                   GKMISFAFLAFLAILREGLETVVFLIGMVGRMSNFELLMGILAGLGVLLIIAFVMLRYS
FT                   VHIPVKPFFMISSAIVFYLCFKFMGSGIHSLQLAGVIPTSVEDYLPSIPALSIYPSWYS
FT                   FLPQVLLVIFGLIILIKQQIKKRANSKKELAQGGKL"
FT   gene            407329..408489
FT                   /locus_tag="LM5578_0400"
FT   CDS_pept        407329..408489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67156"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463896.1"
FT                   /protein_id="ADB67156.1"
FT                   /translation="MKKLIIVMLTIFTAVLVVGCSGTGTADKAETKKETTKESKQANAV
FT                   KKEVKEMKSNLDDVKKAISDKDKSALQSSAAELHKHWLEFENNVRDLYPLQYTDVEKYE
FT                   TPIFYESKNDNPNFDTLNDNATGLDGALDTLEKAKETKAKTSEVLDKAVDNYSKYVTEQ
FT                   VDEFVAQTEIFTNAVKSGDIEKAKAAYVSPRLNYERIEPIAESFGDLDPKIDARINDVE
FT                   NEADWTGFHVIERALWEKKSLEGMDVYADKLLTDAKALQAEVKNLKLEPKPMVAGAMEL
FT                   LNEAATTKITGEEEAYSHTDLDDLNANVEGSKVVYQAIIPALNAQDKKLADQIDAAFNK
FT                   MEDTLANYKNGDSFVLYTTLTKDQIRDISDQLSHLSELMAQTGKIF"
FT   gene            408507..409772
FT                   /locus_tag="LM5578_0401"
FT   CDS_pept        408507..409772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0401"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67157"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463897.1"
FT                   /protein_id="ADB67157.1"
FT                   /translation="MTDKKSENQTEKTETKENKGMTRREMLKLSAVAGTGIAVGATGLG
FT                   TILNVVDQVDKALTPKEKAETGVPFYASNQAGIITAQQTYCYIASFDIQTESRQILQDL
FT                   FVKWTKFADLTTSGGVLRDVDNDMLPPNDTGEADGLGISNFTVTLGYGPTFFEKGGKDR
FT                   FGVKAKKPKYLEKIPHMAHDSLDEAYSDGDLCIQVCADDQQVAFHGIRNFIRLASGVAV
FT                   VRWIEEGFLSAPKNETPRNLFGFKDGTANVDHDSNKGYKEVVWAENDEPEWMRNGSYLG
FT                   YRKIQMLIEIWDRSSLLDQEDTFGRKKVSGAPYHKKHEYDKVDPSKLPADSHVRLAKDT
FT                   KQQMHRRAYSYTNGIDKSTGTIDAGLLFICFTQNPAKQFLPMLSIMGKMDKLNEYTVPI
FT                   GSAMFACQGGLAPGEVFGEKLL"
FT   gene            409845..410354
FT                   /locus_tag="LM5578_0402"
FT   CDS_pept        409845..410354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0402"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67158"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463898.1"
FT                   /protein_id="ADB67158.1"
FT                   /translation="MEEWDLLNENRELTGKTHIRGEKLAPGELHLVIHLCIFNEKGQLL
FT                   IQKRQKDKEGWPNYWDLSAAGSALKGETSQQAAEREVQEELGIMIDLSGTRAKFSYHFE
FT                   EGFDDYWFITKDVQLSDLTLQKEEVADARFVTKEELEALRSSGEFIPYFFLNQLFNLKN
FT                   ATTIHF"
FT   gene            410451..411170
FT                   /locus_tag="LM5578_0403"
FT   CDS_pept        410451..411170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0403"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67159"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463899.1"
FT                   /protein_id="ADB67159.1"
FT                   /translation="MGRKWANIKEKKASKDKTNSRIYAKFGIEIYVAAKSGDPDPHSNQ
FT                   KLRFVIERAKTYNVPKHIIDRAIEKAKGTGDETYSELRYEGFGPNGSMIIVDALTNNVN
FT                   RTASDVRAAYSKNGGNMGVSGSVAYMFDNTAIFGVEGKDADELLELLMEADIDVRDILD
FT                   EDGQAIIYAEPEDFHKVQEGLKAAGIEEFTVAEIEMIPQNDIQLSGEDLEKFERLIDAL
FT                   EDLEDVQKVYHNVELED"
FT   gene            411207..411545
FT                   /locus_tag="LM5578_0404"
FT   CDS_pept        411207..411545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0404"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67160"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463900.1"
FT                   /protein_id="ADB67160.1"
FT                   /translation="MSKLPNCPECNSEYAYEDRGLLICPECGHEWSAVATEEASEEKVF
FT                   KDANGNVLTDGDSVTVIKDLKVKGASNPIKMGTKVKNIRLVDGDHDIDCKIDGFGPMKL
FT                   KSEFVKKI"
FT   gene            complement(411586..412299)
FT                   /locus_tag="LM5578_0405"
FT   CDS_pept        complement(411586..412299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0405"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67161"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463901.1"
FT                   /protein_id="ADB67161.1"
FT                   /translation="MSGMAKYMEIYIDIRDKINQNKYEINEKLPDGDSLARVYDCSKLT
FT                   VKKALDMLVQEGMVIRRRGAGTFVKSHSTNGGEFALGPMSGLVNTFGKDNIKSKVILFS
FT                   IEKPSKEVAEKLEMQDDYIYRIIRMREVGHKAYSIEHTYMPLAIIPGLEPRHLEDSIYN
FT                   YIRDDLKLKMQSAHVWVRGDKSNQEDSKLLDLEEPTFMMEIEKLAHLEDGRVFEYSITR
FT                   HTYESFVFETVFVQN"
FT   gene            412456..413898
FT                   /locus_tag="LM5578_0406"
FT   CDS_pept        412456..413898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0406"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67162"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463902.1"
FT                   /protein_id="ADB67162.1"
FT                   /translation="MKELLTFPKDFWWGSAWSAEQAEGRGDTGKAKTVWEHWFETEPNR
FT                   FYEGVGSEITTDHFNRYKEDVQWMKKTGQNSFRISISWARMFPDDGVGEVNQKAIAFYR
FT                   DLLTEMNENGVKPFANLYHFDMPVALQDAGGWESREVVDAYVHFADTCFKEFGDLVYHW
FT                   FTFNEPLGPILGGYLEDFHYPNQIDFKRGAQAGFNTILAHALAIKAFKKLNLSSKIGVI
FT                   LNLSPTYPRSQNEYDLEAAEICDAFYTRSFLDPMVKGTFPEKLVDIMREYNQMPEYTEE
FT                   DLTIIKENTAQILGLNYYEPRRVKARLTAINEKSPFLPDWFFEPHNMPGKRMNIYRGWE
FT                   IYERGIYDLCIDIRDNYGNIESFISENGMGVANEERFLNEEGQIQDDYRIQFVKDHLAY
FT                   VHQAIAEGCDIKGYHLWTFIDCWSWINAYKNRYGLVSLDVETGNRTMKKSGEFYKKMSD
FT                   MNGFEYETSKLVGTKREETTNG"
FT   gene            413891..415225
FT                   /locus_tag="LM5578_0407"
FT   CDS_pept        413891..415225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0407"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67163"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463903.1"
FT                   /protein_id="ADB67163.1"
FT                   /translation="MAETKKKSIVNGFINVAQRLGGQIHLRSLRDAFASIMPFMILAGF
FT                   VTLINYVILEPTGFMGKIINPDTLRTWQEIGISIGNGTLSVITLLVTVAISYHLCLNRG
FT                   YKNVIAPILVALSSFIVVTPIAMTFLPEGASKSIEVPNVIPVSYTGASGMFVGIIVGLI
FT                   ATDLFIKLSKNKRMQINLTGNIPPAVIKSFNVLIPIMITVIIFSVMSFAVNQIFSMDFN
FT                   TLVTTIITKPLSYVTTSLPGFLLITSIANLFFGLGIHQAVISGPLLDPFLLQNMQENMV
FT                   AYANHQEIPHIINMAFKDTFAVMGGSGNTIGLLIAIFIFGKRKDYKDISKLSAAPSLFN
FT                   ISEPIIFGLPIVFNPLLIIPFVLAPIFSLTTAYYATAAGWINHVVVQTPWTTPPIISGF
FT                   LATGGDWRASVLQVIIIVVTVFIYLPFLRMDEKVAFATAQKSDAK"
FT   gene            415243..415545
FT                   /locus_tag="LM5578_0408"
FT   CDS_pept        415243..415545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0408"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67164"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463904.1"
FT                   /protein_id="ADB67164.1"
FT                   /translation="MKNILLVCNAGMSTSFLVEKMKAAGAEQGVEANIWAVSDAELHEN
FT                   WEKADVILLGPQVGYLKGNTEKVVGGKIPVEVINMLDYGRVNGAAVLERAIELIG"
FT   gene            415634..415828
FT                   /locus_tag="LM5578_0409"
FT   CDS_pept        415634..415828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0409"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67165"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463905.1"
FT                   /protein_id="ADB67165.1"
FT                   /translation="MKYVKSQMKELVKDSVDLQERLQKLMKEMDLEKTFALKALYHSEV
FT                   ADGGAYQTAYQDLDYKYKD"
FT   gene            complement(415867..416787)
FT                   /locus_tag="LM5578_0410"
FT   CDS_pept        complement(415867..416787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67166"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463906.1"
FT                   /protein_id="ADB67166.1"
FT                   /translation="MKIERLIGIIMLLLQRELVSASEMATMFEVSKRTIFRDIDTLAMA
FT                   NIPIYTIAGTKGGIGIMPTYKVDKKLLTADDLTAIIASLDGMEQLLSSAETKKTLQKMK
FT                   NMLDHSSEPPKSSISLDFSNLSMKNELNAKVESLYLAIKKHQLVELSYIDRTGNQTVRK
FT                   TEPYHLLFRNRSWYLQGYSLERSDFRTFKMSRIVELKTLEETFEVRPFTVKPFGEPPDR
FT                   PMFLMHEVSLIVDKIAREQIIERFDLVEISQQDDAHFLAKVTLPDHEAGYRFLLQLGTH
FT                   VTIQNRDDFYDNFVDYLKEIQGKYI"
FT   gene            416889..417308
FT                   /locus_tag="LM5578_0411"
FT   CDS_pept        416889..417308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0411"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67167"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463907.1"
FT                   /protein_id="ADB67167.1"
FT                   /translation="MAFEIVELKKETFTGNKVEIPEFDPQKGFGPMSEIKEAAYTKFAK
FT                   NEKDYVGINASLDGLQYYIVASTNGENGDTTFDIPEGKYAKFVTSETDRPALDGFIGAS
FT                   YGEVGQSDTVGIAGSFNLEDLREAEFTLYIPVVSK"
FT   gene            417527..417973
FT                   /locus_tag="LM5578_0412"
FT   CDS_pept        417527..417973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0412"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67168"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463908.1"
FT                   /protein_id="ADB67168.1"
FT                   /translation="MRKLDFSYNNANYNAEFLMKILTTLKDITKVEQFTIEIIDAVPND
FT                   QEQFKEEKGLFSKEVFDFNNLVKESHGIKIDFKEITNILKQCRTVWELSMLVVTSENEL
FT                   NDSGKVLCEVELIEGDLFAILYSEDFNIDLFLEKFSTDEITIEG"
FT   gene            417991..418446
FT                   /locus_tag="LM5578_0413"
FT   CDS_pept        417991..418446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0413"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67169"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463909.1"
FT                   /protein_id="ADB67169.1"
FT                   /translation="MFKIIESKIKSQGQLSYFKDSHEFISEPRINSDTTILVGYIYIGF
FT                   DSEYNESTQIWGFHHDFNWKSSKLTPPKFIQGKIILNEDFINPGESKRIGAANSWETIY
FT                   DESSGWLRFGGVNNSVETCYVEFFPNTIMGIDENGDITELWLCPTLK"
FT   gene            418614..419270
FT                   /locus_tag="LM5578_0414"
FT   CDS_pept        418614..419270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0414"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67170"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463910.1"
FT                   /protein_id="ADB67170.1"
FT                   /translation="MNKFKILGEYKDWCEIYKDGTLIHNGSSLGIVSQVESELCLRLNY
FT                   GSNKHFYSVLKKCGDFILAVPKKVEFLKTEYKYEPIIFNKQEFDEFIDYIYVDEKLISS
FT                   IPQINKEDLLNIWFVSNPQHKTYINEMEMQENIINNILFFSDDEYDISCLKNVINKPDL
FT                   SVHPIDSNYEVITIYMDGDAGMYEWKGIVIIDNNAYLKIDKHYYINLMQEFKLLS"
FT   gene            419470..419856
FT                   /locus_tag="LM5578_0415"
FT   CDS_pept        419470..419856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0415"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67171"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463911.1"
FT                   /protein_id="ADB67171.1"
FT                   /translation="MINELQKKIDEINYWDLLVLDIQSKYFGDEVYIYIEKDEEICWKL
FT                   SFTSCYKVSYETDAKWRGDFKVRNTGPKSGYYAQDISLNIYAENEDFIECSFDASIMTM
FT                   NIICKEIIVEEVSVIENSFFWKNY"
FT   gene            complement(419929..420690)
FT                   /locus_tag="LM5578_0416"
FT   CDS_pept        complement(419929..420690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0416"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67172"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463912.1"
FT                   /protein_id="ADB67172.1"
FT                   /translation="MKVQRIQAIENLIHEKGSISLDDLCEQFNVSKNTVRRDIAKLLQK
FT                   NTIQKVYGGVVSVYNNPEEIRPFENRDTENHTEKQLIGKAAADFIEENDLIFIDSGTTT
FT                   SCLAVALPKDKEITIITNSLDVINFASEMDNVKLIVIGSTFKTSTKSFVGVENWGFFEK
FT                   YNITKAFMAATALSTTHGVMNSDILEYEIKRHMMEKATAKFLLVDHTKVDKSALLTYGE
FT                   LAEFDWLVTSKDIAGGCLGYCEDVGVLVRLV"
FT   gene            420886..422352
FT                   /locus_tag="LM5578_0417"
FT   CDS_pept        420886..422352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0417"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67173"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463913.1"
FT                   /protein_id="ADB67173.1"
FT                   /translation="MADVRKLKNYINGEWVESKTDKYEDVINPATGEVLCQVPISTRAE
FT                   LDQAAVIAEQAFEKWSQVAVPRRARVLFSFQQLLIQHKEELARLITLENGKNLSEARGE
FT                   VQRGIENVEFAAGAPTLMMGDSLASIATDVEAANYRYPVGVVGGIAPFNFPMMVPCWMF
FT                   PMAIALGNSFILKPSERTPLLMEKLVELFSEAGLPKGVFNVVYGAHDVVNGILENEIIK
FT                   AVSFVGSKPVGEYVYKTGSANLKRVQALTGAKNHTIVLNDADLEDTVTNVISAAFGSAG
FT                   ERCMACAVVTVEEGIADEFLAALRTVAQNVKIGNGLDDGVFLGPVIREENQKRTIAYIE
FT                   KGIEEGAKLTVDGRETGLSEGHFVGPTILEDVTTDMTIWKDEIFAPVLSVIRVKNLQEA
FT                   VRVANQSEFANGACIFTNNAKAIRYFREKIDAGMLGVNLGVPAPMAFFPFSGWKSSFYG
FT                   TLHANGKDSVDFYTHKKVVTARYSLKGYEE"
FT   gene            422365..423186
FT                   /locus_tag="LM5578_0418"
FT   CDS_pept        422365..423186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0418"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67174"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463914.1"
FT                   /protein_id="ADB67174.1"
FT                   /translation="MGKLLRKPLNERIAPGVTLVQDINQGNSPLSYVGFRLIELEKDAV
FT                   YQETLGGLECCIVALTGKISVSEGDHIFPEIGTRANVFEKIPTDSVFISGGRAFQVKAD
FT                   SEKARVALCYSPADRALPTTLIKASDNSIEQRGKYQNKRLVHNILPDVSEVASSLLVVE
FT                   VYTDGGNFSSYPPHKHDHDNLPAESLLEESYYHEINPKQGFIFQRVYTDDRALDETMAV
FT                   EHQNAVIVPEGYHPVGVPDGYDSYYLNVMAGPKRVWKFHNDPDHEWILERD"
FT   gene            423203..424180
FT                   /locus_tag="LM5578_0419"
FT   CDS_pept        423203..424180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0419"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67175"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463915.1"
FT                   /protein_id="ADB67175.1"
FT                   /translation="MNLKKHSERKFDLITVGRACIDLNAVEYNRPMEETMTFSKYVGGS
FT                   PANIAIGTAKLGLKVGFIGKISDDQHGRFIEKYMRDLAINTDGMVKDTEGRKVGLAFTE
FT                   IKSPDECSILMYRENVADLYLTPEEISEDYIKEARVLLISGTALAKSPSREAVLKAVSL
FT                   ARKNDVVVAFELDYRPYTWKNSEETAVYYSLVAEQADVIIGTRDEFDMMENKVGGKNEA
FT                   TKAHIFQHQAEIVVIKHGVEGSFAYTKAGETFQAQAYKTKVLKTFGAGDSYASAFLYGL
FT                   FNDESIETALKYGSAAASIVVSKHSSSDAMPTADEIKALIAQAE"
FT   gene            424190..426109
FT                   /locus_tag="LM5578_0420"
FT   CDS_pept        424190..426109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67176"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463916.1"
FT                   /protein_id="ADB67176.1"
FT                   /translation="MVTEKTIRLTTAQALVKFLNQQYIEVDGEMAPFVDGIFTVFGHGN
FT                   VVGIGQALEEDPGHLNVYQGKNEQGMAHAAIAYAKQKNRKRIYACSASAGPGSANLITA
FT                   AGTALANNLPVLFLPADTFATRQPDPVLQQLEHESSAAITTNDGFQAVSRYFDRVQRPE
FT                   QLMSALIRAFEVMTNPASAGPATICIAQDTEGEAFDYPVEFFQKRIHYLNRQIPTKREL
FT                   TEAARLIQASKTPVIIVGGGARYSDAREELITLSEQSNIPLVETHAGKSTVEFDFKNNL
FT                   GGTGILGTLAANKAIRDADLVIGIGTRYTDFTTSSKTAFDPATKFININVSRMQTYKLD
FT                   AFQVVGDAKATLAELAPLLKGYQTQFGDKIAAYKTEWLAERTRLQNTKFNREAFTPEIK
FT                   DQFDQATLNEYADSLQTEFTQTEALITINDTVAPDSIVVCSAGSLPGDLQRLWNPAVPN
FT                   TYHLEYGYSCMGYEINGALGAKMAAANNQEVYSIVGDGSFCMSHSELLTSLQYGKKINI
FT                   MLFDNSGFGCINNLQMANGSDSFFCEFRDSDNQIMQVDYAKIAEGYGAKVYRANTKEDL
FT                   ISALEDAKKQTKTTLIDMKVLPKTMSEGYLNWWNVGVSEVSNKASIKQAYESKQANLKN
FT                   ARLY"
FT   gene            426243..426614
FT                   /locus_tag="LM5578_0421"
FT   CDS_pept        426243..426614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0421"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67177"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463917.1"
FT                   /protein_id="ADB67177.1"
FT                   /translation="MEVFAEYLAEIENPDHRARTQEVLTWVAETFPDLKPEIKWNTPMF
FT                   TKNDTFIIGFSIAKQHMSVSPEAAGIERFEAELKEAGYSHTKGIFRITWAKPVDYDLLA
FT                   KVIEFNIQDKANYTSFWRV"
FT   gene            426708..427076
FT                   /locus_tag="LM5578_0422"
FT   CDS_pept        426708..427076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0422"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67178"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463918.1"
FT                   /protein_id="ADB67178.1"
FT                   /translation="MRIFCGIMSIQAGFIGALAEILSPDSKKNNLFMIPEDLAASSGYL
FT                   MSLAMVLAGILIICAYRNDFLIFMALILWLFGLIFGLIFTPSYSGFYFRPIVCLISFLM
FT                   GLFIFTDYTRHQDTGEER"
FT   gene            complement(427100..428215)
FT                   /gene="ltrA"
FT                   /locus_tag="LM5578_0423"
FT   CDS_pept        complement(427100..428215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ltrA"
FT                   /locus_tag="LM5578_0423"
FT                   /product="low temperature requirement protein A"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67179"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463919.1"
FT                   /protein_id="ADB67179.1"
FT                   /translation="MTERKVTWLELFFDLIFVTAVASTTHLLLSVDNHPDKTAAYFGEY
FT                   LLMVTPMFWAWVGQTMFFNRFGEKIKWPELYMLSQMFFLILMTASFDLTFSNTYYTFLI
FT                   GYLGIRFITVIQYFVISKQLTGNAQKVALLLGSVFLLGVLTTATSVFFEGFARYLVMYL
FT                   GIAVDIILPLFLAKTLRKVPVDFPHLAERFGLFVIITFGESIVAITTILVGHTLDLYTI
FT                   CYTLLGFLIICTLWASYFYSFEKIVDHHKVTHGQFLIYGHFFIIVSVMLLAVNLHLLFE
FT                   GHLQRDVLLLLLFSSVAVFFISKQFVFAAHKKAEVSFSFWKDALLLLLLVGLFFVNLYI
FT                   NLPLFVSFVSIWICALVDLGLQFGTSRSVRM"
FT   gene            428301..429011
FT                   /locus_tag="LM5578_0424"
FT   CDS_pept        428301..429011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0424"
FT                   /product="uracil-DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67180"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463920.1"
FT                   /protein_id="ADB67180.1"
FT                   /translation="MEGQNHGTTETGELKMVKTWEEFLKQEAKQPYFIELMEAVKDARA
FT                   KGNVYPSEEDMFSCFRLCPYNQVKVVILGQDPYHGPGQAHGLSFSVQKDVRIPPSLRNI
FT                   YKELKADLDIEPADHGYLAKWAEQGVLLMNTSWSVEEGKAGSHKKLGWATFTDHVLEEL
FT                   NNYDKPLVFILWGNHAIKAASGITNPQHLIIKGVHPSPLAASRGFFGSKPFSKTNAFLE
FT                   EHERKPIDWDLNEQ"
FT   gene            429179..429478
FT                   /locus_tag="LM5578_0425"
FT   CDS_pept        429179..429478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0425"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67181"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463921.1"
FT                   /protein_id="ADB67181.1"
FT                   /translation="MKHNFTEDDFVYGESWGLVHRGVLEDKEIERMKALRDKVVGKKGV
FT                   AQTTLKPIGSVRIDGEVYEARLKTGYLEVGKPIIAVGIDFGYVLVNEDIQEGEK"
FT   gene            429475..430419
FT                   /locus_tag="LM5578_0426"
FT   CDS_pept        429475..430419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0426"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67182"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463922.1"
FT                   /protein_id="ADB67182.1"
FT                   /translation="MTMIGPIIIAVLIIIFLIVFFTLVPVGLWISALSARVPVGLGTLI
FT                   GMRLRRVVPSRVVKPLIKAVKAGLDLEVNQLESHYLAGGDVDNTVDALIAAHRANIELD
FT                   FSRAAAIDLAGRDVLEAVQTSVTPKVIRTPEFTGVAQNGVEVKVITQITVQSNIERIVG
FT                   GAGEDTVIARVGEAVVSTVGETREHTDVLENPNSISKKVQEQGLGDGTAYTILSIDIAE
FT                   MRIGDNIKAKLDIEKANADMEVAQAAASKRKAEAIALEQENRAAVVAAEAEVPRALSRA
FT                   LEEGNLGVMDYYKMENVQSDTAMRESIAHEDEK"
FT   gene            430454..430903
FT                   /locus_tag="LM5578_0427"
FT   CDS_pept        430454..430903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0427"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67183"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463923.1"
FT                   /protein_id="ADB67183.1"
FT                   /translation="MDLSDFLNSGWESVLVVLGIVGVIINFLSKAGKGTEEENKKAPQP
FT                   RPNLRSMHQASRTQTTKKPEKRKVSQGTFTQNKEQDKVIAEQKAAQQKMLREIRRESDV
FT                   AKGKNIIKSTSSHQKKARKLRGRLQEAIITKEILDKPVSLRKNHL"
FT   gene            431047..431730
FT                   /locus_tag="LM5578_0428"
FT   CDS_pept        431047..431730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0428"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67184"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463924.1"
FT                   /protein_id="ADB67184.1"
FT                   /translation="MNIIATRRKIFFAFIALMISFSVLFLPTTNASAATTYKMTTTADV
FT                   NVRAADNTKGKVIGFYKKGTTVTFTAKTKNNWYKTTYKGKVGYVSGKCVTTYKAPVATT
FT                   QSFTALNNEARKHIGKRYKIGATGPSCFDCSGYTQYVYSKGVKKSIPRTAKQQYASAKK
FT                   IKAKELKKGDLIFFNYGKGVAHVGIYVGNGKMLNAQNNGVKYDTITSGYWKKYIAGYGR
FT                   VANLK"
FT   gene            431768..432211
FT                   /locus_tag="LM5578_0429"
FT   CDS_pept        431768..432211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0429"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67185"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463925.1"
FT                   /protein_id="ADB67185.1"
FT                   /translation="MKEELGMQYKIKEMPLEELEPKVVEGLLEHKERLGYNIPKKDTEY
FT                   IGFAALSEVGEMVGGVTAKISYGELHVSLLSVDPSTQGSGVGTELMAQIERYGRANSCH
FT                   HISLTTFSYQAPEFYRKCGFTELGRVKNFPIKGEEKYFFIKYL"
FT   gene            complement(432214..433014)
FT                   /gene="proC"
FT                   /locus_tag="LM5578_0430"
FT   CDS_pept        complement(432214..433014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="LM5578_0430"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67186"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463926.1"
FT                   /protein_id="ADB67186.1"
FT                   /translation="MNRIGFIGAGNMGTAMIRGLAQANLVKREEIIVGGRNLEKLKPLE
FT                   AEFTGLQITTDTEKLVEQADIIILAVKPYTIPEILTSVKEKLTPDKIIISVAAGVTIQD
FT                   LEELTSAKTKIVRVMPNTPALVGEAMSSVSPNTNVTSEELKEVTAIFTSFGEAEVVSEN
FT                   LMDAVIGVSGSSPAYVYMFIEALADGAVLSGMPRDKAYKFAAQAVLGAAKTVLETGEHP
FT                   GKLKDMVTSPGGTTIEAVKSLENDGFRSAVINAVQAAAKKNSSM"
FT   gene            433142..433624
FT                   /locus_tag="LM5578_0431"
FT   CDS_pept        433142..433624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0431"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67187"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463927.1"
FT                   /protein_id="ADB67187.1"
FT                   /translation="MNEAIERRDDDMTIVSFEVEISAPIQEVFALLTTNTGLAKWFNEL
FT                   EVGELGADGYLLFVMTPEEKITMPIRAFEPNQKLAFEWDQDEVAFELNKITANKTRLTF
FT                   TEQLTTITEHSPRDISGWHICLKKLQASAEGKIYDFNKTEFKTLFAKYQKELNIEK"
FT   gene            433794..434252
FT                   /locus_tag="LM5578_0432"
FT   CDS_pept        433794..434252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0432"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67188"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463928.1"
FT                   /protein_id="ADB67188.1"
FT                   /translation="MIVSEEQLFLNQHLSTKEEVLAFIADKAAEIGITMNSAQVERDLW
FT                   AREKEYATAVQQLIAIPHAKTEAILEAKLLFIRLVEPIDWESKEGFKAQAIFAILVPAS
FT                   EASQQHLKILSSVAVNLLEETFQEQILTIKTEHELMDYLKDNLEGELI"
FT   gene            434249..434581
FT                   /locus_tag="LM5578_0433"
FT   CDS_pept        434249..434581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0433"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67189"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463929.1"
FT                   /protein_id="ADB67189.1"
FT                   /translation="MKVVGVTSCIAGLAHTPMAAKALEKAGVKLGHDVKIEQQGAMGTI
FT                   DEITPAEVSAADVVIIAADKVIDGEDRFKGKPVVRVKIGQCVANGEAVLSKVVAAIEAR
FT                   KQKEAN"
FT   gene            434585..435697
FT                   /locus_tag="LM5578_0434"
FT   CDS_pept        434585..435697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0434"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67190"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463930.1"
FT                   /protein_id="ADB67190.1"
FT                   /translation="MKGKLNEAKDHLMSGISYALPVIIAGSLVVAVAKLIGIIGGVTNL
FT                   DAYADASGFYHYVYLFQNVGWAAIGLLNLVLAGYIAYSIAGKPALAAGFVGGVLATSTN
FT                   AGFLGAVVAGFFAGWLTNWVKKHVRITGPAASSLPLIILPLITVGATGILMSLILGGPL
FT                   GWLNQTLLDWVTEMCKNDTNVIILALILGAMIGFDLGGPVNKAAWMAGNALFMSGIYLP
FT                   SIMINVAICIPPLGYGIATLLRKKNYSTTFKEAGNGALIMGLIGVTEGAIPFTLRSPGK
FT                   LIPLNVIACAIGSAVTMGLGAYVKMPPIGGMYGFFTIGNGWAYLVGGLVGAFIIGICAN
FT                   LFVNFTEEETAAADDVLDDIDISFDEIEIK"
FT   gene            435719..438346
FT                   /locus_tag="LM5578_0435"
FT   CDS_pept        435719..438346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0435"
FT                   /product="alpha-mannosidase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67191"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463931.1"
FT                   /protein_id="ADB67191.1"
FT                   /translation="MTKTKVHVIPHSHWDREWYFTSSRSTIYLVKHLKEVIETLEAKED
FT                   YHFYLMDAQSSLIEDYLRYCPEDKSRLEKLIAEKRLITGPWYTQTDQLVISQESIVRNL
FT                   LYGTRIAREMGHSMAVGYVPDAFGQGGNMPQIYKEFGISKFLFWRGVADNRLKQTEFIW
FT                   RGDDGTEMLAEQIPFGYYYGANIPENDAELKTYLDEQIGALEEKASTPNVYFPNGLDQA
FT                   PVRKNLPELVAKFNELDSTREYQIASPETFFADLEKDVTDLPVIAGELTEGKHSRLHKS
FT                   IFSTRADLKQANNQIENFLSNVLEPVLSISYSLGNRYPHNELAEIWKWMFENAAHDSIG
FT                   GCNSDTTNRDVKHRYKLASDLATNLLDLNMRLISEKIEQKQPFQFTVFNPLPYEKSGVI
FT                   KMTAYIPEDNFTVEDTQGNTLEYTILEKTDLTEYVLNQHIDLNPSRPVYLPEKVFLATM
FT                   LVNVNNLPALGYDTIYFNLEKETAEQEPTQSAATKIENEFYEIQLAANNSLTIHDKKAG
FT                   RTYTDQMIFVENGDDGDSYNYSPPRKDLVISSKEAVVESIESSISSVNQALTISFKLNV
FT                   PYNLEERANGEKNNEMIIKTVISLRKNEELIRFDVQIANQVLSHRLCVTFATEIASEFS
FT                   TADQLFAPIKRPVRLPEMDVWEAEEWQEAPISIEAMQSFVSLHDESHGVAVMTEGVREY
FT                   EIIGENFDTISLTLFRTFSHMGKTDLLYRPGRASGESIVATPDAQLLGEINATFALTLF
FT                   ESSFDEATIAKKAKEYLSNPPVYQMSDFLNGRLIYVYRDEEKILDATYSLALPTIDGAI
FT                   ISAVKKAEDSDAFITRFFNPYLQKEITIPEIFQGKERHLDESKSNEKQTTLKHAKVQSY
FT                   LFEK"
FT   gene            438380..440314
FT                   /locus_tag="LM5578_0436"
FT   CDS_pept        438380..440314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0436"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67192"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463932.1"
FT                   /protein_id="ADB67192.1"
FT                   /translation="MGYFAYKRLETLYGMLLDAGSHLSAQKLSQDLHISERTIRTDIAK
FT                   LTEFLESHGATITLTRGAGYKIEILDPTVFQAFQAEKNKPKNADYFDLDNPEERVKYEI
FT                   FLLLSSADYIKLEDLADTIFASRATISNDMKQVRKVIASYDLTLVSKPGSGVKIVGDEE
FT                   KMRYALTALIASKNAPESYLESFFEWHKQKDKLQKLMTAVTDYFFATNIRFTDEALQNL
FT                   LLHMMILVERIELGHTLEQFELTDVSEEEIAISAKLATILESLFEIEIADADKNYLLLQ
FT                   IASKRILNVEDKEISEFDDYAYIEGLLNRIESHYFYHLQDDMQLKKDLVAHIHSMLYRV
FT                   KYHMTVKNPMTEHIKRYYPLAYEITLDAVESLKKDYPYDINQNELAYLALHIGASLERN
FT                   YQISYYRHKSALIVCGSGFGTARIVEAKVKSAVSNLDITKVVSIQEYNRFIHIEEDIIL
FT                   STVRIPEKNKPVIKISNIPTNEELKMLGAIIQEQTDPNRGFLSNFFTADFFERSSMTNK
FT                   TAILEEMVDSLRQQNIVGEGFLQSVLEREKLGSTVLGTGIAIPHPLGLMAKETKIVIRI
FT                   LDKPIKWDQKQSVRAVFLLCISKNDYEEAINIYELLVELVREEYGEKLSRLSDFNAFTA
FT                   LANDILKKK"
FT   gene            440440..440856
FT                   /locus_tag="LM5578_0437"
FT   CDS_pept        440440..440856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0437"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67193"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463933.1"
FT                   /protein_id="ADB67193.1"
FT                   /translation="MNRQTEFTLLIVGASLSILTFLGAMLYTIIFGLNTLMVADTFGYY
FT                   SSSEETILLGIITFFSVVAAFFALGSAVFGFIGAFKVKSDGPKVKTLGVCFIVLGGLQV
FT                   FTIHGILFLIAGILTITKKEYKTNSKEDEGTKWE"
FT   gene            440847..441245
FT                   /locus_tag="LM5578_0438"
FT   CDS_pept        440847..441245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0438"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67194"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463934.1"
FT                   /protein_id="ADB67194.1"
FT                   /translation="MGMIAFLPIFFIFAMFLGLAAKALLAIWIYKDAEQRGMNAVLWCL
FT                   LMVFINVIIILVIYLIVRNKGEVMKQNLGLLISGIGIAVLNTLMAIIAFIFIISFAVSD
FT                   GGMHNMMDGYNYDYDDGYEYDMDNFEDF"
FT   gene            441354..442361
FT                   /locus_tag="LM5578_0439"
FT   CDS_pept        441354..442361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0439"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67195"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463935.1"
FT                   /protein_id="ADB67195.1"
FT                   /translation="MDTVILITVIIVIVGLAFDFINGFHDIANAVATSISTRALKPRVA
FT                   IGIAAVMNFLGAISFTGVAESLTKSIVDPFSLNNGEFVVLCGLIAAVIWNLMTWLVGMP
FT                   SSSSHALIGAIAGASIASASSFSVLNWSGFTTIIIALIISPIIGFTVGYLIYSLFKHLF
FT                   HDKKLGKMNRRFRFIQIGTAAAQAYSHGTNDAQKTMGIITLALVASGLLKESAGIPFWV
FT                   QVSCAASMAIGSSVGGYRIIKTVGTKIMKITPVTGVASDLSSLSVIMTATLIHLPVSTT
FT                   QVIDSSIMGVGTANHKKEVNWRTGKNMVVTWFITLPLAGLLAAVVYWISAAIFL"
FT   gene            442377..442757
FT                   /locus_tag="LM5578_0440"
FT   CDS_pept        442377..442757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67196"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463936.1"
FT                   /protein_id="ADB67196.1"
FT                   /translation="MKIEHVALWTTNLEQMKQFYVTYFGATANDLYENKTKGFTSYFLT
FT                   FEDGARLEIMSRTDVTGKTTGENLGWAHIAISTGTKEAVDELTEKLRQDGFAIAGEPRM
FT                   TGDGYYESVVLDPEGNRIEITW"
FT   gene            442826..443218
FT                   /locus_tag="LM5578_0441"
FT   CDS_pept        442826..443218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0441"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67197"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463937.1"
FT                   /protein_id="ADB67197.1"
FT                   /translation="MDIVTNKIVVEKYNFETIVEENEQFENKIELEVHEVEPVNGNVEL
FT                   MSKGKIFKITIPFLLVLENFRIDGRISRIIQLKDFFGDFSDLEAVDVEGLSNPLIDYIK
FT                   RLTYDVTEIAFDEPGVSLDFNANHNS"
FT   gene            443231..443653
FT                   /locus_tag="LM5578_0442"
FT   CDS_pept        443231..443653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0442"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67198"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463938.1"
FT                   /protein_id="ADB67198.1"
FT                   /translation="MRQYMKMVRPFDFVIIILLILGSFLPLILFSVAEAKHVGDDVVAI
FT                   ISQDGKVIREIPLTGHKGNEQFTIKGKGAQYNLMEVDGERIRIKEDNSPDQVGVKMGWK
FT                   SKAGDTIVCLPHKVFVEIKSTNKKSKDPDTDLIVPN"
FT   gene            443880..446345
FT                   /locus_tag="LM5578_0443"
FT   CDS_pept        443880..446345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0443"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67199"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463939.1"
FT                   /protein_id="ADB67199.1"
FT                   /translation="MKSKNNYFKQITTIMTVVSLLIMVLGIQGNNDVKAATQVAPPASI
FT                   NQIFPDADLAEGIRAELQKSSVTDVVTKEELESISQLSVYAKKIASIEGLEYLTNLKFL
FT                   NLNGNQITDLSPLSNLTKLTEIYIGDNKISDISPLQNLTNVTDLYLVDNDISDLRPLAN
FT                   LTQMYSLRLGGNSNISDLNPVRNMTRLNNLEVTGSILKDLTPLADVTSLTRLTLSDNQI
FT                   EDLSPLAGLTKLDNIAAYSNKITDITPVTNLTRLQYLDLGSNEITDLSPVANLQKLTSL
FT                   HLANNQITNISMLEDLTNLTSLGLQNNKISDISVLKNLTHVTYLQLGYNQIVDVKIIGG
FT                   LTNLTSLQLTQNHITDISPLANLTKIQYSDFSNQMITNLERNFSKTLSVPNNITSTDGT
FT                   LIAPETISNNGTYDAPNLKWSLPNYLPEVKYTFSQKIPIGTGTSNYSGFITQPLKELLD
FT                   YKVTFNVEGNASEVETITEENLIPEPTSPTKQGYTFDGWYDAETGGTKWDFTTGQMPAN
FT                   DLTLYAHFSVNSYQANFDIDGVVTNEAVVYDTLLNEPTTPTKQGYTFDGWYDAETGGNK
FT                   WDFKTMKMPANDVAFYAHFTINNYQANFDIDGEVKNETIAYDTLLNEPTTPTKQGYTFD
FT                   GWYDAETGGTKWDFKTKEMPANDVTLYAHFTINNYQANFDIDGAVTEEVVNYDALIPEP
FT                   TSPSKTGFTFEGWYDAEVGGTKWDFKTMKMPANDITLYAHFIKETPIIPSPDEGLDSDS
FT                   TNGPITINEPSATSTPSQNNNITVTAGENTTELATAKLPKTGDNAPWKTLFAGILLSSS
FT                   AFYIWRKKA"
FT   gene            complement(446393..448996)
FT                   /locus_tag="LM5578_0444"
FT   CDS_pept        complement(446393..448996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0444"
FT                   /product="phosphoenolpyruvate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67200"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463940.1"
FT                   /protein_id="ADB67200.1"
FT                   /translation="MKPYVLKFQEIQPHSEALVGGKGMNLGACSNIEGVHVPAGFCLTT
FT                   EAYKRTLAENNEFTQLLQRLSSLKTSDMDAIREISETIRTLIQHTQIPSEITSDMDAAL
FT                   LDVGGYEMPFAVRSSATAEDLPHTSFAGQHDTYLNIIGRDALLQHISMCWASLFTERAI
FT                   IYRIQNQFDHHKVQLAVVIQQMIFPEASGILFTADPITSNRKSLSIDASFGLGEALVSG
FT                   LVSADSYTVQENTITNKIIATKKLAIYSLKEGGTKTRILEKSQQTKQTLTDQQILQLAK
FT                   LGRKIEAYFGKPQDIEWCLAEGIFYIVQSRPITTLYPIPEVSEPGNRVYISVAHQQMMT
FT                   DAMKPLGLSFYLMTTPATMYTAGGRLFVDITQSLSAKVSRDMMVNSLGQSDPLIKDALL
FT                   TVINKKGFLPPLPTEENPNQAPISGKPPVRGIPDPSSVFELVQNSENSIKSLKQTIETK
FT                   NGSDLFDFIVEDLEELKRVLFNSTSIDAIMAGMDASAWLNEHIYQWLGEKNVADKLSES
FT                   APNNITSQMGLELLDVADVIRPYPIVRAYLEQTKNPDFLNELATLDGGAETRKALEEYL
FT                   QKYGMRCAGEIDLTKTRWIENPLTLIPLILSNIKNFEPGASMHKFAQGEKEAFDKEHEI
FT                   LRRLQELPDGEQKAMETKEKIDILRHFIGYREYPKYGMINRYFIYKLAFLRASEQLVNN
FT                   GVLQNKEDIYFLYFEELREVVRTDHVDYELINARKRDFATFEKLTPPRILTSDGEMING
FT                   KYKRENLHKDAILGLPVSSGTVEGRARIILNMEKVDLEDGDILVTAYTDPSWTPAFVSI
FT                   KGLVTEVGGLMTHGAVIAREYGLPAVVGVENATTVIKDGQQIRINGTEGYIEILD"
FT   gene            complement(449196..450074)
FT                   /locus_tag="LM5578_0445"
FT   CDS_pept        complement(449196..450074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0445"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67201"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463941.1"
FT                   /protein_id="ADB67201.1"
FT                   /translation="MYMTGLGTLLFLVGIGVLIFGLVSFRRKNWPRKKTQIIIISSILA
FT                   IIIGVGIIPTTDEEASTEEPTKQQEKTEKVDNTPVLKAETTFTTDDEGTLVVEGKTNPG
FT                   AEVTLDFVAIPDAVTTADENGAFSLSVNELDKAQDAVLSIVIDGQTKEQTLKLALTPAY
FT                   ETKIAEKAEAERVAAEKAEAERVERERVAAEEKRAADAKIAAEKKAEEARVAAEKKAAE
FT                   EKRVAAERSKAAAAQPDTSNEQGQMVYITATGKRYHYDQNCRGLNNSNGETAVTVAQAK
FT                   AQGLTLCKFEQ"
FT   gene            450412..450603
FT                   /locus_tag="LM5578_0446"
FT   CDS_pept        450412..450603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0446"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67202"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463942.1"
FT                   /protein_id="ADB67202.1"
FT                   /translation="MAKPIEEIGEEIGAKVEKVARKTGNVAGTAAKLSVYSSIWAVKTG
FT                   VNKTRAFAQGFKQGWSGK"
FT   gene            450630..451439
FT                   /locus_tag="LM5578_0447"
FT   CDS_pept        450630..451439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0447"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67203"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463943.1"
FT                   /protein_id="ADB67203.1"
FT                   /translation="MLNYLSSLNPVLLALLAGIFTWACTAAGASLVFFFKNLNKKWGNI
FT                   MLGFAAGVMLAASFWSLLAPAIEMSKDLGKFSFVPALVGFLLGGIFLRVIDRIIPHLHF
FT                   GFPEQAKEGPKTSLRKSILLVLSITIHNIPEGAAVGVAFGAVITGDTETLITAIVLALG
FT                   IGIQNFPEGAAVSIPLRGEGLSRGKSFWYGQLSAVVEPIFAVIGAVLVVFVTPILPFAL
FT                   AFAAGAMIFVIVEELIPESQVEGSADLATAATMAGFAVMMVLDVALG"
FT   gene            451733..453133
FT                   /locus_tag="LM5578_0448"
FT   CDS_pept        451733..453133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0448"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67204"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463944.1"
FT                   /protein_id="ADB67204.1"
FT                   /translation="MKIRWIRISLVAVLIIAVVFIGVIGFQKYQFSKSRNKVIMQMDRL
FT                   MKDQDGGNFRRLDKKENGVEIISYIPKTTEKKDNEIIQKEIGKATDAEVKKLNRDKETQ
FT                   GIIFYTYQKHRMAEQAISYKAVQSEYVKEGRTKFVLKDKKDICKNIVTDAETGALLTLG
FT                   EVLIKSNQTKLNLKTAVEEELIKTGDFSLKDVGNLGKIKSLVKWNQTNFEITNSEIILP
FT                   VKIPGAPEPKKVKVKLADIASSVNKRYLPSSVKVPEVPKAKTNKRIALTFDDGPSSSVT
FT                   PGVLDTLKRHNVKATFFVLGSSVIQNPGLVKRELEEGHQVGSHSWDHPQLTKQSTQEVY
FT                   NQILKTQKAVFDQTGYFPTTMRPPYGAVNKQVAEEIGLPIIQWSVDTEDWKYRNAGIVT
FT                   KKVLAGATDGAIVLMHDIHKTTAASLDTTLTKLKSQGYEFVTIDELYGEKLQIGKQYFD
FT                   KTDSRMVK"
FT   gene            453287..453463
FT                   /locus_tag="LM5578_0449"
FT   CDS_pept        453287..453463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0449"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67205"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463945.1"
FT                   /protein_id="ADB67205.1"
FT                   /translation="MREERGIGQNELALALEVSRQTIHAIEKGKYNPSLELSLKMARYF
FT                   RLTIEEIFQLEEN"
FT   gene            453465..453875
FT                   /locus_tag="LM5578_0450"
FT   CDS_pept        453465..453875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67206"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463946.1"
FT                   /protein_id="ADB67206.1"
FT                   /translation="MKRYIINRGIMVAVVIIYMYPLLGIIKGEKIFGDIGTPIIMVIAA
FT                   LIGTLSSVFLSEEKTKREYEKEKLEKDERYINNRKTFSYYLLIVLALTIPIVLIVLNLY
FT                   GIEQISISSLTIIFLIFCFAYMIVLEIIRKKV"
FT   gene            complement(453928..454227)
FT                   /locus_tag="LM5578_0451"
FT   CDS_pept        complement(453928..454227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0451"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67207"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463947.1"
FT                   /protein_id="ADB67207.1"
FT                   /translation="MRSLDAVEILRRGETIERYKEGGNSMLPLIKSMQPVRLEPIGMRE
FT                   LKVNDIVFCKVRGSFFTHKISKIRGKQYQISNNHKHVNGWITRNSIYGIVTKIW"
FT   gene            complement(454307..454861)
FT                   /locus_tag="LM5578_0452"
FT   CDS_pept        complement(454307..454861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0452"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67208"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463948.1"
FT                   /protein_id="ADB67208.1"
FT                   /translation="MSKGRLEAFSDGVFAIIITIIVLGMTLPDVFTAASTQAFLWEIFI
FT                   FIEGGLIIGQFWYSHSRLFDQVTFISTSAVLFNILFLLVLSLIPLFTRAIMQHPDMTAP
FT                   IIGFVITILITSVIFQLLHHAVNGKDSGIDNWKFRISSFIFVIALGIISFFAPQISTIL
FT                   FIIFPIAGWIIQLTNRRQPPK"
FT   gene            455008..455820
FT                   /locus_tag="LM5578_0453"
FT   CDS_pept        455008..455820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0453"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67209"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463949.1"
FT                   /protein_id="ADB67209.1"
FT                   /translation="MIRAISVDMDGTFLDGNGEYDRARFEKIYAELMKRGIKFIVASGN
FT                   QYYQLKSFFPGKDEELFYVAENGAVIFHQGELRSVNRFDERLVQKILRTLIQDYHDLQV
FT                   ILCGVKSAYLLKAADPDFKAFAKKYYFELQEVESFDVLPDDTFIKFALDVEVAKTGQIV
FT                   EDLNQTFVGEIRAVSSGHGSIDIIIPGVTKGNAIQQLLNEWQVAPEDLLAFGDANNDIE
FT                   MLQLTSNSYAMLESSPEVLAAAKHVAPSNKEAGVLQVIEEYMKKSQRF"
FT   gene            complement(455872..457122)
FT                   /locus_tag="LM5578_0454"
FT   CDS_pept        complement(455872..457122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0454"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67210"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463950.1"
FT                   /protein_id="ADB67210.1"
FT                   /translation="MSSSTFEEYLGKVIANVKSKQAHSMIKKELSNHLEELSHSFQKRG
FT                   LSIEDANKKAMQEMGDPSTVGRNMNQLHKPRMDWLLIALFILLAGISFLPIIGDVVASN
FT                   SSFMKKQIVWLAIAVLALIGFLFFDYRKLKDLWMYFYAAALILFFTTFLVGIPLTGGGR
FT                   WMSLWGIAIDSPAISLFLFFIAWAGIFTKANAFKGWKKQVVLLILFWVPVISYIIINRF
FT                   VFSIMYFLCVLVMYIFYYRHNRFAIKVALGNLLVGVIFISTMILKYPSSYLPDTSIPLK
FT                   DILSKAGWFGKGLHNNLVLPEAHTDFVFPFLVYSLGWVFGISLCLLLVVFILRISRNAF
FT                   KTKDLFGRLLTIGGAVLFTVPACWNILMGLGIVPIMVVPLPFISYGGSMLLVYAALLGL
FT                   ILNVYRRKDIVESTLVN"
FT   gene            complement(457119..457550)
FT                   /gene="lstR"
FT                   /locus_tag="LM5578_0455"
FT   CDS_pept        complement(457119..457550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lstR"
FT                   /locus_tag="LM5578_0455"
FT                   /product="lineage-specific thermal regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67211"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463951.1"
FT                   /protein_id="ADB67211.1"
FT                   /translation="MDDPFYNLKDSIKKDFESFSFSEERKNAVKKTIRKKQSHLELHSW
FT                   KIETLQNILDALQDEAKHGYEISTQLFQINELSFKNNEGQLYILLHLLENKKILSSKWI
FT                   EGKKYYSLTAKGKKFVATFELRGSKQHGSLKNLIEEASL"
FT   gene            complement(457553..458101)
FT                   /locus_tag="LM5578_0456"
FT   CDS_pept        complement(457553..458101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0456"
FT                   /product="RNA polymerase factor sigma C"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67212"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463952.1"
FT                   /protein_id="ADB67212.1"
FT                   /translation="MTELEEIGIHINSIENTEQIISQLMDNYSDDVLHLVFSYVKNRTT
FT                   AEDLTQEIFIKCYEKLDQFNNKSSIKTWLYRIAINHCKDYLGSWHYRKLNFNDKIWDYL
FT                   PSKSKHVEEEVIAKDVANSLMSAVMDLPVKYREVVFLHYYEELPLANISKITGVNSNTL
FT                   KTRLKQARELLKNKMKKEV"
FT   gene            complement(458281..459138)
FT                   /locus_tag="LM5578_0457"
FT   CDS_pept        complement(458281..459138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0457"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67213"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463953.1"
FT                   /protein_id="ADB67213.1"
FT                   /translation="MSIYLIALLPVLGWGFMPIIANLRKSTPEEQLLGTSISALLFALI
FT                   LFWILSPEITVLSFIVSFISGIFWSFGQLLQFKGIAASSVAKAMPISNGTQLVGATLFA
FT                   VLVFREWQTVTAVIIGVVAVILILIGVVMTGFQKRGNHITESVSFHVYGIVILSSFFLT
FT                   LYVVTNQLFDVTGFSIILPQAIGMLTCAIGINLAKKTAISRKNVTFNLMTGLSWSIANL
FT                   GMFLATAVLGVATSFSISQACVIVATIGGILIFKQKKSPLEWTFILSGILLIMVGVVFL
FT                   SLLK"
FT   gene            459254..461260
FT                   /locus_tag="LM5578_0458"
FT   CDS_pept        459254..461260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0458"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67214"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463954.1"
FT                   /protein_id="ADB67214.1"
FT                   /translation="MSLCNRISVGKGKLKMKAVTKMIANREKNIIQFLMKTGQTRVGTI
FT                   ANHLGLSEKTVSNSLKEIDVFLKDFDMTVVRKPKIGVYIEGDNKAFAEVSRFLDNQVSQ
FT                   IPSTKEERVIYIFSKLLKADDYITIHQLADELYISRSTIEKNMVEVTKMLEKEGITLYK
FT                   KPSKGMKLLISEREKRALTSKFITNFWGNNWYLKQEGEKVLQAFDTIQADVTGIFPEEG
FT                   LKEIIAIVQEFSERHDFTFTDYAFQSIVIHLAIAVERIREGEYVENVESDPMKDVFESQ
FT                   RNNTEILVGMLEERLDIKIPAFEVGYIQLHLTAAYNQQHDELLVNTRPQEDDVAEFVSA
FT                   CLAEGNYDKGLLEDLTTHMKSAINRLKLGMHFKNPYLSKIKQNFPQAFEEALYFKAKFE
FT                   QKYDVQVNEDETAYIALHFEAYKERSRSFPDQIRVVLVCSTGLGSSRLLAARIKKYFPM
FT                   ITIEKILSVQALMETEVDVDLVISTIYLELEDIPSIVVSPMMSKADLQQVESQIERTRR
FT                   KKKKRSQPFVDLIKPKTIFAKLDVATMEEAIAEIGDKLVEQGIAKPGIVESALKREALS
FT                   FTSFEEMATPHAEPALINESRIAIATLKHPVKWGLVDVDKIFFIALTEQNGINLDAMYE
FT                   QFYKYIDNKKWLEKLTQLKSAAEIYEHLLKDGM"
FT   gene            461260..461724
FT                   /locus_tag="LM5578_0459"
FT   CDS_pept        461260..461724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0459"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67215"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463955.1"
FT                   /protein_id="ADB67215.1"
FT                   /translation="MEVKDILTKELVVFDLKATTKETAIEEMAEMLDERGILADKATYV
FT                   QAVLEREAHSTTGIGNNIAIPHGKSESVTKSAIVFARTKEMIEWESLDDEPVNMIFLLA
FT                   ITDSDKTDGHLKILAEIATKLMDDDIVESLKNTRDKEEVIRILNGGVVEI"
FT   gene            461721..462041
FT                   /locus_tag="LM5578_0460"
FT   CDS_pept        461721..462041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67216"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463956.1"
FT                   /protein_id="ADB67216.1"
FT                   /translation="MKRKIIAVTACATGVAHTYMAAQALKKGAKKMGNLIKVETQGATG
FT                   IENELTEKDVNIGEVVIFAVDTKVRNKERFDGKVVLEVPVSAPIKDAEKVINAALALID
FT                   EK"
FT   gene            462054..463160
FT                   /locus_tag="LM5578_0461"
FT   CDS_pept        462054..463160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0461"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67217"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463957.1"
FT                   /protein_id="ADB67217.1"
FT                   /translation="MFRKIGSELKKHVLTGISYMIPLVIAGAVIMAIARVGGSFFGITD
FT                   IWDAKYADSANSLISLLHSLDGFGGLALGMMFPVIAAFIGYSISDKLALAPGLVGGLLA
FT                   RDIGAGFLGALAAGLIAGYTCLLIKKYVKLPKAAASIVPVFLVPVFGTLITVLIINYVV
FT                   GIPFADLNTALENWLNGMSGSNQIMMAAIIGAMVGFDLGGPVNKAAVTTAMALLTSGIY
FT                   APNTAAQVAIIIPPLGLGLATLIAKRKYNTEMREAGKSSLIMGLVGISEGAIPFAVESP
FT                   LKVIPATVLGSAVGGALAVGLGAINQAPISGFYGWFTVENWPVYILAIAVGTLIVAGMS
FT                   VALRKASAGEEMAGSSYDDEIDEAEWEA"
FT   gene            463176..465758
FT                   /locus_tag="LM5578_0462"
FT   CDS_pept        463176..465758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0462"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67218"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463958.1"
FT                   /protein_id="ADB67218.1"
FT                   /translation="MVKAHIVNHTHWDREWYFTSADALVLSEQLFTEVIDELKKHPEAN
FT                   FVLDGQLSILDDYVALYPEKLADIKQLIADEQLFIGPWFTQTDAFFAHGESILRNAMIG
FT                   IFDSKKYGDYMKIGYLPDTFGFNAQMPTLLEHAGFDNVIFWRGIHLGEHVASPYFKWQG
FT                   LGEEASIYAINMPQGYGTGMLLEPTSAYVDGRLDPAIDFIEKYSKTTEVLIPSGNDQLN
FT                   IISNFAEKLAEINKMGRHDYQLSTYQDFIQYVRELPDLEEYRGEFRSPVLARVHKTIGS
FT                   SRMNIKLKSALLEQKLLTRIEPLLVIAKASGISISERLLMHTWKKLLEGQAHDSLAGCV
FT                   SDPVAEDILHRMKEADELCDSIENTIVKKIADDLSLAANEIIVFNTDLHDFDGYKEIQV
FT                   VTEHKNIHFPAFPDATIVQEEFIPSRENVLEETPAGNRFIEEPGYYVLQVRVKVELPGL
FT                   GYRVIAFEENDRELDSMIASTNVAITNDFYKITFENGEIALEKPNGERLTSFITLEDDV
FT                   NAGDTYDYSPLAGDVAELFTFSAANTEKSSEVERLILTGKSDFPLDRLTKEGHGDLQIK
FT                   LILEVKKGSELLDVKVEVENQIKNHRLRLKVNTGVKTDHNIASLPFGYIERKPVVPANW
FT                   QETYSEMPIDIEPLEQSVTLTNETASCTVFTCGVKEYQQLDQDLALTLLATTGQLGKPD
FT                   LAYRPGRASGDTTKKGHVLIETEGAQLLGKHQFRLAIYLGDQAFDEHKTAERTKTFNQA
FT                   NVSYQRQPFNHFLHRLDNKIQKTERKLGAKQTLAMLNLPKEYLVSACHPSYYTADKYII
FT                   RLENPTNTPQKLAFPDMSFEYVNAIEEVVGNDNNTIPAYGAVTLRLDI"
FT   gene            complement(465781..466656)
FT                   /locus_tag="LM5578_0463"
FT   CDS_pept        complement(465781..466656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0463"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67219"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463959.1"
FT                   /protein_id="ADB67219.1"
FT                   /translation="MELRVLNYFLTVAREKTISKAADVLHLSQPTLSKQLKELEEELGV
FT                   TLFIRGNRSITLTEDGLYLANRGKEILSLVELTTSNLLQNETISGKIMVGAAETRGFEF
FT                   IGSLLHELREKHPDITFQLHSGNADDVLEKIEHGLLDFGLVINPVEKLQYDYLPLTIED
FT                   TWGILVNTKHPLAKKTVVTPSDIETNPIVVSNQSFIDNQLASWLGGHFEQLNVIGRYNL
FT                   LYNASLLAKENITSILCIDGIINTENTNLKFIPFSPPLTAGLSIVWKKNQTFSSASKEF
FT                   LRLIQKTCSK"
FT   gene            466774..467343
FT                   /locus_tag="LM5578_0464"
FT   CDS_pept        466774..467343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0464"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67220"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463960.1"
FT                   /protein_id="ADB67220.1"
FT                   /translation="MIEQDLQNRLVDQEILHGSDLLDEIHEVKQNNEQLIIELNTKYHT
FT                   KKEVTKYLSDITGKPVDPSVDVSLPFYSDFGKHITFGKNIFINLNVTFVDLGGITIEDN
FT                   VLIGPGARLVTVNHLVSPKKRRGLRVAPICVKKNAWIGANTTILSGVTIGENAIVAADA
FT                   TVTKDVPPNVIVAGSPAKQIRKIIEE"
FT   gene            467357..468103
FT                   /locus_tag="LM5578_0465"
FT   CDS_pept        467357..468103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0465"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67221"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463961.1"
FT                   /protein_id="ADB67221.1"
FT                   /translation="MTIKNKVIIITGASSGIGKATALLLAEKGAKLVLAARRVEKLEKI
FT                   VQTIKANSGEAIFAKTDVTKREDNKKLVELAIERYGKVDAIFLNAGIMPNSPLSALKED
FT                   EWEQMIDINIKGVLNGIAAVLPSFIAQKSGHIIATSSVAGLKAYPGGAVYGATKWAVRD
FT                   LMEVLRMESAQEGTNIRTATIYPAAINTELLETITDKETEQGMTNLYKQYGITPDRIAS
FT                   IVAYAIDQPEDVNVNEFTVGPTSQPW"
FT   gene            468388..468486
FT                   /locus_tag="LM5578_0466"
FT   CDS_pept        468388..468486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0466"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67222"
FT                   /inference="ab initio prediction:Glimmer:3.02"
FT                   /protein_id="ADB67222.1"
FT                   /translation="MGFERGDDIEEVKKESFGGKSAGLEFVNNRPF"
FT   gene            468784..471186
FT                   /gene="inlA"
FT                   /locus_tag="LM5578_0467"
FT   CDS_pept        468784..471186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="inlA"
FT                   /locus_tag="LM5578_0467"
FT                   /product="Internalin A"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67223"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463962.1"
FT                   /protein_id="ADB67223.1"
FT                   /translation="MRKKRYVWLKSILVAILVFGSGVWINTSNGTNAQAATITQDTPIN
FT                   QIFTDTALAEKMKTVLGKTNVTDTVSQTDLDQVTTLQADRLGIKSIDGLEYLNNLTQIN
FT                   FSNNQLTDITPLKDLTKLVDILMNNNQIADITPLANLTNLTGLTLFNNQITDIDPLKNL
FT                   TNLNRLELSSNTISDISALSGLTNLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDI
FT                   SVLAKLTNLESLIATNNQISDITPLGILTNLDELSLNGNQLKDIGTLASLTNLTDLDLA
FT                   NNQISNLAPLSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDISPISNLKN
FT                   LTYLTLYFNNISDISPVSSLTKLQRLFFYNNKVSDVSSLANLTNINWLSAGHNQISDLT
FT                   PLANLTRITQLGLNDQAWTNAPVNYKANVSIPNTVKNVTGALIAPATISDGGSYTEPDI
FT                   TWNLPSYTNEVSYTFSQPVTIGKGTTTFSGTVTQPLKAIFNAKFHVDGKETTKEVEAGN
FT                   LLTEPAKPVKEGHTFVGWFDAQTGGTKWNFSTDKMPTNDINLYAQFSINSYTATFDNDG
FT                   VTTSQTVDYQGLLQEPTPPTKEGYTFKGWYDAKTGGDKWDFATSKMPAKNITLYAQYSA
FT                   NSYTATFDVDGKTTTQAVDYQGLLKEPKTPTKAGYTFKGWYDEKTDGKKWDFATDKMPA
FT                   NDITLYAQFTKNPVAPPTTGGNTPPTTNNGGNTTPPSANIPGSDTSNTSTGNSASTTST
FT                   MNAYDPYNSKEASLPTTGDSDNALYLLLGLLAVGTAMALTKKARASK"
FT   gene            471271..473163
FT                   /gene="inlB"
FT                   /locus_tag="LM5578_0468"
FT   CDS_pept        471271..473163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="inlB"
FT                   /locus_tag="LM5578_0468"
FT                   /product="Internalin B"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67224"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463963.1"
FT                   /protein_id="ADB67224.1"
FT                   /translation="MKEKHNPRRKYCLISGLAIIFSLWIIIGNGAKVQAETITVSTPIK
FT                   QIFPDDAFAETIKDNLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGIQYLPNVTKLF
FT                   LNGNKLTDIKPLTNLKNLGWLFLDENKIKDLSSLKDLKKLKSLSLEHNGISDINGLVHL
FT                   PQLESLYLGNNKITDITVLSRLTKLDTLSLEDNQISDIVPLAGLTKLQNLYLSKNHISD
FT                   LRALAGLKNLDVLELFSQECLNKPINHQSNLVVPNTVKNTDGSLVTPEIISDDGDYEKP
FT                   NVKWHLPEFTNEVSFIFYQPVTIGKAKARFHGRVTQPLKEVYTVSYDVDGTVIKTKVEA
FT                   GTRITAPKPPTKQGYVFKGWYTEKNGGHEWNFNTDYMSGNDFTLYAVFKAETTEKAVNL
FT                   TRYVKYIRGNAGIYKLPREDNSLKQGTLASHRCKALTVDREARNGGKLWYRLKNIGWTK
FT                   AENLSLDRYDKMEYDKGVTAYARVRNASGNSVWTKPYNTAGAKHVNKLSVYQGKNMRIL
FT                   REAKTPITTWYQFSIGGKVIGWVDTRALNTFYKQSMEKPTRLTRYVSANKAGESYYKVP
FT                   VADNPVKRGTLAKYKNQKLIVDCQATIEGQLWYRIRTSSTFIGWTKAANLRAQK"
FT   gene            complement(473249..473734)
FT                   /locus_tag="LM5578_0469"
FT   CDS_pept        complement(473249..473734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0469"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67225"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463965.1"
FT                   /protein_id="ADB67225.1"
FT                   /translation="MKGLKKMKYSIQFSDAIHILAYIEIFKNTNLLSSEIIAGSVKTNP
FT                   ANIRKIMSNLKKADLITTQTGKANPILARPPEEISLLDVYKSIEGNTNLIHVDPKTNPD
FT                   CVVGANIQQVLTSKYDLLQQKIEFEMEKIKLDSIVRDISVLESKDRPQNMEIIEKFL"
FT   gene            473832..474677
FT                   /locus_tag="LM5578_0470"
FT   CDS_pept        473832..474677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67226"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463966.1"
FT                   /protein_id="ADB67226.1"
FT                   /translation="MTYLVTGATGGLGGYALNYLKELVPMSDIYALVRSKEKGADLKAA
FT                   GFNIRVGDYSDAESMKQAFAGIDRVLFVSGAPGNRQVEHENVINAAKKAGVSYIAYTSF
FT                   AGADKSTSALAEDHFFTEKVIEKSGIAHTFLRNNWYFENEMPMIGGALSAGKFVYAAEN
FT                   GKVGWALKREYAEVAAKAVAGADFPAILELSGPLMTYEELTKALKEATGKDFDVISSDD
FT                   KGFVENLVSVGLPQAVAEMFLSFQHDIKNNQLDVVSDDFEKALGKSLTNRVDALRELLK
FT                   "
FT   gene            474815..475450
FT                   /locus_tag="LM5578_0471"
FT   CDS_pept        474815..475450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0471"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67227"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463967.1"
FT                   /protein_id="ADB67227.1"
FT                   /translation="MKEGKRVKKLVAWFNGLSKIWKVVVIIGTVFVVIIALTTGEDESE
FT                   QTKTKTSSNKIVKTASKPKFSTKDLALIKADLAEFEARELSSEKILKDTIKEESWSDLD
FT                   FANDNINQMIGTMKRYQQEILNIDAIKRSLEASADTKAFKKVFKEWSDFKIERIQVTID
FT                   LLNGKKDSEVAFKKSYPNQTIFKKVRTNKLQTALNNLKVGYELLDSQK"
FT   gene            complement(475483..476751)
FT                   /locus_tag="LM5578_0472"
FT   CDS_pept        complement(475483..476751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0472"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67228"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463968.1"
FT                   /protein_id="ADB67228.1"
FT                   /translation="MVKITKYPAEPSDVKHYISGEKMKNDHHLHTVLTFDNHLNIDVLK
FT                   RAVMQSTQKLPLLLCHFKETKKGAFWQESVFSAEDLVFLVETQAPETEVDRALVTKLST
FT                   ENGPQICFTVVRTESTDQLVIIMNHMLADGAGFKEYLYLLSELYSNLLENPDYAAKLSL
FT                   GSRSLKQVFDQLSRKEIKSIFTEKTKQKAVHNPTLPLKGDPKNPKIIWTKLPKENFSQI
FT                   LHYAKEHDATVNDVLFATMVRTVLQTTGQHEISIDCPVDLRKYLPSKTSSGITNLTANI
FT                   TCQISTDDDLTSFESTLQAVKKSLDPQKNSLAPLRIYYLLELIFKKKSYISAKKASGKM
FT                   YSIPKTSFTNIGIIDEEKLVFEGSALTDCFICGSLKYAPFFQVAATTFRGELTLSTNFH
FT                   GTMQDHAWQKEFLKKMISEFSSK"
FT   gene            476889..477392
FT                   /locus_tag="LM5578_0473"
FT   CDS_pept        476889..477392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0473"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67229"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463969.1"
FT                   /protein_id="ADB67229.1"
FT                   /translation="MTNRTLTTKLLGTLSYTQENGTMMDAVIPLDGKEVKVDYSIFEKL
FT                   TSEDYFKDIVTLTDQIPELHLKAKKTILEQFDGNDTLTIYFDFHTDELPKEVLEVTECD
FT                   ALENVTKEILIDKLVLSGVWFSENANNELDLTFDFKLLPEVSDELLVVRFNTNGEITEL
FT                   THES"
FT   gene            complement(477436..479472)
FT                   /locus_tag="LM5578_0474"
FT   CDS_pept        complement(477436..479472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0474"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67230"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463970.1"
FT                   /protein_id="ADB67230.1"
FT                   /translation="MANLNGKKGNNKKAIIIGSIVAVVVLAGIAIYFFIQNQHKDEKNA
FT                   LAAAETFTSNIAKEKYDKLGSSVSNESLKKVEFTKKEMEDKYQAVYDGIGAKNIKVKNL
FT                   KSVYDDKENKFNLTYELEMRTSLGKLATQKYKTTISKQDDDWKIDWKPALIFPGMVKTD
FT                   KVRITEDDAERGQIVDRNGNPLATTGQFAEAGVVPSKLGEGDEKVKNIADISKKLEVST
FT                   AYINKQLDQKWVQADSFVPLVTLNKDNLPEATGLTYAQKEMRTYPLNEATSHLIGYVGE
FT                   VSAEDIEKNPKLSVGDVIGKSGLERYYDKQLRGKNGGAIKIINDQTKQEDTLQKIDKKD
FT                   GEEIKLTIDAVVQKKAFDSLGSETGAVTMINPTNGELLALVSTPSYDANQMVLGITSED
FT                   YAKYNDDKRLPFLARYANRYAPGSTFKTITATIGLDTGITKPDKVREISGLQWQKDASW
FT                   GKYFVTRVHDVPKVNMTDALVHSDNIYFAQEGLEIGKDKLTAGLKKFDFDKEYNLPFTM
FT                   KPAQISNDGLNSEILLADTSYGQGELLMSPIQQAIAYSAIANDGKMPYPKLDTKEKAGK
FT                   ETQATEAASANQVKAALVKTVSDPAGTAHALQIQGHNIAAKTGTAELKEKQGEDGLENG
FT                   FVYAFDADNPNYLMVGMIENVKGRGGSGLVIDKLKPVIESMYK"
FT   gene            479644..479958
FT                   /locus_tag="LM5578_0475"
FT   CDS_pept        479644..479958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0475"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67231"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463971.1"
FT                   /protein_id="ADB67231.1"
FT                   /translation="MEEMEQPEKKVIIRGKGIHNKWKWSTIIVSILSVIIISVLSYQLY
FT                   SVSQNIPENNTNGTMQGPGGGEMPSGTPPSGEPGQAPNSSDDSSDSGTSDSTTSSDGTL
FT                   "
FT   gene            480095..481024
FT                   /locus_tag="LM5578_0476"
FT   CDS_pept        480095..481024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0476"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67232"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463972.1"
FT                   /protein_id="ADB67232.1"
FT                   /translation="MARHAQKRKARKGRIFVTILVALLILVGVVAVIGYFQYQSSLKEA
FT                   QNESKLKDYKFNGAKAVGDEINVLLIGSDSRGEDQGRSDSLMIAHYNTKTNTPKLVSIM
FT                   RDTYVDIPGHGKNKINAAYSYGGPELVRQTIKENFGVDVQYYVVANFEGFPKIVDTLAP
FT                   EGIKINAEKDMSKNIDANIKKGEQVMDGKTLLQYARFRKDAEGDFGRIRRQQQVLEALK
FT                   EQAIDVGDVGKIPDVIGKLQGYSSTNIPTGTLMSIGADFLLGKTETMEKFAIPVEGKWH
FT                   NERIDGAGAVLRLDDMAANAKALQDFLK"
FT   gene            481244..484030
FT                   /locus_tag="LM5578_0477"
FT   CDS_pept        481244..484030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0477"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67233"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463973.1"
FT                   /protein_id="ADB67233.1"
FT                   /translation="MSMNMVKNEWKKLFHNKVLLISFIAILFIPIMYASFFLKSVWDPY
FT                   GKASHLPVAVVNLDETVEFQGQKMDVGNQLVAKLKKDDSLDWRFVSEKEAKQGMKDLKY
FT                   YMIVTLPKDFSKNATTLLDENPKKMEIGYETNGSLNFIGEEVTKMAMEDLKAQVGTSVT
FT                   KGYAETIFAQVGKLGNGIVQAADGAEQIADGGNKLSDGNKEITANLDKLANSMITFKDG
FT                   ANAFNVGLNQYASGVEKANNGAAQLDAGTKKLASNVGPLKNGIAALDTGANQLSSGVGQ
FT                   YTSGVNELNKGTSSALVGSSSLTKGLNDLNNQLPNLENGVGELQTGLEKLNTGSVKLKS
FT                   GLETLDSNLSSPASKSQIAELQSGLNQFKTGITELNQQVNNTQLTTIVNKSKAIEPTIN
FT                   KIEEHLAALEALTSGNHSEQIIAKIEALETLVPEDKAKLINDIKPILDDLAQKQNEIIQ
FT                   MLHKDLEEMSQLLADVPDSIDEIEALQSGVSQLNNGFNGNPGIYSGTNALIDSMVDIQK
FT                   AVGSANDQNTLLGGATVLHNGIADATTGVKELNEKVPSLADGVNQLTDGSQALNNGLKK
FT                   INDGTTELDNKSGELNSGATKLANGMNAFSGQLPALSNGINALNNGAIQLADGTNELAD
FT                   KVPKLQNGAVALSNGAGEIQNGSAQLVAGSAQLGTGIDKLNTGATELSTKLAAGSQQMS
FT                   QINPTNKNFNMFASPDKVNHKNYSTVPNYGAALAPYVMSLALYVGALVFNFVFPIRKIS
FT                   MRGQTSTAWWASKASVGVFVAIVMALIQATVMLVLGLHIDSLIQFYAMAITTSLAYMFI
FT                   IMFLAMTFDNPGRFVAMILLIVQLGGAGGTFPMPLTNGFFNAIHPFLPMTYSIYGFRQA
FT                   ITSGIGMNVYFQSLLVLVGIFAVFIGLLWLGMKQLQKKHLEGVSQLDNNQELQAVED"
FT   gene            484274..485761
FT                   /locus_tag="LM5578_0478"
FT   CDS_pept        484274..485761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0478"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67234"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463974.1"
FT                   /protein_id="ADB67234.1"
FT                   /translation="MKKDVYLAGDQSITVSMMLLRMIAEESRWYTVNELSERLDMNQRT
FT                   MQRYIADLLEKIEDYNDPNIQLYTAKNKGVFLEITLGADVLNFELYLLEENVTIILMKA
FT                   IFFEEFTSVKKFAMDYFLSETTIRRSLKYFQELLEPYGIKLKRETYEVVGPEEQVRMFF
FT                   YSYFWRLYQGAIWPFDIVNHKMVEEATMKVTSSLRQNLTYVQQYQIEYVIAINIIRIRK
FT                   RHLVELKPNWKNYLDLNNDFKSLTKIKAVFESLNIQKESEIYFFYLLMETRPKLYENKE
FT                   VARRALEPHKKNNSDVYAATEVFIRVFSEEMAPIPQKKYDLFFNSSFSAHLFCTLFKYF
FT                   SADINGYEYIRKFKEYYPKLHQKMDELLDILYEETGNELFLEKDFLLTRYGLLFSSIKR
FT                   LTYFEEEIQIVLDTDLPKFAELNLRHQIFDSLKYRYKVHFLNKNSAPQADVILTTVATP
FT                   MMVERYNREKVLHIGAEPSARDFYNIVNIVVEAISTK"
FT   gene            486035..487024
FT                   /locus_tag="LM5578_0479"
FT   CDS_pept        486035..487024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0479"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67235"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463975.1"
FT                   /protein_id="ADB67235.1"
FT                   /translation="MCTSFVLETLDGKHLLSRTMDFAFILEANPTISPRNYGWKSSTDG
FT                   ANYINRYAFVGAGRELDKYIFADGLNEEGLSCASLYLPGEAVYAPAPVEGKINLAPQEF
FT                   LLWLLGTCATIKDVEAKLSVINLVDQPVPLLGITTPLHWIFTDKSGRCVVIEPTETSLR
FT                   IKENPVGVMTNTPRIEWHIENLRNYTGLQATQLAPVKFGEYMAKPFSQGTGTSKLPGGY
FT                   TPPERFVRAAYLKENIIKAKNEEEAITNVWYVLNSVRIPNGAVIKESGDPDFTQYVASM
FT                   CSESKTYYFTSYENNQINSVTLSKEVIENMKEPTTYQVDKVQNVNKLV"
FT   gene            487079..488467
FT                   /locus_tag="LM5578_0480"
FT   CDS_pept        487079..488467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67236"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463976.1"
FT                   /protein_id="ADB67236.1"
FT                   /translation="MFKTNVEQNNVPVFGSFESGQDLPEKRMNKESVDPRIAYQLVKDQ
FT                   LIDEGSARQNLATFCQTYMEPEAEQIMAETMEKNAIDKSEYPQTAKLESSCVNMLADLW
FT                   NVDESEHYMGTSTVGSSEACMLGGMAMKFRWRSAALKNGLDIHAKKPNLVISSGYQVCW
FT                   EKFCVYWDIELREVPMSEEHLSINTDIIMDYVDEYTIGIVGILGITYTGKFDDIMTLND
FT                   LVEDYNNTHDNEVVIHVDGASGAMFTPFVEPGLEWDFRLPNVVSINTSGHKYGLVYPGV
FT                   GWILWRDKEYLPEELVFDVSYLGGHMPTMAINFSRSASQIIGQYYNFLRFGYEGYRQIH
FT                   MRTRDGALQLSQAVAETGLFEIYNDGANLPIVCYKLKDDANVAWTLYDLADRLQMKGWQ
FT                   VPAYPLPKEMGNTIIQRYVCRGDLGQNMVTAFKNDLSESIEELNNAHILYHDVNTSKTH
FT                   GFTH"
FT   gene            488564..490015
FT                   /locus_tag="LM5578_0481"
FT   CDS_pept        488564..490015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0481"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67237"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463977.1"
FT                   /protein_id="ADB67237.1"
FT                   /translation="MKQQTSAKTLSLFGFFAITASLFITVYEYPTFATSGFSLVFFLLL
FT                   CGFLWFLPVSLCSAELATVDGYQEGGIFGWVSKTLGEKYGFAAIFFQWFQITVGFVTMI
FT                   YFIIGALSYVISFPALDSNPIYKFIAVLIIFWGLTLLQLKGTKVTAIFAKLGFVLGITI
FT                   PVLALFFLTIFHLKSGHHAAISITASSFIPKWTNMSSLVIFMLAYMGVEASAPHINEMK
FT                   NPKRDYPLAMILLIFVGITLNTIGGLSVASVVPSHDLSLSSGVVQTFKALILQNGNSME
FT                   WIVKLIASMIAFGVMAQVSSWIVGPTKGMQTVADKGIIPSVFRKTNKHNVPVPLIMVQG
FT                   VIVSIWAAVLTFGGGGNNVSFLTAISLTVVIYLIGYVLFFLAYFVLVLKKKNLERTYQI
FT                   PGGKIVKLIVAGVGLLMSVAAIVSAFFPPTSLSKSSDMSYEIILAASFIVTILIPFFIY
FT                   GIHLKKKNKVTKEKTIQEKVALSMK"
FT   gene            490027..490182
FT                   /locus_tag="LM5578_0482"
FT   CDS_pept        490027..490182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0482"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67238"
FT                   /inference="ab initio prediction:Glimmer:3.02"
FT                   /protein_id="ADB67238.1"
FT                   /translation="MKKTIRWRNSYQPEPYFTTTKLWILLHIISLELEDDMQEIEPEKN
FT                   YREKQI"
FT   gene            490480..491205
FT                   /locus_tag="LM5578_0483"
FT   CDS_pept        490480..491205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0483"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67239"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463978.1"
FT                   /protein_id="ADB67239.1"
FT                   /translation="MKDKTKKRKWNWAQILAIFVLVTLVVSMVYATVNLITAPSGNVPE
FT                   GQQTKGDYSLMLMQCVLGVVVLFLPSIISKKMKFVIPNAMYIVFIVFLYCAIYLGEVRS
FT                   FYYLIPNWDTILHTFSGAMLGGLGFSIVSLLNNDERITLSMSPVFVALFACSFAVFLGV
FT                   FWEFYEFAADSFGMNMQKTMLEDGTMLQGHAAVADTMGDLFVDFLGAFVISIIGYFSIR
FT                   KNKKWMKNFEFKKVDEEVK"
FT   gene            complement(491248..491913)
FT                   /locus_tag="LM5578_0484"
FT   CDS_pept        complement(491248..491913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0484"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67240"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463979.1"
FT                   /protein_id="ADB67240.1"
FT                   /translation="MARTRQISESIGLGLLLALAGGFMDAYSYIERGQVFANAQTGNIL
FT                   LFGINISEGNWAIAIQYFWPVVSFTVGIALSEVIHRRDIRRLHWRQLSVLIEAVILIGV
FT                   AFIPLDHNLIANSLISFVCGIQVESFRKMHGRGVATTMCIGNLRSATQNLCDYFEYKEK
FT                   QYLHNSFLYFSVILSFIIGAVVGNFFIQLFAQYAILVCAFLQLIAFMMMFIDRESKII"
FT   gene            complement(491934..492689)
FT                   /locus_tag="LM5578_0485"
FT   CDS_pept        complement(491934..492689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0485"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67241"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463980.1"
FT                   /protein_id="ADB67241.1"
FT                   /translation="MTTIFPKEQNVTPLFEQILANPTACRRFKDVFLDNLESYQETRGF
FT                   EKDDTLFAKIILSAYRQSDVSALLLGVCGRTLFELLRQAFLIPKKLTVDNPFFLTDKEG
FT                   NFIAKKDDISNREQEKFQEIYQSDLHHSETTIFLVDDDDIVHSYEPDFSISTKRINKKR
FT                   GILVLYSLPDTLKSGMTESEVYAFIWKTFLHIQEIIPSSRIFYGQETSENADELGVFLP
FT                   IHHFEKKMLQNIEQVNELVDALREQMVNK"
FT   gene            complement(492807..494966)
FT                   /locus_tag="LM5578_0486"
FT   CDS_pept        complement(492807..494966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0486"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67242"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463981.1"
FT                   /protein_id="ADB67242.1"
FT                   /translation="MKRYLTLVMLFILSVLLISEWIYPFAELTELSTATWIILFITLSL
FT                   GSFFLRLKYYWTIPLHVVMIIIVSGIYYAKGGILAGNWLGSFFQITFNGFRDMVQFRSS
FT                   DISMDFILIVFLIALWLLSYITTYSILRKQRVMSVLVLTVAYLAVINTFTDYNSNWAIV
FT                   RTVLEGFLLLHLALASRIAAPNRISADSLKRNGLFYHIFVILLLAAFVFSSLMLPKKAP
FT                   IFPDPIPTIKNALGINTTRTVGYSEDDTTLGGALKKDNATVFTARAEKGHYWRVESKTV
FT                   YTGTGWANANSGDVISFSSGDNFPIQLTEQTTGATNTAEISFASSSDYMPYPYGTQAVN
FT                   GAVDSFSANLTIERVGPVDTIKNYTVQLKTPVYNIEKMQNADFSTLSNTFVSQYTQTPK
FT                   DLPDRVTKLANKVTKDADSIYDKTKAIEHYLSASGTFTYSTDDAKETPRGADYVDQFLF
FT                   ETQIGYCDNFSTSMVVMLRTLGIPARWAKGYTPGEGEKKENDAKTTYTITNNNAHSWPE
FT                   VFFPGTGWVPFEPTATFSNPENFQEPTTETANKPETPNDSTSTPETPNTPDKTPEQDNG
FT                   SSSTGETPKKEEPKTETATSNVEIPSWVWWIPAGLVVALLALAIVFRRRIRGYLLLRSL
FT                   RNSPEFGKTYHRLMKLLASYGYVRESSETLRHFSARVDADLTTSEFSRLTKMYETQLYS
FT                   KNLTEKVIAAEETQLVQQIIARLTK"
FT   gene            complement(494963..496111)
FT                   /locus_tag="LM5578_0487"
FT   CDS_pept        complement(494963..496111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0487"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67243"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463982.1"
FT                   /protein_id="ADB67243.1"
FT                   /translation="MLKKRLLLASRWIIMLIIYAGLWTYTLFQGDTASWFLTYFFSFIL
FT                   LLLFLSSIYPLKAWKVNRSFVKNTYHDGDLIDMQVSFTRKSRYPVGYLLFQQKIPATFG
FT                   KVRARQQVVYPLFKKQFTVTLAGFVGVRGIHSFPPVDVETSDAFGLLERSRQLSSEKSL
FT                   TIYPTYFPNVLEKISEASPENERNAAYWTLKKNSNLHSLREFSSGDRISLIDWKSSAKS
FT                   DQLMTREFENSATSRLSVIFYGASHPNFELSLRAAYSFIRKISEENGEIRVTLLGDQTS
FT                   KFAPAKGTSRLQDISTAFAEIAPVDSLTLQESLDSNLHSGEKILLFTPCMDTMLMQKVT
FT                   RLTDNKQLQIITFQSEHSKAMDAPAIFLEQASLLSRWERETK"
FT   gene            complement(496116..497063)
FT                   /locus_tag="LM5578_0488"
FT   CDS_pept        complement(496116..497063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0488"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67244"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463983.1"
FT                   /protein_id="ADB67244.1"
FT                   /translation="MSIEPSIKINEIINEVEKVIVGKRHVVKLSLTALLAGGHVLLEDV
FT                   PGVGKTMMVRTLSKTIGVSFKRIQFTPDLLPADVTGVSIFNPETRDFEFRPGPVMGNIV
FT                   LADEINRTAPRTQAALLEGMAENSVTVDGITRKLANPFFVMATQNPIEYEGTYALPEAQ
FT                   LDRFLLKINIGYPTVEEEMQLLTLKQYQDPLDQTQQVVTLSELLDLKNKAKQVFIDDVL
FT                   KNYIIRLVDATRKHPSVALGISPRGSLAFMQAAQAFALIEGRDYVIPDDIQYLAPYIFT
FT                   HRLILKSEAYYNEETAESIIASILKNTSVPVEKR"
FT   gene            497219..498814
FT                   /locus_tag="LM5578_0489"
FT   CDS_pept        497219..498814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0489"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67245"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463984.1"
FT                   /protein_id="ADB67245.1"
FT                   /translation="MSVKLADLMKLPSLKEAKVVSGKSGLSKLVSSISVLEYTEVALLE
FT                   DDLFDNDEFYGSEIVVSAFVNIRDDVEAQCRTIERLHKVGEVALILYYVGIFVPKMDQK
FT                   LIDFANELDFTIIVMPENEMSLRYSEVIYEVVEAIVKQEMTDTNFVTESLEQISSVRPP
FT                   QRNIDTTLKILSDRTHSSLVLTDNSFQVINSITWPRTRHWDFERVIETSKQIDEHELVQ
FT                   LHLDERDFYTARKPIFQDGMQAMHLFMMKEKGALTADVVMQITEVVQVFMNLWGRNYVE
FT                   ISTAELMKAILNDESVKMRRLGKILNVDVSSIKWMWLVKTEEIRNNEQVLAELKSFVAS
FT                   HFQVSLIDLFEDNIVVLLDNSVGQRDRTHTANEFAMMMKEHGIDLKITVCQGMEQTSDV
FT                   QSAYSLVNEYKNAANAIYANKSIYSLQEIDFAAKCVEIVDRGELAIAEQMRPLKSLEDN
FT                   DELIETLSVFLLEGESNYNQAAELLFLHKNTIKYRIQRINELLQYPATKIPESYNLYLA
FT                   VAIRRLLGGNNNNK"
FT   gene            498948..500231
FT                   /locus_tag="LM5578_0490"
FT   CDS_pept        498948..500231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67246"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463985.1"
FT                   /protein_id="ADB67246.1"
FT                   /translation="MTEKKTVEQAQSWQSLAFVWTGAMICVPSLLVGGTLISGMPLWEA
FT                   ILIALLGYGVIVVFMIYQGMQSSDLGIPAVSVASQVFGEQGSKKIISILLAIACLGWFG
FT                   IQANVCGAAFSQFLGIYGINLPVPVSSLIWGVIMLLSAIYGIRILSILNYIAVPILLFV
FT                   CIYGLVVSLNNGGLAVVENYKPAGSMSFMTGLAITIGSFALGAVIAGDYSQYTKSRKDV
FT                   VKAAIVGILPSGVLMIAVGAILALTAGTADISVVFTNLGLPVLGIIGLILAAWTTNAVN
FT                   AFSGGIAIINVFNISEKYHKVAVAIAGGLGTVLAVIGILNHFVPIMSVLSAMVPPVAGV
FT                   MIASYWIVQKGDKSKWAPVPGVNWLGVTSWLVGAVIAGIPVILTFFPALPQLPNQPLIG
FT                   IILSLAVYLVGAKVLSGKTNNVENLEGK"
FT   gene            500232..501332
FT                   /locus_tag="LM5578_0491"
FT   CDS_pept        500232..501332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0491"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67247"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463986.1"
FT                   /protein_id="ADB67247.1"
FT                   /translation="MRYLDEQAIENIAIGAAFLGTGGGGDPYIGKMMALTAIKKHGPIK
FT                   LLSPEEIADDDYFIPAAMMGAPSVLIEKFPKGDEFVRVFEKLGRYVGKEVKGTFPMEAG
FT                   GVNSMIPIVVAAQLGLPMVDCDGMGRAFPELQMVTFHLDGISATPMAITDEKGNIGIME
FT                   TIDNKWTERLARVTTVEMGASSLVSLYPCNGAQIKQSSIKNIVTLSEEIGKVIRETSMD
FT                   EAEKLQKLLDVTHGYHLFEGKITDVVRETRAGFNFGRVKIDGLNKDTNSEVIVHFQNEN
FT                   LVAEKNGEPIAITPDLICMVDLETLMPVTTEALKYGKRVRVMALPADDAWRTDKGIETV
FT                   GPRYFGYDVDFEPLEELVKKEERRHV"
FT   gene            501325..502875
FT                   /locus_tag="LM5578_0492"
FT   CDS_pept        501325..502875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0492"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67248"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463987.1"
FT                   /protein_id="ADB67248.1"
FT                   /translation="MYKIGIDVGGTNTDAVILDENQQLIHSVKMPTSEDIETGITESLH
FT                   RVLSETGIDRSKVTHAMLGTTQCTNAIVERKKLAKVGVLRLGYPATASVLPYTAWPEDM
FT                   VGFLSGKYKLTGGGYEYDGQVLSEINEAEIRETLASWKGEVESVAVVGVFSSLKNDQEL
FT                   AVQKIIEEELGADIPVSISSSVGSVGLIERENATILNAALFKVIAATSDGFEKALEQEG
FT                   IEHAEIYLCQNDGTLMSLNYARQFPILTIACGPTNSIRGASYLAGLKDAMVLDVGGTTS
FT                   DIGVLTDGFPRESSLAVDVGGVRTNFRMPDIISIGLGGGSIVRENDGDITIGPDSVGYR
FT                   ISEEALVFGGKTMTTTDIAVRLGVAEIGNPELVAHIPTDFAEKAYKKIADMTEDAIDKM
FT                   KTSSGSVSLVLVGGGSVIIPDEISGVAQIFRDKNGPVANAIGASISQISGQYEQIYIYS
FT                   QIEREEALQDAEQKAREQATLAGAVTDSIEVVEVEEIPLAYHPGNATRLRVKVVGNLV"
FT   gene            503439..504026
FT                   /locus_tag="LM5578_0493"
FT   CDS_pept        503439..504026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0493"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67249"
FT                   /inference="ab initio prediction:Glimmer:3.02"
FT                   /protein_id="ADB67249.1"
FT                   /translation="MSKKSKYIKKRDNIMKLLSKLFVSLMLISIGISSPQGVKADESTI
FT                   GVDKANKEVEFSSLSSTEKSYLESKGFSEEEEYQQTTIIETPFKAGVMSINAINLTAST
FT                   KKVNATKGYTIYVITASKAGFLELNTQLTYGTKRKTSSVIPHKAPKAYGGGIYFDYTGK
FT                   KKYFACSVSTQYYTRMGIGTISAKAGGETLGR"
FT   gene            504023..504361
FT                   /locus_tag="LM5578_0494"
FT   CDS_pept        504023..504361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0494"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67250"
FT                   /inference="ab initio prediction:Glimmer:3.02"
FT                   /protein_id="ADB67250.1"
FT                   /translation="MIELNYYCLSNFKEDEVEIEVFKSISTQQFKDNYVFLKEKTADIN
FT                   LFFYDENIQPFMDNDLVREVLEKEGLTKLPIVILNGKLIKKGQFLSNKEIGDILDIGIS
FT                   TQETDGNY"
FT   gene            505068..505412
FT                   /locus_tag="LM5578_0495"
FT   CDS_pept        505068..505412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0495"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67251"
FT                   /protein_id="ADB67251.1"
FT                   /translation="MKKIIIVLAPVMLMSLSVLPLATYASETENTPTESYDGENFIATQ
FT                   TGNTLVIEDKKTGETVKIEMNDEENGVITSDDGTIENVHRDEEGNVYVDNELELEAPPL
FT                   DIEDGINIAT"
FT   gene            506028..506375
FT                   /locus_tag="LM5578_0497"
FT   CDS_pept        506028..506375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0497"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67252"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464002.1"
FT                   /protein_id="ADB67252.1"
FT                   /translation="MPKDTYSGIRLSVIQLIDSKKENLKENNIKLTIIKNEKDGYVVEL
FT                   DNDKCMAEIVVEEPTYTPYRYISFEVVSLMDGKVKIIYSWYDDETSQWSDIEKELNKGI
FT                   QFLNNFKTMEQ"
FT   gene            complement(507104..508081)
FT                   /locus_tag="LM5578_0498"
FT   CDS_pept        complement(507104..508081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0498"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67253"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464004.1"
FT                   /protein_id="ADB67253.1"
FT                   /translation="MKMTDPLYGTFEIEPVLAELIQSPLVSRLAHVHQGGSSYLVNPLW
FT                   DLSRLDHSIGVMLFIRKFGGSLEEQIAGLLHDVSHTAFSHVVDYALDFEEEDYHEQIFE
FT                   DFVKTSTIPAILEKYGYSFEGIFEDISKWEILEQEAPELCADRIDYTLQDLYRHGKISL
FT                   AEVEGFLQALVMVNGRLYLANISSAEWFVKQYYSEVIDYFYDPLNVYSYEILAEAMRIA
FT                   FQQESITTADLRLTDAELLAKLNANSDAREKIQLLASAHLEENEVDFTYHHKKKMRLIN
FT                   PSVLVDGRLIPADELSEKVREMNDWASERSKHGIYIKATKKSKQ"
FT   gene            508187..508348
FT                   /locus_tag="LM5578_0499"
FT   CDS_pept        508187..508348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0499"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67254"
FT                   /inference="ab initio prediction:Glimmer:3.02"
FT                   /protein_id="ADB67254.1"
FT                   /translation="MAEDSIDKMKTSSGGVRLVLVGGGSVIILDEIPLVYHLANAPRLH
FT                   MKVVGNLV"
FT   gene            508817..509194
FT                   /locus_tag="LM5578_0500"
FT   CDS_pept        508817..509194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0500"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67255"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464005.1"
FT                   /protein_id="ADB67255.1"
FT                   /translation="MKKYKKWWITIGIVLILCVIGYVYWFAIPKHTANKAVDNYLAEQK
FT                   ITSNQIDTRVIKKDWKMGGYLTMIIFKDDPNLKYEYSYDERIDLPYHVFVDAYKDGSGQ
FT                   TEGEMKHPPLEEQLKEMNKSK"
FT   gene            509494..509871
FT                   /locus_tag="LM5578_0501"
FT   CDS_pept        509494..509871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0501"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67256"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464006.1"
FT                   /protein_id="ADB67256.1"
FT                   /translation="MKKYKKWWITIGIVLILCVIGYVYWFVIPKHTANKAVDNYLAEQK
FT                   IKSSQIETRVIKKDWKMGGYLTKIVFKDDSDLKYEYVYDERYEYPHHIYLIAFKDGSSQ
FT                   EDNQMKHPSLQEQLEEMNKSK"
FT   gene            510204..510563
FT                   /locus_tag="LM5578_0502"
FT   CDS_pept        510204..510563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0502"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67257"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464007.1"
FT                   /protein_id="ADB67257.1"
FT                   /translation="MKKYKKWWITIGIVLILYVIGYVYWFAIPKHTANEAVDDYLAAQK
FT                   INSTQVKTRDIQKDWTRGGYYVTIVFKDDPNLVYEYNYNSKRNTPYHINLLVFKDGSSQ
FT                   EDDQVKHPPLQEQND"
FT   gene            510889..511449
FT                   /locus_tag="LM5578_0503"
FT   CDS_pept        510889..511449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0503"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67258"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464008.1"
FT                   /protein_id="ADB67258.1"
FT                   /translation="MAESLITKKAIAGGLMELCQHKRFEKISIADITNICGLNRQTFYY
FT                   HFTDKYDLLTWTYENDFFHCLADGITLGNWDKHVLKMLESIKENADFYKNTVSADASIL
FT                   SFCFSKLTNSLFMDLFEKIDTNATVNEADRVFYAEFFSYGCSGVLIKWITRGFKEAPET
FT                   IANQLFRLAKDTEFLANSMYREN"
FT   gene            511559..513259
FT                   /locus_tag="LM5578_0504"
FT   CDS_pept        511559..513259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0504"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67259"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464009.1"
FT                   /protein_id="ADB67259.1"
FT                   /translation="MKNKKRTLVALTGAAIGTGIAAKKISEQKAAEKERAVDEAIKARY
FT                   YGDKQVYFVGGGIASLAGAVYLIRDANFDGKNIHIIEGMHILGGSNDGAGSVEHGFVCR
FT                   GGRMLNEETYENFWDLFSSIPSLDMPNFSVTEEILNFDHLHPTHAQARLVDKDRNILDA
FT                   HSMGFNNNDRMLMTKLLATPEEKLDNLTIRDWFDEHFFETNFWYMWQTTFAFQKWSSLF
FT                   EFRRYMNRMMLEFSRIDTLEGVTRTPLNQYESLILPLKTFLDKHHVDFTINQTVEDIDF
FT                   KDAPGITATALHLSDGSTIELGPDDDVIMTNACMTDSATLGDMNTPAPKPEEKPISGEL
FT                   WYKVAQKKPNLGNPEPFFAHEEETNWQSFTVTCHGDKLLKRIERFTGNIPGSGALMTFK
FT                   DSNWLMSTVVAAQPHFKAQDANTTIFWGYGLYPDRVGDFVKKPMKECTGEEILYELMCH
FT                   LNWQDDFEEIKADIVNVIPCYMPYIDAQFEPRAMSDRPAVVPEGSTNFAMISQFVEIPK
FT                   DMVFTEEYSVRAARIAVYTLLDIDKKICPVTPHNRDPKVLAKATQTMFR"
FT   gene            513410..514513
FT                   /locus_tag="LM5578_0505"
FT   CDS_pept        513410..514513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0505"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67260"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464010.1"
FT                   /protein_id="ADB67260.1"
FT                   /translation="MEKSSIYGLTWTKLTEWLEAHGQKKFRATQVWDWLYRKRVKTFEE
FT                   MSNVPKETIELLTANFVMNTLEEQVVQESTDGTTKYLFKLSDGNLIETVMMKQEYGLSV
FT                   CVTTQVGCNIGCTFCASGLLKKSRDLTAGEIVEQIMNVQHYLDGRNLEERVSHVVVMGI
FT                   GEPFDNYDNVMDFLRVINHDKGLAIGARHITVSTSGLAPRIIDFANEDFQVNLAISLHA
FT                   PNNELRTSIMRINKTYSIEKLMEAIHYYVNKTNRRITFEYIMLKGVNDHKKEALELAAL
FT                   LGEHRHLAYVNLIPYNPVDEHIDYERSTKEDVLAFYDTLKKNGINCVIRREHGTDIDAA
FT                   CGQLRSKQIKRVGVRERMKQKQAAAEE"
FT   gene            514603..515082
FT                   /locus_tag="LM5578_0506"
FT   CDS_pept        514603..515082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0506"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67261"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464011.1"
FT                   /protein_id="ADB67261.1"
FT                   /translation="MEVEIVERNAFTAVGKKRTFSVENDAQKEKISQFWQEANANGDAE
FT                   RINELAEFATIDGILGVCKMNGDKMDYYIAIESELTPPEDMEKLTIPASKWAIFKSVGP
FT                   LPNAIQKVWEYIYGEWFQTSNYTHGNAPELEVYTEGDTTAADYYSEVWIPVVEKD"
FT   gene            515240..515605
FT                   /locus_tag="LM5578_0507"
FT   CDS_pept        515240..515605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0507"
FT                   /product="heme-degrading monooxygenase IsdG"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67262"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464012.1"
FT                   /protein_id="ADB67262.1"
FT                   /translation="MIIVTNTIKVEKGAAEHVIRQFTGANGDGHPTKDIAEVEGFLGFE
FT                   LWHSKPEDKDYEEVVVTSKWESEEAQRNWVKSDSFKKAHGRTKDTREQREDRKGIVGNA
FT                   IARFEVVHVQNPVIVEK"
FT   gene            515774..516349
FT                   /locus_tag="LM5578_0508"
FT   CDS_pept        515774..516349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0508"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67263"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464013.1"
FT                   /protein_id="ADB67263.1"
FT                   /translation="MIEKTIMERRSIKKANDEPISRETVNTILEQAAYAPFHSKVEPWN
FT                   VYVLHTLAEKERYIEKIIEFNEREQGVSFSEAEIADLKAGYAKKIITPPYLLIVTTNII
FT                   GHGKKDFESIGATSAFIQNIQLLGWEAGIGMIWRSNRFIFDAKFADDLGIPAEQKIVGT
FT                   LHLTSLAEVPEAKPRRPLNEWVKNLADL"
FT   gene            516414..516584
FT                   /gene="rpmF"
FT                   /locus_tag="LM5578_0509"
FT   CDS_pept        516414..516584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmF"
FT                   /locus_tag="LM5578_0509"
FT                   /product="50S ribosomal protein L32"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67264"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464014.1"
FT                   /protein_id="ADB67264.1"
FT                   /translation="MAVPARRTSKAKKNKRRTHKGLTTPGLSRDSETGEYRMSHRISPD
FT                   GTYKGRTIIEK"
FT   gene            516676..517404
FT                   /locus_tag="LM5578_0510"
FT   CDS_pept        516676..517404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67265"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464015.1"
FT                   /protein_id="ADB67265.1"
FT                   /translation="MTEEFVNKEDALKNYNVKEFRTPDGYTSDMILTTVKEVNGKPTLH
FT                   ILLIKRSSTNAEGRPNIEGGKWAVPGGFVDENESADQAAERELEEETSLTGIPLIPFGV
FT                   FDKPGRDPRGWIISRAFYAIVPPEALEKRAAGDDAADIGLFSMTEALELPLAFDHLDML
FT                   KKAYSAITEEFLLTTAIRDFLPETFSAELLYQTLDGCTKPGILPDEVEFMENIEYLPYL
FT                   EKVGELYRFNADAEAGSIYF"
FT   gene            complement(517441..518334)
FT                   /locus_tag="LM5578_0511"
FT   CDS_pept        complement(517441..518334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0511"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67266"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464016.1"
FT                   /protein_id="ADB67266.1"
FT                   /translation="MNLRQLYYFKKLAEKEHYTIAAAELSITQPSLSHSIAELERELGV
FT                   YLFEKQGRNIRLTKYGRFYLTYVKKSLAELEKGEKLLHELTSPSHGNIDLGFIYTMGAH
FT                   TVPELVQNFTKVESHKDITFSFFQGATKSIIPDLKNEKFDLAICSYVENEPDIEFLPLT
FT                   KQELVVVVAENHPLAKYDSIDLQDTADYSYIFFSDTSGLRPLIDSLFAEINIQPKIGCY
FT                   VEEDTAMVGLVSVDYGISIMPKISSLAHYNVKVLSINEPKHDRFIYLASLKNHYISPAS
FT                   KAFKDFALRYGKKHFL"
FT   gene            518532..520526
FT                   /locus_tag="LM5578_0512"
FT   CDS_pept        518532..520526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0512"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67267"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464017.1"
FT                   /protein_id="ADB67267.1"
FT                   /translation="MTDYPSIFEPLTVKRMTIKNRVIMPPMGTNLAGLNGEFLEEHMNY
FT                   YEQRAKGGTGLITIENACVDFPYGTNGTTQLRIDNDQYIPGFYKLTERLHKHGTCVSIQ
FT                   INHAGASAYPARLNGLQPVSASDIPSKKGGTVPRPLTVEEIYEIVNKYGDAARRAQQAG
FT                   FDAVEIHGGHSYLLCQFLSPLYNKRTDEFGGTPENRARIVKLILEKVRAEVGPFFPIVL
FT                   RFSADEFTEGGNHLEDILELLDYCQEEADILNVSAAINDNLYLQIDQMNLEDGWRSYLA
FT                   KAVKDKFNKPTITSGNIRSPKAAEKILSEGYADLLAMGRGLIAEPNWVNKVATGQEDML
FT                   RKCISCNIGCADHRISKSKPIRCTVNPDIIHEDKYKETKVTRPTNVVVIGGGTAGLEAA
FT                   CTAAEVGCNTTLIEANEQTGGLARAIANLPDKSRIADFPNYLANRAEKLTNLKVITGTK
FT                   ADTALIDTFNPDVVVNATGSKPLLPPIKGLLDVIDKEGSKVHSIFGLISNIDDFTEFSN
FT                   KKVAVIGGGAVGLDVVEYFSERGSDVTIVEMMPLLGKDLDMITRLSMMDIIEKNHVDVQ
FT                   TETALTEVAADHFKVKHDGVDAEIPFDYGFVCLGMRPERPLMEELAAYGKEKQIEIVNI
FT                   GDSAATRKILEGVREGRNILTTLEKIGSL"
FT   gene            520626..521501
FT                   /gene="aroE"
FT                   /locus_tag="LM5578_0513"
FT   CDS_pept        520626..521501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroE"
FT                   /locus_tag="LM5578_0513"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67268"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464018.1"
FT                   /protein_id="ADB67268.1"
FT                   /translation="MTNKITERITGHTELIGLIATPIRHSLSPTMHNEAFAKLGLDYVY
FT                   LAFEVGDKELKDVVQGFRAMNLRGWNVSMPNKTNIHKYLDKLSPAAELVGAVNTVVNDD
FT                   GVLTGHITDGTGYMRALKEAGHDIIGKKMTICGAGGAATAICIQAALDGVKEISIFNRK
FT                   DDFYANAEKTVEKINSKTDCKAQLFDIEDHEQLRKEIAESVIFTNATGVGMKPFEGETL
FT                   LPSADMLRPELIVSDVVYKPTKTRLLEIAEEQGCQTLNGLGMMLWQGAKAFEIWTHKEM
FT                   PVDYIKEILF"
FT   gene            521567..522325
FT                   /gene="aroD"
FT                   /locus_tag="LM5578_0514"
FT   CDS_pept        521567..522325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroD"
FT                   /locus_tag="LM5578_0514"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67269"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464019.1"
FT                   /protein_id="ADB67269.1"
FT                   /translation="MNKVVVKNVTFGEGAPKICVPMVGKTVAALKEEAEMLQTIDLDVV
FT                   EWRVDFFEDVKDLAKVEAALGEIRAILPETPILFTFRSAKEGGELAVSDEFYFELNETL
FT                   AGTGKIDLVDVELFNEEADVLRLIETAHKNNVKVVMSNHDFDKTPAKEEIVSRLTRMEA
FT                   LGADLPKIAVMPKSAGDVLTLLDATNTVFEKANQPIITMSMAGTGVISRLAGEVFGSAM
FT                   TFGAAKKASAPGQIDVNELRHVLDLLHKQF"
FT   gene            complement(522393..523301)
FT                   /locus_tag="LM5578_0515"
FT   CDS_pept        complement(522393..523301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0515"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67270"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464020.1"
FT                   /protein_id="ADB67270.1"
FT                   /translation="MKLSNLKYFVDVAMEGSFTRASEKLFISQPTLSRRIKELETELGV
FT                   ELFIRNRHSLELSSAGQQFLIEVNDILNRVNKLSHMFDNQKTADEAGQLLKIGYLSNFN
FT                   MNAMYELLESFKQSHPHVQFSLKPDTPMNLAEGLSNGQYDLVFNLSAYFQPNMSIEEVL
FT                   FIKNHLQIAIPADHRFRKKKKVYFNDLKQEIVILLERKQSPIIVDYVVSQCTKHGFNLK
FT                   ANSYVKDLDEGLAMTSVGEGLAFLYSGMNDGTLEDKYNIKIMDIQEERNDQNIVAAINK
FT                   QSENTLLQELFSFIKSSLLTK"
FT   gene            complement(523376..525136)
FT                   /locus_tag="LM5578_0516"
FT   CDS_pept        complement(523376..525136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0516"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67271"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464021.1"
FT                   /protein_id="ADB67271.1"
FT                   /translation="MTAKITEKMLFSPSFEYVDNGIEHGVLSPFETKEIILEKGQQIAE
FT                   GFKLLDCSIKMLKDVPVKMRDGITIYTDIYLPITEEKVPTLIAWSPYGKSAGTAPRYKN
FT                   LFNMLGMGNAWNSGLTKFEAPDPAYWCAHGYAVCNPDMRGIAHSEGNTTMIGSQEAEDG
FT                   YDLIEWLAKQSWSNGKTALTGTSYLAFSQWYIAAEQPPHLTCINPTEGLADGYRDLAFI
FT                   GGIPDPNFIERLQINHVSAKNSQREDLTKEMEAYPLADSAIWKDKVADPSKITIPAFVI
FT                   ASYSNTLHTMGTFRSWRSLGSKEKWLRIHDRQEWPYYYDENNVEELRRFFDYYLLGKEN
FT                   NWTDTPTVRYALIDFQGGNQTDLPSEVFPPTNSENKRYYMNGLLRTLQETPTSDDFKVS
FT                   YTTENLPGRASFQMTFDKETHFVGYPKAKLFMEVDGYDDLDVFVWLQKLDKFGNVLSEF
FT                   VVPNHGAALQDFTQEGASALRYKGAWGRLRASMRQLDSQVSTDEIPAYSFDKVEKLSSG
FT                   EIVELDIILSPIGLTYKAGETLRVVLSSKDELGSVMPGTPGCTPNNKGTHILHTSKEHP
FT                   SYIQLPIINK"
FT   gene            525328..525921
FT                   /locus_tag="LM5578_0517"
FT   CDS_pept        525328..525921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0517"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67272"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464022.1"
FT                   /protein_id="ADB67272.1"
FT                   /translation="MKKLLFLGDSVTDAGRDFENDRELGHGYVKMIADQLGKEDVTVIN
FT                   RGVSANRVADLHRRIEADALSLAPDVVTIMIGINDTWFSFSRWEDTSVTAFKEVYRVIL
FT                   SRIKEETNAELVLMEPFVLPYPEDRKEWHGDLDPKIGAVRELAAEFGATLIPLDGLMNA
FT                   LAIKHGPTFLAEDGVHPTKAGHEAIASTWLEFTK"
FT   gene            526107..527066
FT                   /locus_tag="LM5578_0518"
FT   CDS_pept        526107..527066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0518"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67273"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464023.1"
FT                   /protein_id="ADB67273.1"
FT                   /translation="MQKEKAPIGLYFLLIAVMASWGFNVTMTKVLVSYFPTVTMTSFRI
FT                   FTAAITVIIILFITKKLRLPTKREFGLILLASIFNIVIHHFFLSNGLKLTTGTNAGLIL
FT                   GSAPIVVAIFSVIFLRERIGAWRALGFLAGIFGVSLVVLSNGTGISGISLGDIDIFIAM
FT                   ASQAFSFIIIKKLAGSMDTGLMTGYMLFLGSLMLFGLSRFMEPGGMSELVAVHSWKLWL
FT                   LFVVSAVVATAFGNFVYNYAVGKIGPSRSAIFMNFNPLFSLIGALLFLGEAIKIPQLVG
FT                   FIFIIIGVLLGSGALMDLIYERKKTKVRDPEKLLEKEV"
FT   gene            527141..527365
FT                   /locus_tag="LM5578_0519"
FT   CDS_pept        527141..527365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0519"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67274"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464024.1"
FT                   /protein_id="ADB67274.1"
FT                   /translation="MKLLLKNINELAAKQKSEGLTAFEKERQAALRQEYLKKIRGTVQD
FT                   NLHHVTIIDPLGDDVTPKKLKEIQAELRG"
FT   gene            complement(527416..528924)
FT                   /locus_tag="LM5578_0520"
FT   CDS_pept        complement(527416..528924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67275"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464025.1"
FT                   /protein_id="ADB67275.1"
FT                   /translation="MIKISVIIPIYNAENYIEKAFSSLKNQTLAQNEFEILCIDDKSTD
FT                   NSLGKLKQLSKIHKNMRIINLHKNSGGPMIPRNKGIKEAKGKYIIFLDNDDYLGEEALE
FT                   RLFIQAEKNQSEVIFGKYVGINGRGVPQSQFKKGNRNEADILADNLVYTLAPHKMFQTA
FT                   FLKTKKIYFDPNILIGEDQYFVMKAYVNAKVITVLADYDYYYVVSRGDENLSIKESKMD
FT                   PREICKVVPAVVKEIEASPLHPTYKKTLIRAYIQRYFNDYITGNYNLDYKNMSERQKTF
FT                   VQVMKDTIVCHLDEKMKNELPTKIRFMIDIIAENNPEKLIDVRMQMENFSKNQVVKVEN
FT                   GYIKGRFRKMRPQLAYDDVYDINHLNSSKVQLHSVTLQNNNYLLDISLEQSLLTRFQTA
FT                   LRLCLKERDGNLEIWISPLKMLSTERGIYAVDSTLFNHTCIWDLFIESEINGFKNRKRV
FT                   GKDRDFEEIVSSSNTPLLIQNNSYQIKAYFTTPFNNLSFQIISE"
FT   gene            529120..529569
FT                   /locus_tag="LM5578_0521"
FT   CDS_pept        529120..529569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0521"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67276"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464026.1"
FT                   /protein_id="ADB67276.1"
FT                   /translation="MEIAIAADHGGFQLKEKIRAHLIESGYTVKDFGCYSLESVDFPEY
FT                   AAKVGHFVATENSLGVLCCGTGIGMSMAANKIKGVRAAVVSDAFSAMMTRRHNNSNVLC
FT                   LGERVLGDSLALLLLDTWLVAEFEGGRHNTRLQKLAELEEQEEDK"
FT   gene            529566..530234
FT                   /locus_tag="LM5578_0522"
FT   CDS_pept        529566..530234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0522"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67277"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464027.1"
FT                   /protein_id="ADB67277.1"
FT                   /translation="MKMIAASIMCADSLHLADELRALEQANVKMLHCDVMDGVFVENAA
FT                   MGAYVLQDIKNNTDMLLDIHLATVNPDKFVDLYAAIKPAYMSFHVEASRDVNATINHIR
FT                   ELGIRPSIAISPDTEIEQIYPFLDKVDMVLMMTVNPGFAGQKFQHHVLEKIKKLQKELE
FT                   SHTNKPLIEVDGNIFEETVRLLEPIGADVYVVGTAALFNEKAGSYTEKLAPLREIIQER
FT                   "
FT   gene            530241..530891
FT                   /locus_tag="LM5578_0523"
FT   CDS_pept        530241..530891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0523"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67278"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464028.1"
FT                   /protein_id="ADB67278.1"
FT                   /translation="MHLDSANLDDVKKIQASSIFKGITTNPTILVKEKCNRQTAINRIL
FT                   ELTDKQVFVQTVGFTYEEILADARMLLTMFGKDKIAIKIPAHEAGTNVIDTLKKEDKTI
FT                   QILGTAIYSADQAITAALVGADFVAPYVNRMSAANIDPFKEIRQMRHFFDKKALKTQIM
FT                   AASFKHSGQVMQAYESGADTVTIPYEIYLQMTNKVLAVEAIRVFNEDAVLYEK"
FT   gene            531000..533060
FT                   /locus_tag="LM5578_0524"
FT   CDS_pept        531000..533060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0524"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67279"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464029.1"
FT                   /protein_id="ADB67279.1"
FT                   /translation="MYLDNRSKTLFQEVIKNPNITNKQLEVKYKLSRYQISYSFQKVNE
FT                   WLKWKNYPEVKRSKNGRFILEPELTALFSEKETRDPSVEYLPSENERANLILLMLLTSK
FT                   EELSLAHFTTKIQVSKNTILRDLKVAQKLLPKETTVTYSRASGYQLAGSEWELRKVLTQ
FT                   VVSSVKEMFRGEHYFLSYSGIEKVQLMEIRRTLEEAEAMMQIKFTYEQIELLPYLLSVM
FT                   FLRIRDRRLIDTAFHIDEKSLSDTREYHITDILLEKTGPVPEQERLFITLQLLTTNIFS
FT                   GEILTEKLTEDLEKVVLTCLDLFEKKALVSLKNKHILIEKLLLHLKPAYYRIKYQMNLE
FT                   DTLYEKFNQEFEALNFIVKEAFDPLAKFIGREIPAGEIFFISLFIGSDMIPQNDIYHKQ
FT                   KRAIVLCPSGVTFSKIMENILVKLFPEIHFYPTISVREYAFFKAEVDIVFSSIPLKDGE
FT                   NVFVVQPFMNDIEKTQLRQHVLQNLFGMGNQLTSIDKIMEVVERNADIKDPNAIRDGII
FT                   DILSANTATDENKRVKKVYLHDLITEDNIMICEDVKNYQEAIRLASQPLLLQQAITANY
FT                   VKTMIDNHKFHDPYIIIGEDIAIPHAMPNAGVNRLAMSLLVVKNGVYFSETEQVHFVIV
FT                   IAPVDKEQHIEALYQIVHLAENHQILDDLLENVTKEKIMQTINQLVIREDE"
FT   gene            533064..533666
FT                   /locus_tag="LM5578_0525"
FT   CDS_pept        533064..533666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0525"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67280"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464030.1"
FT                   /protein_id="ADB67280.1"
FT                   /translation="MDKQAILNNIHQTWQEEANAISRLPEVTSEEALVKTVEKIAECTG
FT                   KIVVAGCGTSGVAAKKLVYSFNCIERPAVFLTPSDAVHGTLGVLQKEDILILISKGGNT
FT                   GELLNLIPACKTKGSTLIGVTENPDSVIAKEADIFFPVSVSKEPDPFNMLATASTMAVI
FT                   ASFDAVIVCLMTYMNYTKEQFSVIHPGGAVGNKLLNK"
FT   gene            533694..534161
FT                   /locus_tag="LM5578_0526"
FT   CDS_pept        533694..534161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0526"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67281"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464031.1"
FT                   /protein_id="ADB67281.1"
FT                   /translation="MDVLEYFKEEMVRFSNEQNKEKLLAEMAEQLCEVGAVKPSYKDAV
FT                   IKREKVFPTGLLTAHAGVAIPHTDSEHVIRPVVAVRILKKPVSFIEMASDNEAIDVRIV
FT                   FMMALRSADEQLDMLQTLIQLIQDEEVMTTLLKAQETGDVLSAIEHFSKNN"
FT   gene            534178..534576
FT                   /locus_tag="LM5578_0527"
FT   CDS_pept        534178..534576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0527"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67282"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464032.1"
FT                   /protein_id="ADB67282.1"
FT                   /translation="MGSFFASFVDWLIGSPGRFVVNLIEDNMLIFMVVVMIYATTILYA
FT                   KWTLAYYLPKKMSQLAEMKTWELDELYAAWQTEKKALPWYILVPSRNEFWVKSARNAPE
FT                   STKLLHFSQQKLKLSDKEKLQKIIEIQS"
FT   gene            534587..535237
FT                   /locus_tag="LM5578_0528"
FT   CDS_pept        534587..535237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0528"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67283"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464033.1"
FT                   /protein_id="ADB67283.1"
FT                   /translation="MAKIVPSVFGADIGRINEQLQVLEKNDIDLLHVDMMDGSFVPNIA
FT                   FGPDQIKMMKKGTKLQFDVHMMVYEPDRYIPRLVEAGAHMITVHQEATTHLHRTIQLIK
FT                   SYGVRAGVVLNPGTPPSTLEYVLDDIDCILLMTVNPGLGGQKFFQSSLEKIRKTKAYIG
FT                   NRPIQIEVDGGVNAELAKECTLAGADLIVVGSYLFEGDIEANLEKLAKGVLTE"
FT   gene            535234..536280
FT                   /locus_tag="LM5578_0529"
FT   CDS_pept        535234..536280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0529"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67284"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464034.1"
FT                   /protein_id="ADB67284.1"
FT                   /translation="MKALKLYGKRDLRYEEADMPTIEEPDDVILKVKTVGICGSDISRY
FT                   SKLGPYVPGMVWGHEFSGEVIEVGSEVTDIEIGDRAAGCPALYCGECEYCKKGEFARCR
FT                   KLTVIGARHPGAYAEYIKLPAENVVKIPDELDYEAAALVEPSAVVVHGFYHTKLQAGDD
FT                   VVVVGSGNIGLLAIQWAKVFGARRVIAIDVDDKKLALAKEVGADVVINSLKEDPLEVVA
FT                   AHTDGLNADLVVEAAGSPITSAQVFAYAKKGGGVVFLGIPYADVTIERFYFEKIVRSEL
FT                   TVWGSWNAISAPFPGKEWQTTIHFLANKQINIEPMITHRLSLAEGPEVFERIYERNEFF
FT                   GKILFFPE"
FT   gene            536296..536589
FT                   /locus_tag="LM5578_0530"
FT   CDS_pept        536296..536589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67285"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464035.1"
FT                   /protein_id="ADB67285.1"
FT                   /translation="MKKKRIYVCCGTGIATSTVISKKVRAVLDEKRIPYEISQCTVQEV
FT                   ASKVSTSKPDIIVSSTTVTGDVGDVPVVIGRSFLTGLKKQETIDEILAILQD"
FT   gene            536604..537875
FT                   /locus_tag="LM5578_0531"
FT   CDS_pept        536604..537875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0531"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67286"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464036.1"
FT                   /protein_id="ADB67286.1"
FT                   /translation="MDIILDFFKYIIGLGVTVMMPIIITILGVIFRKKISVAFKAGLTV
FT                   GVGFVGLGVITSLMLTTITPVTKALVENYNFKLTATDIGWGVGSSLAWGTEVVPFVFVA
FT                   IIATNILMIAFKWTKTMDVDIWNYWQPLFIASALYLTTGSMIIAVLSSIINMAIIFKIA
FT                   DWTQKDVEDVLGLEGISLPQIQTTGWALVGYPMNWLLGKIPGVRKINWSTEKVQSRLGI
FT                   FGEPMLMGLIIGGGLAAIAQMPLSQVLQTGVTIAASLVLIPRMVSLLMDGLTVISEAAH
FT                   EFMEKRFPGRELFIGLDSAVGIGHPFVLSLGLLMIPITLILAFILPGNKVLPLADLTAL
FT                   PFYMIFAIVPSKGNLFRGIFTGIVIVIITLYLSGAAAPLMTELAGQIGYNIPKDAVEVT
FT                   SLAVGTQWYTWIVYYGLHWFGGIL"
FT   gene            538015..538950
FT                   /locus_tag="LM5578_0532"
FT   CDS_pept        538015..538950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0532"
FT                   /product="phosphoribosyl pyrophosphate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67287"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464037.1"
FT                   /protein_id="ADB67287.1"
FT                   /translation="MAGKMKLFSVTSERPLATKIADYLDIPLCEVELQKFSDGEVKINI
FT                   EESIRGTNAYVVQSMNSNVNERLMELLIMVDALKRASVHSINIIMPYYGYARQDRKARS
FT                   REPITAKLMANLIQRAGANRLITVDLHAAQIQGFFNIPIDHLSAIPLIGDYLIENYGEK
FT                   DVVVVAPDHSGVVRARRIADRLNAPIAILNRKPRPHEDEIMSVIGDVKGKVAIVVDDII
FT                   DTGVRATTSADILLEKGAVEVIACATHSVMAGNATERLQNSNIKEVITSDSIDLPEDKQ
FT                   FDKLTTISIGRILGRAIEGVQENRSLHPLF"
FT   gene            540057..540635
FT                   /locus_tag="LM5578_0533"
FT   CDS_pept        540057..540635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0533"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67288"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464038.1"
FT                   /protein_id="ADB67288.1"
FT                   /translation="MKKILVPILLLATILASCSSPNEKITKDTKISKTNTIRADYKVPK
FT                   DIKELEDDSANIVKVKFLQNKTIGKDGSTISEIEILTSYKGNLEKGSKVDISEPWYLSD
FT                   GKYVAVENYIALDKEQEYTIFLGEKDKDTYPLSSLGYGKFGGSLKEDQAVLADFNILGE
FT                   VQKFDFISENTEEVKNYQLIKEQVAGKYK"
FT   gene            540724..541422
FT                   /locus_tag="LM5578_0534"
FT   CDS_pept        540724..541422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0534"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67289"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464039.1"
FT                   /protein_id="ADB67289.1"
FT                   /translation="MTGADKLIIDVLQHVPHEGPGLIANWARENQHQLKIHSLFEENAH
FT                   VPNDSDFLIVLGGPMGINDTAEFPWLKDERKLIKRLSEQHKPVFGVCLGAQQIAATFGS
FT                   EITVNKEKEVGWFPVKRTSDKLLFFPESLNVFHWHQDTFALPTGSTRLFASEGCLNQAF
FT                   LYGENIIGLQFHFEMEKAGIETILRIDEAFITPGKYVQSVEVMREKDVPEDNKQMLEAI
FT                   LDYLINPKTI"
FT   gene            complement(541447..541809)
FT                   /locus_tag="LM5578_0535"
FT   CDS_pept        complement(541447..541809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0535"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67290"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464040.1"
FT                   /protein_id="ADB67290.1"
FT                   /translation="MMEQILFIQTGFGVDVHGQNITNAAERAVRNAIFTNSMPGIQGLL
FT                   PDGDLQNMVVNIKLALPCDADQLDEDTIRAIIPYGTVTIEKMAGGMMTTSGIFLEDKED
FT                   KNDLMYIVNASVETGY"
FT   gene            complement(541813..542271)
FT                   /locus_tag="LM5578_0536"
FT   CDS_pept        complement(541813..542271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0536"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67291"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464041.1"
FT                   /protein_id="ADB67291.1"
FT                   /translation="MNNEQNMNQQIALFYFGYKAFTETADLIIAKHSLKRLHHRILFFT
FT                   ARMPGLTINELLTFLEISKQALHQPLAELKERELLTIEQGRRDKRQRCIFLTAAGKELE
FT                   NELGAAQRKQMSEIFTNSADTDGMHFTEVMEGYAKNRPGAAFIKDFKE"
FT   gene            542653..544488
FT                   /locus_tag="LM5578_0537"
FT   CDS_pept        542653..544488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0537"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67292"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464042.1"
FT                   /protein_id="ADB67292.1"
FT                   /translation="MKKALKLFLATICMFIMIYPSTAAHAEETNIVNIPDANLKTYLNG
FT                   LLKQASDAPITKTQMNTIQTVTLSGSTYTDLTGLEEAGNLVTLSLNNTNIQTLEPIKNQ
FT                   TSLTYLTVGGDNVKDSLFVDLNGLVNLQSLSISGSEVTHNVFKTFNKLPKLTYLYAQNS
FT                   MKITDISALASLPALTTLFLQFDGIDDFRPLNDFESFKNGNLKALAAFGQNTGRTNPRI
FT                   TLKSGKLDYNETNQTLYLPFSMMPKPLTSFDGTVAPFSKSTSASNTYLGFNDVALPSSR
FT                   LSITDDGITVSGVTKEEFDNLDEIEYNARYDFPTGSYPTPPSMTSYTISSGTYDQYFDI
FT                   SHTLDLTADESFDYNQYDTTSEEQFLKDVHAETDDGTAVKSDFDQVVKLDVPGEYTVTL
FT                   NAENAAGLKATPVTVKVTVHEKPVITSDSQISYKKETTKSVDEFLKEIHGSVTGNAVLT
FT                   SDFDKVVDLNTPGEYTVTLNAINDRGQKADPVTVVVTVTTSDSGHVDPVPPTPEIKPTP
FT                   QEETDQTIIPEPQSETTEDSVKEDQAKDGQAKSEEKADKTSLTTKENKVEKSEKTNQPK
FT                   TKALPQTGDTNKTALPIAGVMLSLAALLIFRKSKS"
FT   gene            544586..545020
FT                   /locus_tag="LM5578_0538"
FT   CDS_pept        544586..545020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0538"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67293"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464043.1"
FT                   /protein_id="ADB67293.1"
FT                   /translation="MMEKYHRILVAVDGSEPAKLAFEKGLELALKLDGVLGIASIVDLR
FT                   AFSPNVSYDGSLEEKAELELKTSVNEYAEKARTAGVKQVETFVAKGNPKILLSTDIPAE
FT                   FQADLIICGATGMNRVEKLVLGSVSSYIMAHAICDTLIAR"
FT   gene            complement(545067..546497)
FT                   /locus_tag="LM5578_0539"
FT   CDS_pept        complement(545067..546497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0539"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67294"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464044.1"
FT                   /protein_id="ADB67294.1"
FT                   /translation="MKKLTYVIITGLVLVFIAGAFWITNSTNQSDQKATQTEPIKKISP
FT                   ANVKTISSEAKKTLNSLASSGADKASISDLKQLIKELKSYPTEKNDSGVYLQNLTACLE
FT                   AVKSYTTGKTDEKTLGKVYPAFLASEQKLSAIEKTNQYDWFYAAAATNQQGLKEKGVVT
FT                   LTMVGDNSFGTYPETPEHLKFDNVFQKNNGNNTYVYKNCLPWFKSDDYTVINAESAFTN
FT                   ATKAENKKWRIKSDPAHVAFLPASGVDAANLANNHTMDYFQVGYDDTLKAFKENNIPVF
FT                   NADAPLETTIKGMKTVLLGYDCRMSQQSPAYLERIVKDVKKYKKEDTLVIVNMHWGVEY
FT                   RETPTDYQTQFGHAILDAGADIIMGSHPHRLESVEKYKDKYIVYSMGDFAFGADPTLLS
FT                   RMTSMFQLRFTKEDNKIVLKDISIVPTYENSDGSTTENNYQPLPVFGDDAKKIVDELNR
FT                   ISKPIEGGVTEYTYFDPF"
FT   gene            complement(546618..547433)
FT                   /locus_tag="LM5578_0540"
FT   CDS_pept        complement(546618..547433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67295"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464045.1"
FT                   /protein_id="ADB67295.1"
FT                   /translation="MKKNIFKLLMALCAVLLIAGCGNSTSADKKETKETKEDGTVTFYV
FT                   VRHGKTMLNTTDRVQGWSDAVLTPAGEEVVKSAGKGLKDVDFSAAYSSDSGRAIQTANL
FT                   ILKESDKSADKEVQTDPRFREFNFGSYEGDLNENMWTDIAKSQGKTLEEWQKAGLSPKD
FT                   FANSVAALDKTRVKEGENWPAEDYATIQARLKEGLTDVAKKESKNGDSNVLLVSHGLSI
FT                   GALLDTIEPGYKLPAEGIKNASVTKITYKDGKFTIGDVNDLSYVEKGSK"
FT   gene            complement(547714..548082)
FT                   /locus_tag="LM5578_0541"
FT   CDS_pept        complement(547714..548082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0541"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67296"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464046.1"
FT                   /protein_id="ADB67296.1"
FT                   /translation="MAILAFILTFIVMIEHIYIMILEMFFANTKLAAKTFGVEKELLAN
FT                   KKVQTLFANQGLYNGFLAAGLVWGLFFAGAGMAETVQIFFLSCVVVAALFGGATSSKGI
FT                   LVKQGLPAVLALVAVLLV"
FT   gene            548229..549644
FT                   /locus_tag="LM5578_0542"
FT   CDS_pept        548229..549644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0542"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67297"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464047.1"
FT                   /protein_id="ADB67297.1"
FT                   /translation="MQQEATGGQKIRPIPIIASFLMAGFIGLFSETALNMALSDLIQVF
FT                   DISSATVQWLTTGYLLTLGILVPISGLLLQWFTTRGLFFTAVSFSIAGTLIAALSPTFA
FT                   MLMIGRVVQAVGTALLLPLMFNTILLIFPEHKRGSAMGMIGLVIMFAPAVGPTISGLIL
FT                   ENLTWNWIFWISLPFLIIALLFGMKFMQNVSVVTKPKIDILSIILSTLGFGGVVFAFSS
FT                   AGESGWGSATVLVSIIVGGLALGLFVWRQLTMEKPLMDLKVFKYPMFTLGLILVFISFM
FT                   MILSTMILLPLYLQNSLALAAFSAGLVLLPGGVLNGLMSPFTGRLFDAYGPRALVIPGF
FT                   IVAVVALFFLTRIEVGTSALTIIVLHSVLMIGISMVMMPAQTNGLNQLPPKLYPDGTAI
FT                   MNTLQQVSGAIGTAVAITIMSAGQKAYMETAQGVGPEQMVASLTAGIQNAFVFGLIMAC
FT                   IGLLCSLFIRKAK"
FT   gene            549773..550780
FT                   /locus_tag="LM5578_0543"
FT   CDS_pept        549773..550780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0543"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67298"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464048.1"
FT                   /protein_id="ADB67298.1"
FT                   /translation="MMAIPRDLKELNKKNIKSILRQQGAMTKAEIAEVTGLSVVTVNKL
FT                   IRDLVENEEILEQDNSVATGGRRAVSYEINPNFQQVLVISLQEKWKKITYSFSVYNLLG
FT                   EPEFVEDMSGEDLDITALKRNTKDIICAFPKISCVVIGVPGIEIGGKLRAMDFPLLLNV
FT                   QLRETLEAEVNLPVLVETDTNAAILGYKNRPVKEENIVGLYYPERFPPGAGLLMNGEIL
FT                   KGQNGLAGEIKHMPLQVDWDNFDFSVDEIKAHIRKMVLLTMSFYDPETIVLYTNFYFGQ
FT                   KDFMEELTEELKQVYPYAVLPEIVLSRKFTTDYRIGLLAFGIDYLENNMTDWRI"
FT   gene            550983..554045
FT                   /locus_tag="LM5578_0544"
FT   CDS_pept        550983..554045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0544"
FT                   /product="type I restriction enzyme, R subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67299"
FT                   /protein_id="ADB67299.1"
FT                   /translation="MGTMKYDIEKITLIVHNKIAKGRIYVAEAKFEAALIKKLETEGWT
FT                   YREDLSNVSINKLEEHWRNILNETNAHKLNGVPLSEIEFGLILQELQRIKTPYDAQLLL
FT                   VGAGGVGSIPITRDDGSSLEVEIFYEDDVAGGRSRYEIVNQVRFDNLPKGLTTKRIIDV
FT                   ALLINGIPVVHIEEKDEHLQNQWSAFEQLKGYHGDGLYKGLFAFVQVQVIMSQHSAHYF
FT                   ARPNAFDQYNKTFVFGWRDENNKDITDAFEFIHQVMSIPALHRLVTVNMIPDASNDNIM
FT                   VMRSYQIQATREILQRMKEMEASGLVQKEGGYIWHTTGSGKTVTSFKVAQLLASAPRIK
FT                   NVLFIVDRIDLIDQTLENFKSFAYAHFKNRIKKVNGRELKRELKRKGSSQILLISVQGL
FT                   TKAVKKGLENDDWNVIIMDEAHRSASGESVKLIKKALKKTTWFGFTGTPNFYSDEINDV
FT                   KTTREISTHDIFGKRLHTYTIKDAIGDGNVLGFDVTYFKPHCVVEHPQEDFSEKDYEKE
FT                   VYQSDVYRQEVVKDILDNWTKTSSGALIAGKREENAFQAMFAVSGKQAAVNYYNIFKSK
FT                   GSHLNVAMTFSRDESNEHGTKEQNEALKIAIKDYTEKFNVPSIIDAKDPARAYMLDITK
FT                   RLARKRPYNQGKEEDRLDLVIVSDQLLTGFDSKFINVIYMDKMLKEGMLIQAISRTNRT
FT                   FDLNSKPHGKVRFYRQGDEMREFVENALRIYTRGGNDTLQEAEEETKNQLPKDLENDDI
FT                   LAKPQSHQINELEEAILRLKELAGDDFSQVPRGQNDLKEFVGLALTTQTKIQQLVQQGY
FT                   ELGSEIEELNEQGEATGRMVRLNISSIDEFGALQARLYDAKEKLPPEERPDLTEIKIGI
FT                   EFYHHEIIDYDMLVELLNTFMDEKNKSNKDAIEKHIVPMDEESQHEIHGIVDDIEAGNI
FT                   TEHFTTDSLQETRKKYRTEHRELKVRRWAANQKVNGNRIVEAFDLFLPGHTLIDNPKLA
FT                   DIVREIEEEENIGFFEASDFEEELMAFFNSL"
FT   gene            554093..555682
FT                   /locus_tag="LM5578_0545"
FT   CDS_pept        554093..555682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0545"
FT                   /product="type I restriction enzyme M protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67300"
FT                   /protein_id="ADB67300.1"
FT                   /translation="MALSTEQKTKMWAMLNQTRGQIGLTAYKDYIFGILFYKYLSEKAT
FT                   HWLNGVLRGENWESVYSQDSVKALNYMKKNLGYAIQPNEFFVDWKKAIDRDRFNIGMMT
FT                   DTFTHFNQQIAFEAKNDFEGIFDGMRFDSADLGANAQARASVMISMIELLSSPEFDLSG
FT                   SNDTVSDIYEYLVAQFATVLASDMGQYYTPKEISNVMARILTFGREDMEKFSIFDPTVG
FT                   SGSLLLTTASYMKNSGRRGVIKYYGQEKDATPYRLSRMNLMMHGIEYNDININHADTLE
FT                   SDWPDGVVEGKDTPRMFDAVMANPPYSAHWNNKDREDDPRWREYGVSPKTKADYAFLLH
FT                   CLYHLEDNGRMAIILPHGVLFRGASEGRIRKALIDKHQIEAIIGFPDKLFLNTSIPVCV
FT                   VILRKNRIESDILFVDASKGFEKIKKQNNLRSEDVEKIVDTVINRKEIEKYSHVATLDE
FT                   IKENDYNLNIPRYVDTFEEEEAIDLVALGNEMVTLNADIKKAETDFLGLLDELAVTPDT
FT                   KEIIEATKAVFR"
FT   gene            555679..556896
FT                   /locus_tag="LM5578_0546"
FT   CDS_pept        555679..556896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0546"
FT                   /product="type I restriction enzyme, S subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67301"
FT                   /protein_id="ADB67301.1"
FT                   /translation="MKKLEKSVPVIRFKGFSEAWEQRKLGEIANSFEYGLNASSKTYDG
FT                   ENKYIRITDIDESSHVFNQDNLTSPNISLDKLNHYLLEEGDILLARTGASTGKSYYYSK
FT                   MDGKVFFAGFLIRAKIKQEYNVSFIFQNTLTERYNNFIQVTSQRSGQPGINAQEYARFA
FT                   LYIPELKEQQKIGVFFKQLDNAIALHQRKLDALKLMKKGFLQQMFPKIEADIPEIRFAD
FT                   FDGKWEQRKLGEIFNERSERSADGELISVTINSGVIKASKLEKKDNSSFDKSNYKVVKK
FT                   GDIAYNSMRMWQGASGYSSYDGILSPAYTVIYPRKDIDTIFIAYMFKKIDMIQTFQRNS
FT                   QGLTSDTWNLKFPSLSTIKIKIPANDEQIKITNLFQKLEYTSILHQNQIEMLKKVKKAY
FT                   LQTMFI"
FT   gene            556980..557909
FT                   /locus_tag="LM5578_0547"
FT   CDS_pept        556980..557909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0547"
FT                   /product="integrase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67302"
FT                   /protein_id="ADB67302.1"
FT                   /translation="MKARKRKEQTFHEYFKEWVDLYKVGAIRSITLQKYYVTEQKIQEL
FT                   VPDLKIKDLDRYTYQQLLNSYALTHEKQTTMDFHHHLKGAILDAVDEGVISQNPTRKIV
FT                   IKGKTPRPKKAKFLNQFEVQALLKELNLKEDINWDWFILLIIKTGLRFSEALALTPSDF
FT                   DFSKQKIIINKTWDYKMVTGSFQPTKNESSNRKIQIDWQLAMQFSQLIKMKGPDKPIFV
FT                   KSRVFNSTINNRLKVLCENANIPTITVHSLRHTHASLLLFAGVSIASVANRLGHSSMTT
FT                   TQETYLHIIQELENQDNDKIIRHLSMLM"
FT   gene            complement(557952..559121)
FT                   /locus_tag="LM5578_0548"
FT   CDS_pept        complement(557952..559121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0548"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67303"
FT                   /protein_id="ADB67303.1"
FT                   /translation="MSFNFDLPFRAWEQRELSSLLSFSNGINAPKEHYGKGRKMISVMD
FT                   ILDEKPVKYEFIRNSVQVDKKIESKNKVEYGDIVFVRSSEVPEEVGWAKAYLEKEYALY
FT                   SGFSIRGKKINEFNPYFVELTLNSINRKQIERKAGGSTRFNVSQTILSSIELLMPEIEE
FT                   QNKIDKFFIQLDTTIALHQRKLDTLKRMKKGFLQQMFPNNEEKVPRLRFADFDEEWEQR
FT                   MLNEIANRYDNLRVPITASARSSGTTPYYGANGIQDYVEGFTHDGEFILVAEDGANDVK
FT                   NYPVQYVNGKIWVNNHAHVLQAKENKHDNKFLMNAIKILKIEPFLVGGGRAKLNSDVMM
FT                   TLMVKFPCYEGQKKIGTFLQRLDNTITLHKNKINKLSSLKKTYLQNMFI"
FT   gene            complement(559209..560525)
FT                   /locus_tag="LM5578_0549"
FT   CDS_pept        complement(559209..560525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0549"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67304"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464049.1"
FT                   /protein_id="ADB67304.1"
FT                   /translation="MTKGIKIATIGGGSSYTPELIEGFIKRQDELPVRELWLVDVEAGR
FT                   EKLEIVGNLAKRMVKKAGVNMEIHLTLDREEALKDADFVTTQLRVGLLDARVKDERIPN
FT                   SYGVVGQETNGPGGMFKGLRTIPVILDICKDMERLCPDAWLINFANPAGMVTEAVLRYS
FT                   NQKKVVGLCNGPIGIERNIAETLGVDVSEIYVEFVGLNHMVFAKTVYHNGKDVTKDVVF
FT                   KMTEDEAGSSLKNINATGWDKTFLRTLNMIPIDYLRYYWQTKQQLEDQARAYAEHGTRA
FT                   EVVKKVEAELFELYKQEELAEKPKQLEQRGGAYYSEAACNLINSIYNDKRDIQIVNTRN
FT                   NGAILDIDPDSAVETNCVITRQGPIPLASGRLPIAINGIIQEIKTFERLTAEAAVTGDY
FT                   DKALLAMTINPLTPSESVAREMLDELLEAHKEYLPNFFK"
FT   gene            560727..561479
FT                   /locus_tag="LM5578_0550"
FT   CDS_pept        560727..561479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67305"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464050.1"
FT                   /protein_id="ADB67305.1"
FT                   /translation="MLFLDKNLELNDTELDIYNYIVANLDKVVYMRIRDLATEAHVSTT
FT                   TILRFCRKFGCNGFSEFRVKLQLYLEEQKLAQIDMADETTYIDFLKRTAQPEFKAQIQN
FT                   AVEILRDRELVLFAGVGSSGVIAEYGAIYFSSLFTLALHIEDPLNHPFYHLSSKLSDKI
FT                   CMIAISVEGENEDIIRYIHQLKAQNCKVISITNSAKSTIARLSDANIAYYINKEMYQEA
FT                   NITSQLPALYTIENIAREIRTQIDKEKM"
FT   gene            561586..562029
FT                   /locus_tag="LM5578_0551"
FT   CDS_pept        561586..562029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0551"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67306"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464051.1"
FT                   /protein_id="ADB67306.1"
FT                   /translation="MYSNMKEKVVFTLIMCSLMILCMSSYNIFLENGIGTDSLMIILKA
FT                   FVPFLFIGFLLDFFVVGKIANRLHALLVSEDASKFKKIIMMQLLMVTFMCVLMSTLSLI
FT                   VNQGEWSHLGILILRNYFVALFLQIFIVSPFVRLISPRIFALL"
FT   gene            complement(562075..563736)
FT                   /locus_tag="LM5578_0552"
FT   CDS_pept        complement(562075..563736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0552"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67307"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464052.1"
FT                   /protein_id="ADB67307.1"
FT                   /translation="MFKHILLSLNGYKISYLRNDVISGVGVAALTIPVAMGYAQVAGLP
FT                   PIYGLYASFLPVIAYVIFASSPQLIFGIDATASAITGSIILGTAGLAAGSKEAIALAPI
FT                   LAFFCAIFLVLFSVLKLGRFAKYISAPVLSGFISGLSVSIIMGQIPKIMGLKESGDSFF
FT                   SSLGIIFGQFFQSNWISFAMGVVTVIIVITCKKVIPKIPMSLVVLVLGTMAAYFFKLDQ
FT                   YNVDIVGKIPVGFPSLALPDFGASSWALAIGGGLVCAIATFAGSLLPSESFAMRNKYTI
FT                   DDNRELFAYGVSNFVAAFSGCSPASASVSRTAANEQFRGKTQMVSIVAATIIALIVAFL
FT                   SGLLYYMPQPVLSGIVFAALVGIIDVDVLKGLFKVSRREATVWIVAALGTLLVGVIFGV
FT                   LLGIFLSFINVVSRSMKTPIAILGVIEGRHGYFDLKRKSEAKPIPNVVIYRYSASLFFG
FT                   NFNKFADGLKEAVQDDTKLVIFEASAIINIDTTATESMKDLLKWLDDKGIEYYFADLID
FT                   HLKTSFRKHDLGYLIDNGYTKKTVEDALDAYYAEHK"
FT   gene            563992..565323
FT                   /locus_tag="LM5578_0553"
FT   CDS_pept        563992..565323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0553"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67308"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464053.1"
FT                   /protein_id="ADB67308.1"
FT                   /translation="MATQKNLVDLATKAYIYGFPFIFNTQQIERYVTVGIGGTKQVPFN
FT                   NFTHASRLAEPSDKFVSVNNDTIYSNAPIDVSAGPVVLSVPDTSGRYYVLQFVDAWSNN
FT                   FAYVGKRATGTSAGKFLLTPPNWNGDVPADMIEIKFPTNIGIIIGRLACDGEADLPTVR
FT                   ELQEQLKITPLNEGKEVDGFPEYDRSLGKELAFFEQLRVYMAQFPPAERDLVKQESFAP
FT                   IGLMEKGVSPYSNPSEELKNALIEGAKAGLANIKKATTNFKSENGWGLTQHLFDYNADF
FT                   FEIGTKKSLDWVIEDREEAYIIRAVSAITALWGNHGYEAVYLMTWTDTDGNALNGKNKY
FT                   TLELNPIPPVDSFWSITMYDLPEYFLCENPINRYSIGDRTPGIQYNDDGGITIVVSKDE
FT                   PTDPKERANWLPAPDAEFRPMFRLYNPQQPLVDGSYHFPGFEKK"
FT   gene            complement(565369..566109)
FT                   /locus_tag="LM5578_0554"
FT   CDS_pept        complement(565369..566109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0554"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67309"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464054.1"
FT                   /protein_id="ADB67309.1"
FT                   /translation="MQIKELAELTGVSVRTLHHYDKIGLLVPQKDDWNGYRIYSEKDVD
FT                   KLQQILFFKELDFPLKKIQQILDDPLFDKNVALDMQRHLLIEKKQRIETMLATLDLTIK
FT                   NEKGEITMTNKEKFTGFDFSSNPYEEEARKLWGDKVVEKANEKVNNMSEKEQLTLKESF
FT                   DAEFRHLASVRKLTPESEEAQLEIDHFFHYLNDTHGNIYSLEAFASLGEMYVNDERFTK
FT                   NIDQFGDGLSQFLQEAMTIYAKNK"
FT   gene            566339..567814
FT                   /locus_tag="LM5578_0555"
FT   CDS_pept        566339..567814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0555"
FT                   /product="transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67310"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464055.1"
FT                   /protein_id="ADB67310.1"
FT                   /translation="MIRKVKSISMWLWHHLTPQIFAVICVFIITIIALFMPPYIGMADN
FT                   GDFFRIFSSNGLFVNNTNYDALQFGHFVKEFGIYQYFNENQVAIYSSQSIFIQMALLLN
FT                   KLFWSTTVFDVRFLGGLQLALLLPAIYLLVAGLTAKMKGWPGYVVAALTVFIFADTAYT
FT                   AYFNSFFSEGLILIMMLYISAGFLLLYQHKYNDYAMLGLIFVASLILITAKQQNAPIAV
FT                   VIAVCGILVFFIRKNRAFRISAAATFLVIFLSGVVMYAFIPGEFVTINQYQTMTRGVLL
FT                   DSENPEKSLEEMGMNSEFALLKGTNFYQKYKMIDLDSKLMEKEFYPNYNFVTVLSYYLE
FT                   NPKQFGKMLDLSAQNSFSIRPFEMGNFEKATGYKFKEKTHFFSAYSDVKEKFAPAKFTF
FT                   LILWALVFLICYGVSAFKHFREKNIRGTLLFDLIVLLIGSGFAVILVTIVGDGEADLTK
FT                   HNFLFNVCFDLTMLIGAASLLEVYLKKRGERNA"
FT   gene            567807..569303
FT                   /locus_tag="LM5578_0556"
FT   CDS_pept        567807..569303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0556"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67311"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464056.1"
FT                   /protein_id="ADB67311.1"
FT                   /translation="MRKKMIISILLAFVIFIVGGHSAIAKTDDGVVVFYDSLATGTENE
FT                   GNMDALLRMLNSLGKRVTIYSWEENPDLSQTSEIIVLQNKNDGLANDWTEKLAKSKAKI
FT                   AYIGGNPPTFLTDKLQLKTKAITDASITIQTEAGLSGKPQLVNETNLITSYKGTSFGEM
FT                   DAAENGQAAYGVQAGNYAYAPLFQTDNTSEFTLMDVLKALFDIKTTTNQYAFITGVNPF
FT                   VDFDLLKKTADTFYEKGIPFIVSAGPVFYNQDFQAAKNYAEILRYVQAKNGTIMLNVPA
FT                   VTYGDSPSGELESIMQKSVHFFAENDIAPIGVTAELYWNFDKVYGVEGFAPFNTGILLP
FT                   NQKIIHTTKVNNGSAFEKSPYSVANDFYATTTEGRNFPVDIAITYSFFDNEKELKAAAE
FT                   ELANDNISDFRFQNHGVKTNKDTIESSAGSLYINNQPVALDGDLNYIKTKNKAVKQAGS
FT                   LEGFFGYQNTFFTIVIVLSLGIIGVLFVFGYRLYMKKYMK"
FT   gene            569314..570564
FT                   /locus_tag="LM5578_0557"
FT   CDS_pept        569314..570564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0557"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67312"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464057.1"
FT                   /protein_id="ADB67312.1"
FT                   /translation="MVVADYLALFAVICIWGLLLINIVLIVAGYVYYLKNEARKVPEIP
FT                   VEVPFVSVMVPAHNEGKVIVKTVESLLAFDYPVDRYEIIVINDNSSDNSAELLAAIQAK
FT                   NPTRFLKIINTDNITGGKGKSNALNIGFAESRGELVAIYDADNTPERQALRILVGEITN
FT                   DAKLGAVIGKFRTRNRNASWLTRFINIETLSFQWMAQAGRWALFKLCTIPGTNFIVRRS
FT                   LLEEIGGWDVKAVAEDTEISFRIYMMGYRIKFQAKAVTWEQEPQTLPVWFKQRSRWAKG
FT                   NIYVILKNVPLLFKREGRRVRFDILYFLSIYFLLLTSLIVSDVLLVLYALGLVHTTLAG
FT                   LSGALWLLAILLFVAGTFITLTTEKGEISFSNLLFIMLMYVTYCQLWMVVAAYGFFIFL
FT                   KDTVLKRETKWYKTERF"
FT   gene            570580..572631
FT                   /locus_tag="LM5578_0558"
FT   CDS_pept        570580..572631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0558"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67313"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464058.1"
FT                   /protein_id="ADB67313.1"
FT                   /translation="MKKFTVMWLLIFAVLFLYRPEVLAADKNYQTVFGTDKTAQGKFTT
FT                   TKQNFTVENYWDVSNANVKLVYTITQLSEKEVSTMTLKINDVAFYSFKPDKADKGTKQI
FT                   EIEIPKDKLKKGVNVLSIESFVYTDLPDGRCTIDDTPANWLQLDKTSAVNVSYSDKAFQ
FT                   KTIAEFGERFTGIDTVKSEQGAVAVSNKAGDAELGAALEGLSGFSAANTLEDKNIAFGQ
FT                   YEETKTRDGKNYLVLFSSYDNLPNDLKSQIKDDNKLEKQALYQVVTVGNTNTLVVTSKS
FT                   NDALKKAGKLIANQNYLSQLGTNTKWLTTDERIDTPATSVDKNTKLTTTGDKLKGIGHI
FT                   TQDYFISMPANRSASTGTEVSLDFRYAQNLDFEHSLVTILVNGKPIGSQKLTAKKANGD
FT                   KLTFQIPSDLNVKGDFSVTVAFDLVLTNNYCGFIADSEIPWAYITPESKINLNTSEETD
FT                   LLFEQYPYPFIANGDFNNAVVVVPDELTTEDTDSLANIFNLLGRFHDGNRGDLTAVHAA
FT                   NWKKPKEESNVIAVGTMNNNPVIKNANDDLYFQYNKTGDYFLSNEKISIEKNYGKQLGS
FT                   VQLITSDGVPILAVTGPGAKQTELGSDLIATKANLAKIYGDGAIVDTDNTIHSYRFKKE
FT                   ADTQEESFGAKISNNKEVTVFGAFALLTVVILVVAVLLILRKYRRSRK"
FT   gene            572644..573498
FT                   /locus_tag="LM5578_0559"
FT   CDS_pept        572644..573498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0559"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67314"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464059.1"
FT                   /protein_id="ADB67314.1"
FT                   /translation="MKKITNNLFADIGFLFFILLCFITIGFMINTPDEYLRNIILLNIT
FT                   FLLVIITYFTNLTLGLILNVLYIFIYATYIIYEIVANQIAYGFGSYFWLIITPLFTVAS
FT                   AMFTRNTSRLQEENTKIKQQNLYLGTIDQETLLKNIVSFQNDERIFSSISRRYDLPLSL
FT                   MVIKVRHWRELKRFQSEDEMRLALQDISAILETCIRTSDVLYLLDKDDATWGLLLLTDE
FT                   PGGKLVADRIKSRIAEANTEEFAAKYRVKLELRIGTSQFDSEKVKTPLDFIDLATKELE
FT                   YDV"
FT   gene            573558..574388
FT                   /locus_tag="LM5578_0560"
FT   CDS_pept        573558..574388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67315"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464060.1"
FT                   /protein_id="ADB67315.1"
FT                   /translation="MNLEEIVDCMLLNENDKEIQRTQTEHRIKLVDFWRVKKGDRVLEV
FT                   GCGQGDTTAVLANAVGASGFVQGIDIAPRTYGAPFTIGDATDHLQKSKLGAQIDFKLGT
FT                   DILKGDITFPDNAFDVAVLSHASWYFSSKIELTLMLELLTKWAKRVCYAEWDTRITNVK
FT                   QTSHMLAVLTQSSYEAFKQETQSNIRTFITPIDMQEIIQEHNWKMGAETSIFSEKMQDS
FT                   RWEIGYVKDFITKELEADLGLPEKFKAFLLSQSKLITLENSLPMASYCTSWQAK"
FT   gene            574466..574735
FT                   /locus_tag="LM5578_0561"
FT   CDS_pept        574466..574735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0561"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67316"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464061.1"
FT                   /protein_id="ADB67316.1"
FT                   /translation="MRAVLTVIGKDNVGIVAGVSNKLAELNINIVDVSQTIMDGYFTMM
FT                   MMCDISQITKEFDEVKAELAGKGEDLQVKIHIQREEIFNAMHKL"
FT   gene            574754..576109
FT                   /locus_tag="LM5578_0562"
FT   CDS_pept        574754..576109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0562"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67317"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464062.1"
FT                   /protein_id="ADB67317.1"
FT                   /translation="METNQILETIRMIEEEKLDIRTITMGISLLDCMDGDGEVARKKIY
FT                   QKIVTKARNLVAVGEAIESEFGIPIINKRISVTPIAIIAGSSADTDYVEFAKTLDAAAK
FT                   EVGVNFIGGYSALVQKGYTKGDEILIRSIPQALAQTERVCSSVNVGSTRTGINMDAVRQ
FT                   MGEVIKETADLTADTQGLGCAKLVVFANAVEDNPFMAGAFHGVGEADCVINVGVSGPGV
FT                   VKRAIEKVKGEPFDIVAETVKQTAFKITRMGQLVGQVASEKLGVPFGIVDLSLAPTPAI
FT                   GDSVAHILEEMGLEMVGTHGTTAALALLNDAVKKGGVMACGHVGGLSGAFIPVSEDAGM
FT                   IEAVQQGALNLEKLEAMTAICSVGLDMIAVPGDTTAETLAAMIADEAAIGVINNKTTAV
FT                   RVIPASGTKVGDMVEFGGLLGTAPVMPVNGKSSVDFIARGGRIPAPIHSFKN"
FT   gene            complement(576149..577117)
FT                   /locus_tag="LM5578_0563"
FT   CDS_pept        complement(576149..577117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0563"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67318"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464063.1"
FT                   /protein_id="ADB67318.1"
FT                   /translation="MANIQEIAKLAGVSSATVSRVINKRDYVSDETRKRVQTIIDKLDY
FT                   VPNINAVSLKKGATKLIGMVIPSFTDSLNVFLKSFTMIAQEHGYNVTLFMTRIDPDKEL
FT                   EALEMLRQKQIDALVLVIRSNDWKTIEHYTKYGPIVTWQRVESEKIPSVFMNQYDGYTL
FT                   GLEHLYAKGYRKFVNVYGNTTGLNTQSRMLAFKDFCARYELDPHEFRQFYGQGSRQDGE
FT                   KIAHWFAETEHKPDAFLTPNDYFAAGLLTEARRLGYSVPEDFAICGFDNMEIAHLLDIT
FT                   TIHYPVNLQAENAFTLIMNQLFGSNLPLLDLDFHLVERKTT"
FT   gene            577289..578611
FT                   /locus_tag="LM5578_0564"
FT   CDS_pept        577289..578611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0564"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67319"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464064.1"
FT                   /protein_id="ADB67319.1"
FT                   /translation="MKKGVKIVTIGGGSSYTPELVEGFIKRYHELPIRELWLVDIEAGR
FT                   EKLEIVDNMAKRMVKAANIDCEVHLTLDRREALKDADFVTTQFRVGLLDARIKDERIPL
FT                   SHGIIGQETNGAGGMFKAFRTIPVILGIVEDMRELCPDAWLINFTNPAGMVTEAVLRYG
FT                   NWDKVIGLCNVPIGAVKSASDVLEKPEEDLFFKFAGINHLHWHRVFDKDGTELTEKVID
FT                   GLYAPDANPGKVVENIKNMRFLYEQVKHLKMLPCPYHRYYYMTDAMLEEELASFKNEGT
FT                   RGEVVKKLEDSLFELYKDPNLDYKPEELSKRGGAHYSDAACEIINSIYNNKGTVMVVST
FT                   RNNGAIDDVPYDSAVEITSVIRAHGAEPINFGKFPPAQRGLLQVMKSMEELTIEAAVTG
FT                   DYATALQAFTSNPLVPSGDLAKTILDEMLEAHKEFLPQFAK"
FT   gene            578715..579986
FT                   /locus_tag="LM5578_0565"
FT   CDS_pept        578715..579986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0565"
FT                   /product="allantoate amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67320"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464065.1"
FT                   /protein_id="ADB67320.1"
FT                   /translation="MQTNLERIKKHIEKLDTFTATPGQGTTRLTYSKEDLDARNYLKQE
FT                   MAKVGLTVSEDAIGNIYGRLEGESPDLPAVIVGSHFDSVPNGGAFDGPAGVITGLEVAS
FT                   VFHEQQIKPHFPLEIIAMVEEEGSRFGAGLLASRAITGKVTTEMLHEMKDIDGITATDA
FT                   MAKLGFNANRVHRAIRTKESVKAFIELHIEQGPILENASEDVALVDTVVGLTQIKVTVK
FT                   GQAGHAGTTPMLDRKDALVSAVEILGQLPELAIQEGGGTVLTVGKLNVYPNGANVIPDK
FT                   VIFTVDIRAKDEIHVQNTLAKTKEIIQATEKNGITCEIKDMIYQQPTHLSKEIHQALTE
FT                   SADQLGFKYRTMVSGAGHDAMIFASLTEVGLIFVPSHNGISHAPEEWTDYDKLQKGIEV
FT                   VLKTVKKWTEESANESENKTNSFK"
FT   gene            579952..581127
FT                   /locus_tag="LM5578_0566"
FT   CDS_pept        579952..581127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0566"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67321"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464066.1"
FT                   /protein_id="ADB67321.1"
FT                   /translation="MNQKIKQIVLNNESEMIAFRRDLHMHPELQWQEFRTTDQVAKELD
FT                   KLDIPYRRTEPTGLIAELKGGKSGKTVALRADMDALPVQELNQDLPYKSTEDGKMHACG
FT                   HDAHTAMLITAAKALVEIKDELPGTVRFIFQPSEEIAEGAKAMIAQGAMEGVDHVFGIH
FT                   IWSQTPSGKISCVVGSTFASADIIQIDFKGQGGHGAMPHDTIDAAVIASSFVMNLQSIV
FT                   SRETDPLDPVVVTIGKMEVGTRYNVIAENARLEGTLRCFNNTTRTKVAKTIERYAKQTA
FT                   AIYGGTAEMIYKQGTQPVINDEKSALLVQETITESFGEEMLYFERPTTGGEDFSYFQDE
FT                   APGSFALVGCGNPEKDTEWAHHHGRFNIDECVMKNGAELYAQFAYNYLNQN"
FT   gene            complement(581175..582191)
FT                   /locus_tag="LM5578_0567"
FT   CDS_pept        complement(581175..582191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0567"
FT                   /product="tagatose 1,6-diphosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67322"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464067.1"
FT                   /protein_id="ADB67322.1"
FT                   /translation="MVQITKGKFDGLQRLSNDKGVIAALAIDQRGSLKKMIQQAKGTEN
FT                   KKDVEDFKQLVSEELTPYASAILLDLEYGTPAIKARHEGSGLLTSYEKTGYDATTPGKL
FT                   PDLIEDLSALRIKENGGDAVKILVYYDPDEPAEINEIKYAFLERIGAECRAVDIPFFLE
FT                   PITYDATVTDSGSLEYAKLKPAKVKASIKEFSKPRYGVDVLKLEVPVNFKYVEGFAEGE
FT                   VAYTQDEAARHFEECSDLSPLPFIYLSAGVTSEMFHKTIQFANQHNVQYSGVLCGRATW
FT                   ADGIEVYGKQGDDALREWLRTQGKENITSLDKLLDEGAVPWWTKYGSFEDVHVVEKQ"
FT   gene            582429..583622
FT                   /locus_tag="LM5578_0568"
FT   CDS_pept        582429..583622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0568"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67323"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464068.1"
FT                   /protein_id="ADB67323.1"
FT                   /translation="MNRRERRKHKRRKNMIIVLSTVFLLFIATSWMIYEFKSKQEQTVS
FT                   APTKKKAATATNPSENAATNEPEETKEPEPVEEKPKETIVKNQEIDNYLQKIGFSGSAL
FT                   VVRDGETIIQKGYMYANRDDKVLNTPDTLFYIGSSQKAIIATALLQLEEKGKINTNDPI
FT                   SKYIPDFPNGNKILVKNFMNHTSGIVGRPNLTSNMTPDQIVKAIEKRGIKSQPGKWDYM
FT                   DANYTVVGYLVEKISGQPLATYLQENIFNPAGMKHTGYYQKDVDGGKNVSTGYKIDENG
FT                   VFQSPKLADLTKLYGAGDISMSTTDMYLFDKALMDKKLISEASLKKMFTKGSKSTYGMG
FT                   FYVDPGSYNSHGVVTGWDVSNSFSHTGRTYVILFSNVQNYIASFGKVNNDIYGFLNK"
FT   gene            complement(583662..584582)
FT                   /locus_tag="LM5578_0569"
FT   CDS_pept        complement(583662..584582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0569"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67324"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464069.1"
FT                   /protein_id="ADB67324.1"
FT                   /translation="MYQKHKWAAILMTVLLAVVLTACGSSSDKDSSKEKESATKTVTDT
FT                   TDRKVEVPTTPKRIVALQNVSEMEILGVKPVGTTDYYITTYPDATKGTESVGNDKPSIE
FT                   KIANLKPDLIIISDYQKDLLENLEKVAPVYITHFGDTPDKQLSNIANLLNKKAEKEKWD
FT                   KDYAASSKEAKATLKDAGVANEKAAVIQFYGKEIYVHDAKVFDGLYSGAGFTPTDAAKA
FT                   NKETKAISSEAIPEYAAGADRLFILMPADGNTDSVDEMLKGVWKDIPAVKKNQVYKVDN
FT                   TKWSDYSAAAQLYQMEDAVKQITGK"
FT   gene            complement(584693..585043)
FT                   /locus_tag="LM5578_0570"
FT   CDS_pept        complement(584693..585043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67325"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464070.1"
FT                   /protein_id="ADB67325.1"
FT                   /translation="MTISKIMEIGPLVPAFEEEKIVILFGPTATNELREISVIHEFQDA
FT                   PNNALTKGNTLLIGEQVYTIEEVGTDANKNLEELGHISVYFRSGQNEVLPGAIVVSPEV
FT                   FPTITVGDSIQF"
FT   gene            complement(585062..586048)
FT                   /locus_tag="LM5578_0571"
FT   CDS_pept        complement(585062..586048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0571"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67326"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464071.1"
FT                   /protein_id="ADB67326.1"
FT                   /translation="MYQSIHVNKGQGGWGVGLDITPSEPRTKVVSITGGGIHPVALRIA
FT                   ELSGAEAVDGFKNSIPEEEMMCVVIDCGGTARIGVYPMKRIPTVDVLPSSPSGPLAKHI
FT                   TEDIFVSGVKPEDIEVRDISAEPGKPFDREKFKEDYAKIKEDQKEASELKEGFLVKFSR
FT                   GIGKAMGVFYQAGRDSVDMLIKNIIPFMAFISMIIGIINYTGIGKLIANTLSPLAGSLW
FT                   GMLLIAFICSLPFLSPILGPGAVIAQVIGVLIGSQIAIGAIPVTYALPALFAINAQAGC
FT                   DFIPVGLSLAEAKPKTVQFGVPAILYSRMITGVLAVVIAWVFSIGMY"
FT   gene            complement(586069..586590)
FT                   /locus_tag="LM5578_0572"
FT   CDS_pept        complement(586069..586590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0572"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67327"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464072.1"
FT                   /protein_id="ADB67327.1"
FT                   /translation="MNYIEWFGTNFIGLFEAGGKQFVSFMTGIVPLLIVLLTFTYSIIA
FT                   FIGEERVNRAIQFSAKNMILRYTLMPVLSVLMLTNPMAYTFGRFVKEHQKPAFYDSVVS
FT                   FLHPVTGLFPYANAGELFVYLGIANGVVEAGYSMSSLAVRYFLAGIVVILMRGVITETI
FT                   TKFLMRKEKV"
FT   gene            complement(586615..586995)
FT                   /locus_tag="LM5578_0573"
FT   CDS_pept        complement(586615..586995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0573"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67328"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464073.1"
FT                   /protein_id="ADB67328.1"
FT                   /translation="MNIVLIASLIFIAQTCLGFFQVKYYQHHMNKVANKYAGKIGYHLY
FT                   SEMERLKFRTSAVAILVVNENHIVHECQILTGKTVFAQFKTFTNYHHKELSEILTELSS
FT                   KNKNTIQEKAIIKTVNSCMKAL"
FT   gene            complement(587050..588300)
FT                   /locus_tag="LM5578_0574"
FT   CDS_pept        complement(587050..588300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0574"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67329"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464074.1"
FT                   /protein_id="ADB67329.1"
FT                   /translation="MTLYRQLLARENENNPIRVGVIGAGQMGFGMISQIAAIPGMSVVG
FT                   ISDIHVEAAQKAADAYNATATKKEKILLSNDFKEIIHSDLVEVVVDATGVPEVGAKISL
FT                   ETLLAKKQLVLLNVEIDITIGPLMKKLYDSAGLVYTGSDGDEPAAITELYEFSKSMGME
FT                   VLVAGKGKNNKLKISANPDSCQVEADGKNMASHMLAAFQDGTKTMAEMNLLSNAIGYVP
FT                   DVVGMHGISGDVDSVIKDLDLKDQGGILNKFGVVEYVDGLAPGVFVIVKGQNEGVSHEL
FT                   SYLMKKGDRDHHILYRPYHLASLETPLTIAKAVLNHDHAIVPMGAPVSETVAVAKKDIA
FT                   AGEKLDGIGGFCVRGVLETHVDMATNGHIPIGLISGEVVARRNIKAGTFITDEDVSLDE
FT                   STTVWKLRKLQDETFSK"
FT   gene            complement(588558..589505)
FT                   /locus_tag="LM5578_0575"
FT   CDS_pept        complement(588558..589505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0575"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67330"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464075.1"
FT                   /protein_id="ADB67330.1"
FT                   /translation="MKWEEKRDMVKIATWYYHYGWTQAQIAKKIGISRSIISKTLQRAK
FT                   DLGIVEIFIKDETYYTVDLEQKLEEKFGLEEAIVVATHDMSEEEALNFLAKEAAYTLSK
FT                   RIAKVKTLGISWGKTIRKFANEFPFIPHKDLTIIPLIGGMGSSDIDLHSNQICYDLKKK
FT                   MKCHSKYLYAPALVEDTEMKTDLSKNKYISEVLEEGKTVDMAIVGVSSPYNHSTMEEIG
FT                   YINSEDIEELRYKDVVGDINSRFFTADGKEAKTEINTHVIGLSLEELKNIPTVVALANG
FT                   LQKKEALVAALNAGLIDVIVITDRMAEYILQKND"
FT   gene            589872..590537
FT                   /locus_tag="LM5578_0576"
FT   CDS_pept        589872..590537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0576"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67331"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464076.1"
FT                   /protein_id="ADB67331.1"
FT                   /translation="MEKLFTYKEFVDMMQKYGIRHTKRKLRRGENLMENASKFSNVVLL
FT                   INGYISSYTYESPEKLLSIFEPGIFLRYSILEDQPEFVTNIALSDNCEVYEYKKEDIEY
FT                   ALTLFPENFGFQYFFLKRIGRHLYYRALLNGKEHKEKLYYAMKYLGELIGKTDENGNVS
FT                   LPPEVTLKVLIEYSTLSKAAFYRQRIRLLEQEILKPHENTFIVQKKVASHYEDQLTSI"
FT   gene            590555..592576
FT                   /locus_tag="LM5578_0577"
FT   CDS_pept        590555..592576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0577"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67332"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464077.1"
FT                   /protein_id="ADB67332.1"
FT                   /translation="MKFNWKVVLLFVLILALIVPVYSKAVETGKELPKSPELQDDKSST
FT                   LKNVNTPKNLKASPLTIPANSTIADLFPDEGMAKTIANQLARVENNNFQTPTKTDWKVD
FT                   DVVTEVELNKIVFLTSVATIGSIEGIQYLPNLYDVRLQFDKQCKDLSPFLKAPNGYSQL
FT                   YRLNINNGNISDISPLTELSAPTLNDIDLGGNNISDLSLFPKLPNKLPNLEEISLERNN
FT                   ISDVSPLAKFASTKIKIFNLDENHITDLSSLTNNKMPNLQRLYVRYQTLDMEPVVTSSK
FT                   YEFSIQPSIFGTTKPVKITATKPKATIDPITSKITYSAEEMAKKPFYYSPLFPGVTYSW
FT                   DENFPLNGSNSLVDFRGTITQPLTYIEPPQVVSYNSGLTYEIGTSLTEQQFLNDVNLIT
FT                   DQPTTITSDFDVKLKNLNTVGIYWVAVKASNIEGNAEANIMVTIKYKPPVITADAEYTY
FT                   LVGDKVNATQFRADVNATLTGEGTLRDDFIYKVRLNTAGDYVVTLTSPKSGYYEQDAIP
FT                   VTVIVHVKELLELQIPDEFRMDIDANADSVPISDKKQTLKCYGSSGKAELEVIDRRTVR
FT                   QGWTITGAMTPFTNSGGDILQTSLKYQSKSPSSSPIYLNTTNQPIEKKQSAVTDPKYDS
FT                   TVFNLEDSLSMEIEPNDALVNDSYESKITWTLEDAPRP"
FT   gene            592609..592905
FT                   /locus_tag="LM5578_0578"
FT   CDS_pept        592609..592905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0578"
FT                   /product="pepdidoglycan bound protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67333"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464078.1"
FT                   /protein_id="ADB67333.1"
FT                   /translation="MKKMGFILICCLFVCASPFYVKANTDKATSKAGVIFTHDPRKPKT
FT                   GTDDRSGTFPTKVPPKRLPKTGDTTDFYLVLLGFGFILIAKKGYFKEVREEIR"
FT   gene            592949..593791
FT                   /locus_tag="LM5578_0579"
FT   CDS_pept        592949..593791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0579"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67334"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464079.1"
FT                   /protein_id="ADB67334.1"
FT                   /translation="MTSRTVKVTTASLLALGLIVAPVLSGDFASAATSVTKDSKGIVKF
FT                   DKSTTPDPDPVNPDPVDPDPVIPDPTDPPVGTDGLWILAVSDWDFGTHNVSSLSSGALN
FT                   VHAADDTISTYVDANGNGQQDLPGEVSVTKKVTPYAQISDVRGTNTGWTLSVTGSAFKD
FT                   SSTPAKTIPGAELTIPKSTVSSATSTAQAPTGYDSVTISMTGGAAVPVMAAKDMQTATP
FT                   TNFNDDQGMGTWTDSFGSQAVSATDTSKPKLSIPKNVVVADGTYQSTLTWTLSDTPAV"
FT   gene            593867..594898
FT                   /locus_tag="LM5578_0580"
FT   CDS_pept        593867..594898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67335"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464080.1"
FT                   /protein_id="ADB67335.1"
FT                   /translation="MKKICAIIFACILAILCFPGQQAYATENSSFSVKAILPDNQASSV
FT                   TYFDLQMNPKQKQTLKVEITNHSKEKIIVNCIANTAVTNEMGYVDYSIPNTKPDKTLKY
FT                   PFADIVKESVSEVTLKPNETKIWTAAIQMPAENYDGIILGGLHFQEKKEEDKEKESSEN
FT                   DVQIKNEYAYVIGVKLTEKTTVVKPELELNQIKPATRNYRNVVEMNLQNTKATLVGGLA
FT                   VDAKIYKKGSEKVLHESKRTDLSMAPNSNFNYSVDWENQELKPGKYKVHLVAKNKEDKW
FT                   EWTKEFTISSDQAKKANKAALGLEKDYTWMYIVGGVLLSILLIITTYFVGKRAAKKKQE
FT                   NEK"
FT   gene            complement(594955..595590)
FT                   /locus_tag="LM5578_0581"
FT   CDS_pept        complement(594955..595590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0581"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67336"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464081.1"
FT                   /protein_id="ADB67336.1"
FT                   /translation="MLIKNLCIPKINLTTVPGDATLQEAIHLLEESGYRCVPVLDEKGE
FT                   KFLGNIYKMHIYKHAANGGSLSDPVMSLIKNATKHICVNASFFEVFFTIKELPYIAVLN
FT                   EQGNFYGILTHGKLLGLLQDGWNVKTTSYVLTIATGEVQGALTKITKIIDRYSSISSLI
FT                   TLDNQTEDFIRRVLVSLPVGVTEEKKNEIVSHLERKGLRVVETEKIEK"
FT   gene            595800..596981
FT                   /locus_tag="LM5578_0582"
FT   CDS_pept        595800..596981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0582"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67337"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464082.1"
FT                   /protein_id="ADB67337.1"
FT                   /translation="MQKEMLNFDYYNPTHIIFGKNRFNELNEVIPQDKKVLILYGGGSV
FT                   ERFGTLDKVKAALKSREVGEFGGIEANPTYETLIKAIQLVKEENYDFLLAVGGGSVIDG
FT                   TKFVAAGALFDGEPMDIFGSGIGEKRPITKALPFGTVLTLPATGSEMNSGGVITFVEKK
FT                   AKLGFGSAYTYPVFSLLDPELTYTLPKRQLANGIMDAYVHVMEQYMTYPVGALLQDRYA
FT                   ESLLQTLIEIGPDVIKEDNHDYNTRATFMWSATNALNGTLSRGVPQDWASHSLGHEITA
FT                   LYGIDHARTLAIVLPSLLNVRRSEKHDKLVQYAERVWGITSGSDEEKIDAAILKTREFF
FT                   ESLGAGTRFSDYGLGEEVVDLLVDQLDRHGLTNISERGDQTLEVSRQIYTNAL"
FT   gene            597071..598549
FT                   /locus_tag="LM5578_0583"
FT   CDS_pept        597071..598549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0583"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67338"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464083.1"
FT                   /protein_id="ADB67338.1"
FT                   /translation="MSTNKEKTFFGHPRGLATLFNTEFWERFSYYGMRALLLYYMYTAV
FT                   ADGGLGFSQSTATAIMSIYGSLVFMSGVIGGWFADRVLGARKTIFYGGVLIMVGHIVLA
FT                   LPNGGAAALFGSMAFIILGTGLLKPNVSNVVGDLYPAGDNRRDAGFSIFYMGINLGAFI
FT                   APPIVSAVSDNAGSYHAGFGVAAVGMAIALVVYVLTGKRYLKDAGKKAPNPLQRSEAKS
FT                   LTFKIIGIVLGIGLLIAVLTLITGSLTIDTIILAVTVMGVGVPLAYFIMMMTSKKTEAD
FT                   EKSRLTAYIPLFLIAVLFWMIEEQGSSTLALFAAERTDLSIWGMNLNPANFQSLNPVFV
FT                   ITLSPIFAWIWTKLGDRQPSTPRKFALGLFFAGLSFVVMMLPGILHGNTTTLVSPLWLV
FT                   LSFFICIFGEMFISPVGLSATTKLAPKAFASQTMSLWFLSDAMGQSFNAQLTQLFNADT
FT                   EIAYFGITGFVAIAFAIALFIFAPFLKKYMKGVH"
FT   gene            598678..599385
FT                   /locus_tag="LM5578_0584"
FT   CDS_pept        598678..599385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0584"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67339"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464084.1"
FT                   /protein_id="ADB67339.1"
FT                   /translation="MESSSRVVIYLTRHGKTILNTLDRVQGWADSPLTEEGALVAHDLG
FT                   RGLKGTNFVAAYASDRGRAIETARIVMKESDNHHLKLEKLAEMREFGFGKFEGEYNQAV
FT                   LKMVAKAHGFESIESYYDKTSENNSNIVIDTVHKMDETGMTENSAIFEERLTAGLDTIL
FT                   ADAKNRGGGDVLVVAHGMVIHRIIEMIDPSKNLRIIENASVTKVIFEDGAYSIEEPGNM
FT                   LYVEAGKKAQGGV"
FT   gene            599386..600081
FT                   /locus_tag="LM5578_0585"
FT   CDS_pept        599386..600081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0585"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67340"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464085.1"
FT                   /protein_id="ADB67340.1"
FT                   /translation="MATGKLNVYLVRHGKTMFNTSRRVQGWSDTPLTNEGIEVAEFLGR
FT                   GLREIPFDAVYTSDRGRTIETAGIVLRESNQAHLEINELRDFREFGFGKFEGEYEDIMF
FT                   GRVMEHLGFRSMEEAFEKFGDDGYQIISETVEKIDETGMSENWDEMVARLKNALGTVSA
FT                   ENEVENANVLVVSHGMAINTIISFFDKSLINPDLANASVTRLGFENGEWTIETVNDLSY
FT                   IEAGKLVLV"
FT   gene            complement(600123..601163)
FT                   /locus_tag="LM5578_0586"
FT   CDS_pept        complement(600123..601163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0586"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67341"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464086.1"
FT                   /protein_id="ADB67341.1"
FT                   /translation="MSKNQATAYIGTYTKAESQGIYRLVIDKTTGEIKENKLAGKMDNP
FT                   TYLKISDDEKFVYSVAKDGDKGGVAAFSVEEDGSLTFIGQDVQTGNPPCYVDASHDGSI
FT                   VVSANYHLGTIVSYPTENGALKPSVSTIQHTGKSVHERQEKPHAHFAGFTPEQKYVITC
FT                   DLGTDKVTTYSANAGKLEKVTELDVKPGSGPRNLVFHPNAKYVYIMTELTSEVIFAEYD
FT                   EATGALKVIQTIASLPEGFDKENKGSAIHISPDGRFLYVSNRGQDAIVSYAVAENGTLT
FT                   LATTTPVEGVGPRDFDLNYTGEILVATNENSNNVTVFGVNKETGALTLLQKDVKVPEPV
FT                   CIKFVK"
FT   gene            601554..602468
FT                   /locus_tag="LM5578_0587"
FT   CDS_pept        601554..602468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0587"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67342"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464087.1"
FT                   /protein_id="ADB67342.1"
FT                   /translation="MNKMSIQTIFGNGQYNWINIDTDNTDKLADFYEEYHIDDEVIAYS
FT                   IDRNERAHFEYDQKTNTFVIVFNVPDQRKIDNHYETIPMVFIIKDKQLITITNNDNQYI
FT                   TRKMKRYLKESDEVTIFQFLFSSLYFIMDAFFPYVEEMDTDRRTINDKLKIKTTKKNLL
FT                   SLSDLETGIVYFVSASKQNAALLEQMKAHMIYRELNEVEKEQFEDALIEARQLVEMTGL
FT                   SSQILQQLSGTYNNILNNNLNDTMKILTALSILLTVPTIITGFFGMNMPLPLEHNTFGW
FT                   IVTIFISVILWFGLSFILRKLMR"
FT   gene            complement(602511..603887)
FT                   /locus_tag="LM5578_0588"
FT   CDS_pept        complement(602511..603887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0588"
FT                   /product="glutamate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67343"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464088.1"
FT                   /protein_id="ADB67343.1"
FT                   /translation="MAQTSTIQNDTKAAEEYAARVFETIKQRNPGETEFHQAVEEFLNS
FT                   VIPALAKEPKYEANGILEQLTEPERLISFRVPWVDDSGTVHVNRGYRVQFNSAIGPYKG
FT                   GLRFHPSVTGSIVKFLGFEQIFKNSLTGLPIGGGKGGSDFDPKGKSDSEVMRFCQSFMT
FT                   ELQKHIGPDTDVPAGDIGVGGREIGYLFGQYKRLRGAYDAGTITGKGLSYGGSLARTEA
FT                   TGYGLVYFTVEMLEAAGETIRGKKIVVSGSGNVAIYAIEKAHELGAKVVACSDSAGFVY
FT                   DKEGIKVETVKQLKEVERKRISEYTTIHPSAEYYAGGDVWSVPCDIALPCATQNEINAD
FT                   QARALVKNGVIAVAEGANMPSTLDAVDIYHENKVLFGPAKAANAGGVAVSALEMAQNST
FT                   RMSWTFQTVDEHLQNIMKDIYKNSSNAASEYGAPGNLVIGANIAGFLKVADTMISQGII
FT                   "
FT   gene            complement(604380..604691)
FT                   /gene="hisE"
FT                   /locus_tag="LM5578_0589"
FT   CDS_pept        complement(604380..604691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisE"
FT                   /locus_tag="LM5578_0589"
FT                   /product="phosphoribosyl-ATP pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67344"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464089.1"
FT                   /protein_id="ADB67344.1"
FT                   /translation="MLNDLYEEIKLRKTQPREGSYTNYLFDKGLDKILKKVGEEATEVV
FT                   IAAKNDNQELIAEVSDLAYHLLVLLAEKNIPLVAIQTELQKREGKLSTTRDRKEINDL"
FT   gene            complement(604692..605009)
FT                   /locus_tag="LM5578_0590"
FT   CDS_pept        complement(604692..605009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0590"
FT                   /product="phosphoribosyl-AMP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67345"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464090.1"
FT                   /protein_id="ADB67345.1"
FT                   /translation="MISVDFSKGLVPTIILDDQNGDVLMLAYMNEESYQKTLETGYTWF
FT                   FSRSRNELWNKGATSGHTQKVKQIWTDCDNDTLLIRVTQIGPACHTGKKSCFFNLIKED
FT                   F"
FT   gene            complement(605006..605761)
FT                   /gene="hisF"
FT                   /locus_tag="LM5578_0591"
FT   CDS_pept        complement(605006..605761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisF"
FT                   /locus_tag="LM5578_0591"
FT                   /product="imidazole glycerol phosphate synthase subunit
FT                   HisF"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67346"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464091.1"
FT                   /protein_id="ADB67346.1"
FT                   /translation="MLTKRIIPCLDVTAGRVVKGVNFVSLTDVGDPVEIAKAYNEAGAD
FT                   ELVFLDITATVELRQTMIDVVERTAEQVFIPLTVGGGISSVSDMKELLQAGADKISLNS
FT                   AAIKRPELIQEGAAKFGNQCIVVAIDAKWNGTNWSVFTRGGRNDTGLDAIEWAKKAVQL
FT                   GAGEILLTSMDGDGTKNGYDIPLTKAISEAVSVPVIASGGCGNAAHMVEVFEKTKATAA
FT                   LAASIFHYGELSIKNVKKTLLEKGVNIRP"
FT   gene            complement(605751..606473)
FT                   /gene="hisA"
FT                   /locus_tag="LM5578_0592"
FT   CDS_pept        complement(605751..606473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisA"
FT                   /locus_tag="LM5578_0592"
FT                   /product="1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]
FT                   imidazole-4-carboxamide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67347"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464092.1"
FT                   /protein_id="ADB67347.1"
FT                   /translation="MQIFPAIDLKNGQCVRLFQGDFSKKTVVNEDPIAQAKAFATDGAT
FT                   YLHIVDLDGALEGRPINLEVIQKMKITAKIPVQVGGGIRSMAQVDYYLESGIDRVIIGS
FT                   AALTDPDFLRAAVQKYGAKIAAGIDAKNGFVATRGWLDVSQVSYLDLAKRMEKVGVETI
FT                   IYTDISRDGTLTGPNLEQMANLKEHVKVNLIASGGVSSRADLEALAQLGLYGAIAGKAL
FT                   YNHHISMSDIVEVEQIAY"
FT   gene            complement(606452..607078)
FT                   /gene="hisH"
FT                   /locus_tag="LM5578_0593"
FT   CDS_pept        complement(606452..607078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisH"
FT                   /locus_tag="LM5578_0593"
FT                   /product="imidazole glycerol phosphate synthase subunit
FT                   HisH"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67348"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464093.1"
FT                   /protein_id="ADB67348.1"
FT                   /translation="MIVIIDYDTGNTKSISKALDFIGLQNKISSDATEISQADGVILPG
FT                   VGAYPEAMKELTRRGLNKTLKEIAAGGKPILGVCLGMQLLLESSNEHSFTNGLGLIPGH
FT                   VEKLPEDPEFAVPHMGWNQLQIKRATPLTKQLDGEYVYYVHSYYANCPEEYIIATSGYS
FT                   IEVPGMINKGNIYGAQFHPEKSGQIGLEILKGFKEVTYSCKSSQQ"
FT   gene            complement(607079..607663)
FT                   /gene="hisB"
FT                   /locus_tag="LM5578_0594"
FT   CDS_pept        complement(607079..607663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisB"
FT                   /locus_tag="LM5578_0594"
FT                   /product="imidazoleglycerol-phosphate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67349"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464094.1"
FT                   /protein_id="ADB67349.1"
FT                   /translation="MRTATKTRVTAETSIELSINLDSQVESTISTGVGFLDHMLTLFAK
FT                   HSRVTLNVKADGDTYVDAHHTVEDIGITLGLCLKEALADKASINRYGSAYVPMDESLGF
FT                   CALDLSGRSYLVFDAELTNPKLGDFDTELVEEFFQAVAFNTEMNLHLRVLYGKNTHHKI
FT                   EALFKAFGRALREAITINPEIKGVNSTKGVL"
FT   gene            complement(607664..608947)
FT                   /gene="hisD"
FT                   /locus_tag="LM5578_0595"
FT   CDS_pept        complement(607664..608947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisD"
FT                   /locus_tag="LM5578_0595"
FT                   /product="histidinol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67350"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464095.1"
FT                   /protein_id="ADB67350.1"
FT                   /translation="MKILTGTINELLNEVKAENNTNNSLQVESEVKSIIEKVKKDGDQA
FT                   LFDFTSQFDGVRLTELRVQTADIQSASSKVDPAFLVALQQAKANIESFHSKQKQHAFLD
FT                   SEKDGVIRGQLIRPLETVGIYVPGGTAAYPSSVLMNVLPAKIAGVKRIVMITPPAENGI
FT                   NPHVLAAAQLAGVDEIYQVGGAHGIAALAHGTESIPKVDKIVGPGNIYVATAKREVFGL
FT                   VDIDMIAGPSEIVVLADENANPAFIASDLLSQAEHDILARAILITTSKKIAEETQNEIN
FT                   KQLENLPRKAIAQKSIETQGKIIIAANTQEMFDIMNEIAPEHLEVQLENPMNYLNQIKN
FT                   AGSIFLGSYASEPLGDYFAGPNHVLPTSGTAKFFSPLGVEDFTKRSAFISYTKEALAKE
FT                   KDAIVLLAKKEGLDAHAKAIQIRFEEEN"
FT   gene            complement(608944..609585)
FT                   /gene="hisG"
FT                   /locus_tag="LM5578_0596"
FT   CDS_pept        complement(608944..609585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisG"
FT                   /locus_tag="LM5578_0596"
FT                   /product="ATP phosphoribosyltransferase catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67351"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464096.1"
FT                   /protein_id="ADB67351.1"
FT                   /translation="MKALKIALTKGRLEKDAVALLEKAGIDCSSMTDKKRKLIFHSSTQ
FT                   PISFILVKAVDVMTYVKHGVADIGIVGKDVLMEASKSHYEMLDLEIGKCQFCLASTPDF
FT                   DPSSYRRKIIATKYPTVASKFFREKGEDVEIIKIEGSVEIAPVLDLADAIIDIVETGST
FT                   LKENGLIIYEKMYPISARLIVNKASLKQNKTQIFHLIDQLEQAIKEELAE"
FT   gene            complement(609582..610763)
FT                   /gene="hisZ"
FT                   /locus_tag="LM5578_0597"
FT   CDS_pept        complement(609582..610763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisZ"
FT                   /locus_tag="LM5578_0597"
FT                   /product="ATP phosphoribosyltransferase regulatory subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67352"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464097.1"
FT                   /protein_id="ADB67352.1"
FT                   /translation="MNLNKNLPTGTRDKLFREARAAYKIEQQVNHYFEKRGFKRIETPV
FT                   IEFEDVFSSEHQADAKLYRFFDEKGRLTVLRPDMTLPIGRVVSTTGVMLPLKLSYSGKI
FT                   FRANEDFGGEQNEQTQAGIEIIGYPSIKAEIECILIGIGVLNALEIPNFQIELGHAAIY
FT                   RRVTNLLNLSETAEIDFRLLIQNKSLTGIKRFVADNPSTLDDFILVLPRLFGPATAILK
FT                   QAKNLTTDKGILTALREMETIVEAVSYTADISVDLGLVQDFHYYTGIIFRGYADLAADN
FT                   FLSGGRYDHLLEQFTSASSPAVGLALNLDSLTTLQNRAGVIKKQVSTSLLIHYDLDAIQ
FT                   QAEKLMQETPNSELSFFETPTNAISFAKKWHIPAVIHVSRQGIQTIFQREADL"
FT   gene            610915..611742
FT                   /gene="hisJ"
FT                   /locus_tag="LM5578_0598"
FT   CDS_pept        610915..611742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisJ"
FT                   /locus_tag="LM5578_0598"
FT                   /product="histidinol-phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67353"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464098.1"
FT                   /protein_id="ADB67353.1"
FT                   /translation="MKRDGHTHTEFCPHGTHDDVEEMILKAIELDFDEYSIVEHAPLSR
FT                   EFMNNTAGDKEAVTTASMAMSDLPYYFKKMNHIKKKYASDLLIHIGFEVDYLIGYEDFT
FT                   RDFLDEYGPQTDDGVLSLHFLEGQGGFRSIDFSAEDYNEGIVQFYGGFEQAQLTYLEGV
FT                   KQSIEADLGLFKPRRIGHISLCQKFQQFFGADTSNFSGEVMEEFQAILALVKKRDYELD
FT                   FNTAGLFKSLCGETYPPKEIVTLARELKIPLVYGSDSHGVQDIGRGYNTYCQK"
FT   gene            complement(611727..612023)
FT                   /locus_tag="LM5578_0599"
FT   CDS_pept        complement(611727..612023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0599"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67354"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464099.1"
FT                   /protein_id="ADB67354.1"
FT                   /translation="MVPADFEERVYTVVRQIPRGKVTTYGQIAYMIGFPKNARLVGATL
FT                   KHSKRDQITPCHRVVNAAGRLVPGWEEQRELLLSEGVTFKENGHVKMKDHFWQ"
FT   gene            612100..613131
FT                   /locus_tag="LM5578_0600"
FT   CDS_pept        612100..613131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67355"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464100.1"
FT                   /protein_id="ADB67355.1"
FT                   /translation="MPDFSYTKITKLVVHFAGNKAREEGTEVSANVLADIGSEMNQTLA
FT                   SIFLEPFKKDEYYQFTHETDLDFNEVRTFAANMFVAEEEFLDESKKILEHLYSETTHPN
FT                   IKSGDVWIFFIEGCVVDGDFTNGIGIFKVENKEVFLKNDFNGREFQIGYDKGITGTDLD
FT                   KGCLIFNVDHDTGNKVLILDRLNRGDSVYWKDKFLSIDKITDEKFYTEGFVEVCTDYIK
FT                   QREESLLDKSNFVKATTEYLAGEETLNIAEFARTTIEKPEEITEFNTMVDTFERENNVR
FT                   FPETFQLDEEKREKLSKKIRKTIKLGKNISVVVKDLEQLEETDFVQGYDEEKGKNYMIV
FT                   YYD"
FT   gene            complement(613172..614467)
FT                   /locus_tag="LM5578_0601"
FT   CDS_pept        complement(613172..614467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0601"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67356"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464101.1"
FT                   /protein_id="ADB67356.1"
FT                   /translation="MDKFFKLRENKTTVRTEILAGLTTFLSMAYVLFVNPSMLATTGME
FT                   LKAVFVATILASVVGSLAMGLIANYPIGLAPGMGLNAFFAYTVCAQWGIPWQTALAGVL
FT                   VSGLVFICLTISGLREKIVNAIPTELKFAVGAGIGFFIAFLGLKNAGIIVPNESTIVAL
FT                   GDLHSGPVLLAVFGIVVTVAYMTIGWKGAIFFGMATTAVAGMLFGLIDVPTQVVSSVPS
FT                   MESTFGQAIIHLPDIFTPQMLIVILTFFFIDFFDTAGTLVAVATQAGFVKDNKIPRAGR
FT                   SLFSDSLATVFGAIFGTSTTTSYVESTAGVAVGGRTGLTAVVIAICFSLSLFFSPLLGV
FT                   ITSAVTTPALVIVGILMIGNVAHIDWTKFEVAVPSFFVILMMVLTFSIATGIAIGFIFY
FT                   PITMVLKGRYKEVHPIMYVMMVLFILYFMFVV"
FT   gene            614783..616177
FT                   /locus_tag="LM5578_0602"
FT   CDS_pept        614783..616177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0602"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67357"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464102.1"
FT                   /protein_id="ADB67357.1"
FT                   /translation="MTYKFPENFWWGSAASGPQTEGAADVDGRKPSIWDHWYKIEPGRF
FT                   FNDVGPTNTSNFYYQYKEDIALMKQTGHNSFRTSIQWSRLIPDGIGEVNPKAVDFYNRV
FT                   IDEMLANDVEPFMNLYHFDMPMSMQEKGGFESREVVDAYATFAKTCFELFGDRVKHWFT
FT                   FNEPIVPVEAGYLYDMHYPNVVDFKRATQVAYHTTLAHALAVKEFHALEIPEGQIGIIL
FT                   NLTPSYPRSQNPADLKAAHIADLIFNRSFLDPVTKGEFPTDLVEIIREHDALPEYTEED
FT                   LAIIKNNIIDILGVNYYQPRRVKAKEYAAHPDAPFMPEHLFDNYEMPYRKMNPYRGWEI
FT                   FERAIYDIAINLRDNYDNIPFFISENGMGVEGESRYRNADGMIEDTYRIDFIKSHLKWL
FT                   HKAIEEGANCHGYHLWTFMDCWSWANAYKNRYGLVEVDLDNDFKRTVKASGHWYKELAE
FT                   NNGFED"
FT   gene            616221..616949
FT                   /locus_tag="LM5578_0603"
FT   CDS_pept        616221..616949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0603"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67358"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464103.1"
FT                   /protein_id="ADB67358.1"
FT                   /translation="MAQNQTKYSFIAEEIRKRIMNHAYPLNQPIPDEITLAKEFDCSRM
FT                   TMKKALEVLVLEGLLYRKRGHGTFIIKSALDADRLQIHNQEVNGFTKLLNGKKVISKVI
FT                   EFKVIFPTEEIAERLHIEMETPIYDILRVRLVKDEPYVLEHTYMPVGVIPGINQQILEG
FT                   SIYSYIQDDLNLKIASSYKQIRADKATLLDQQYLDCASDDPVVEVEQTVYLNNGLAFEF
FT                   SRSRHRYDKFVFTTVNIARR"
FT   gene            617379..618842
FT                   /locus_tag="LM5578_0604"
FT   CDS_pept        617379..618842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0604"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67359"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464104.1"
FT                   /protein_id="ADB67359.1"
FT                   /translation="MKKKYFLCVFAVILFFTGFLFGNSPVNAAETDTSNVTYNYINIST
FT                   LTETQKNSIIKGNPNETLTNDYENFSFVYQKNTSEPTTNIDNTSDNNKNQNGTLLKAGD
FT                   VGANSYLIILGFILFGSGIGLITLKKRHAKQLLVFLVVLGGSSLLVGSIVQATENSNLK
FT                   TQESQTVAKGTKETKQPESIEGYTYVGYIHTSKNNTPPVVGKGTVTVNYQDEQGNSLAT
FT                   SETLEGDIGQLYQTATKNIEEYQLKEVNGNTTGTFTEKAQVVTYVYQKVPVATVTVKYL
FT                   DQDGNKIHDPQTISGNIGEPYDASTDKYKLQIDGYTLDTTKLPNNANGIFTNQAIEVTY
FT                   IYTKEAQDVKITIKFVDSNGDPFVLTDLTTYKNGDLVPIYPNLDQYHMRLNYNQQIYNQ
FT                   GEAVPDIVIPTKEGETYLLPERMTFNILDDQGKQIPYVISQNADFSSTGIERWENYQSI
FT                   PANREGTLTSEDVVVTYQILVYGVLIPEP"
FT   gene            complement(618896..619354)
FT                   /locus_tag="LM5578_0605"
FT   CDS_pept        complement(618896..619354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0605"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67360"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464105.1"
FT                   /protein_id="ADB67360.1"
FT                   /translation="MDLVWTIIIQLVLSYVATVTFAIITNVPKRALNACGITGTFGWMA
FT                   YWTLMQMDSGTGASSLAGAFVVAVLSHFFAKHKKMPITIFNVPGIVPLVPGGLAYQAVR
FT                   NFVLGDYTEAIGFSVQVTVVAGAIAAGLMLSEVFNHSIRAFRGRKERI"
FT   gene            complement(619368..620120)
FT                   /locus_tag="LM5578_0606"
FT   CDS_pept        complement(619368..620120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0606"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67361"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464106.1"
FT                   /protein_id="ADB67361.1"
FT                   /translation="MSNETTDYLLETCLMAGKIMMESGAEMYRVEDTMNRIATVASNKK
FT                   GISFVTPTGLFMSLEGERNVQLQQIPTRTINLEKVSMVNEFSRDFAEKRISLKELHTKL
FT                   VNLDKDVRYFPIWLQIIAASLVSGSLMVIFGGGWFDFIPTCIIGAIGFIIFYYTQIFMK
FT                   VKFLAEFLASLSVGLLAVLTISVGWGINLDTMIIGGVMPLVPGVPITNAVRDLLAGHLL
FT                   SGMARGTEALLTSCAIGIGIAVVFRFFL"
FT   gene            620285..620494
FT                   /locus_tag="LM5578_0607"
FT   CDS_pept        620285..620494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0607"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67362"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464107.1"
FT                   /protein_id="ADB67362.1"
FT                   /translation="MANIEYEIIEEIGVLSENARGWRKELNKVSWNGRPPKYDIRDWSE
FT                   DHEKMGKGITLTDEEAEVLKKLLD"
FT   gene            620510..621172
FT                   /locus_tag="LM5578_0608"
FT   CDS_pept        620510..621172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0608"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67363"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464108.1"
FT                   /protein_id="ADB67363.1"
FT                   /translation="MRMFAYDIYEPIGRKDEDTFPVIFALHGFGGDELEMAGRLELLMD
FT                   RFVVVSMRGDVEYGPAYGFYHMVTEGDPNPREVDYISLRVAQFIDKICTDYISIDKEQV
FT                   FLAGFDQGAVLAISIMQSYGGQYKAAALLSGRLPYYMEERPANLMLKDKRIFIGHGIED
FT                   AVIQISEADDIARLFEKMGCQVEKHRYFIGHNVNEAEEDDLYRWFESFLPNQPVKNK"
FT   gene            complement(621203..622387)
FT                   /locus_tag="LM5578_0609"
FT   CDS_pept        complement(621203..622387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0609"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67364"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464109.1"
FT                   /protein_id="ADB67364.1"
FT                   /translation="MKNLVKVKVFPKFTKGYKEGYPLILKERMEKWPKELQEGDVLELT
FT                   DTNGQFIARGYHGEQNKGSGWLFTWDKKQQLDEDFLTNLITTAIEKRQFLFADDSTTAF
FT                   RIFNGEGDGLGGFTVDYYDGYLVIQWYSLGIYAFQKMIIDIFLSFPEIKGIYEKRRFQE
FT                   DTKDDFVAGQKATFPLIIKENGINYATYLDDGWMTGIFLDQRDVRRRISEDYSVSKNVL
FT                   NTFSYTGAFSVAALFGGASKTTSVDVAGRSLSKTKEQLEVNGLDPNEQAIIVEDVFHYF
FT                   KYAARKQLTFDLVVVDPPSFARTKKVTFRAAKDYPAMLREIIDITAPNGTIIASTNYAG
FT                   FGMKAFKKLIAEAFQTSDRTYKIVETHSLPADFTVNKNFPEGNYLKVLFLTLDI"
FT   gene            complement(622475..623923)
FT                   /gene="iap"
FT                   /locus_tag="LM5578_0610"
FT   CDS_pept        complement(622475..623923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iap"
FT                   /locus_tag="LM5578_0610"
FT                   /product="P60 extracellular protein, invasion associated
FT                   protein Iap"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67365"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464110.1"
FT                   /protein_id="ADB67365.1"
FT                   /translation="MNMKKATIAATAGIAVTAFAAPTIASASTVVVEAGDTLWGIAQSK
FT                   GTTVDAIKKANNLTTDKIVPGQKLQVNNEVAAAEKTEKSVSATWLNVRSGAGVDNSIIT
FT                   SIKGGTKVTVETTESNGWHKITYNDGKTGFVNGKYLTDKAVSTPVAPTQEVKKETTTQQ
FT                   AAPAAETKTEVKQTTQATTPAPKVAETKETPVVDQNATTHAVKSGDTIWALSVKYGVSV
FT                   QDIMSWNNLSSSSIYVGQKLAIKQTANTATPKAEVKTEAPAAEKQAAPVVKENTNTNTA
FT                   TTEKKETATQQQTAPKTPTEAAKPAPAPSTNTNANKTNTNTNTNTNNTNTNTPSKNTNT
FT                   NSNTNTNTNSNTNANQGSSNNNSNSSASAIIAEAQKHLGKAYSWGGNGPTTFDCSGYTK
FT                   YVFAKAGISLPRTSGAQYASTTRISESQAKPGDLVFFDYGSGISHVGIYVGNGQMINAQ
FT                   DNGVKYDNIHGSGWGKYLVGFGRV"
FT   gene            624342..626672
FT                   /locus_tag="LM5578_0611"
FT   CDS_pept        624342..626672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0611"
FT                   /product="preprotein translocase subunit SecA"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67366"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464111.1"
FT                   /protein_id="ADB67366.1"
FT                   /translation="MRQNYDDRKIVKQYREIARQIVKKEGLYKNMDQAELCEQTNFWRE
FT                   KFKTKPMTDRDKINIFALAREAASRIIGLDAVVVQLIGALVLGDGKVAEMKTGEGKTLM
FT                   SLFVMFIEVMRGNRVHLVTANEYLARRDREEIGQVLEYLGVSVALNESGLDIAQKKAIY
FT                   TADVIYGTASEFGFDYLRDNMVRQKEDKVQSGLDFVLIDEADSILIDEARTPLLISDRK
FT                   EEDLSLYHTANKLVKKMMKDDYEMEEHKRFVWLNDAGIEKAQKFWGVESLYSAEAQSEL
FT                   RITMLLMRAHFLMHKDKDYVVLDDEVLIIDPHTGRALPGRRFNDGLHQAIEAKEGVEVK
FT                   EESRTLATITIQNYFRMYKKISGMTGTAKTEEEEFRQIYNMDVVVIPTNLRVNREDMQD
FT                   DIFYTKKEKGRAIVYEVSWRYEKGQPTLIGTSSIKSNEWISGLLDAAGIPHQVLNAKNH
FT                   AQEAEIIAKAGKRGMVTLATNMAGRGTDIKLDPDVHKLGGLAVIGTERHESRRIDLQLM
FT                   GRSGRRGDPGFSKFMISLEDDLLEQFESKSWEKLSAKLKRKAPRDGKPVNSRKIHAVVV
FT                   DAQKRLEGANYDIRKDLLSYDEVIDLQRKMVYKERDLLLERNKLGVSSEKILREVAEYS
FT                   FIHPSDIPEEELEIYYSRQKELLGGTKFPISFDQVTLMEPREVVEEIVSWHKKERNKFP
FT                   AETIAAIEREVYLNLMDQMWVMHLDAMVQLREGIHLRAYGQQDPLVMYQKEGAQLFEKF
FT                   QADYHFYFAHALLELDPDGLIQG"
FT   gene            626788..627960
FT                   /locus_tag="LM5578_0612"
FT   CDS_pept        626788..627960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0612"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67367"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464112.1"
FT                   /protein_id="ADB67367.1"
FT                   /translation="MKGSFTKFKQFFIENKFVLGLLIFLLVALDIYVLTKIAFIFDPLM
FT                   VILKTVAAPIILAGISYYLFNPIIDWLEKHKWKRGWAIALLYLVIIGLLILLFSFVIPA
FT                   VKDQIVSLFKSFPGYWDQITQKFDEFSRSSLFDQLKDKLNTNMSDIMKTLSTKGTSVIN
FT                   SAISSIGSIVGTVTEVVLAIVTTPLVLFYLLKDGKKLPDFLLKMLPVNGRAHTRQVLGE
FT                   ANHQISSYIRGQIIVSLCIGILLFIGYLIIGLPYALTLAIIAACTSIVPYLGPAIAITP
FT                   AIIIAIVTSPWLLIKLIIVWCVVQLLEGKFISPQVMGKTLKVHPITILFVILVAGNLFG
FT                   VLGVIFAVPGYAVLKVIVTHVFIWFKRISGLYGEQPESEYVETPTEEKEL"
FT   gene            628219..628932
FT                   /locus_tag="LM5578_0613"
FT   CDS_pept        628219..628932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0613"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67368"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464113.1"
FT                   /protein_id="ADB67368.1"
FT                   /translation="MIFKKTLIVGLIGISSVTLFAPSAFAVTSEGDSKATVKFKAGTGV
FT                   VDPVDPENPTKPIDPLDPSNPTDPGTGNTGSLTLDYVSSVNFGEHEVSSTEQSYSSTSR
FT                   KPFIQISDRRGTGAGWKVTATATAFQNEDGAASLSGATLSFKNGETASASTTATTPTAA
FT                   QTVELPTDGTSIVSVVSAKESEGMGTWINRWFGATPNDTASLNDNVQLTIPAGSATLGD
FT                   HEATITWTLSDAPGV"
FT   gene            629000..630025
FT                   /locus_tag="LM5578_0614"
FT   CDS_pept        629000..630025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0614"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67369"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464114.1"
FT                   /protein_id="ADB67369.1"
FT                   /translation="MKKSFLSLLFIIPLLVTCSNFTEAQAAEGDVGYSVQAHIPANQID
FT                   KRQTYFDLKMQPNQKQTVEIDVMNSSNEEIQVEAAINYASTNRTGVIDYTKNDLTKKDK
FT                   SLKYPLPELAEIPDDQKRLTIPVNGKKTVQVMIEMPAEKVDGVVLGAVEFKKKNTNETK
FT                   KTKGVSLKNEYSYIVGMQLSETDKQVKPHMNLLSIKPALINYHTAIVAKLQNDQPVILE
FT                   NLSIDAKVYQQNSDKLLYQTKKTDMKMAPNSNFDFGIDWENQPLKEGKYRLKMTATNGV
FT                   ETWTWDEAFTIGKEGQNLNKEAVNLEKTNTWLYVAIAAGVVLIALIIILVIRKRRNKQE
FT                   K"
FT   gene            630043..632508
FT                   /locus_tag="LM5578_0615"
FT   CDS_pept        630043..632508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0615"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67370"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464115.1"
FT                   /protein_id="ADB67370.1"
FT                   /translation="MAFKKLILVLTMAALFLGLKIVVAAENEPTDLASNEAIVTNFADL
FT                   KTAISEDNGIDTVYLGADVELSGGIIIPATKKTFTLSGKNPATGEIHTLTETMASAGAQ
FT                   SSVITVNTNTGAKETTLKDINVVGKNYYGTISVYGAAKNVVQNYENVHYQGPQMIYNLN
FT                   GTANFKGTNDITIASVVSGSAAPNEVAEIKGVSASGKLTINHASSNANSAFWFGGGTAE
FT                   VNTFTVEENADVTIISNGTGMFYRSGTKPVDIDVKKNAKLDITSNNNIFRDTPGGAVKI
FT                   AEGADVTMTKTAGANPLLWLADDVTVSPDARFILNKTGGTGYIIQFYNATAKLDINDPR
FT                   SFLIATNSNTPMFYWPYANTFNLSAQMVNYWDTAGTIDRTDLPAQSFSLPDGGNVLGSL
FT                   TYTGTTTKILSTNAGMTPTNFNQNTARMIAMGRLEGTINPVTDADNEIVGTATPNAFIS
FT                   ISYTENGENKVLEGQSNDAGTYRIAIPNGFIKPYIKLTTTIKQDQKRITLDDVTVEDVT
FT                   PPSGDAVTQIIQLGDPFPDVAELVTNIYDHSDNTSGAGVTTTLQSAPDTNVFGPAEAIV
FT                   RLEDKAHNHVDIRVPVFIKDDATEIQDGKALRAEDFSVNVKDINELNDAELEQFILTKS
FT                   GAKAFQIETGEDLTTDVKVASTNLKKETGTYTATIQIGGLTKEIAIQVTGELKFNHVPE
FT                   TISFETMGLNQQKNIAKRNADFDLSVLDSRGAGDNFSVTAAIKAPLTSTANSAHTLPNG
FT                   LIFIDNAGEKKILSDEPITIFQSQSASDMIVPIEWAEDRGILVEVDAAEAYVDESYETT
FT                   IEWTLTDAP"
FT   gene            632621..634024
FT                   /locus_tag="LM5578_0616"
FT   CDS_pept        632621..634024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0616"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67371"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464116.1"
FT                   /protein_id="ADB67371.1"
FT                   /translation="MTSVMWFRRDLRVNDNKALYHACKEDDLLLLFQVNPAQFITGSPS
FT                   HQAFFASVAHFKQEVDKTAHLQIMFGEPIECFQQLKDTLPSWDKVYFNLDETGYGAKRD
FT                   EAAQAFFDEQKIEVQAFHDSYLHSAEEVKKSPTEYYKIFTPYYKKWREEIKETPFKMTL
FT                   KPENIWKESLFPKYEEQFAEMTCDLPILDSGERAANTRLANFIKHDIADYDKARDFPEL
FT                   DKTSHLSRYLRTGEISVRTIWQALQENEATEGRAIFEKELCWRDFYNMIYVSFPNQKNE
FT                   PIQENYRFIEWENNREFFKAWQDGKTGFPLVDAAMRQLKETGWMHNRLRMVTASFLTKD
FT                   LLIDWRFGEKYFQQMLIDYDPASNIGGWQWAASTGTDAVPYFRIFNPTTQSQKFDPTGK
FT                   FIRKYVKELANLPDKFIHQPEKMSEIEQKEYGLLLGKDYPFPLIDHKERRKLAIARYEF
FT                   SKEHYRGNI"
FT   gene            634162..634575
FT                   /locus_tag="LM5578_0617"
FT   CDS_pept        634162..634575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0617"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67372"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464117.1"
FT                   /protein_id="ADB67372.1"
FT                   /translation="MAQFLKLFLTSAVVFLVFDLFWLLVASKKMYQQFIGDLMGDVRLA
FT                   PAVIFYFIYVVGVTFFVLLPGTEKGSLGYTILAGALFGLVCYATYDLTNLATLKDWPIT
FT                   MTIIDLVWGTAVTTVTSVIVYFINLHFFSGAGS"
FT   gene            634575..636344
FT                   /locus_tag="LM5578_0618"
FT   CDS_pept        634575..636344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0618"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67373"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464118.1"
FT                   /protein_id="ADB67373.1"
FT                   /translation="MMESESKRLLQSMLNGAAEVISKKDELNRINVFPVADGDTGSNLA
FT                   SLMQAIIDHVSPREYSTKELLEEVASAALIGARGNSGMIFAQYLNAVAESYHHIESTFD
FT                   GLVIAFQKAVHKAYEALLDPKEGTILSVMKAWSEELAGTYEQERSFQQSLLNAQIVAEK
FT                   ALINTEFQMPILRKNRLVDSGAKGFYYFIAGLTNAYCGKAVSATVRFMEVEQTAEHMHV
FT                   ETSEPKYRYCSEFIIKQATISHQHLQEILASKGDSLVIAGNEKQIKIHIHTNEPKEVLS
FT                   LMAAYGMMTYQKVDDMRLQYEVTKKPRAKIAIVTDSIADLPEAFLLEHQVHVLPMNILA
FT                   GDENFLDKLTVGPDMMQEKLRKQTKMSTAQPTIRTVDALLSFLENKYEHVLVISVAAKL
FT                   SGTYQLIKQRIKVRELSSDWIRVIDSKLNSVAQGILVKQAVELVESGKSWESIYPEVEQ
FT                   MIERTFIYVAVADLSPMVQSGRIPRVLGKLAQKLSLYPIVSLDESGDGKLIGVSFSQKQ
FT                   SMKKIIKKIAKLQLKELAITHVSSRDNAAIWQKQLEKETGKISYLVDSSAAIAISAGLG
FT                   SVAVAGIKKEETI"
FT   gene            636341..637114
FT                   /locus_tag="LM5578_0619"
FT   CDS_pept        636341..637114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0619"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67374"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464119.1"
FT                   /protein_id="ADB67374.1"
FT                   /translation="MMYWTVALALLVYFILWFIISKIKGKYSLVDIAWGGGFVVVAWTG
FT                   FLTTFSVTTQSITILILVTLWGVRLFWHLARRNWNKPEDYRYVNMRKRWGTTLVNLKAF
FT                   LNVFVLQGVLLFIIALPITHSFANETATFAWWQILGIVIWIIGFIFEVGGDLQLENFKK
FT                   NPANKGKLLTSGFWSVTRHPNYFGEALSWWGVFLVALTQLTDLWLITSPIVITLLLLFV
FT                   SGVPLLEKKYQDRADFQAYANKTSKFFPFIGKKGL"
FT   gene            637242..637784
FT                   /locus_tag="LM5578_0620"
FT   CDS_pept        637242..637784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67375"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464120.1"
FT                   /protein_id="ADB67375.1"
FT                   /translation="MKKEKTVLIMNFDEESISYQAFSEMKRLHQERKIIGYQMAVVKHE
FT                   PGNKLVAQDFLDFTGADKNMKDSLIGMLIGILGGPFGILIGWMVGAIVGSMRDAGEVKD
FT                   ALTVFERTLKTIPEGSTGVILIATEQELANVNDVAMDELHGRVQRMDEAIVAEEIKSAQ
FT                   ETEGKAKDSAKKHWFSK"
FT   gene            638012..638812
FT                   /locus_tag="LM5578_0621"
FT   CDS_pept        638012..638812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0621"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67376"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464121.1"
FT                   /protein_id="ADB67376.1"
FT                   /translation="MDVESSPLMQKIDYSTRKKIDLVNNSILRYIVRAMLACLFLTLGT
FT                   AVAVMIGDKVDHFAPGLGKITYAFMFSWSLVMIIYMNAELGTSNMMYMTTGVYQKIVKP
FT                   GKALQILLLCIVCNLLGGILAGYLVSLTSVFHNLPADHFLFTAVSGKLEKAPLQIFVEG
FT                   IFANIVVNTAVLCTLRMKDDAGKVIAMIFIIFIFAFLGFEHVIANFSSFSLAFFASGGT
FT                   LAAMTAGNVTVNLVLALLGNFVGGGLVIGLGYAWLNRTKSIYKD"
FT   gene            complement(638851..639957)
FT                   /gene="metX"
FT                   /locus_tag="LM5578_0622"
FT   CDS_pept        complement(638851..639957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metX"
FT                   /locus_tag="LM5578_0622"
FT                   /product="homoserine O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67377"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464122.1"
FT                   /protein_id="ADB67377.1"
FT                   /translation="MTLQQKELFQKSPLLLENGETLSPVLVGYETYGTLSASRDNCILL
FT                   EHALTGTAHAAKHFEDDAPGWWDDYIGPGKTIDTDKYFLVCTNVFGGCSGTTGPSSINP
FT                   KTGEPFRLQFPGFSIKDIIKVQRELLEQLGVTRIVSVIGGSMGGMQATEWAIDYADITD
FT                   SIINIASPLAAGPDAIGYNLIMRMAILNDPDFNGGNYVGQPEGGLATARMVGMMTYRTS
FT                   ELFSKRFERFTVAESSPAAFSKEHFQIESYLQYQGDTFVERFDANSYLYLTKAIDLFDV
FT                   TAPAKDDLPAFSKIKIPYLLIGITTDQLFRIHDLRRGYELLKEWDVPVTYHEVASEYGH
FT                   DAFLVEKEVPKFEPLIRSFLSNLPVKSI"
FT   gene            complement(639974..641251)
FT                   /locus_tag="LM5578_0623"
FT   CDS_pept        complement(639974..641251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0623"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67378"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464123.1"
FT                   /protein_id="ADB67378.1"
FT                   /translation="MSNEYKFETIQVHGGHTPDGDTHSRAVPIYQTTSYTFDSPEHAAA
FT                   LFGLQETGNIYTRIMNPTTAVLEERLTLLEGGIGAVATASGMAAITYSILNIAGSGDHI
FT                   VAAATLYGGTHTLFSHTFKTFGIDVTFVDPNEPENFEKAIKDNTKAVFIETIGNPDINI
FT                   VDIEKVAKIAHASDIPLIVDNTFATAYLNRPFDFGADIVVYSATKFIGGHGVAIGGAVI
FT                   DSGKFNWANGKFPKLVVPDDSYNGLSYTNDVGAAAYITKLRVSLLRDTGAALSPFNAFL
FT                   LILGLETLSLRLEQHVKNAKQVANFLNDHPKVAWVNYPGLKDNKYHELAQKYLPKGPGS
FT                   IFTFGVKGGYEAGKKVIESVELFSHLANVGDAKSLIIHPASTTHQQLSEEQQLTAGVKP
FT                   ESIRLSIGIENADDIIQDLTKALEQI"
FT   gene            641699..642226
FT                   /locus_tag="LM5578_0624"
FT   CDS_pept        641699..642226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0624"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67379"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464124.1"
FT                   /protein_id="ADB67379.1"
FT                   /translation="MKTFTRILVLLAGIAMIILGVWFLFHPGISLLTSTLMFGFLLLIS
FT                   GIFHTISYFSDRKSQNVSGWVLADGILSILLGFLLLFNEFDGTLTLVLLFGMWVLFAGI
FT                   MRTIGAFTAKQNNVQGWGWILTIGIIGIIVGFIALFNPVVSAIGIVLVVAIFFIVQGIG
FT                   AIATFFFIGKNS"
FT   gene            complement(642315..643016)
FT                   /locus_tag="LM5578_0625"
FT   CDS_pept        complement(642315..643016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0625"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67380"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464125.1"
FT                   /protein_id="ADB67380.1"
FT                   /translation="MSLLNEENSFYNVDLLNLLKDSSEAVLPYKRIRFRRNQQILAEGA
FT                   ETDYFYIIEDGVVSMSKNTCKEDSIINFLGKQECIGPLTLLGGAKSPVNYTTISEVSVY
FT                   QFERKYVLNKFLSSPDVFWQMNALMQSMVTPMLEREGYVNLPSSEKVLAGLIACGERFG
FT                   RIESDGSCLIPYYFTQKILGNYLNLARAYVATNLRKLEEDGIIALSPKPWRVNNFEIHK
FT                   QKLKENHEPYI"
FT   gene            complement(643092..643640)
FT                   /locus_tag="LM5578_0626"
FT   CDS_pept        complement(643092..643640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0626"
FT                   /product="putative biotin biosynthesis protein BioY"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67381"
FT                   /protein_id="ADB67381.1"
FT                   /translation="MRDQKLKFLVVDALFAVIIALLAQVAIPLGPIPLTGQTFAIGLAA
FT                   TILGARHGTISVLVYIVLGAVGIPVFQGMTAGIGIIFGPTGGFIIGFIFNAFLTGWLLE
FT                   KTKFTVPYAIVANILGAIVTLIFGVLWLKVSTGLDWPTAFLTGMVPFIIPGIIKAVFAA
FT                   LLGIIIRDRLIKAKLLRAS"
FT   gene            643834..644166
FT                   /locus_tag="LM5578_0627"
FT   CDS_pept        643834..644166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0627"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67382"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464126.1"
FT                   /protein_id="ADB67382.1"
FT                   /translation="MEVNPQFKKGVLELCCLFLIQKKDCYGYELANQVSKYIEVAEGAI
FT                   YPVLRRLVKEEYCSTYLVESNEGPSRKYYQLTVKGEIYLNELISEWNNFTDSVAKLLTE
FT                   GEAVNE"
FT   gene            644159..644749
FT                   /locus_tag="LM5578_0628"
FT   CDS_pept        644159..644749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0628"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67383"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464127.1"
FT                   /protein_id="ADB67383.1"
FT                   /translation="MNKQDFLNELNQRLELLDPKERRELLSDYQEHFRNGIEAGKSEEQ
FT                   IVFDLGKPEEIAADIISERGIREEPTEMDYYYVPRKNQNENRSVSKQILIGVGLFFLDV
FT                   CLIIPIMVSLWSLVISLWATVGAFLLSPVILGVGILFGADFEFYQMFVSIGLVGLGLML
FT                   LFVANALTQLTSKVTMAIIQWHKYAVKGGGKNA"
FT   gene            644742..645842
FT                   /locus_tag="LM5578_0629"
FT   CDS_pept        644742..645842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0629"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67384"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464128.1"
FT                   /protein_id="ADB67384.1"
FT                   /translation="MRKHHLSKKLFFAGLVLFIIGAIGVAFTMNTGKMIEKGEPLTKQW
FT                   DLSTENIKKIAFSSERDASIEWKESTTGKNYIELKGNYSANDKKAIQQLEPVSEDGTSF
FT                   DITVPEEDDWYNGFGKIYAYGKQKVTIYLTKDTKLADLEVKSHSGDIDVADFKVKKFVS
FT                   STNSGELKVTNLEANTAQMATSSGDLTLSNIKANSSIETDSGKTELTNLTGDLEVNGGS
FT                   GDVNVAGVKAKKLKIAIDSGDIELTSGTVTDLAVLTTSSGDIDANTKGKIQAESDSGSI
FT                   ELAGATNNVTAKTSSGDIDVAFTKQVKNIEINSDSGEVELELPGDFKAIYEASSNSGSV
FT                   KAPTSDSNTDNRVTVKTSSGDIKIEK"
FT   gene            645945..646448
FT                   /locus_tag="LM5578_0630"
FT   CDS_pept        645945..646448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67385"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464129.1"
FT                   /protein_id="ADB67385.1"
FT                   /translation="MMDFHIRKATNSDAEAIQHVAITSWHHTYQDLIPGDVQDDFLERF
FT                   YNVETLHNRISATPFAVVEQADKVIGFANFIELEKGKSELAAFYLLPEVTQRGLGTELL
FT                   EVGMTLFHVPLPMFVNVEKGNETAIHFYKAKGFVQVEEFTEDFYGYPLETIRFNLNHHA
FT                   FEEE"
FT   gene            complement(646496..646882)
FT                   /locus_tag="LM5578_0631"
FT   CDS_pept        complement(646496..646882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0631"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67386"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464130.1"
FT                   /protein_id="ADB67386.1"
FT                   /translation="MRFIIAYLSIFVLGIFSALLVETILYDNVTPQLVFSAILFAAPVI
FT                   LVASTLGEIFYGFSKKASYFTFAIWGFAYGVVAAVIILSIIQVSGMLISVGVSILAGVI
FT                   MALLAIIFFFLRGGKSTSGKAATK"
FT   gene            complement(646934..647278)
FT                   /locus_tag="LM5578_0632"
FT   CDS_pept        complement(646934..647278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0632"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67387"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464131.1"
FT                   /protein_id="ADB67387.1"
FT                   /translation="MLDKKIISALSYFSLFFAPVITPAIIWCTTKDKEIRHHVKWALLT
FT                   QATFVAGIVVMILLYNNVPFSTNSADTINFLALATVFFIVFLNVSILIFNLIRGITRIV
FT                   KHSDDNWARC"
FT   gene            complement(647425..648765)
FT                   /locus_tag="LM5578_0633"
FT   CDS_pept        complement(647425..648765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0633"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67388"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464132.1"
FT                   /protein_id="ADB67388.1"
FT                   /translation="MSSVHKVASISLFTLAWPIFLEQFLRLMISYIDVFMLGHYSDDAV
FT                   AATGVANQILVISIIIYGFISVGVQIIVAQMIGAKKHKEIENVITNGLVVAFLIGIVMS
FT                   IIFIFMSKNFLTWMGIAPHLVEVGAPFLEIIGGSSVVIAIHASILPILRAHGYVRQSIL
FT                   VPVTISIINVVGNYLFLYGPLAYLDYGVAGVGISTAVANFVGMGLAIWMLRKYIGYTFH
FT                   FKKLEQVSKKLLYSILRLGLPSAGENLSYAGSQLVVTAIIAILGTEALTTKVYASTVSQ
FT                   FVALFAIALGQASQIIIGRAVGAKEIDKAYKQGLRSWKIGLVVAIVVSVSIYLFAEPIM
FT                   RLFTTNTEIIAMTKELFLLSIFLELGRATNIIIISSLNSTGDVRFPFICGLIVMWIVSL
FT                   PFSYVLGISAGLGLVGVWLAYIIDEGVRAVLMYRRWRSKVWSLKSVI"
FT   gene            648910..649392
FT                   /locus_tag="LM5578_0634"
FT   CDS_pept        648910..649392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0634"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67389"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464133.1"
FT                   /protein_id="ADB67389.1"
FT                   /translation="MIERSGEMSSKNQDLGHSVIKAFMNFKHAEIKSFQIPGYSKSETR
FT                   FIFILSRGLKSRGPKIRVSDLGHMLRISKPSVTQMIQSLEGKGLIKRVQNPEDKRSMYV
FT                   ELTEVGAGVSEKMLDEFQASFEDMQEFLGEDDMKKLITLLEKLTDYLNTKSENKEA"
FT   gene            649400..651124
FT                   /locus_tag="LM5578_0635"
FT   CDS_pept        649400..651124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0635"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67390"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464134.1"
FT                   /protein_id="ADB67390.1"
FT                   /translation="MMKLMKRLKPYWLSITAVLVLTFGQVIGQLYLPTLMSNIIDKGVV
FT                   TGDTDYIWSTGMKMLLISFASVILSVIVVYLASRISMGFGKELRDKIFTKVEDFSLQEF
FT                   DKVGTSSLITRTTNDVVQIQNVLYMMMRLMVMAPIMLLGGIIMAVGRDAKLSLIFVVVL
FT                   PLLLLLVVILGGKAMPMFKSLQKKMDKLNRVIREGLTGIRVVRSFNRNEDELEKFEEAN
FT                   ADYATTAIKVNRLLSLMSPLMMLLMNLTSIAIVWIGSIFIGNGDMQVGDLMAFIQYAMQ
FT                   IMMSFMMLSAVFIMIPRAGASAERINEVLDMNAEILNPENPKTSTPPAKLSFEHVTFRY
FT                   EGAEKPVIEDITFEANAGETIAIIGSTGAGKSTLINMIPRFYDVESGVVKINGIDVREM
FT                   DQSSLRQKIGLVPQKAVLFTGTIASNMRYGKEDATDEEIWEALRTAQAENFVSKLANGL
FT                   GSRVEQGGNNFSGGQKQRLSIARSLIRKPEIYIFDDSFSALDFKTDAKLREALKAETTE
FT                   AVTLIVAQRITSVVNSDQIIVMNEGKIAGMGTHEELKESNQIYQEIMRSQLSEEEIA"
FT   gene            651121..652938
FT                   /locus_tag="LM5578_0636"
FT   CDS_pept        651121..652938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0636"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67391"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464135.1"
FT                   /protein_id="ADB67391.1"
FT                   /translation="MSGPGPGGGMRMQTAAKPKNFKQTLFRLLGYMKPRSVAIIVVFIF
FT                   AILSTIFNIFSPKELGKATTEIFKGVMSQDGINNDKIFNILMIVLVLYLGSSLFSFIQQ
FT                   YVMSSVAQRTVYDMRKDLKAKMARLPLKYYDTRSNGDILSRSVNDMDNIANTLQQSLTQ
FT                   AITAIVQMIGVLIMMLTISWQMTLIVLVTVPISIILVAIIAGRSQRYFGAQQRNLGILN
FT                   DTVEETYGGQTIIKAFGQEKKTLVKFDEVNEDYFKAAKKAQFISGIMMPVMQFVGNLGY
FT                   VGVCVAGGIFVTNGTLQVGDIQSFTQYVQLFTQPISSVANIANIIQSTIASAERVFEMM
FT                   DEEEEKDEIPANVNQVAGEEHSIVFDHVKFGYTPDKPLMTDLNIHVEEGQMVAIVGPTG
FT                   AGKTTIINLLMRFYDVDGGQIRMKGIDTRDMTKDAVREKFGMVLQDTWLFNGTIADNIA
FT                   YGREGATKDEVIGAAKAAYADDFIRRLPNGYDTILNEEGSNISQGQKQLLTIARAILSD
FT                   PSILILDEATSSVDTRTELNIQLAMGNLMEGRTSFVIAHRLSTIRDADLILVMNHGSVI
FT                   EQGTHQELLDAKGFYADLYNSQFTGAQAV"
FT   gene            653054..653353
FT                   /locus_tag="LM5578_0637"
FT   CDS_pept        653054..653353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0637"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67392"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464136.1"
FT                   /protein_id="ADB67392.1"
FT                   /translation="MYQSITANDLEQDLKKVPHNILDVRDADAFVEGHIPDAINIPINE
FT                   LPEKLATLDKEKAYTIICYAGGRSERASQFLAAEGFDVTNVMGGMGAFHGTVTN"
FT   gene            complement(653398..655167)
FT                   /locus_tag="LM5578_0638"
FT   CDS_pept        complement(653398..655167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0638"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67393"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464137.1"
FT                   /protein_id="ADB67393.1"
FT                   /translation="MKKMGVKIGLCILLIMPFTISFSANVSAEENISIKAAQDVVNIPD
FT                   PALKSYLNGLLGQPSTSDITEAQMDTITDVTISNASLTDLTGLDYAHNLTILHLTNTGV
FT                   TDYSLVANIPSLTNLNISGSNLTTNSIPDLNGLTNVTNLNLSSGKLDNSALTKFNKLPN
FT                   LTFLNLDNNPSITDFMPLKSLPNLASLFIQFCGVNDFRGIDSFPKLTNLAAFGQNVGSA
FT                   ILINSTIKSSALNYNEANQTIFVPFTLMTERSMNFDGYLFPFTTNTASSSTYFTLNGVQ
FT                   ISGSRLSIDDTGVTVSGITKDFFDSITKMEYNAFYDNPAGSYNSPPNFNSYSVSSGTYD
FT                   HYFDIDHSLTITNDSAISYGEQTTVTEEQFLKDVHAETDDGTPVTSDFNTIVDFSKPGV
FT                   YTVTLNAENAAGLKATPTQVTVTILAKPVITADKSISYTKDTTKTEQQFLQDIAAKTSD
FT                   GSKVTSDFDSVVDLAKVGTYKVTLNAVSADGLNADPVIILVNVVAGNEPPTPPGPSPDP
FT                   TPDPTPNPNNPNINPNPDNGQSANSEIASNPSNSEVNIALPNTGDASQATTVLIGIILA
FT                   GGAILFFRKRKHS"
FT   gene            complement(655328..655954)
FT                   /gene="acpD"
FT                   /locus_tag="LM5578_0639"
FT   CDS_pept        complement(655328..655954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpD"
FT                   /locus_tag="LM5578_0639"
FT                   /product="azoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67394"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464138.1"
FT                   /protein_id="ADB67394.1"
FT                   /translation="MTNVLFIKANGLPAERSVSVALYEIFLTEYKKSHPDDNVTELDLF
FT                   EADLPYYDVTMMSGLHKEAAGETLSPEEKRLADIANSYLDQFLAADKIVMAFPLWNFSI
FT                   PAQFLTYLFYLNQAGKTFKYTANGPVGLVADKKIALLNARGGIYSDGPMQSFEMSLNYV
FT                   KNVLAHFGISEPEMVIVEGHNAKPDQAKDIISAGAKEAVELAKIF"
FT   gene            656123..656578
FT                   /locus_tag="LM5578_0640"
FT   CDS_pept        656123..656578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67395"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464139.1"
FT                   /protein_id="ADB67395.1"
FT                   /translation="MEVKILKPCTERSELLYRMHLLSKEISHVFEQQTNMSFTKVEILF
FT                   HIQQTPGQSQNRLREKLYIDSASITRHLKRMEEQGLIVRKKQDENKRYTYLFLTSAGEA
FT                   ELATLLLEKEKFQNGALEAFSEEEVSALLKSVTKMMNNVEKMEEKLK"
FT   gene            656575..657516
FT                   /locus_tag="LM5578_0641"
FT   CDS_pept        656575..657516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0641"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67396"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464140.1"
FT                   /protein_id="ADB67396.1"
FT                   /translation="MKAVVIENYGGKEELKEKEVAMPKAGKNQVIVKEAATSINPIDWK
FT                   LREGYLKQMMDWEFPIILGWDVAGVISEVGEGVTDWKVGDEVFARPETTRFGTYAEYTA
FT                   VDDHLLAPLPEGISFDEAASIPLAGLTAWQALFDHAKLQKGEKVLIHAGAGGVGTLAIQ
FT                   LAKHAGAEVITTASAKNHELLKSLGADQVIDYKEVNFKDVLSDIDVVFDTMGGQIETDS
FT                   YDVLKEGTGRLVSIVGISNEDRAKEKNVTATGIWLQPNGEQLKELGKLLANKTIKPIVG
FT                   ATFPFSEKGVFDAHALSETHHAVGKIVISFNK"
FT   gene            657612..658145
FT                   /locus_tag="LM5578_0642"
FT   CDS_pept        657612..658145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0642"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67397"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464141.1"
FT                   /protein_id="ADB67397.1"
FT                   /translation="METRELKNGQIMMIRKATKEDSSNIITYLNEVAGETDYLSFGQGE
FT                   FAFSIAEEAEYIEESDKNPGSVMLLCFIDDELASISQLIGHIKKRELHTSELAISIRKK
FT                   YWGLGIGTICMEELIKYAKSSEYLKLIYLEVVTENKRAINLYKKFGFIEAGEIPALMQV
FT                   DRRYLDVTMMYLVI"
FT   gene            complement(658142..658384)
FT                   /locus_tag="LM5578_0643"
FT   CDS_pept        complement(658142..658384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0643"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67398"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464142.1"
FT                   /protein_id="ADB67398.1"
FT                   /translation="MHPIEQLLANNNTTATDIESNTRLKEGSLQKIIDKDIRTSDISLR
FT                   VLSQIAIFLNTGADIIAKQLSDIEVANDLAFLIED"
FT   gene            658491..660242
FT                   /locus_tag="LM5578_0644"
FT   CDS_pept        658491..660242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0644"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67399"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464143.1"
FT                   /protein_id="ADB67399.1"
FT                   /translation="MKDLKDSFKVLYQFKTDYLKVTLLLTILQAFVIGPFIYYFFFFIL
FT                   RVIGVPGITDANLGEVFSSPVAIIMLLILALLILLFVYYELGFFIMMAIYQLRGESYTF
FT                   FKIIQRLNVKAKYFLSYQAIYFLLYFFLLLPIAGLSLPITITENLYLPHFITDELMKTT
FT                   TGTWLYVIAIAIIFYISARLVFALPYFIEDKSLKISRAIRKSWKYPQKHLFFMLLKWVL
FT                   IIVAIGFLVSIIATIIMLPLLLVEKITPGIAVVIAGITLTILQVIGFFAAGIFQGIIAQ
FT                   LLVKNAFAIKEQPALVTRSQFPHKKRFIIVAIIIFIIFSSFNIYTVNATLYEPNTKIIA
FT                   HRGDTMNAVENTVEAIESAAEAGADYSEIDIQETKDHQFVVFHDMTLRRLAGSSKRVAD
FT                   MTLKELQQTKVRSGDYSSHIASFDEIIKIAKKNKIDLLVEVKLHGGESSDMVERLVTLL
FT                   KKEKVTDKYLVQSLDQPVIEKIEQADPTLETGIILALNIGNLPKTSADFIVLEDFSINK
FT                   RLLTQAKQNNKMVFVWTVNKEKLMQMYLRKNIDGIITNYPKKAIELRESFNENDSLRSR
FT                   IENRLGF"
FT   gene            complement(660283..660777)
FT                   /locus_tag="LM5578_0645"
FT   CDS_pept        complement(660283..660777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0645"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67400"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464144.1"
FT                   /protein_id="ADB67400.1"
FT                   /translation="MKKLKSILLLMGIITFALALTACGGTEDKASTEKTETAKAETKKK
FT                   SNPNELGDYKVEILSSEVVKDFEGNNAIAIKTKFTNNSKENISFMVAIDQQAFQNGTQL
FT                   ETTVSADASMGGSEKDVQPGGTLEVTELYKLQDTQNTVDIEATELISFSKNSVKKSFEL
FT                   K"
FT   gene            complement(660857..661999)
FT                   /locus_tag="LM5578_0646"
FT   CDS_pept        complement(660857..661999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0646"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67401"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464145.1"
FT                   /protein_id="ADB67401.1"
FT                   /translation="MGEMTLAFIEEQYKELDNLNNKENPAVLTRNTSTGELFVRKIIPS
FT                   SFAPVIEQLKNLSSKYLPKIEVMIPKGNQLIVYEEYINGKNLADLMKTNAPFDTDEVTR
FT                   LMLMLSDALTELHANAIIHRDIKPSNIMISSDGVLKLIDFDASRMFEVGKNQDTVNLGT
FT                   IGYAAPEQYGYSQTDARSDIYSIGVLMLELLLGKNTLPDKEHATSLEKIAMQAGAFDPE
FT                   QRYQSIQDFRTAVKNDSLGPSYVSELSDFTELDDSPTESAWKTPADEYENDFIPWYKHI
FT                   PGFRTGTPWKMIVAVFGYMFLIFGLFSPPTEGVKMSHTVNFFSNFFLIVPAFVIFTNLC
FT                   GIWSKLPLLKSPSPGTRKAGIVIYIIVCVSIYGIYNEIFS"
FT   gene            662106..662561
FT                   /locus_tag="LM5578_0647"
FT   CDS_pept        662106..662561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0647"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67402"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464146.1"
FT                   /protein_id="ADB67402.1"
FT                   /translation="MDGEKETSKLLHELKKATNLRQVLDENEAEFKSSEMVTYLKELLA
FT                   EKKLTKASVIRAARLHETYGYQIFSGVRRPSRDRTIALSFGFKLSGLEASRLLKYTEYP
FT                   PLYAKNRRDAIIIFALDHGYTLDQTNDSLYDLEEALIETYKEEKPLI"
FT   gene            662617..663009
FT                   /locus_tag="LM5578_0648"
FT   CDS_pept        662617..663009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0648"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67403"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464147.1"
FT                   /protein_id="ADB67403.1"
FT                   /translation="MLNEQTILQAATSEKNAGDFPKVVQGFKDLGVTKYQFLVQKGVYV
FT                   FWDETDTRVESKLNGVSMPVAEEISSEKMKDAIKQAQAGKIDFEMFIKLAGLAGVGLWE
FT                   ADLTAMKVTYIDNAGNDLVVEPIPSV"
FT   gene            663106..663846
FT                   /locus_tag="LM5578_0649"
FT   CDS_pept        663106..663846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0649"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67404"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464148.1"
FT                   /protein_id="ADB67404.1"
FT                   /translation="MDMITYFLIALSTSVVGSFLGIGGGVILLPILLLMGVSQGTAAFS
FT                   SALTVFTMAIFTCSIYYKRKQGNVGLALKIAVTSIPTTFIGAMVNQMLPEAVYRFLYGA
FT                   LIVVLLGIMIWKKKRNNEKPHFLSKYRIIPYVFGVIIGFLAGLFGIGGGPIVIPILLLI
FT                   FMLNQKTASATSSYVTLLTSLASIGSYAIIGGSDFSIGIYMIPGAIIGALIGTRLNKLL
FT                   DEKWIAILFNVLLIALFALNLIKI"
FT   gene            663932..664210
FT                   /locus_tag="LM5578_0650"
FT   CDS_pept        663932..664210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67405"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464149.1"
FT                   /protein_id="ADB67405.1"
FT                   /translation="MKRSWPDFAAFLLTILTVTWIILTWGLHISDIVPGGEKGIWYKLI
FT                   PLFLGIISTISVFFVKEKLVKWILLGFNILLLILIYFVYHIGEIGMF"
FT   gene            664226..664492
FT                   /locus_tag="LM5578_0651"
FT   CDS_pept        664226..664492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0651"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67406"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464150.1"
FT                   /protein_id="ADB67406.1"
FT                   /translation="MDEPTKAVIYQILSKTEEQNATMDHLVFEMMQFPGAAAFTKNELL
FT                   FGIYWLETYHYIFRMSENQTTRYYRTEKGHEKLAELELLKNKS"
FT   gene            complement(664530..664973)
FT                   /locus_tag="LM5578_0652"
FT   CDS_pept        complement(664530..664973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0652"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67407"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464151.1"
FT                   /protein_id="ADB67407.1"
FT                   /translation="MTAFDLEDFLTTAITDYAKEKVEAGTWDEEESLAKSQDSFNKLLY
FT                   DGITTPNEYLYSIISGEKIGYIWFHVDETRSGKHAFIYDFVIFEAFRGKGFGTKTLAAL
FT                   DVLAKEMQITKIGLHVFAHNQTAIGLYNKVGFQNTDITMAKYL"
FT   gene            complement(665004..665705)
FT                   /locus_tag="LM5578_0653"
FT   CDS_pept        complement(665004..665705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0653"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67408"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464152.1"
FT                   /protein_id="ADB67408.1"
FT                   /translation="MKKTIQSVGVWGDSIMKGVLFNPEKNRYTLLKNNCIKRASEKLGL
FT                   TFQNHSTMGRTITKGHEILTKDLAKDATNDIAIIEFGGNDCDFNWAEVAENPAAEHIPR
FT                   TPINIFETQLLEMIARLKKLDIKPILMTLPPLHAKRYFDFITRDGLNKDNILQFLGGDV
FT                   EMIYRWQERYSNTISRIAAETSSQIIDVRDSFLAEFHYENLLCADGIHPNEAGHIAMSR
FT                   RFIQYASFHKA"
FT   gene            complement(665791..667470)
FT                   /locus_tag="LM5578_0654"
FT   CDS_pept        complement(665791..667470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0654"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67409"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464153.1"
FT                   /protein_id="ADB67409.1"
FT                   /translation="MWKKHKWLIIAVLLLVIYVAPLFILGGNSHVRIHDNLDSNVTWYK
FT                   MVLDSGDYTAKVGTANIDQIMDDSVPRDSFDSEFVGIDWLYMIFSTPIAFAMSQLITRV
FT                   FAFLGLFLWARDYLIKDKKYLVPIYFVSLAFALTPFWPSGMLSTLGMPLALWAFLNIRN
FT                   NKRRIWNVIILTLLPFYSSLILGFCFFLVMVGCIWLYDVFKKKQVHIRFLLSTLYMGLI
FT                   YVIVNYRFIYAMFLHPEPDSRSEFSLPNLSFLSSIRLSFKNFIFGHTHDQALAGYVILP
FT                   ILLLVLVLIIIKREWVKEKLFLWLFGFNLFLSFWYGFWWYRGWNVIKEHVEIMRTFNFS
FT                   RFHFLQPFLFYGLFALAIVYLIKKGNWWRKLAYVAIVLQLIVVFANNSEIYYRTGNGSP
FT                   SINQFYATEQMEEIKDYIGKPQSSYRVGSIGLHPSVSQESGFYTVDGYVNSYPLAYKRA
FT                   FRKIIAGELDKSPVLEDYYDNWGNRCYIFSAELGKNYDFGKDSKKHIKQLDFNTEAFKK
FT                   VGGEYVLSAVPIDNASEVGLQFEKAFDNKESYWKIYLYKATN"
FT   gene            667776..672524
FT                   /locus_tag="LM5578_0655"
FT   CDS_pept        667776..672524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0655"
FT                   /product="pepdidoglycan bound protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67410"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464154.1"
FT                   /protein_id="ADB67410.1"
FT                   /translation="MLKHNWQKVFVVMVAVALIFQLVPWSNIFAGAEENQTKTTQQIAQ
FT                   PDDQKAADENKTTVTPDNKETTKNLVNGKQLLKGSVDWNFTNKVTDANGNTKETYAPGD
FT                   SLKFSVSLAIPSYSEAVLDETYTFWIQKDFFQGDKVTFVNPAIDGLTPRQNVFTDDSMK
FT                   NSIGTKTINGVEYIGYTLKFNQSPEALAKYEDEPLTNAKFDMFATISTTITTKEDYKAI
FT                   VIEDDKDVDISNIEVPVTPPTPDTDNGVLTASKVIDSAWRLDKDTGKYVKVATSSTNYT
FT                   PEKDDLVFYYVYAMNNSGENAVLEKMIDELPAGFSIITEGSPEWQALSTASGSSLQRGW
FT                   VASADQTNLAPGATRYELPFSPAQTISKNGGGIYRTIAAKVTDPTKDLTNVTKSPTKGG
FT                   EGKSGSITPSGKDVYDMAITTKISSTYDKNNKYIGAVSSTTTPVSISEGSTVGGTYTAI
FT                   NQGNYTKDVVVYAYVPAGYELNNDTSDFKTANDKWKYETTVPSGGGVWSDIKVYSITLS
FT                   GGMASGATKTATMYMKAMGIPEDGTYSAVDFYMAGEIGSFSNFNGESTLDGAITDVDST
FT                   PDMNPGNDLISNVDGSTIKPIDGFQKEKPHVVKENAKSTATLQDEDDFDFDYVTFIKTP
FT                   EVIPSEGKVFEKTRLSAADAEKTARNMIGNDIMGSALKDYTPLADDGRITSPKTYMVYE
FT                   MNINPSGVEDTLNSSFTDTLPKGLKMLEYDIAGLNSSNKHIYGFTTNKFEGTPKFTNAD
FT                   GQDVIVYQKGLYSEKQVCIANPTLNDVGVRYFGNNADKMGVTGSVTKDARTLTLNFGQP
FT                   AADPMYSETKAAYKVYMIVVIDPDEIDYSSIMQNKATYTYNDKVITSYENSEMYWDAGG
FT                   GTAYAKKYVLDNKTNAYLSGSQYNVATPDADGNLSVGYKIRVRSAYEFDKSSINIGDVI
FT                   AADNFKSISNVEVNGYEASPNTGFQIDGELENPVPLTADKYAVEAKATANTLDITNPVD
FT                   IPQMQLYNVLFKVNYQKVKYGAKLVNQAAGSEVATVVPLNLNLLKQDDISKTALTGYEF
FT                   KAYYADENGKADLTKPVKDTNSNEIVMTDSSGAANFIPNGYKTTSKNQEWKVVLVETKT
FT                   PTGYESNENKEYPVTVKSDANGNLSIPTSTETGLEITNDDHGAATATIDNHADVKMIDV
FT                   NGAKTWTGDTAADRPDSIEVQLLQDGVAYGSPITVTKADDWKYEFKNVPETNADGNKYT
FT                   YTVLENTVTNYTSAVTGLDINNTLIKPDIKMINLDGQKTWKNDTENDRPASIEIQLQQN
FT                   GQDYGFPVTVTKANNWKYEFKNLPETTNDGAAYNYTIVEKAVPGYETKVDGMDVINTKI
FT                   DAPKTAVSGEKTWKNDTAKDRPDFIEVQLLQNGQTYGDPVKVTKENDWKYSFKDLPKAD
FT                   ANNQDYRYSVAEIAVPGYKTTTDGMNLTNTKVTDEKNVTSASGTKTWVGDNEKTRPDSI
FT                   EVQLLQNGKAYGTPIKVTAKSNWKYSFTNLPEKDKTGEKYSYTVSEKQVSGYSVKVKGM
FT                   DLTNTKVTKTTPKDTPKDTHSTNKPSKTKKLPGTGDTNGMLLFAGGLALLFLGLHLRRK
FT                   SAK"
FT   gene            672617..672895
FT                   /locus_tag="LM5578_0656"
FT   CDS_pept        672617..672895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0656"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67411"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464155.1"
FT                   /protein_id="ADB67411.1"
FT                   /translation="MMKEELLQAIEVGKPVLLVTAIGYIVGIVEAKGELIRLNDVYINC
FT                   VSASRVNRFSRGLAVNINQVIGMQLLSKSEKDEMIGGWKAYVAPTAG"
FT   gene            672957..673484
FT                   /locus_tag="LM5578_0657"
FT   CDS_pept        672957..673484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0657"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67412"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464156.1"
FT                   /protein_id="ADB67412.1"
FT                   /translation="MILLVIDTQKLIMTNNLYNFDSLVPNIEQLIATARKNKIEIVYIR
FT                   HDDGPNTELTEGKEGFDIYKKFQPTTHERIFDKTVNSAFKGTGLLEYLKEKGTKKIVVA
FT                   GLQTDFCIDATVKCGFEHGFHMIVPAHANSTEDNHFMSGENSYKYYNEWMWPGRYATCI
FT                   SMEETIKEMEHN"
FT   gene            673843..675873
FT                   /locus_tag="LM5578_0658"
FT   CDS_pept        673843..675873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0658"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67413"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464157.1"
FT                   /protein_id="ADB67413.1"
FT                   /translation="MLSGRMVLIIKYLEGKSESSIRGISKKLEISERKVRYDIDNINDA
FT                   LTLNQLKPILKEGKGRLVIPADLAKLALEEKETYIFAPQERINILQYLLFFNVKKVNLE
FT                   HLSKWMNVSRTTIKKDLLLIEEQLQKLNLQLVYKQGYRLIGNENALLNERVRILRDYID
FT                   FIPSEDIETNFYRKCMLGEMKVSLKNIDINGVNKWSKQLLKQMGWILNDESYYWYLANI
FT                   LVFCWYIKNDVTNPLKDAKLVLPIFNSQLIQGMEVILDYELSQEQLNILVGFVFFTNKY
FT                   ASLNEEMDLITTETIVNSLITSMSEELNLPFLEDAILYKGLLNHVAPLIERVRGNVQIY
FT                   EDTFDVIPTEFLYILQATSKVVKTIPLLESVENESEISLLAIHFLASIQRNQREEKLHV
FT                   LLVCGLGYGAIAMMKDTLNSEYQIAFVATIPEYMLKDFTAWEEVDLVITTAKVTTPLPK
FT                   STVKVSPVLKECDLVELEKQGLKKKNILTSYFAINKRLSFLDSTVKQQVISVIKEELGY
FT                   GHVSIPNRKLGLSDLIGIDAIQITSESLTWQTAIQRATKLLSDNHFVLPAYAENIKQIQ
FT                   EELGFYSVKDEEFALFHGNDSQLVQMNSMALLINEQPVMFGEKQAKVIFILASKDKKEQ
FT                   IPAIITLTKMTYQTDFISKLEQAKNPIDADRIIKKYEEEVR"
FT   gene            675875..676327
FT                   /locus_tag="LM5578_0659"
FT   CDS_pept        675875..676327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0659"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67414"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464158.1"
FT                   /protein_id="ADB67414.1"
FT                   /translation="MGVKIDFLSISNINVNTKEDAILQLVNVLEKADYLADKSLFEQDI
FT                   LERERTLSTYIGHEIGLPHAQSSGVKEPCVVVGKLSKPVKWTEEEEFVQIVFLIAVPRD
FT                   NQNNLHLKVLSNLARLLMHEDFRTKLSKLDDIATVALLNKSVKEDN"
FT   gene            676328..677389
FT                   /locus_tag="LM5578_0660"
FT   CDS_pept        676328..677389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0660"
FT                   /product="putative fructose-like permease EIIC subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67415"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464159.1"
FT                   /protein_id="ADB67415.1"
FT                   /translation="MRTLKFLQKHLMTATSYMIPFVVAGGILFALSVMLSGQAAVPDAG
FT                   WLAKLNQIGAAGLALFIPILGGYIAFSMADKPGLAPGMIGAYLANEIGAGFIGGIIAGF
FT                   LAGFVVIQLKKIKLAPSMRTLGSIFIYPLLGTLITGGIIVFLIGEPISGFMDWMTNALN
FT                   SLSGAAKVPLGALLGAMISFDMGGPVNKVAATFAQTQVDTLPYLMGGVGVAICVPPIGL
FT                   GVATLLFPKKFTRVEKDSGIAALLMGSVGITEGAIPFATADPLRVIPSIMVGSIVGNVS
FT                   AFLFGCLNHAPWGGLIVLPVVDNRIGYIASIALGAVVTAIMLRILKKDATELDEALEEG
FT                   QDIDDLDINFEDI"
FT   gene            677404..677712
FT                   /locus_tag="LM5578_0661"
FT   CDS_pept        677404..677712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0661"
FT                   /product="putative fructose-like phosphotransferase EIIB
FT                   subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67416"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464160.1"
FT                   /protein_id="ADB67416.1"
FT                   /translation="MKIVAVTSCPSGVAHTYMSAESLELSAKKMGVTIKVETQGSSGIE
FT                   NKLTAKEIEEADCVIITNDVEIRESQRFKGKKVVKMSVSEIIKKSDALIKKLQTMFE"
FT   gene            677739..679007
FT                   /locus_tag="LM5578_0662"
FT   CDS_pept        677739..679007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0662"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67417"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464161.1"
FT                   /protein_id="ADB67417.1"
FT                   /translation="MKLPIKKAVEALLKLQTTGDSATLIGVGPMSRNLLQASFELAKED
FT                   DYPLMFIASRNQVDADELGGGYVNGWNQFSFIDAIKEVAKEVDFDGLYYVCRDHGGPWQ
FT                   RDQERNDHLPTEKAMELGKKSYIADIEAGFDLLMIDPTKDPFEVGKVIPLETVLERTVD
FT                   LIAFCEEERKKRGLPEIGYEVGTEETNGGLTSTETYEKFITQLKVELEKRDLPLPTFIV
FT                   GQTGTLTRKTEQVGHFNFKNAYDLAQMAKKYGVGLKEHNGDYLDDVTLLEHIPSEITAT
FT                   NVAPQYGTEETRAYLKLVELEQKLVENGLIKTPSNAREVLLIQSIKSERWRKWMLDGQK
FT                   DITINEIMQDDDLSLEILDIAGHYTFNDAMVKKEINTLYANLAANNIDGKRFVIDHIKR
FT                   PIRNYSECYNLKGATTRIKQLAK"
FT   gene            679097..679801
FT                   /locus_tag="LM5578_0663"
FT   CDS_pept        679097..679801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0663"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67418"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464162.1"
FT                   /protein_id="ADB67418.1"
FT                   /translation="MINLIFDIDDTVYDQLKPFENAFKTVFGKADHLKIENLYIKSRFY
FT                   SDEVYHRVVRGEMPKAEMHVYRITQALSDFDYQITKKEAETFQHTYEQNQRKIELSPGI
FT                   KEILAWAKKNEITMGIITNGPKEHQQHKINDLQINDWIPAEHTFISGKVGIEKPDKKIF
FT                   KLVEEQIGINSAETYYIGDSFENDVIGSKSAGWKSIWLNRRGHLRPTEAAFQPDYCVEN
FT                   EQQLFAILQEIF"
FT   gene            679906..680322
FT                   /locus_tag="LM5578_0664"
FT   CDS_pept        679906..680322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0664"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67419"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464163.1"
FT                   /protein_id="ADB67419.1"
FT                   /translation="MKFSKATNYALHTIVYLANLSPEKSVGVKELATKQNVSPTYLSKV
FT                   LTMLVKASFIESVTGVNGGYKLAEPASSISFLDVIQAIEGKGAFFHCDPKNHSESQPHC
FT                   LIGEVMNKAEQQMEDYLSKQTVGSIVVEIEKHQH"
FT   gene            680336..680929
FT                   /locus_tag="LM5578_0665"
FT   CDS_pept        680336..680929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0665"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67420"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464164.1"
FT                   /protein_id="ADB67420.1"
FT                   /translation="MKHHHNHHGEAGFKRKVDYLDRPERSEVLSPEGFLQAMPIGKTAS
FT                   ILDLGAGTGFLTIPAAKLVDNTVFALDLDAKMLELIESKAKEAGLANVETLEASMDDIP
FT                   LEANSVDVVLASLVLHEADSLADVLREVSRVVKTGGYFASLEFDTKGTDLKGPPMEIQI
FT                   SAEKLKEELAGFGFEVVKNWQLDEGMYVSIAVKK"
FT   gene            complement(681092..682243)
FT                   /locus_tag="LM5578_0666"
FT   CDS_pept        complement(681092..682243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0666"
FT                   /product="integrase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67421"
FT                   /protein_id="ADB67421.1"
FT                   /translation="MAVYKRENYWSYRISFKKENGKYGRINSDKKYRTKKEAQLAESAI
FT                   KNKLSKGFHLDEGETLFTDYFEEWFKIYKKGKLSIENDVDINSTLNFVKANFDGIKLKN
FT                   LTRKKYQEVLNKYGEERATATVKKKHTYMRACIKDAVQEGVIYKDPTYRVRAIGNAPTQ
FT                   KESEKFLTEKQLIILTKNLMNTHKVEYTSRNIIFFQIATGCRFSEALGLTWDCVDFEKK
FT                   SVIINKTWDYKYTKFFSDTKNFSSKRSITIDEKTIELLREIKLEQTKFELKKNIRNKHN
FT                   LVFCSFDSFQVVSNNAVNKTLKKFCEKSGITPSITSHALRHTHASLLLFKNVNIKYLSK
FT                   RLGHNSITTTLQTYSHIIDEMEQQESRHVDNIISSVYGIKEVK"
FT   gene            complement(682265..682978)
FT                   /locus_tag="LM5578_0667"
FT   CDS_pept        complement(682265..682978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0667"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67422"
FT                   /protein_id="ADB67422.1"
FT                   /translation="MKKMILGFVLILNVFLFGCGEPELSIKEKQKDEFVINVNGKTDAG
FT                   AKVTLIDESGEKSDIVNSEGDFVLVVPRMLSDTTYQVTSEKDDKKTTTKVKVPKKNKLI
FT                   AYYDFEKQFNELSEQYPGLNTKIPSVDSAKNQQDGFSVSLDGKNIMSIRLSYSENNSDA
FT                   SISSFTDYQNFILSVAATNVILNKAIDGTDTIDFIKNAVDEKEDAKKTVDNIIYNVSNL
FT                   DYMGDTITSVMIYPK"
FT   gene            complement(683033..683533)
FT                   /locus_tag="LM5578_0668"
FT   CDS_pept        complement(683033..683533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0668"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67423"
FT                   /inference="ab initio prediction:Glimmer:3.02"
FT                   /protein_id="ADB67423.1"
FT                   /translation="MNILDFYQPSVAEKYLSDYLIAQNVLLPSDLEIESLLIKLNLFIV
FT                   KGDFSMSLADYGGIVLAQQLSREQFIEKLHHELVHIITHCGNQQLMNLKAIENQEKNAN
FT                   RSLMYISIPYHMLNFIDFTSDYIEQDLLELFPTTTSDIISNRMLSIRNYLLQSSSLPKL
FT                   QYG"
FT   gene            complement(683546..683872)
FT                   /locus_tag="LM5578_0669"
FT   CDS_pept        complement(683546..683872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0669"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67424"
FT                   /protein_id="ADB67424.1"
FT                   /translation="MFGKILKTLRINRGMTQADLGSKLNISKVSISKYENGNQFPDTDT
FT                   LKRIADIFNVSTDFLLGREEAIPQNLAFDDLRGLTEDDLKKVNNYIALIKKQRQELEEI
FT                   EKEL"
FT   gene            684046..684237
FT                   /locus_tag="LM5578_0670"
FT   CDS_pept        684046..684237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67425"
FT                   /inference="ab initio prediction:Glimmer:3.02"
FT                   /protein_id="ADB67425.1"
FT                   /translation="MITKLKELRIENNLTYGDVATKVGISKEYYWMIENGERDGYTYNT
FT                   AKKIASVFDKNPDDIFLC"
FT   gene            684336..684662
FT                   /locus_tag="LM5578_0671"
FT   CDS_pept        684336..684662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0671"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67426"
FT                   /inference="ab initio prediction:Glimmer:3.02"
FT                   /protein_id="ADB67426.1"
FT                   /translation="MVTQELSVTIPIPESHVIITKTEYEELLKQEIVGKYWDLKALENK
FT                   IGRKRDWIEEKILYKPSFRSMLDVDENPDGFVKYPSAENRKWSFLASKMNDFLENNFPE
FT                   IMRG"
FT   gene            684835..685749
FT                   /locus_tag="LM5578_0672"
FT   CDS_pept        684835..685749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0672"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67427"
FT                   /protein_id="ADB67427.1"
FT                   /translation="MSGINNNNLLINDYPLQVLPTLAREIGLNEAIVLQQIHYWLNKKQ
FT                   NLHDGRYWTYRSIQKWQEENFSFWSLNTVKRTFTSLREKKLLLTANYNKKKFDKTVWYS
FT                   IDYDALEAMSQRLAQNEPTISLKRANALAQNEPDNTLDLPETPKENKKNTVEELDDTSI
FT                   FKNVIDFLNENAETNYRHTTQVTQTLIRARLKDGFTFEDFKKVIIIKCKDWKNDSAMSR
FT                   YLRPGTLFGIKFEGYLNQKTVSGNQKKPWEKEPKKEELPPWFDKDQNGADGKVYTEDEK
FT                   AQIAQKLEEAQAKYEEDRRKRGL"
FT   gene            685751..686107
FT                   /locus_tag="LM5578_0673"
FT   CDS_pept        685751..686107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0673"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67428"
FT                   /inference="ab initio prediction:Glimmer:3.02"
FT                   /protein_id="ADB67428.1"
FT                   /translation="MKESDMDKVRKMNVAEIRQLQNGVIANIETNYDNLSRDERKELQN
FT                   DLKFLEGIRDSKKGITAASKLLAFTVEEYKELAKSNSDKSIADELGVSRSTFADWKRKK
FT                   NLVPWNNNVKGRNI"
FT   gene            686104..686520
FT                   /locus_tag="LM5578_0674"
FT   CDS_pept        686104..686520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0674"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67429"
FT                   /inference="ab initio prediction:Glimmer:3.02"
FT                   /protein_id="ADB67429.1"
FT                   /translation="MIIANNRLKKVIDKIDFAAKNNRMMLPDKLDAETLATIYAEIEAR
FT                   NSKIKRLEKMAGITESEADLIQIPNKNTDFVHCNVGAFRFDKGQQYEVVKVNKKRGTFI
FT                   LLDNNGKKEEFSFLAIINESFSVSKKRNDKGVSS"
FT   gene            686517..686693
FT                   /locus_tag="LM5578_0675"
FT   CDS_pept        686517..686693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0675"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67430"
FT                   /inference="ab initio prediction:Glimmer:3.02"
FT                   /protein_id="ADB67430.1"
FT                   /translation="MRKNEQDLLNQLSKRRIGIQHQIASLIHTEKCSLKEALAMTDREI
FT                   ESAYNEMRMLLES"
FT   gene            686707..687231
FT                   /locus_tag="LM5578_0676"
FT   CDS_pept        686707..687231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0676"
FT                   /product="sugar-phospahte nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67431"
FT                   /protein_id="ADB67431.1"
FT                   /translation="MYELRKTDKDHVATPRYVVEDIYSLIDIESFKSLWFPFNHYDSLF
FT                   KLRADELNLKYKATHIFDDVGNDFFTTEPPAGCDLMISNPPFSEQNRIIERSFQLIDEQ
FT                   KIKSFALLLPLSTLETEKRANIFAQYSDKLAILIFKKRIKFLGHSTSFNRGCCWVCYNV
FT                   PALENKRIQWV"
FT   gene            687240..687704
FT                   /locus_tag="LM5578_0677"
FT   CDS_pept        687240..687704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0677"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67432"
FT                   /protein_id="ADB67432.1"
FT                   /translation="MKILDACCGSRMFWFNRTNKNVTFMDNRELETELCDGRKLVVKPD
FT                   VVADFRSMPFDTNTFHLVVFDPPHLLKAGEKSWLAKKYGKLDSLTWRDDISQGFEECMR
FT                   VLKPNGTLIFKWNEDQIKLSEILKIIDFEPLFGNKRSKTHWLVFMKEAKA"
FT   gene            687701..688414
FT                   /locus_tag="LM5578_0678"
FT   CDS_pept        687701..688414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0678"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0678"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67433"
FT                   /protein_id="ADB67433.1"
FT                   /translation="MTLTTETINSLIGIKESYQASDALMKILFDREKREEIFKQFLQHD
FT                   THLEKDWFHVYFEEEHANKKKYAQDFTPTAISNVASQLVRGLTDSQGGTRLDVAAGTGS
FT                   LTICKWYEDCLKYSPFDYLPSMYLYQCEELSDRALPFLLFNLLIRGMNATVIHGDALTR
FT                   EAKQVYFIQNDKDDLLNFSSFNIMPHSETVEKEFNIHKWLEPVIEHIESPLSVADRYLN
FT                   ELETEDEEASQLKLF"
FT   gene            688425..689369
FT                   /locus_tag="LM5578_0679"
FT   CDS_pept        688425..689369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0679"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0679"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67434"
FT                   /protein_id="ADB67434.1"
FT                   /translation="MAKKQKEILFCDYFEEWIEVYKVGAIAKITLAKYYNAAKQLRDIC
FT                   PKLFISDFDRREYQRIINVYATTHEKQTVKDFHHHVKACIKDLFHDGLIDKDPTYRVVI
FT                   KGAEPTRAKKRKFLQKEELSKLLQSLDTNEIGFGWFVMLVAKTGMRYAEALAITPADFD
FT                   WTAQTISINKTWDYKYNKGFAKTKTLSSVRTIKIDWQIVGQFKPLIKDLPENEPIFVEK
FT                   FEDGTYKRQFNSTINNFLDAKCKEAGITQISFHALRHTHASVLLAEGVSVHTISARLGH
FT                   ADVGVTQETYAHVLDELQKKDDQKMLSVLMQIA"
FT   gene            689382..690062
FT                   /locus_tag="LM5578_0680"
FT   CDS_pept        689382..690062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67435"
FT                   /protein_id="ADB67435.1"
FT                   /translation="MRKNWTDEEIRVLQNNYEYVDTEIIANFLDRSYYSIKNKATRLGI
FT                   SKNYDWTEDDDIYLEYFVYENDDNIGKAAEFLGRTKEAVLNRLVKLRKRDSSVAYIRRP
FT                   WTKKEDELLKNNYIIMSNDQFAERLRRTKASVSGRKVLLGLTNKHMSKEDDKMIRHLGN
FT                   QGYTIKEISAEMNLSYCLVKNYIRSHKINYRRESKNEINGWRKEADATYSHYINSKKIK
FT                   EEQA"
FT   gene            690059..690274
FT                   /locus_tag="LM5578_0681"
FT   CDS_pept        690059..690274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0681"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0681"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67436"
FT                   /inference="ab initio prediction:Glimmer:3.02"
FT                   /protein_id="ADB67436.1"
FT                   /translation="MSEQEAKKIILKWLKESSEFLTPIRLFFDLENRNSKAPRQVVEAY
FT                   LAIENRKVEYELLAEFASWGLEEVAE"
FT   gene            690271..690654
FT                   /locus_tag="LM5578_0682"
FT   CDS_pept        690271..690654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0682"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67437"
FT                   /inference="ab initio prediction:Glimmer:3.02"
FT                   /protein_id="ADB67437.1"
FT                   /translation="MSILASIGILAVASLFTLILIFIFDRCKNKRVLRDLRIGDEIREK
FT                   GSFTLLQGIVVHIDSARKEVVLLCLDGRRLFRTVKPGNFIKTGLRFTVTELNEYRSDYS
FT                   KKLYKEADELLNSYTAFNGKYNN"
FT   gene            690676..690924
FT                   /locus_tag="LM5578_0683"
FT   CDS_pept        690676..690924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0683"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0683"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67438"
FT                   /protein_id="ADB67438.1"
FT                   /translation="MTKTHELKIAPEYFEAVTEGRKTFEIRKNDRDFQVGDTLILREWD
FT                   DMDTGLYTVVEVVYMTDYEQKDGFVVLGIVLKEEEEE"
FT   gene            690924..691505
FT                   /locus_tag="LM5578_0684"
FT   CDS_pept        690924..691505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0684"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0684"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67439"
FT                   /inference="ab initio prediction:Glimmer:3.02"
FT                   /protein_id="ADB67439.1"
FT                   /translation="MNSVIHLFSFNDYVGYMMYMHKKGYRWSDGTPLAPASYEEWDVKG
FT                   RGTYVLENYKSKTISRVSIGYVTQTPLPNIIPYFEKTNYVGYPEPIKRDLNAEMLTEKE
FT                   SRVIKKEAFDALVKPQHRMKDEISQPSHYTSGGIEPIKFIQSHNMNFEKGNVIKYVTRA
FT                   GKKEGQNEVKDLKKARQYLDFLIGKLEESK"
FT   gene            691505..691984
FT                   /locus_tag="LM5578_0685"
FT   CDS_pept        691505..691984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0685"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0685"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67440"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_465832.1"
FT                   /protein_id="ADB67440.1"
FT                   /translation="MMNRVVLVGRLTKDPDLRYTPAGAAVATFTLAVNRPFKNAQGEQE
FT                   ADFINCVVWRKPAENVANFLKKGSMAGVDGRIQTRNYEDNDGKRVFVTEVVAESVQFLE
FT                   PKNNPGRATTNDYQSKANYSNNAQTSSYESGASQKDGAFVSDSKPIDISDDDLPF"
FT   gene            692038..692229
FT                   /locus_tag="LM5578_0686"
FT   CDS_pept        692038..692229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0686"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0686"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67441"
FT                   /inference="ab initio prediction:Glimmer:3.02"
FT                   /protein_id="ADB67441.1"
FT                   /translation="MGVTKMWDLYVRKETSFCYKNSYKTKKEAEQEAEKLFADGACNHC
FT                   YITNFKAKEHAYISKNDN"
FT   gene            692290..692808
FT                   /locus_tag="LM5578_0687"
FT   CDS_pept        692290..692808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0687"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0687"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67442"
FT                   /inference="ab initio prediction:Glimmer:3.02"
FT                   /protein_id="ADB67442.1"
FT                   /translation="MGLDDLIFEYKVSLQHANRKKAECENIAEKKIWGEITTSLENSIA
FT                   YMQTGVSPWDFKLGEKANTQSRTIYADSYLLDYLNYKNPQTCAEKELGEFETKMISSLL
FT                   RKLTKQEKECYLLNKQCMCSYSDIAEYLNITIKSVENSIRRAKHKIDVQKEKSLLVNVY
FT                   LNGENEVHK"
FT   gene            692805..693347
FT                   /locus_tag="LM5578_0688"
FT   CDS_pept        692805..693347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0688"
FT                   /product="prophage LambdaSa2, site-specific recombinase,
FT                   phage integrase family"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0688"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67443"
FT                   /protein_id="ADB67443.1"
FT                   /translation="MNTVEPIRDRDTITEIKRYLIVKSSRDYILFFLGINVGLRIGDLL
FT                   KLKVKDVRGGHISMREQKTNKNKKILIPRDVKKALELYTLDLEDEDFLFQSRKGVNKPI
FT                   TRETAYRVLKELEPIFKLDRVGTHTLRKTFGYHFYKQFNDVVALQKIFNHKDQKETLLY
FT                   IGIQQDELDKKMAKFNL"
FT   gene            693629..693856
FT                   /locus_tag="LM5578_0689"
FT   CDS_pept        693629..693856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0689"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0689"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67444"
FT                   /inference="ab initio prediction:Glimmer:3.02"
FT                   /protein_id="ADB67444.1"
FT                   /translation="MKLREVTINANSQSGEESNVKIHIDYAGCTDKTVVQIMQCFVNAA
FT                   RKISLESKLTCVIDNEEVYSNTGGADIAEQ"
FT   gene            693843..694157
FT                   /locus_tag="LM5578_0690"
FT   CDS_pept        693843..694157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0690"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67445"
FT                   /inference="ab initio prediction:Glimmer:3.02"
FT                   /protein_id="ADB67445.1"
FT                   /translation="MPNNEALEAEAIKMMLSQNKLNEEGLALRLYLITVIETFKAMNKK
FT                   IKTNYNTHMIMNLEKLADDYDQALSAHGLISDEQFTAMKKAQLDVVNKTLYPAQTKKKK
FT                   "
FT   gene            694209..694355
FT                   /locus_tag="LM5578_0691"
FT   CDS_pept        694209..694355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0691"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0691"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67446"
FT                   /inference="ab initio prediction:Glimmer:3.02"
FT                   /protein_id="ADB67446.1"
FT                   /translation="MDMLLIKEKLLKKNEREQRANELNFIKVERGRNVDTISYLKNLFA
FT                   KDV"
FT   gene            694611..695138
FT                   /locus_tag="LM5578_0692"
FT   CDS_pept        694611..695138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0692"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0692"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67447"
FT                   /protein_id="ADB67447.1"
FT                   /translation="MAGRKKKLTAVNKKHLTKEEKEERENVENKATDGFGELQETPPKY
FT                   FNNLARNEYRRVVKEIKKLPIRGLDRGVLEQYCVWYSVWREAYDKYKKNGIYMTRSYLN
FT                   KNQEVKYYTDYSRKNPAVGMMADASAKIIQSASSLGLTVDSRMKIVTPEEKQESSIFDM
FT                   FADDDEEDEDDD"
FT   gene            695107..696858
FT                   /locus_tag="LM5578_0693"
FT   CDS_pept        695107..696858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0693"
FT                   /product="terminase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0693"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67448"
FT                   /protein_id="ADB67448.1"
FT                   /translation="MMTKKMKTMTNFSEIEDKYKDDAYLYCRLILDKKILASNAVIAAC
FT                   ERHLNDLLEIKEQSFKYSYRPKRAQNAIKFMEVLPDPKTGKTFPLAMFQKFIVGNIHGW
FT                   YKKGKKNVRRFKTALVMMARKNGKSILIAGLMLYEFLFFKNPQMSRQMFCAGNDKKQAS
FT                   LVFKMVAKFLRALSLQDKQVRKATKKVREEIRNLIDDSFIIPLSRDTSSLDGFEPQFTS
FT                   MDEAHEYTDDEIFELIESGQGQLESPLTFIISTAGFKLNGWLYTTMYPYAKSILAGNVI
FT                   DDEMFVFIAEQDFADEWQDETTWIKSNPILEIKAKYEDNMEYLRKRIKTGIEQNKIFRR
FT                   LVKNFNYWMQASEESYMDSKDWKAAGTSDADIYGKDVYIGVDLSKGGDISALGFVFPFE
FT                   DKKFHVDAHSFIGTRGGLDLKIDRDKIDYRLMVKKGVATLTDLESGIINYAQMIDYIER
FT                   YVQAYNLNVRAICYDSYNISLFLAELEKRGLDYELIEVRQGVKTLSDPTKEFKLGVIDK
FT                   RITHSNNALLDIAVNNAILKYTNDACQINKERNREKIDPIVAVVDGFTEAMYYEPDSKE
FT                   LYFDVWG"
FT   gene            697068..698303
FT                   /locus_tag="LM5578_0694"
FT   CDS_pept        697068..698303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0694"
FT                   /product="portal protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0694"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67449"
FT                   /protein_id="ADB67449.1"
FT                   /translation="MFFKKRSEVREKTEVDTDTLNVLLSEAYGGNVSWSGVGALRNSDI
FT                   YTAVKTISSDVASSPFEIVVNGIKEKDSNLNYLLNKRPNQQMNPWHFKFVITANMLLNG
FT                   KSFVEIKRAKYGVPAELLFHRNSTVTFTQKKDAIVYTIVQSNGKTKTIPAKNMLHFRTF
FT                   TLDGFNAYSPLHTLAKEISIQEGSKSALDAFFKRGAMVGGIVKLDKALKSTEELTDKRK
FT                   EFSEAYGGAMKAGGVLALDSTMDFKQLEIPTEILKFLNGYTFSTAQVAKSFGLPLEKLG
FT                   IETTNTSQSQANADYLKSTLYPIFSCFSTEIEFKMIDYPFNQFTEVSFNVDRLLEMDPE
FT                   TKAKVVKELVQGTLLTPNEGRARFGAPPVEGGNELLASLNYTELSGLKEYQKNRSERGY
FT                   KTRSAGEGGEDE"
FT   gene            698300..698866
FT                   /locus_tag="LM5578_0695"
FT   CDS_pept        698300..698866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0695"
FT                   /product="hypothetical protein"
FT                   /note="Kegg: K06904"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67450"
FT                   /protein_id="ADB67450.1"
FT                   /translation="MNEMETRSLESVESKEENSIAGYALKYNSLSEDLGGYKEIISPNA
FT                   LNGVDLSDVRALINHDRNQCIGRTKAGTLMLKNDSTGLGFVCTLPGTSFARDLKENIKA
FT                   GNISQCSFKFRTTENGVSWKRSKDGDYIRTIEQFSEIEEISIVTIPAYEDTNVAVATRE
FT                   LANEKDYQNRLAIVKLQLDLDELTI"
FT   gene            698930..700099
FT                   /locus_tag="LM5578_0696"
FT   CDS_pept        698930..700099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0696"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0696"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67451"
FT                   /protein_id="ADB67451.1"
FT                   /translation="MFKDKIEKLEKELQTTRESFNTKITEAREKAESGDVDAAEKLKKE
FT                   IDTLKETLKAKQKELDTLLGLSELETIPDPLEKREGEEDNGERSKGNHNILDNTNKVDA
FT                   FERYIRSKGAETRDLTTTNTGVIVPVDITNSVKELKQQELDLSKYATVENVNTKTGKFP
FT                   IAKRISATLATKEELAEIAKIDEPMFIEVEWDVQTRSGQIVLSEELIEDSAIDVKAYIK
FT                   KQLARMVLNTKNYNIIKVLSSMTTVAGTGADDIKKAINVTLDPALNKMFIVNQDAFNWL
FT                   DTLKDSEGRYLLQPDLTAPSGKSLFSSPVEVVSNSLLASKGTQANPKYPIIVGDIEESV
FT                   AVFNRSEITVEWEKFDRYSQGLAVNVRNDFKKIDPDAACYLEITPPTAG"
FT   gene            700148..700486
FT                   /locus_tag="LM5578_0697"
FT   CDS_pept        700148..700486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0697"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0697"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67452"
FT                   /inference="ab initio prediction:Glimmer:3.02"
FT                   /protein_id="ADB67452.1"
FT                   /translation="MTNEHKTRIDLATAKEHLKLEHDEDDSIIQNIYLPAAEQEIVGAV
FT                   TLEYESPFFDDNAVFKIATLLLLSSNYENRKATSLQKQNEVPFALISYIQRLRGDYKKW
FT                   TLKNSQIE"
FT   gene            700456..700776
FT                   /locus_tag="LM5578_0698"
FT   CDS_pept        700456..700776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0698"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0698"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67453"
FT                   /inference="ab initio prediction:Glimmer:3.02"
FT                   /protein_id="ADB67453.1"
FT                   /translation="MDFEELTDRITFRQKKNKKNNYGESEEVKEAVGSCWAGVRRATIK
FT                   EFSDTEGRANTITFIIRKKQRFNIDSTQVIFYEGNDFEIIEMPPTAQADDFKLIKARWV
FT                   EW"
FT   gene            700770..701135
FT                   /locus_tag="LM5578_0699"
FT   CDS_pept        700770..701135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0699"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0699"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67454"
FT                   /protein_id="ADB67454.1"
FT                   /translation="MVKGLEEMQANIQKMILENKQEAKKAVNQVAEETKELLQSNIPVS
FT                   TEAGKHLKDDVALSGFKMISGGSVEKDILYKKEGWRARFPNNGTAKQSAQNFEEKTLNV
FT                   MSRKALRIYAEALRKGL"
FT   gene            701138..701536
FT                   /locus_tag="LM5578_0700"
FT   CDS_pept        701138..701536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0700"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67455"
FT                   /inference="ab initio prediction:Glimmer:3.02"
FT                   /protein_id="ADB67455.1"
FT                   /translation="MLPVKRAYDALVLNEALNESINNIRGKILEEQTIYMLALPETFQN
FT                   KKNAPVIRIESVNNYSSFYFDDKANAESAEIQISTMTNSIQHLEILIPLIDEAMRLNGF
FT                   EQYADDTYIEPDFKFNYNARQYKGVFKK"
FT   gene            701557..702132
FT                   /locus_tag="LM5578_0701"
FT   CDS_pept        701557..702132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0701"
FT                   /product="major tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0701"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67456"
FT                   /protein_id="ADB67456.1"
FT                   /translation="MVKIGLDKAQYAKLDEKDKASEVKSLPGLTTAKLELEMENENFYA
FT                   DDTIFAILESGITKLGLEYGLADISSDAKKDLLGIVVEKGMELFKKDISAPYIATSFRS
FT                   RLDSGKYVWFGLVKGKFAPSGLDLTTKEDKATAQTETISASFVAREADGNMLVIAREDN
FT                   KDFVLGDFYKMVYGIDPTEAVTPPENGE"
FT   gene            702222..702569
FT                   /locus_tag="LM5578_0702"
FT   CDS_pept        702222..702569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0702"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0702"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67457"
FT                   /inference="ab initio prediction:Glimmer:3.02"
FT                   /protein_id="ADB67457.1"
FT                   /translation="MEIRLMKENEKQGVLYKKNKTTMFDAMVGMEYNIRQVERFAGKDE
FT                   MELTNTYEGIMLQMEGTKDAAKFLVTAFDNQFSVDDVLKGITREDFAGVVNGVLFEVMG
FT                   GNTDETKKEQK"
FT   gene            702653..702748
FT                   /locus_tag="LM5578_0703"
FT   CDS_pept        702653..702748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0703"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0703"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67458"
FT                   /inference="ab initio prediction:Glimmer:3.02"
FT                   /protein_id="ADB67458.1"
FT                   /translation="MTLDDVEFLIEITKQEEEKIVAIDKAFPGLF"
FT   gene            702766..706965
FT                   /locus_tag="LM5578_0704"
FT   CDS_pept        702766..706965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0704"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0704"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67459"
FT                   /protein_id="ADB67459.1"
FT                   /translation="MAEKFGDLIATASLDINPFQTSARTLERQGRALGKNLKATEAMFK
FT                   NTGKSIEGLKAKQQVLGKQLQVSSELVRKNTEKYNALKDATGDVNAATDEQKRKLLAAE
FT                   QAMHKSVAEAESLRGKYNALSKEIALNSSKLVQSGIKMQALGTKMQNVGKGISSVGMGI
FT                   TTKFALPLAAGIGLSVKAASDFESAFAGVKKTVDEVVNQNGEVTYSYDKLAAGIRQMSK
FT                   EMPASTTEISAVAEAAGQLGIQTPAILDFTKTMVNLGVATNMSSEEAATALARFANIVQ
FT                   MKQSDFDRLGATIVSLGNNFATTEKEITDMGLRLAGQGKQVNMSEADIMGLAAAMSSVG
FT                   IEAEAGGTAMSMVMKKINNAVYSGKGSLKGFADLAGMSAKQFQKAWKDDAAGALDDVVH
FT                   GLQKNSKEGKNLTAILNDLGIKGIRESDTMLRLSGNADILTDALGNSKTAWKENSALTD
FT                   EAAKRYETFESQLKIFKNQINDIAIDLGGPFMKALNAGLQASKPFLNSIKEMSKAFADA
FT                   TPETQKLVLKLAATALAFGPVTIGVGKFVSAGGTLIKATGSMVQGLGNFAVKAKLAKTG
FT                   TDALAIGTVNAGKGAKVASVATRGFGASLGATLVTMGPWVLAIGAIGLAAYGLYKVFGD
FT                   NNARKWGADIGDAADKSLSKVSQFSAEGTVAMESFSTDMSGNAKIVKTAFQGMADEVKK
FT                   SVDDSIKALEESYNNLPEEVKTMYKKTLDEAKKDGEEKKKLAQTQADSAMKIVENAAKN
FT                   ERDLTETENKRLISLEKNLLSENVEALKLSSDEEKKVKAALYQDIEKMDRSQRVKSANA
FT                   LSKSMSEQKKAYEEQKENAKALYAEDGNTERYMSTLDILETKNKAVTESIAVRWVELER
FT                   ASGISESAIEDGLKNFGLSLEDIERISNETTKNTADNLGLLADESSDANVAWNDLILDD
FT                   KTGEVTTNINDVISKAMSSEKEWKNLQFIIKEADLNSNAKATILDAVAQSGKWNQLSFE
FT                   EKEILIESDSTRQIVLALEDNKKWNNLDYEVKKAILESNTPQKLDEVLKNYELWDEIPW
FT                   DSSKKEAFLETNVDNTMQDVKKGFAEWDKAIPGQKNLIVDNNDVLNKILQSETVLVQYN
FT                   NQTVDLKDLFANNSDVLNKVKKGNDVIVEYNGRKINLKELYANNRDLFNKVTSGKKVLY
FT                   DYNGVPVNLKWLKMETNAGSVASQVQSAINNWQEMLNMRNKKIIEIAYKTNGKAPSGPQ
FT                   GLATGTNFHKGGLAVVNDARGANYQELITLPNGKTFLPHGRNVMLNLARGTKVLRGDKT
FT                   AKILNKVPKFASGTTRDLVSKSKAVNIASAINSATENASLSKKQTGVSDEQKSNKVLLS
FT                   QLKELVEQLIVVVQKPVMLGTVECMVSEGVLFKTIARFEKQKNSVQSRGIRGDLNV"
FT   gene            706958..709201
FT                   /locus_tag="LM5578_0705"
FT   CDS_pept        706958..709201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0705"
FT                   /product="minor structural protein GP75"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0705"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67460"
FT                   /protein_id="ADB67460.1"
FT                   /translation="MYNNSINEFGFSFAGSHSSLYNLKIIDIRRVVIPPSSEIVQNIEG
FT                   MDGAVYQGNNIGQRPFEIDVKLVSNTHESRLADLHDISDWLWSDKDNEYSLIFDDEPDL
FT                   EWFAHVSNISEVNRTKANGFFTIAFNCSDVLGYMEKETVQVAVNPFIITPQGTRRSNPI
FT                   ISMIPYANTRKIAVVQDEEDRWAYLGEDVDPETGNIGVDKSPLVYQDECNTLAPWTTLS
FT                   SSNIPFALENGFIYNDAKMISNHTEFRIGSKNGAQFWGGNGTTTENWHGAAVMKMMDAE
FT                   LDNWSVKFVCHNYTYYPRAKGKVELYLLDKNKSKIGVMTLKKNSVKSSELILEVKLFSG
FT                   SKNTFVYSGTGPTKKGKTVTKTVRVKLGGKTVKVKVKGTNKTKTEQAWSDVKIAETTTT
FT                   SMFSNFYGEIILEKRGNKFTLLVNKYNKSRSQDPKFTPIRITKTLNDYKGLSLSGVAYY
FT                   NAKMDIYEDNPKHAKGYSQQGMSMSFLRVNKLFENTPSGVDYVANSRDEVKFNAEDKHV
FT                   YINGTIQQKNWAIGGELPIFDGGHETTLAFSHSPYEQIYDGASHNLIRNSTWKEGKKFW
FT                   TNGDANGNPYRISNPEADKPDSSIFSIMAHTNAAAQNASDLIFVEKGKEYLVSCDVRLT
FT                   KNDKSSDIFFCVRTFPDEEYTNAAAVATSTFYIRKSDYPNWTINQWYRLTFSFTADDNW
FT                   VRIIPYNSDVINGTRVDYREVKMTDNLTDIIWSPAPIETECAEIYIEYRPTRG"
FT   gene            709207..711498
FT                   /locus_tag="LM5578_0706"
FT   CDS_pept        709207..711498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0706"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0706"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67461"
FT                   /protein_id="ADB67461.1"
FT                   /translation="MYLILDNRLQQVGVLDNDRPASCKFYDDVVVTQLADESGKVWSDN
FT                   LTISASYGYHETDYIVAGNHILKQKRNGKYYIYRIIEVRETTAGQTFAKTATCENLLIS
FT                   DLNHTVLDNKNLINATSEQIFEYALQNSGWIISDNEFAGDTKSIDFTGRKEGREAFSEA
FT                   VSLFNVEIDAYVEFSAGQITKCVDIKRKIGDNNGVRIEYEKNVVGMSRIENEESFYTAL
FT                   IVEGGTPSGKDSPITIASVNGGKDYIVNENANDQFNDGKEYRFGKVQNEKIFNASGLLT
FT                   WGKEQLEKASRPLFNYEIDISLFNEDIQIGDTVRIINLDMSPALTVIARIISVTESEAN
FT                   PSENKVVAGEFVTVKSVKPSDVSALEALIFETQRDIEESKTYKIELAGANVIKSSQLET
FT                   QIIARVFSGKDNITSSIAPANFVWSLFDKDGNHVESWEREWAGKGNVVTIPASLMAGAS
FT                   ISCTVVDDVSEVMLVSAKEEDAILLAELGAGTGITNVMQCAGVDYERGHIYWTQASNYA
FT                   GYTESFILTRTDLRGIYIDSVRCLEGGHGTTIGLEWSELESEMNIWTHWFTDAKHTANA
FT                   IVRFKYVGTSTPALLTYEKTDYKLNTGTTYYRVTYDTKNNYVVLSDGGANLGISICNVS
FT                   DVLKGKITPLYRCSGKEMGFNIATMTLQSTCAAFPYAYLSYGAGITGTDRNTVICYDMI
FT                   NKEVIYKLAFTFDKGTIVPTGSVAEMEGAFIYFDGNGVRNLSCNFGFGEPGKRVNRIYR
FT                   IREKEVLVSE"
FT   gene            711491..712552
FT                   /locus_tag="LM5578_0707"
FT   CDS_pept        711491..712552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0707"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0707"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67462"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_465804.1"
FT                   /protein_id="ADB67462.2"
FT                   /translation="MSKNALGTGYLSLQVLSDGITTSAAPPENPSIGTGWLDANYSPAV
FT                   YKFWNGVVWEVGTIDIAEADPKASEKIDEALEEARKKSRTIYSETPPETPGEGDTWYSL
FT                   NATGNVGAVKIWKEGEWVDKKFDLTALSIEELHAISIYGGVISGSEFLHTVNHRDEDGN
FT                   LYSGAVRMNDDGFTSSTYLPTGLGSTVLESVINTLGGYKIAQKLIDDKGEGVAKDAMLT
FT                   ASSLIFSESGNIKLSIDADSFYKTSWKDLPLNAGYSTAKFNTPQYMILCIFGIRIVFFR
FT                   GQVQKSTAWASANAFASVPLEIQTTRTAMAYAPTSKSTGGRVHASSANAMSFMPVDTSV
FT                   TYFSLNQLFYVLD"
FT   gene            712969..713250
FT                   /locus_tag="LM5578_0708"
FT   CDS_pept        712969..713250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0708"
FT                   /product="holin"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0708"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67463"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_465803.1"
FT                   /protein_id="ADB67463.1"
FT                   /translation="MEFGKELLVYMTFLVVVTPVFVQAIKKTELVPSKWLPTVSILIGA
FT                   ILGALATFLDGSGSLATMIWAGALAGAGGTGLFEQFTNRSKKYGEDDK"
FT   gene            713250..714095
FT                   /locus_tag="LM5578_0709"
FT   CDS_pept        713250..714095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0709"
FT                   /product="L-alanoyl-D-glutamate peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0709"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67464"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_465802.1"
FT                   /protein_id="ADB67464.1"
FT                   /translation="MTSYYYSRSLANVNKLADNTKAAARKLLDWSENNGIEVLIYETIR
FT                   TKEQQAANVANGASQTMRSYHLVGQALDFAMTKGKTVDWGAYRSDKGKKFVAKAKSLGF
FT                   EWGGDWSGFVDNPHLQFNYKGYGTDTFGKGASTSNSSKPSANANTNSLGLVDYMNLNKL
FT                   DSSFANRKKLANQYGIKNYTGTATQNTTLLAKLKAGKPHTPASKNTYYTENPKKIKTLV
FT                   QCDLYNSVDFTEKHKTGGTFPAGTIFTISGMGKTKGGTPRLKTKSGYYLTANTKFVKKI
FT                   "
FT   gene            complement(714317..714406)
FT                   /locus_tag="LM5578_tRNA04"
FT   tRNA            complement(714317..714406)
FT                   /locus_tag="LM5578_tRNA04"
FT                   /product="tRNA-Ser"
FT                   /note="Cove score: 63.08"
FT                   /inference="ab initio prediction:tRNAscan-SE:1.23"
FT   gene            715535..716398
FT                   /locus_tag="LM5578_0710"
FT   CDS_pept        715535..716398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0710"
FT                   /product="glutamyl endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0710"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67465"
FT                   /protein_id="ADB67465.1"
FT                   /translation="MLIPLSGKATVEKSLDLSGTTCVTNEEQLEIQDFVDSSKEAREKF
FT                   VEEYNEAHPEDQVENTEPIINPIEKQAPRLLKKVVGADNRVKANVNNSPYKQIGYMEMS
FT                   FKKGNKMVWYVGTGTIIGSNKVLTAGHNLYDKSTRSWANGVIFQPKMNNWVSPTYVTSS
FT                   KLHVPVNWSSKGDSNYDIGVVTLSKSVSSYGSLKYRVPTANTTLFSTISGYPGQSPKAG
FT                   SQWYGNGNALITNQKISYSIDTTGGQSGSPIINNGSIIGVHTLGSSANSGVRITPALKS
FT                   FIDGAK"
FT   gene            716398..716757
FT                   /locus_tag="LM5578_0711"
FT   CDS_pept        716398..716757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0711"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0711"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67466"
FT                   /protein_id="ADB67466.1"
FT                   /translation="MKKIISLILLLLILTACSNDPQKESSVEANGIVESVDGYSIVVNS
FT                   FKENSKKVTADKGEKIYFDIEDKYYNEEGKKIKLSEIKRNDKVLIELSDDYKIQETYPG
FT                   KIDSMDVIKIIKLNS"
FT   gene            716855..716977
FT                   /locus_tag="LM5578_0712"
FT   CDS_pept        716855..716977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0712"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0712"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67467"
FT                   /inference="ab initio prediction:Glimmer:3.02"
FT                   /protein_id="ADB67467.1"
FT                   /translation="MIQGIFVRFLVIGEKIYDLLDAFKSNWAIEILCLKNDYHM"
FT   gene            717289..717822
FT                   /locus_tag="LM5578_0713"
FT   CDS_pept        717289..717822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0713"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0713"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67468"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464166.1"
FT                   /protein_id="ADB67468.1"
FT                   /translation="MERKLIQEINLLENKKLVMNLNIVAIAIVLILTVLGIVFSGGFAI
FT                   TNGFMGIIWMFGGYAVAIVLHEAVHGIFFKAFRPEAKVKFGFKNGMAYAGSPGAFYTRA
FT                   QFFIISIAPFIVLTGLFIFLRFLGVNEAVLYLIFALHTSGCVGDFYYCILLINQPAGIV
FT                   VEDTDKGINFYSEG"
FT   gene            717886..718803
FT                   /locus_tag="LM5578_0714"
FT   CDS_pept        717886..718803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0714"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0714"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67469"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464167.1"
FT                   /protein_id="ADB67469.1"
FT                   /translation="MKRITIGNSALTASEISLGCMRMADLSKEDANKVINTALENGIDF
FT                   FDHADIYGGGKSEEVFADAIDMNATIREKMILQSKCGIRQGFFDFSKEHIIASVEGSLK
FT                   RLKTDYLDTLLLHRPDTLFEPEEVAAAFTELEKSGKVRHFGVSNQNPGQIELLKKYVDQ
FT                   ELIANQLQFSIMHTGMIDTGFNVNMTIDPSLDRDGGILEYSRLNNMTIQAWSPFQYGFF
FT                   EGVFLDNDKFPELNKTIDKIAADKGVTNSAIAVAWIQRHPASFQTVVGTMNPGRIADIA
FT                   KASDVTLSREEWYEIYRAAGNQLP"
FT   gene            719069..720949
FT                   /locus_tag="LM5578_0715"
FT   CDS_pept        719069..720949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0715"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0715"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67470"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464168.1"
FT                   /protein_id="ADB67470.1"
FT                   /translation="MKDWMKQNWQFITTGISGILIVIGCLIGSDVGDFWTAIIFLSAFV
FT                   IGGFEQAKEGIQATIKTKKLNVELLMILAATGASIIGYWFEGAILIFIFSVSGALETYT
FT                   TNKSKREITKLMAFQPERAFRLLSNGDLEEVAVKELQLDDMVFVRPGESVPIDGVIVRG
FT                   STTLNEAAINGESVPATKTVGADVFGGTVNVSSAITVKVTQTFENTIFSKIIRLVETAQ
FT                   SEPSKTARFIERFEDVYVKAVLLFVLVMMFLPHFALGWSWNETFYRAMVLLTVASPCAL
FT                   VASVTPATLAAISNGARHGILFKGGVHLENLRGVKAIAFDKTGTLTNGTPALTDRLFAE
FT                   NVDKQLVINVVGAMERQSLHPLAAAITQDLEPEITEKLTEIEVTDVPGWGVQAIYREGN
FT                   WQVGKAGFVGKEAAAAFSNGAFERLASEGKTIVYVAKDGVIQAMFALKDTCRPEAIRTI
FT                   KALQAKGIKTIMVTGDNEQTGAAIQAELGMDYVVSGCLPEKKVDVLRELSVTYGSVAMV
FT                   GDGINDAPALAHAAVGIAMGEGTDIAMETADVVLMKNDLEKIPYAYTLSERLHWITWQN
FT                   ICFAIAVILVLITANVFQLINLPFGVVGHEGSTILVILNGLRLLRSNRKK"
FT   gene            721045..721773
FT                   /locus_tag="LM5578_0716"
FT   CDS_pept        721045..721773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0716"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0716"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67471"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464169.1"
FT                   /protein_id="ADB67471.1"
FT                   /translation="MKKINWTQWIALFVFASMGISVVFTIYEIFTAPVKQPATGPHVTL
FT                   RGDYIFLLFEIILGIFILLLPSIIARRFKFEIPGLVYILFIVFLYGSIYLGTVQKFYST
FT                   VPHWDKILHTFSGAMLGAIGFSFVSLLNSNDKVVMKLKPGFIAVFAFCFAVTMGAFWEV
FT                   YEYTFDGIMNLNMQRYNLSNGTPLTGRAALEDTMTDIIVDIIGALFIVIVGYFALKKGR
FT                   PWMERFEFKRKNWKKEPKKK"
FT   gene            721746..721883
FT                   /locus_tag="LM5578_0717"
FT   CDS_pept        721746..721883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0717"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0717"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67472"
FT                   /inference="ab initio prediction:Glimmer:3.02"
FT                   /protein_id="ADB67472.1"
FT                   /translation="MEKRTKEKIRAKSISARGGAFLVAQIRQQIWVSETIDWLVELFYT
FT                   "
FT   gene            721916..722566
FT                   /locus_tag="LM5578_0718"
FT   CDS_pept        721916..722566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0718"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0718"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67473"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464170.1"
FT                   /protein_id="ADB67473.1"
FT                   /translation="MFLDTGNLEEIKKALRFPFFEGVTTNPTILLKENRSRKTHIGSIQ
FT                   AKVVFVQAAGLTEEEIWEDVLRIQAIEPAEGTVIGLKIPAHEAGIKVIAKVRANFPNEI
FT                   ILATAIFSSEQGYIAALSGADYLAPYYNRMEVSGLDAAKTIEELRYVLDLQGLEDVKIM
FT                   GASFKNSRQIMQALASGADTVTIGYDLFLQMMNKPLALESIEKFNEHHAALPK"
FT   gene            complement(722606..724447)
FT                   /locus_tag="LM5578_0719"
FT   CDS_pept        complement(722606..724447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0719"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0719"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67474"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464171.1"
FT                   /protein_id="ADB67474.1"
FT                   /translation="MLERGIQLILFYFLLIIGKFTFAYFQIFKDPNFLALGMDLLFIVL
FT                   LLGLIHLFAPVRSHIYWYAGMSLFIGILMLVCVLYVRFYNEVPTYHSFSLIGEVGVVKN
FT                   SATSLLSGTDWLYILDIILLPFILYFNIKKGHEFPSFRLTSRVYGVSFISTLLILSGFT
FT                   YFMMQQNIISDSKRAKRMGIFTFNISTALTGADHVKAADITAKNVNDIKGVSVKSNPDY
FT                   FGAAKGKNLIIVQLESFQRNLTNVKINGQSITPTLDGLQNETMYSNQFFQTVSKSNTAD
FT                   AEWSVYTSTFPSGYYTNTQTYGDRVIPSMPRLLGKNDYKTATFHTNDASFYNRDEFYPA
FT                   VGFDKFYDRKFFGDEDVIGFSPSDEVLYNKAFPILEEQYKNNQKFYAQLISVSSHMPFD
FT                   IPKDKQEIDLPSDLKDTELGNYFEAVHYADKQLGEFIQKLKDSGIWDDSVVVFYGDHHI
FT                   IKTDQLPEEQKKYVNRSTQLKAEPADDYRIPFFLHYPGMENPGEIKNVGGEIDIMPTVM
FT                   NLLGIKTGDQIMFGTDILNSSNNYVPERYTMPEGSYFTNSYMYQPDESFETGAATNYDG
FT                   TNKELSSDVKKRFDASRKLLQYSDSYVNNLPLRDEDK"
FT   gene            724661..726052
FT                   /locus_tag="LM5578_0720"
FT   CDS_pept        724661..726052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0720"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67475"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464172.1"
FT                   /protein_id="ADB67475.1"
FT                   /translation="MNSLFRRKPIEDLMHNKSGSTHLKQTLGPLDLTLLGVGAIVGTGI
FT                   FILPGTVAAKNAGPAIIFSFVIAAIVCAIAAMCYSEFASSVPVAGSAYTYGYVVFGELI
FT                   GWLLGWALILEYGLAVASVASGWSSYLNALLSGFHISIPEAISGPFNPEVGTFINLPAI
FT                   IIVLVIAFLLTLGIKESTRVNTIMVVIKVGVILLFLVVGVFYVKPDNWQPFMPFGISGV
FT                   MNGAALVFFAYLGFDAVSSAAEEVKDPQRTMPIGIIGSLLICTVLYVAVSAVLTGMVPY
FT                   TDLNVTDPVAYALQVINQDWVAGIVSLGAVVGMITVILVMSYGATRLIFAMGRDGLLPK
FT                   VLAEINQKYQTPVKNTWIFAVIVAIISGLVPLDRLAELVNIGTLLAFMMVSIGIIFLRK
FT                   NKDIQARGFKVPLYPVLPIVSFLLCAFLISRLSVHTWILCGIWFVIGLIVYFAYGRKHS
FT                   ELLKK"
FT   gene            726142..726981
FT                   /locus_tag="LM5578_0721"
FT   CDS_pept        726142..726981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0721"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0721"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67476"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464173.1"
FT                   /protein_id="ADB67476.1"
FT                   /translation="MAEISEELRLGEVVLNVGHLKEMAGFYQEVIGLKLLEENERMVRL
FT                   GVSGSDEALLVLKKIDNAVVPEVPRIGLFHTAFLLPTRESLADVLLHLAKSGYPIDGAG
FT                   DHAYSEALYLHDIEGNGIEIYADRPKAEWMRDGDGNLPMVTEQVDVDSLLQIATDEPFT
FT                   GMPNGTIIGHVHLQVADADKAEQFYKEALGMKLTTAIPSARFFAAGDYHHHIGSNVWAG
FT                   RNLELLQENETGLAWFTIITPDKDAIITTLEEQGYDVKRFESTISVTDSNGIKIHFK"
FT   gene            complement(727064..727348)
FT                   /locus_tag="LM5578_0722"
FT   CDS_pept        complement(727064..727348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0722"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0722"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67477"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464174.1"
FT                   /protein_id="ADB67477.1"
FT                   /translation="MEFMSMIVTGIVLAAIISGLSFVVGKLSGLSWFWIAFCANSGFFI
FT                   IFITVQNSFPDNAAVALSYLNLGIGVVLIALTLFQSSNWLFKKTMQRKH"
FT   gene            727446..728396
FT                   /locus_tag="LM5578_0723"
FT   CDS_pept        727446..728396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0723"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0723"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67478"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464175.1"
FT                   /protein_id="ADB67478.1"
FT                   /translation="MIEFFKTTNEKMEQLSALEDGCWVKVTAPTDDEIEMLSKEMDVPK
FT                   PYILDALDSEERSRIELKRAEQDVRHSLVIVDYPYESEDELGYAMYETLPIGIVLTRKH
FT                   LVTITLRDLPILKDVQSMKLEEYDTTNHKQFLLKLLYAVSYYYLKYLNQIIKQTNNLEI
FT                   QIKQSMKNEQLYAFMAVQKSLVFFATALQSNKAILDKMEDVEHFMQQEDNHDLLRDVII
FT                   ENKQAIAMTDTYTQIISGMSDVFSSVISNNLNIVMKFLTSFTIILSLPTIVASIYGMNI
FT                   KLPFMHNEHAFALILLFTLLITTGVTVIFWRRKYF"
FT   gene            728420..729061
FT                   /locus_tag="LM5578_0724"
FT   CDS_pept        728420..729061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0724"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0724"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67479"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464176.1"
FT                   /protein_id="ADB67479.1"
FT                   /translation="MEKQTYEKLAYYTIKEKILSGKLHVGQHISEAGIAKELSISRTPV
FT                   RKAIAVLVSEELIEYELNRGAIVIESSMSAGRFIELLEMAEILVVQTIEKCKNKNLTYK
FT                   PEQGNALLEEMREIQKEEDVEAYLSLLSKWLLQFVAQLANSYAEDIVRKMKRDFFNKAQ
FT                   KDIKIIPVLLEEETMETLEQLTYYMVEKKHDLAKEVIQKLVNLYIIRTFR"
FT   gene            729104..731794
FT                   /locus_tag="LM5578_0725"
FT   CDS_pept        729104..731794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0725"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0725"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67480"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464177.1"
FT                   /protein_id="ADB67480.1"
FT                   /translation="MRKVYEIFILDWRRLFKAPLALLLVIALIILPSLYAWFNIEALWD
FT                   PYSNTSGIKVAVSIDDEGAEIDVPGKKPQQVNVGNQLKKTLEKNKKLGWTFVSEDEAKK
FT                   GVKSGKYYASIHIPKDFSEDMVSVVNDNVTKPTIDYSVNEKINAIAPKMTESGATTIVN
FT                   QISSEFVGTVSKAVLEEFNKAGIDLENELPTIRRLKTKVFQVQDALPELKKMGAEAVKI
FT                   EAKLPELKAKANQVVELNEKIPELNKATENVLLVEQQLPKIDQLGQDILVLQKKIPEIK
FT                   QIAESVKEVDENFGTIKKTVNDAVNESGKALDVIDTAMAAIPTVEKIAQNGSGYVDKVS
FT                   DFADEINKSFDTLAPAIKQNLTLMKQMADNIYQVTEAIKNGSITPEQAITELKKMEQDI
FT                   DSLQQMITKQTATLESLNETLPNKPFTDLIANLKTINSQLGAQKETITKVRTELENGAQ
FT                   PSEELLNQLNEQAKNVSEKLDQILANYDSEIVPAIKVGLNQIQGDLKDSQKLLETLQAK
FT                   IPEITQVLKDSRETLQTGQTYLEEFQERLPEIQKTLDEATKVINTKLDTIIAGINEAAN
FT                   FYQNDYPNVKANIKKAANFIRDDLPGLEKEINQASGLIQEKMPEFEKAIKIAADLSREE
FT                   LPEFEKAINNAANKITDFDKNYDLQSIIKMLRNDADKDSSFIASPVKLKETSYYPIPNY
FT                   GSASSPFYTALCLWVGALLLISLLRVDVEVPAGIFSHYHRYFGRLLTFLSIGLMQALIV
FT                   TLGNIFLLGVSIAEPLLHVLFSMFISVVFMTIVYTLVSLFNNVGKGIAIILLVLQISGA
FT                   GGNFPIQVSPPFFQAIYPFLPFTYAVSLIRESVGGLYMPTVWIDMSVLAGFAILFITLG
FT                   ILLKKPLDKVVPKLSEKAKRSKLIH"
FT   gene            731840..732487
FT                   /locus_tag="LM5578_0726"
FT   CDS_pept        731840..732487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0726"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0726"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67481"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464178.1"
FT                   /protein_id="ADB67481.1"
FT                   /translation="MANKFKTLDKMVYNLLLEKIKNGELVPNEHLAEEKLAREFGVSRS
FT                   PLRKAIATLTAQGIVSYHENSGAVLNDCIVDADRYVQLMETIEIFVDAAIAKAAHFGYE
FT                   MDLEKLYARMQEMERFSYLTDLENYFDAHHRFILCLISFAENPYQVRIVKQIFFQMVHF
FT                   SDGINMFKSVEIREWTNKKSNQIYELLAEGKIELARKTIKSMFAELTIQAYR"
FT   gene            complement(732496..733032)
FT                   /locus_tag="LM5578_0727"
FT   CDS_pept        complement(732496..733032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0727"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0727"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67482"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464179.1"
FT                   /protein_id="ADB67482.1"
FT                   /translation="MNQNKITAGGLEFLVRFALPTDRLKINGLMMDTARWLKESGSTQW
FT                   SDILHGFDVHNIEQRIELGEVALFETEAGKLAGTMIIRKTPSDWDTDLWDNLAIDKAYY
FT                   LHRIMVSREFSGISLSKQMIYFAEKLGIEMSVPFIRLDCIESNKTLNQMYLRYGFQFLG
FT                   TKNGFHLYQKKLPQK"
FT   gene            complement(733019..733942)
FT                   /locus_tag="LM5578_0728"
FT   CDS_pept        complement(733019..733942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0728"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0728"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67483"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464180.1"
FT                   /protein_id="ADB67483.1"
FT                   /translation="MMTISQVKQTAKESLRGNWGIAIGIFVLAWLIETVGGGVLGWIPV
FT                   VGWIALFLLTGPLYTGVAWVYLAISRREQPDVAYMFSGFKQFGRTFLAYLLISIFTFLW
FT                   SLLLIVPGIIKTYSYSQTFFILRDNPNISALDAITESRHMMNGHKGRLFGLSLTFLLWY
FT                   LIPLAVAIAGTVIVAGGMATTSYTADPAEVISALAAGATFGGLVLILASWLITLGISLY
FT                   VYPYLITSIAVFYDDLYAATEGTFTEETVIVEEEVNPFGATEADPFAEDTHPEGFGPDA
FT                   AKEPETPVVPEAPETPEAPKDNNEPK"
FT   gene            734130..734339
FT                   /locus_tag="LM5578_0729"
FT   CDS_pept        734130..734339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0729"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0729"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67484"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464181.1"
FT                   /protein_id="ADB67484.1"
FT                   /translation="MAHENLRELEDQLIELRQTYQEVISETREFEDPQLQNGPINAAEV
FT                   RLSALRHEIAEVEKKIKKAESKTE"
FT   gene            734407..735114
FT                   /locus_tag="LM5578_0730"
FT   CDS_pept        734407..735114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0730"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67485"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464182.1"
FT                   /protein_id="ADB67485.1"
FT                   /translation="MKPIFAVGDVHGEITLLDELLENWDKERERLLFVGDLIDRGENPA
FT                   AVLRRVKALADETGAIVLKGNHEQMLLDFLENPSGKMHYYLRQGGMETIQSLIADSLDK
FT                   KMTPEGLAKRVKEEASELIDFIRKLPLYYEEGKYVFVHAGVDLTKKDWHDTEERDFFWI
FT                   REPFLFGQNKTGKVFIFGHTPVQNLHIDESSGIWVSEDKTRLDIDGGAVFGGELHGVVV
FT                   EEKVITKSFSVKK"
FT   gene            complement(735158..735721)
FT                   /locus_tag="LM5578_0731"
FT   CDS_pept        complement(735158..735721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0731"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0731"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67486"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464183.1"
FT                   /protein_id="ADB67486.1"
FT                   /translation="MEQNKEKLTKPTSEKNYFWPIMIISFVAVVVILLLFFSPIGYQGA
FT                   VHFDITIFPRMNAIFNSFTFVFLVIALWAIIKKKNIKMHRGFILAAFTSTLFFLVSYLT
FT                   FHYLSAETSTFGGTGIIRPIYFFILITHSFLAAIVVPLALFALVWGWTMQIEKHKKIVR
FT                   WTMPIWLYVSLTGVLVYLFMAPYY"
FT   gene            735841..736257
FT                   /locus_tag="LM5578_0732"
FT   CDS_pept        735841..736257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0732"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0732"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67487"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464184.1"
FT                   /protein_id="ADB67487.1"
FT                   /translation="MSIIARELTKAEEAEIIRLKEEGEVMLQTDGTPEERIEKITEYLK
FT                   NTSPDPDLAEELGYILGSLYGEAVREKYGWRWLFVSENDLEGYAITSKEHGYTFMVHDY
FT                   FMQVIVQNKPDNSKMLFELMVDMTGNRNDFRMIG"
FT   gene            736309..736944
FT                   /locus_tag="LM5578_0733"
FT   CDS_pept        736309..736944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0733"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0733"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67488"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464185.1"
FT                   /protein_id="ADB67488.1"
FT                   /translation="MNVDEQKVRVLNNLVEHYGYQDWWEADNRLADWLSMILIQRTTEK
FT                   NAKQALANLGPHLDLESLIGMDMATLEEYIYPAGFYKQKSIYIKALIKWFHGHGASLDK
FT                   FQTYSTEDLRKELLGIKGVGEETADAMLLYIFERNVFIADLYARRLFSRLGFGEYKTYE
FT                   QMREEFMPITENIPHKLCKEWHSVIDVHGKHFGKDKAMDESWLLEFSN"
FT   gene            complement(736934..737830)
FT                   /locus_tag="LM5578_0734"
FT   CDS_pept        complement(736934..737830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0734"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0734"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67489"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464186.1"
FT                   /protein_id="ADB67489.1"
FT                   /translation="MIGYGKTVRDIRTSKGIHQKDLYDNIISKSFAIEFEKGKHDITLS
FT                   LFEKILKRMNMDLDEFFYIHRELSKSAEKNYLCMNQERGNIYDLESLELLYSELSKHDG
FT                   ELVEVWKAFVRSRIKMVEHLLKYHEFTVDVITPKDKCTIQKYLFSIDTWTLEELKICAN
FT                   SIYFFEEDLQIQFLNQVIKAIQPYKNYDRARRVLCTLLINTIEVFISRGQLSSASKLLI
FT                   LLDSLCIYNESAFYRNISNFLKGLLKMQSNQIKEGYAQAKKAIQLMNDLHFEEIAYLYE
FT                   ILLDQFIQLEGIDILNY"
FT   gene            737934..738068
FT                   /locus_tag="LM5578_0735"
FT   CDS_pept        737934..738068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0735"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0735"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67490"
FT                   /inference="ab initio prediction:Glimmer:3.02"
FT                   /protein_id="ADB67490.1"
FT                   /translation="MAEEVLFLGLYEKMMEKLGILGVENRFVYIFLGYLTIERRKFYG"
FT   gene            738061..738345
FT                   /locus_tag="LM5578_0736"
FT   CDS_pept        738061..738345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0736"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0736"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67491"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464187.1"
FT                   /protein_id="ADB67491.1"
FT                   /translation="MAKAKYEENFKKSLVALYRRGKTKHSICQEFNVPHSTFGKWIKKF
FT                   NNEENIESNEILNILQAQELKKQRVLLEEELSILTEAIAVFENPLPENK"
FT   gene            complement(738400..738708)
FT                   /locus_tag="LM5578_0737"
FT   CDS_pept        complement(738400..738708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0737"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0737"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67492"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464188.1"
FT                   /protein_id="ADB67492.1"
FT                   /translation="MKVSKSFEVFAKEAPEVHSAWMETVHKLDAASKLDKKTEELAYIA
FT                   VMAATRLESGLPFHVKMAKSNGATRDEIISAILVGLPAVGNTVISALPIALDAFDEE"
FT   gene            complement(738771..739586)
FT                   /gene="thiD"
FT                   /locus_tag="LM5578_0738"
FT   CDS_pept        complement(738771..739586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiD"
FT                   /locus_tag="LM5578_0738"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0738"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67493"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464189.1"
FT                   /protein_id="ADB67493.1"
FT                   /translation="MTIKKTLTIAGSDSSGGAGLQADLKTFEEYGTYGFSAITTIVTMD
FT                   PDNNWAHGVTPIDAQLVREQLKTILSGGPVDAMKTGMLGSIEIIKATREAIDKYDLKNV
FT                   VIDPVMVCKGEDELIQPENAEAIRDLLLPKATITTPNLFEAGQLSGLGKLTTLDDMKAA
FT                   AKKIIELGAKYVVIKGGKALESDKAIDLLYDGKEFTIYEVEKISPSHNHGAGCTFAAAI
FT                   TAGLAKGLTVEEAVAKAKDFVTAAIKGGFALNEFIGPVWHGAYNKAENR"
FT   gene            complement(739612..740478)
FT                   /locus_tag="LM5578_0739"
FT   CDS_pept        complement(739612..740478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0739"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0739"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67494"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464190.1"
FT                   /protein_id="ADB67494.1"
FT                   /translation="MIKVIASDMDGTLLNSDIEIAQENVEAIEKARAKGIHFVLCTGRM
FT                   YDDAMGLINKANLYAPAICMNGAEIRDEHGKIILQHPIDRNLARNTYNTLTELGMYTEF
FT                   FTDMGPITTDKARGKEFMIEMHKRIHPDVPAETIMDKVEERFESKDVHEIPDVERILGN
FT                   KDLTILKFISFSSDKDILAKAKQKLEKDSELSVTSSFSDNIEITHREAQKGISLQYYVE
FT                   KLGVTLDETFAIGDNMNDISMLKMAGYSVAMGNGEEEVKDLAEHVTLSNDEHGVAAAIY
FT                   KMLETND"
FT   gene            740652..741215
FT                   /locus_tag="LM5578_0740"
FT   CDS_pept        740652..741215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0740"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67495"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464191.1"
FT                   /protein_id="ADB67495.1"
FT                   /translation="MKTELEKMIAGEMYDPSDRELAHGRNRARKFCREINDAMDSESRA
FT                   SVLKRLFGGTKENVYVEPDFRVDYGSNIYVGENFYANFDCVILDVCEVHIGDNCMMAPG
FT                   VHIYTATHPLDPVERNSGLELGKPVEIGDNVWIGGRAIINPGVKLGNNVVVASGAVVTK
FT                   SFPDNVVVAGNPARVIKTIEVEEK"
FT   gene            741212..741475
FT                   /locus_tag="LM5578_0741"
FT   CDS_pept        741212..741475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0741"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0741"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67496"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464192.1"
FT                   /protein_id="ADB67496.1"
FT                   /translation="MIISDSKIFEQMENELAKAKAATTKASQDKHLHGLMLLVQLAKTG
FT                   DETTAAVEPIAIQPTEPAQIASMDGKKIELEDGANGDSLLDF"
FT   gene            741485..741862
FT                   /locus_tag="LM5578_0742"
FT   CDS_pept        741485..741862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0742"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0742"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67497"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464193.1"
FT                   /protein_id="ADB67497.1"
FT                   /translation="MKKTIITGAIFAGLAVLLGAFGAHALKDVLGSYASTWETGVQYQM
FT                   FHAGGILVIGLLMEKQASRLYTWAAILFATGIVFFSGSLYVLSISKVSILGAITPIGGV
FT                   CFVVGWFLLILGVSRRTMSRY"
FT   gene            741976..742911
FT                   /locus_tag="LM5578_0743"
FT   CDS_pept        741976..742911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0743"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0743"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67498"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464194.1"
FT                   /protein_id="ADB67498.1"
FT                   /translation="MTYALEIKGLRKIYSTGVEALRGVDLTVEEGDFYALLGPNGAGKS
FT                   TTIGIITSLVNKTSGQVSVFGYDLDTDIVRAKQQIGLVPQEFNFNPFETVQQIVVNQAG
FT                   YYGVSRKEAIKRSEKYLKQSNLWEKRSERARMLSGGMKRRLMIARALMHEPKLLILDEP
FT                   TAGVDIELRREMWTFLRELNESGTTIILTTHYLEEAEMLCRNIGIIQSGELIENTSMKS
FT                   LLSKLQFETFIFDLEPYEEAFEITGYNHVFEDKQTLSVEVERNQGVNHIFEQLSEHGIK
FT                   VLSMRNKSNRLEELFLKITEEKHQVGEKHV"
FT   gene            742904..743674
FT                   /locus_tag="LM5578_0744"
FT   CDS_pept        742904..743674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0744"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0744"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67499"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464195.1"
FT                   /protein_id="ADB67499.1"
FT                   /translation="MFNLYYTALKSLAAKETNRYMRIWVQTLVPPVITTSLYFIIFGKM
FT                   IGSRIGDMNGFSYMEYIVPGLIMMSVITSSYANVSSSFFSQKFQKNIEEILVAPVPTHI
FT                   IIWGFLIGGIGRSVLVGALVTLISMVFVPIHIHSWTIGIITFLMTAILFSLAGLINGIF
FT                   ARSFDDVSIVPTFVLQPLTYLGGVFYAISMLPPIWQAISKVNPIVYMISGFRYGFLGVT
FT                   DVPVVISLSILVVFSVVLYSICWYLISKGRGLRS"
FT   gene            743807..743923
FT                   /locus_tag="LM5578_0745"
FT   CDS_pept        743807..743923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0745"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0745"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67500"
FT                   /inference="ab initio prediction:Glimmer:3.02"
FT                   /protein_id="ADB67500.1"
FT                   /translation="MGNKKVKRKLGANIWWILILAILIIFVAYLVMGYVAKI"
FT   gene            743935..744816
FT                   /locus_tag="LM5578_0746"
FT   CDS_pept        743935..744816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0746"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0746"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67501"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464196.1"
FT                   /protein_id="ADB67501.1"
FT                   /translation="MNKENPLNKYHTGKFEKQRQDYPGLQSKMTPVPDAGESSYQGANK
FT                   LTGKKAFVTGGDSGIGRAAVIAYAREGADVAINYHPDEEVDAQEVKAIVEEAGQKCVLL
FT                   PGDLRKEGLAKDLVKKAYNELGGLDILVLNAGLQQYQLDIQKLPAEQLRDTFEVNVFSV
FT                   VFAIQEALNYLKAGASIILTSSIQGVKPSAHLVDYAMTKSSLISLTKSLAAQLGEKGIR
FT                   INAVAPGPIWTALQISGGQPQDSIPEFGQDQPLGRAGQPAELASAYVLLASDEASYTTG
FT                   QVYGITGGAPIN"
FT   gene            744834..745010
FT                   /locus_tag="LM5578_0747"
FT   CDS_pept        744834..745010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0747"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0747"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67502"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464197.1"
FT                   /protein_id="ADB67502.1"
FT                   /translation="MPWTKNDYPDSWKNLKKTEREKAIEIGNALLKDGYSESRAIPIAT
FT                   SKAEEWYKNHKES"
FT   gene            745136..745744
FT                   /locus_tag="LM5578_0748"
FT   CDS_pept        745136..745744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0748"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0748"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67503"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464198.1"
FT                   /protein_id="ADB67503.1"
FT                   /translation="MNKRRWIFSTVVTAFLLIIGGFLVYQQMIPKPFTEVVAEAKIDGY
FT                   ESGDELENASTVIVTGQLEKRGDSIIERASDDAVVGVYRMSTFKIAQVLKNETDDNLAK
FT                   EMTIPIYENEGYDAKTNTTYHIAGYTKMEKEEKYLLLLQKDSEDDYYIPTAVIFGKINL
FT                   DPNKRNELFPKNSDTEVAINKVQAEVLKNLEKEIDREDK"
FT   gene            746270..746368
FT                   /locus_tag="LM5578_0749"
FT   CDS_pept        746270..746368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0749"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0749"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67504"
FT                   /inference="ab initio prediction:Glimmer:3.02"
FT                   /protein_id="ADB67504.1"
FT                   /translation="MSNFNIMGSLMLIAVLVLAVYVITKVINKLKK"
FT   gene            746659..747087
FT                   /locus_tag="LM5578_0750"
FT   CDS_pept        746659..747087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0750"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67505"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464199.1"
FT                   /protein_id="ADB67505.1"
FT                   /translation="MGFLEAYKSFWRNYVNFSGRAPRSAYWYVVLWNVIIFVILYALAF
FT                   IFGISAIMEAAMGGTGMAGGGGAIVLVIILWLYLLAALLPTISLMVRRLHDSGKSGFFV
FT                   LLSLIPFAGGIIMLIFMCLESDGPNQYGDGDIDSKFDF"
FT   gene            complement(747126..747335)
FT                   /locus_tag="LM5578_0751"
FT   CDS_pept        complement(747126..747335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0751"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0751"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67506"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464200.1"
FT                   /protein_id="ADB67506.1"
FT                   /translation="MYIEIYTVNGESIRLDDDAKINNISIHELSKADLKNLFNEKCIEL
FT                   TKYDLTYFINTNQVNWFLVSEGIH"
FT   gene            complement(747354..748274)
FT                   /locus_tag="LM5578_0753"
FT   CDS_pept        complement(747354..748274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0753"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0753"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67507"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464201.1"
FT                   /protein_id="ADB67507.1"
FT                   /translation="MPKSEIRKLLQEIKKQVDNPGNSSTTEIKKMASEAGIDEQTAEEI
FT                   YHLLTEFYQAVEEHGGIEKYMHSNISWLKIELELLSACYQIAILEDMKVLDISEMLSLN
FT                   DLRIFPKTPSQLQNTYYKLKKELIQVEDIPKNKPGRKRKTQKNTKKEKTNIFGKVVPAE
FT                   FKAPASIKEQISYDKSREKNLVDLLSGVKSNVQLLSENQGEENNVYDLLKSIYSLSSLA
FT                   VQKEELDKKYQDLQTKCQELEQENSYLKQQNETMTDSFHTLVLQVADFAYASDLDQIQA
FT                   LPLFSQQLVVTLNQLGVFKENYKQM"
FT   gene            748646..748960
FT                   /locus_tag="LM5578_0754"
FT   CDS_pept        748646..748960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0754"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0754"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67508"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464202.1"
FT                   /protein_id="ADB67508.1"
FT                   /translation="MEYFLSLLKIIVLLAVLAGISYFLVKKNKQANRTRKSENDLIKLK
FT                   DTLLISHQLRAVLLEADGEKVLAIISNNDIRTVSLKGKNDQNEALFRELLLKEETKENA
FT                   "
FT   gene            748953..749720
FT                   /gene="fliP"
FT                   /locus_tag="LM5578_0755"
FT   CDS_pept        748953..749720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliP"
FT                   /locus_tag="LM5578_0755"
FT                   /product="flagellar biosynthesis protein FliP"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0755"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67509"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464203.1"
FT                   /protein_id="ADB67509.1"
FT                   /translation="MRKIASRRVFQVSFIVIFAISLVVFWPGVNVHAESWLDSLGVNGT
FT                   DGVNSSVALFVLVTVLSLSASIVLMFTHFTYCIIVLGLTRQGLGATNLPPNQVLVGLAL
FT                   FLSLFMMQPLITAWYDDVYKPSQKEEWSASKVWDETQPLLTKYVAENTYKHDINMMLKA
FT                   EGEDPVTKKEDAPLMALMPAFILTQITQGFLTGMFIYLAFIFIDLIVSTLLMYLGMMMV
FT                   PPMTISLPFKILVFIFIGGYGLITNMIFQTIHF"
FT   gene            749733..750005
FT                   /gene="fliQ"
FT                   /locus_tag="LM5578_0756"
FT   CDS_pept        749733..750005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliQ"
FT                   /locus_tag="LM5578_0756"
FT                   /product="flagellar biosynthesis protein FliQ"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0756"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67510"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464204.1"
FT                   /protein_id="ADB67510.1"
FT                   /translation="MNLTPITQIFQDFFYSGLALILPVSLICIVVVIVVAILMAMMQIQ
FT                   DQSLTFLPKIVAFVVALFILGPWMFEHMTDLFVGIFSKLPLMIRV"
FT   gene            750008..750769
FT                   /gene="fliR"
FT                   /locus_tag="LM5578_0757"
FT   CDS_pept        750008..750769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliR"
FT                   /locus_tag="LM5578_0757"
FT                   /product="flagellar biosynthesis protein FliR"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0757"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67511"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464205.1"
FT                   /protein_id="ADB67511.1"
FT                   /translation="MEFEFFLAVVIVFSRVASFLFFFPLLKGRNIPNSVKVVFGMAISI
FT                   PVATWVDVSGITTLPDLLLRVTSEVVFGLALAKLVEIIAVIPKMAGFMIDYDLGFSQVN
FT                   LIDPSYGTQNSITAAILDTFFVVIFLSLQGMDYLIYYLMKSFEFTASVSILFEKGFIDL
FT                   LLGTLGFALASAVSIALPIMGSIFIVNIILAFISKSAPQINIFMNAFIIKITFGIFILA
FT                   CAVPILSTVFKNLTDEMIQQYVSFFDYLLKK"
FT   gene            750785..751831
FT                   /gene="flhB"
FT                   /locus_tag="LM5578_0758"
FT   CDS_pept        750785..751831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhB"
FT                   /locus_tag="LM5578_0758"
FT                   /product="flagellar biosynthesis protein FlhB"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0758"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67512"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464206.1"
FT                   /protein_id="ADB67512.1"
FT                   /translation="MAKDNKTEKATPRRIKKARNEGNVAKSKELNNAFSLLIVAGLLYF
FT                   FGEMFIKNTIQAFVALLKQPPKLANMESYSLFYLMEFGKVLMPIMVMVVIFGLMNYGVQ
FT                   VGILFSAKAVKPQFKRLNPANYFKRVFSVKGIVEVVKALLLITLLSYVAYIGFRDHLDT
FT                   LISYTGQNWLYSLGQIFALFKNEFLALFLVIAVIGLLDFFYQRYDYKKGLRMSKQEIKD
FT                   EMKDSEGRPEVKQRQRSIARGLLQGSITKKMADATFVVNNPTHISVVMRYDKTKDHAPK
FT                   LLVKGEDELALFIRQVADTDGVPMITNRQLARSIYYTTNPDEYIQEDLYKDVIEVMKEL
FT                   MDADKIKF"
FT   gene            751878..753953
FT                   /gene="flhA"
FT                   /locus_tag="LM5578_0759"
FT   CDS_pept        751878..753953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhA"
FT                   /locus_tag="LM5578_0759"
FT                   /product="flagellar biosynthesis protein FlhA"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0759"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67513"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464207.1"
FT                   /protein_id="ADB67513.1"
FT                   /translation="MGNLGAIKKYFAILIAVSFVIALIVPLPPFVLDLVLVTILAFSVL
FT                   VYMRATSIKDWNELKSFPSLLLLMGIFRVSINISTTRAILTTGDPGQVIKQFGNFVIGS
FT                   NFVVGIVIFIILIVFQFIVANGSSRTAEVAARFTLDALPGKQMAIDADLNQRLITEPEA
FT                   KEKRAYLNMETEFYGAMDGAGKFVKGDVLFTVLLAVVNIVFGLIVGMVQGGLSFGEAAV
FT                   KYTELTIGDGIVSQIGSLLMAMSAGVIVTRVFDGSDDNVAVGIFKELMQNSVVVYTLAA
FT                   MFILMGVFSPLPTIPFVGIGVVLGIIGYRTQFNLKKKEQLELEKEMELIQSETNSAEAE
FT                   HNQAFGAAREKFPVVVELGLNIAALVKQKMNGETAKDKVVLMRKSILQDLGIGVPGINF
FT                   KDNTSFQPRGKYEIKVKGVAVASGVLKAGHLLALKTPGVMMDLDAEPTKDPIFGEDGYW
FT                   ILPGELEDAQMKNYQVLEPLSILITHLDVVLRKNLHELLMRQQIKDLIDGLADENQILI
FT                   DEIKKKEIDYSLIQGVLRQLLKEGISVRDLPTIVEGIIDGQTIYPNDLDGITAFVRERI
FT                   SKVICEQAKNQDGKIYALLLQDSIEMDTEIVNTPYYGYALNWALDKELPIIQKVRDTVN
FT                   KAQLTGREPVILTRRKDFRFGFVRVLERYQLDVPVLSISELSPETEVEQIALIEPT"
FT   gene            753975..755198
FT                   /locus_tag="LM5578_0760"
FT   CDS_pept        753975..755198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0760"
FT                   /product="flagellar biosynthesis regulator FlhF"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0760"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67514"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464208.1"
FT                   /protein_id="ADB67514.1"
FT                   /translation="MGKHLVEKMEIFKGNSKREIHKKIQLVTNEPYKITDERVTKLGIF
FT                   KKQYEVTAVIMSEVAIADGRMDFQETFQKSVVKTRPKTDDLLKKEKLLEMLAAGAELAQ
FT                   STPLLEERKTQEEELSSMRLELAALNRELAVKMREEREQNSDFVKFLKGRGISDTYVAD
FT                   FMQAGRKQFKQVETAHLDDITDWFVPYLSGKLAVEDSFDLSGHRIISLIGQTGVGKTTT
FT                   LVKLGWQLLKQNRTVGFITTDTFRSGAVEQFQGYADKLDVELIVATSPAELEEAVQYMT
FT                   YVNCVDHILIDTVGRNYLAEESVSEISAYTDVVHPDLTCFTFSSGMKSADVMTILPKLA
FT                   EIPIDGFIITKMDETTRIGDLYTVMQETNLPVLYMTDGQNITENIFRPKSRWLAERFVG
FT                   TDRRQVVE"
FT   gene            755195..755974
FT                   /gene="flgG"
FT                   /locus_tag="LM5578_0761"
FT   CDS_pept        755195..755974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgG"
FT                   /locus_tag="LM5578_0761"
FT                   /product="flagellar basal body rod protein FlgG"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0761"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67515"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464209.1"
FT                   /protein_id="ADB67515.1"
FT                   /translation="MKGLYIGAAGMMNYMQHIQVHSNNVANAQTPGFKFDQLTSEVISR
FT                   NKVNYQNGPVTRQVGTIDYGVRPAATHINLTAGSSYITNRDRDFFMQDTDPTQGSNFFI
FT                   TAKNGEISLSRGGQFHSDQFGFLRTADGANLLSATGEAIQVGQKTSIRAEANGDLYNAE
FT                   TSQYLGRLGTKFVSANQADSLVKDGEGRLHINGVNTMNLPAGQGIIQNGVIETSNVDLG
FT                   VEMVQLMDNQRMVQASKNVVNMFDKVYDKEATGLIRQ"
FT   gene            756003..756791
FT                   /locus_tag="LM5578_0762"
FT   CDS_pept        756003..756791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0762"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0762"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67516"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464210.1"
FT                   /protein_id="ADB67516.1"
FT                   /translation="MIPDLEKDYLYFTRVVKRDLGLDLALYKETQMKRRILSFIVKKKY
FT                   ITFGEFFKHLKKDAVLLDEFISLITINVSSFFRNRNRWDALEKQVLPRLLEDSRGKLRV
FT                   WSAACSSGEEPYSLAMMMERSVGTRHYDILATDLEPAILKRAVIGEYQSRQMEELSEQE
FT                   RHTAFVEKGDTYQILPKYRKSIRFRRHDLLTDYYEKGFDLIVCRNVLIYFTAEGKHQAY
FT                   QKFAESLRRGGVLFIGGSEQILNPADYGLATLNNFFYIKT"
FT   gene            756816..757151
FT                   /locus_tag="LM5578_0763"
FT   CDS_pept        756816..757151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0763"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0763"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67517"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464211.1"
FT                   /protein_id="ADB67517.1"
FT                   /translation="MGRIENIKNLAFFEDKPGLAEQILMLEKKTQLFLPNEFEIRQTVG
FT                   YEIGDKEVILGRLESFYFLALKGVGENNYRSQAFASEADAKAFFVHLPEMENELVAFWL
FT                   NEVELVR"
FT   gene            757178..758029
FT                   /locus_tag="LM5578_0764"
FT   CDS_pept        757178..758029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0764"
FT                   /product="flagellar motor protein MotA"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0764"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67518"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464212.1"
FT                   /protein_id="ADB67518.1"
FT                   /translation="MEITTIIGLVLAVIVIAGSFMIQNISLAMLFSAEALIVIILGTIT
FT                   AVMMAHPWSDVKVVPKLFKILFTKEKMPDKVDVLVQYKEYADEIRRSGVLALEDSVDEI
FT                   EDPFMKRGMRLVVDGQSSPEFLRDVLEEEVASMEERHAAYAKIFASAGAYAPTLGVLGA
FT                   AMGLIHAMGEMSNPDKLSEAIAAAFVCTIFGIFTGYVLWTPFANKLKVKSQKEVHLRYM
FT                   MIEGVVALQERNAPRVVEERLLSFLSPKEKDVLRNGKGKKTREVEEIERGQASQETAGG
FT                   TR"
FT   gene            757989..758816
FT                   /gene="motB"
FT                   /locus_tag="LM5578_0765"
FT   CDS_pept        757989..758816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motB"
FT                   /locus_tag="LM5578_0765"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0765"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67519"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464213.1"
FT                   /protein_id="ADB67519.1"
FT                   /translation="MAKRRKKPQEEHVDETWLIPYSDLLTLLLALFIVLFASSSVDAKK
FT                   FEQMGNAFKKIVEEGAAGNQAYVSKEKGPDDPNVNAVLKAMEEQDKKKEANEQEKAKKA
FT                   AAALLKKQNEEKIEAFKKQIDSYIAAENLGTKMTTKYSDEGLLITIRDDILFQSGSAEL
FT                   SAGKREIAKEIGELFAQGKGTMEGIVSGHTDNVPISTSIYSSNWELSVARAVNFMEAII
FT                   QENSEVNPGEFSARGYGEFRPVAKNDIAANREKNRRVEIMVRPINRDTLDEDE"
FT   gene            758826..759326
FT                   /locus_tag="LM5578_0766"
FT   CDS_pept        758826..759326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0766"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0766"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67520"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464214.1"
FT                   /protein_id="ADB67520.1"
FT                   /translation="MQLFLSGSHTLTDYDKQEIQAYLEKFAPVNHIHLLCYKSIENEVL
FT                   QFFLKKEHLAPRLSIYTFAPKECLPEPFLSAIDYLERLGSSYQSFGYFDTVIAKPTYEK
FT                   FLAQIVSKMDLVCCFYNGDKPTDVIPVDVAKAFDVQSMIYDLPKAKKHLLHRASSDKIK
FT                   LVN"
FT   gene            759349..761262
FT                   /locus_tag="LM5578_0767"
FT   CDS_pept        759349..761262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0767"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0767"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67521"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464215.1"
FT                   /protein_id="ADB67521.1"
FT                   /translation="MRPLISICMIVKNEAHILRQSLASFRKFTEEIIIVDTGSTDETKE
FT                   IAQEFTDFVYDFEWTGNFSDARNFAAKHATGKWILAIDADECLEEESYRKLEKQLKSPV
FT                   EPIQMAQIISFTGEKGRVTTTNQMARVYKNDGTICFRGVIHEQLEAIDKRPIAAGFAEV
FT                   KIYHYGYMSEIVEKQDKSDRNLRLLEKEVKNNKNSGFVHFNIGQEMNRLGNKKEALKEF
FT                   SEAFRLRDHNHYIWAKLSAYHIAELLEQEKRYDESLAIIEEARVIWPNVPEFPLKKANI
FT                   LYVNHQLEDAKEIYQSLLENTAIDYQPIVLYEATNFMPHKMLGTIYLEEKDYTRAMTHF
FT                   SKAYAENSSDYGVMFQMIMLLSKFHQPKEIFAFMERHHFISSTETGLRLLSMTTQQGYA
FT                   ELSELIVQSLTDVYPPVAEATEVKIATIRNVFPVISESAILFGIKEELIDAADLCLWHY
FT                   ENPQLPIENVMKNSDVGDIYDFIFENGPRISKKRYLFVLERAIALGKGEFADYLLALRN
FT                   VYHDSINSHIADLFFQYDFADIALDFYNIVDADEVTKQGYINLINYLVDADVLDEALAI
FT                   AERGIDNFSTDFRFYLWAIKIDTENRANRISEAMDEFPNNRYLAKLLDEVTMLQDTVTN
FT                   NR"
FT   gene            761275..762183
FT                   /locus_tag="LM5578_0768"
FT   CDS_pept        761275..762183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0768"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0768"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67522"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464216.1"
FT                   /protein_id="ADB67522.1"
FT                   /translation="MTEEKGILLQSGTNELEIVTFTVGENLFCINVLKVKEIIHPLEVT
FT                   PVPDSNPAIEGVSQVRGEIMPVVNLARVMKLPEIEPENTKFIITELNQMKIVFRVDEVH
FT                   RIQRISWEQIEEPEKLSIGLEELAVGIVKLDGNLVLLLDYEKIIYEISGNADFAVTGED
FT                   RIARKVNREEKTIFIAEDSQMLRQLLEDTLHEAGYTNLQFFANGREAQEHIFKLLKEQK
FT                   EQTFENVNLLITDIEMPQMDGHHLTKVIKEDEIGRELPVVIFSSLITEDLEHKGAGVGA
FT                   DAQVSKPNIHQLINILDELVL"
FT   gene            762421..763284
FT                   /gene="flaA"
FT                   /locus_tag="LM5578_0769"
FT   CDS_pept        762421..763284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flaA"
FT                   /locus_tag="LM5578_0769"
FT                   /product="flagellin"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0769"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67523"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464217.1"
FT                   /protein_id="ADB67523.1"
FT                   /translation="MKVNTNIISLKTQEYLRKNNEGMTQAQERLASGKRINSSLDDAAG
FT                   LAVVTRMNVKSTGLDAASKNSSMGIDLLQTADSALSSMSSILQRMRQLAVQSSNGSFSD
FT                   EDRKQYTAEFGSLIKELDHVADTTNYNNIKLLDQTATGAATQVSIQASDKANDLINIDL
FT                   FNAKGLSAGTITLGSGSTVAGYSALSVADADSSQQATEAIDELINNISNGRALLGAGMS
FT                   RLSYNVSNVNNQSIATKASASSIEDADMAAEMSEMTKYKILTQTSISMLSQANQTPQML
FT                   TQLINS"
FT   gene            763559..763918
FT                   /gene="cheY"
FT                   /locus_tag="LM5578_0770"
FT   CDS_pept        763559..763918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheY"
FT                   /locus_tag="LM5578_0770"
FT                   /product="chemotaxis response regulator CheY"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0770"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67524"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464218.1"
FT                   /protein_id="ADB67524.1"
FT                   /translation="MLKLLIVDDAMFMRTMIKNIVKDSDFEVVAEAENGLEAVKKYDEV
FT                   KPDIVTLDITMPEMDGLEALAQIMAKDPSAKVIMCSAMGQQGMVVDAIKKGAKDFIVKP
FT                   FQADRVLEALEKAAK"
FT   gene            763938..765794
FT                   /gene="cheA"
FT                   /locus_tag="LM5578_0771"
FT   CDS_pept        763938..765794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheA"
FT                   /locus_tag="LM5578_0771"
FT                   /product="two-component sensor histidine kinase CheA"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0771"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67525"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464219.1"
FT                   /protein_id="ADB67525.1"
FT                   /translation="MTTNMLDLFIEEASEHLQALNDNLLQLEKDPTNGQLVSEIFRSAH
FT                   TFKGMSATMGFQQVADLTHAMENVLDEVRNNRLAVTEHLVDIIFTCTSHLETMVSDIQH
FT                   GGQGAADISKTVADLEALLHPEQETDLTVEKTYRIAIQIEEAAILKAVRAVMCLERLAE
FT                   MGIISETTPDREAIELEEFEQSFEVVLESAQTKDEIKAVILDISEIEKVTVTEEVEEVQ
FT                   VIEPIKKAAKQTTKRLENKTIRVQLEKIEKLMNVFEESVIERARIDEIAEKTNNKELME
FT                   HLGRFSSISKEIQNGLLNMRMVPVDSVFNRFPKMVRTLAKELGKKIDLVIEGADTEVDK
FT                   IVIDEIGDPLVHLIRNSVDHGAETVEVRRKNGKNETATINLKAFHSGNNVVIEIADDGA
FT                   GINKRKVLEKAIAKNVVTRAESTKMTDAEIFDLLFDSGFSTADQVSDLSGRGVGLDVVR
FT                   NTILKIGGKISVESSENAGSTFRIEIPLTLSIIQSMLVATSERRYAVPLANVAEAITIN
FT                   PADIQHVHGKDLINYRETIIEVLDLGECFHETPLNDTDELLLLVVKNAKRTFGLIIKDI
FT                   IGQREIVLKTLGGFFSESQIAFSGATILGDGRVVLILNLETF"
FT   gene            765804..766106
FT                   /locus_tag="LM5578_0772"
FT   CDS_pept        765804..766106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0772"
FT                   /product="flagellar motor switch protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0772"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67526"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464220.1"
FT                   /protein_id="ADB67526.1"
FT                   /translation="MMEQVFQVELPEWEPKETPQEGREKGSIRQVDNIGVNLIVRLGKK
FT                   EMPVGDIAELSIGDVLEVEKKPGHKVEIFLDEKKVGIGEAILMDENFGIVISEID"
FT   gene            766149..766535
FT                   /locus_tag="LM5578_0773"
FT   CDS_pept        766149..766535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0773"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0773"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67527"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464221.1"
FT                   /protein_id="ADB67527.1"
FT                   /translation="MKMKVDQEKTAILKELQLLLSKREKVTEKLAHEKEVYYSRTKKER
FT                   LQVAVLAGSMQLDAFSPSRIQQMEREITQISQYIKSNEQILEKLEEKGKQAKKMYDDTR
FT                   KKWQQLENKREEQTLRDLKMVLLK"
FT   gene            766551..767597
FT                   /locus_tag="LM5578_0774"
FT   CDS_pept        766551..767597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0774"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0774"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67528"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464222.1"
FT                   /protein_id="ADB67528.1"
FT                   /translation="MLIPDNLLQPLVGKKQVEPKESLAEELVELPFISLLMENSPAPLI
FT                   KGEADNEEQATIPLKEIAPSLVSAKLLDSEPETKLPSAPLELKEVKETLAAIAKQAIDQ
FT                   PKIDSAPQVAQPPEMNTPKEPTKNTTREQQPPPELIMPTKDSPKLAENVAKNQPALAKL
FT                   PQEKEAVQLFKASIKEPVTVKEEVAVKKPAESSNIWHDTTKQLTPAAKVEVPVTLKQLD
FT                   KTITDQIEQLQKFQVKQNKAFFAIQPESLGKVEVLLKKMPDKIFVHIEYQEQTAKQKLE
FT                   QMAQDLHNRFRDRGVEVAVTMTEKQAPKENGQGSEGRHHGESKKEKERENPHQEKAKQQ
FT                   VFDLEEET"
FT   gene            767599..768021
FT                   /gene="flgD"
FT                   /locus_tag="LM5578_0775"
FT   CDS_pept        767599..768021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgD"
FT                   /locus_tag="LM5578_0775"
FT                   /product="flagellar basal body rod modification protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0775"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67529"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464223.1"
FT                   /protein_id="ADB67529.1"
FT                   /translation="MDGISSLSGASQDTNNAVTSSVSKTLGKDDFMKLFLTSLQYQDPS
FT                   SPLDTNEMMSQMAQLSLMEQVANMTTAVDKLSEQAQNSALQSAVNFIGKDIKGVSLNGE
FT                   VISGKVESVQQTTNGVMLKLKDNDSLVPMTYVTEIN"
FT   gene            768041..769276
FT                   /gene="flgE"
FT                   /locus_tag="LM5578_0776"
FT   CDS_pept        768041..769276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgE"
FT                   /locus_tag="LM5578_0776"
FT                   /product="flagellar hook protein FlgE"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0776"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67530"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464224.1"
FT                   /protein_id="ADB67530.1"
FT                   /translation="MNQTMYTAISGMNAFQQALSVTSNNIANANTTGYKKQSVVFNDLL
FT                   YQNTMGSVAGGLYAGTNPMSFGSGSKIGAILTDYTAGSPTSTGRNKDAALQGRGFFIAG
FT                   DNAGGNIVYTRDGSFAVSDNNYLTTQQGKYVMGYATDKNGNVLNGNLQPIQIPLNSAIP
FT                   GEATKNGSLSGNIPLDWGEKDTISSELSVYDNAGGKHKLQVNMKAATPDASGNVSYEYE
FT                   IQMDGKALTPPVTGTLNYNAQGELTNPDALKNIQINSTVNGKQVNMSLNLSGLTNYGTN
FT                   QVFSPTSDGKGAATVKDYAVTDSGYIAVSYSDGTVIPVAQLAVATFSNEDGLVKMGNGE
FT                   YVPGLSSGDAVYGVAGQNGAGGISGSSLEGSNVDLSREFVNLMTYQSGFQGNTKVIRVA
FT                   DDVMKQIVNLIQ"
FT   gene            769290..769526
FT                   /locus_tag="LM5578_0777"
FT   CDS_pept        769290..769526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0777"
FT                   /product="flagellar motor switch protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0777"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67531"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464225.1"
FT                   /protein_id="ADB67531.1"
FT                   /translation="MKINHTIPLRIDFELGRTKQPVGSLLDVKKGTVFRLEDSTANVVK
FT                   ITISGKCIGYGEILTKDGKMFVKITKLGEGSSS"
FT   gene            769547..770539
FT                   /gene="fliM"
FT                   /locus_tag="LM5578_0778"
FT   CDS_pept        769547..770539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliM"
FT                   /locus_tag="LM5578_0778"
FT                   /product="flagellar motor switch protein FliM"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0778"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67532"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464226.1"
FT                   /protein_id="ADB67532.1"
FT                   /translation="MSDKLSQEQIDALLSQMSEGKVVDESTEIGDFGRFHPYDFHKPEK
FT                   FGAEHLESLKTIASAFTKKSMEFVSQRIRIPIHTEATLADQVSFASGYIETMPNDSYIF
FT                   CIIDLGNPELGQIIIELDLAYIIYIHECLSGGNPKRKLSERRLLSVFEELTLKSILEKF
FT                   CEALKDSFKSVHPISPEIVNIETNPALLRVTSPNDMMALVSVDIKSEFWISTMRIGVPF
FT                   FSVEEIMNKLENVVEYTFDKRRNFDAEVEQELHQVEKEARIRVGEIKTTWKELNKLEVG
FT                   DVLLTETHIRDTLKGYVTEKWKFECYMGKSGNQKAVKFMRHTGRTEQER"
FT   gene            770542..772089
FT                   /locus_tag="LM5578_0779"
FT   CDS_pept        770542..772089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0779"
FT                   /product="flagellar motor switch protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0779"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67533"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464227.1"
FT                   /protein_id="ADB67533.1"
FT                   /translation="MEQLLEKNITQMELDVIGEIANISFGSASTVLSDLLHQQVTISTP
FT                   KVEIVDLYNTKDIDIPHVVLEVNFHKGIEMRNLFVLQSEVAAAIADLMMMGDGNIDPNE
FT                   ELSELHLSAVQEAMNQMMGHSATAMSNMFGEMIDITTPDIKVIALKEQLEDTNDQTMIK
FT                   VGFDLIIGDLITSNLMQLIPVDKGRELAKRLLGDAVPEADPVKEEISLTAEELDVFLEV
FT                   CNIGIGSASTVLSKLLNRKVSLQIPTARVIDSKEFEFNERPCLVTSVEFVEGLRSSNTF
FT                   IISKNAALIMADLMMMGDGIVQEDAELTELEVSAVQELMNQMMGFSATAMSEMLGTKID
FT                   ISPPTMEFCNFGDTMIQKNIEEGKTVEVIFPLEVDGLLKTPMYQIFNPAAAKEMAQLML
FT                   GIQAKEVAEKEATTPAEIIEPEKPAEPIKHTVIEEKETLSEMEQILEDIPVTLEVVFGT
FT                   AKVKLEKFISWCEKDVIILKESMNEPLVLALNGVTIGKGILVRVDDHFGIQMTELVR"
FT   gene            772095..773498
FT                   /locus_tag="LM5578_0780"
FT   CDS_pept        772095..773498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0780"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67534"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464228.1"
FT                   /protein_id="ADB67534.1"
FT                   /translation="MRKLGLMTILFWMFLSVQAFAADLEPPMISLEKEQRVFTSGEVIS
FT                   FHVKNPEELKIVLVNEHGQRKLLDGETYTVTDWDLDGNYQAEFYQADISKPVVTVEDLF
FT                   EVKQLEEVAKDETAPSLKMIEITHDEDVLPTSVLYASAELDDAESGVKQAILLVHSKSN
FT                   ESEMELIRNNYTGEFDAEIPLEKFQLGEELTFQLQLVDFAENEITLDLENTIQLYEPKA
FT                   PVLSYDGSDITNVQKKIGQVGNRIELTLDKYTTEFPELETENGKTIPLLWQKTATEWKG
FT                   SLALTTELSGEIIHIQEMNQYMLVRATSEPFGDIQLINNSILTGTIHPDFTFISNLYVE
FT                   VNGQNFPIKRTDNSFTSAEITTTGKITLHWTDWDGQVFSKQMNQEIKPVIEMPDKETIA
FT                   PPSVIPKEKESLLTSPDPKPSVESHENTPKKQEKKETSTKNKSSSIPFWIPALMIIGVI
FT                   IFSGNRAMK"
FT   gene            773521..774687
FT                   /locus_tag="LM5578_0781"
FT   CDS_pept        773521..774687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0781"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0781"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67535"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464229.1"
FT                   /protein_id="ADB67535.1"
FT                   /translation="MKIDGIQESAENRNQLERELIKQNPVVKEGTIKAQMNTEVAVPKT
FT                   PPVSFSFKELSSLQLNGTSAASLELYMKLMMNNAKKANDLIFYVMRAGIKNPTDSTKWQ
FT                   TVRSEISSQLSTILMKQHNFEAYFSENPANQKLFLANQKIMNEISFLLKMLPTLTFETT
FT                   GKYDFLRMMQIASGNMETGIQMMREFQGHIEHATRLDSIVDARQETNWMIKVLREFGNM
FT                   FQSRHLLPYELQAENINIWKLGSEYLKLMNQLLPQIGAFPNGNIKIFHQQATKPLTELF
FT                   QELQRLADGQMTQGGIAVILDRMQGQLTRLAQLFQKMEIEAGFTDTERILGSVDAEFAS
FT                   DMTKMMLLAQQEMSFFDLLVKDFRSVSKQPIFFMIVAIFIILLLIILF"
FT   gene            774794..775258
FT                   /locus_tag="LM5578_0782"
FT   CDS_pept        774794..775258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0782"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0782"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67536"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464230.1"
FT                   /protein_id="ADB67536.1"
FT                   /translation="MNNVSIGQISQSKQTNVVRGIQELNQTQQLYFEQMKANGKKQTPS
FT                   LTEINELITNVTDKKSLVEMDMTVDNVLSYKKAVQTFLNFYVNNVMDYDNIESRHPKYG
FT                   FSQKMTILKQVEKQTNELDDVMNLIDTKTGHLDMLNRIGEITGMILDVVL"
FT   gene            775268..775696
FT                   /locus_tag="LM5578_0783"
FT   CDS_pept        775268..775696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0783"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0783"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67537"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464231.1"
FT                   /protein_id="ADB67537.1"
FT                   /translation="MQNELINQLEILIEKNVKATDEAILLGKLVQEENWIEAEERQLGL
FT                   QRELAALQNEYQALKTIIGEDNTLRTVQNTWTPEENAIIDERKKMLLEKENLLRVSVTE
FT                   NQIRTEMQLAFSEHMVDVITGHHAETQAENNMMINETF"
FT   gene            775716..777236
FT                   /gene="flgK"
FT                   /locus_tag="LM5578_0784"
FT   CDS_pept        775716..777236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgK"
FT                   /locus_tag="LM5578_0784"
FT                   /product="flagellar hook-associated protein FlgK"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0784"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67538"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464232.1"
FT                   /protein_id="ADB67538.1"
FT                   /translation="MRLSDFNTSLSGMSAAQIANMVAQQNISNMNTPGYIRQAVDQTAV
FT                   YGDGGLLGGKQTGYGVKVTDIKRLTNTALTTQYNNQIAKQSASLYQSGALNQALNLFGT
FT                   PGKNTPSDNLDNFFTAWAALAKNPDQATNTTALLSSMSIFTDQLNQLHSGLKELETTIA
FT                   ADTDAAIQDLNSLIKKLGSINKAIGNAGSNPPNDLLNQRDQLLSTMAGYAGISVSAHPN
FT                   NPDVYDVTIGGRLVVQGDETTEITSTRTATGFEFSVDGQKLNMPEGSIIASVRVNQNEI
FT                   KSYQEKIETFSNGLAKALDDIQVKNVNKTMDDLQKINDALQANPNDEKLLSNRDELLRQ
FT                   LEKFPGVTRSGDTLTIGGVDHPVDTLGTSTYVTDVNDFSIPIFTQSSGKWILNPAITSN
FT                   ADNKPFLGVIAADIASLKTDKNIQGTTFPSFMDGIITEVATDASKSSATATADTQALSS
FT                   LTESKSSLEGVNIDEEMTNIMQYQSYYVANTKAMNTVNDMMKALLAML"
FT   gene            777248..778123
FT                   /gene="flgL"
FT                   /locus_tag="LM5578_0785"
FT   CDS_pept        777248..778123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgL"
FT                   /locus_tag="LM5578_0785"
FT                   /product="flagellar hook-associated protein FlgL"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0785"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67539"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464233.1"
FT                   /protein_id="ADB67539.1"
FT                   /translation="MRISTNQQASSIINQLNNVSGNLAKYQLQVSSGKKYESMSENPGA
FT                   TAQILSYNHVLSQLNREKTDVTEAKSLLNTAETSLSSMSTSMNRVNALVLQAINGTSDK
FT                   DNMSQSAEEIKGLLDVLISVANSEDDGRYVFSGSSTSVKPFTTDKTTGEIIYSGTTENK
FT                   KFRVTDTLEVEVFHDGSAMTDVFNNIQKIVDAMKTGDKDALSALQETNSKNIEIITNSM
FT                   TNIGGQKNGVTAYDNVLSSKIVDFSERKSNVEEVNMPEAVSNLNKTSIAYQAALQSSVM
FT                   VQKLSILNYM"
FT   gene            778135..779424
FT                   /gene="fliD"
FT                   /locus_tag="LM5578_0786"
FT   CDS_pept        778135..779424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliD"
FT                   /locus_tag="LM5578_0786"
FT                   /product="flagellar capping protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0786"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67540"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464234.1"
FT                   /protein_id="ADB67540.1"
FT                   /translation="MGSSIASSLMDPTQYYSQFISLQKASLEKAKTPYQNQISSYQSRI
FT                   DLYASLKNALSDSLKTMSSFTTYESKTKLATSSNETSFTVSSTSSSVNGSYSIEVQNLA
FT                   TADTYNKAVPDIEAKIGVSGTIKINGKEIKVDADSSMKNVMNSINSAGAKVNIYTLGEN
FT                   MVVTSSTTGVENSIKFEGDSAVLDALGLVQNSPDHLAAEDAKLRINGATVTSATNKVTN
FT                   YIPGVTINLKKETTGAEKLTIQDQSDEKAASMITSFVNTYNALTSTMKTYTGKGTILQA
FT                   SAADLEANRALNNVFQHKKDGNTLFDFGISVDKEGVLKVDETAMKKMVAEDPTAVERFF
FT                   FGIGGIGDELYQSLNKTFGSTGFISDETTSMTNEINKLNLKLTDITSRNDTLLTNITDQ
FT                   YNKWLEMMQAMQSDAMTLDALIDGMNSSNK"
FT   gene            779443..779829
FT                   /locus_tag="LM5578_0787"
FT   CDS_pept        779443..779829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0787"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0787"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67541"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464235.1"
FT                   /protein_id="ADB67541.1"
FT                   /translation="MQAWKRYTQNELNTSNPIKNTIYIYERCIIEFKKLDKALAELHFS
FT                   EADLILDKMEKIFEELKLQLNPEAGQELYDNIFGLYEWISEQIRQMQLLKQPVNIDTII
FT                   HVITQLKEGYEGVMKHESSKDTFG"
FT   gene            779801..780082
FT                   /locus_tag="LM5578_0788"
FT   CDS_pept        779801..780082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0788"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0788"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67542"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464236.1"
FT                   /protein_id="ADB67542.1"
FT                   /translation="MNQAKTHLAELKALFHSTGQLNVTLEEYQAKLNELLKSTEHLPKE
FT                   TKEAILKETRDVINKGILFTQKQLESTENAFSENKSRNAANLNYAKFF"
FT   gene            780103..780504
FT                   /gene="flgB"
FT                   /locus_tag="LM5578_0789"
FT   CDS_pept        780103..780504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgB"
FT                   /locus_tag="LM5578_0789"
FT                   /product="flagellar basal body rod protein FlgB"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0789"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67543"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464237.1"
FT                   /protein_id="ADB67543.1"
FT                   /translation="MENYTTHIGNYLNYLQTANQVVSNNIANANTPNFKASEASFEESL
FT                   GSSLRASGQNSAESAGNLTKTNTKHLAGTDIDETNAKVTTKSGSINEDGNNVNVTSEMI
FT                   SLTKNNQMYALAISALNYNSSINTAARGK"
FT   gene            780516..780926
FT                   /gene="flgC"
FT                   /locus_tag="LM5578_0790"
FT   CDS_pept        780516..780926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgC"
FT                   /locus_tag="LM5578_0790"
FT                   /product="flagellar basal body rod protein FlgC"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0790"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67544"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464238.1"
FT                   /protein_id="ADB67544.1"
FT                   /translation="MFEGINTSGSALNAAKQWMEVSSNNIANADSSAAPGETPFLRKRV
FT                   VLSEITPFETALTGTKGVKVSEISSDTGSVKRVYDPTHPNANEAGYVNYANVDMTAEMT
FT                   NLMVGQKMYAANTSALQANEKMMEKDLEIGKV"
FT   gene            780943..781239
FT                   /gene="fliE"
FT                   /locus_tag="LM5578_0791"
FT   CDS_pept        780943..781239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliE"
FT                   /locus_tag="LM5578_0791"
FT                   /product="flagellar hook-basal body protein FliE"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0791"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67545"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464239.1"
FT                   /protein_id="ADB67545.1"
FT                   /translation="MAIESINAASVLPKVTLGETAKTDNAAGAGNTFTQMLDSMSDTQS
FT                   NAQTSVSNLLTTGEGNASDVLIQMKKAESEMKTAAVIRDNVIESYKQLLNMQV"
FT   gene            781307..782959
FT                   /gene="fliF"
FT                   /locus_tag="LM5578_0792"
FT   CDS_pept        781307..782959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliF"
FT                   /locus_tag="LM5578_0792"
FT                   /product="flagellar MS-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0792"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67546"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464240.1"
FT                   /protein_id="ADB67546.1"
FT                   /translation="MAKIKTMYSKLKNWHKGAILVGLFVVVTVLLLYMNTPKTEVTLYK
FT                   NLSETSQQQVTDQLAKMGVDYTVDKSGNILVDEKVETLVRDKFADLGIPYTGQDGNDIL
FT                   LNSSLGASEEDKKMQEKVGTKVNLEKEIVQSYGTTIDSASVQLTLPESSSIFEEASQKG
FT                   TAAVTLKTKNNQTLTSEQVLGIQRTVSAAVPNVASDDVAIIDTKNGVISEADTSKEEGS
FT                   SAYKNEVDIQNAIGKNVKTDIEGTLSSIFALDNFRVNTNVAVNFDEIKQNTEHYPNDGK
FT                   VRSNQKDTSTDTSKGSANTTESGTASNADVPNYTEQNGDDTNTYTSEKSSETTNYELDS
FT                   TIQEIKKHPALAKTNVVVWVDQNALNKNGVDMAEFTKAIGVSAGLTPNMTTEEAGADGE
FT                   AAAAPTFEGTFQNGDVTIMPIQFLDNATPAEKDTTEKAEPASKAWIWWLAGGLLFAVIA
FT                   AGIITYIILLKRKEQLEEALEPEEKDYIPAEEAIINPEEHPDFNFQTDAFDLSEPELKA
FT                   RKESLKNKLGEMAKEDPGRAAAVIQKWLNERQE"
FT   gene            782962..784068
FT                   /gene="fliG"
FT                   /locus_tag="LM5578_0793"
FT   CDS_pept        782962..784068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliG"
FT                   /locus_tag="LM5578_0793"
FT                   /product="flagellar motor switch protein G"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0793"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67547"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464241.1"
FT                   /protein_id="ADB67547.1"
FT                   /translation="MAETLKETLEETNAELETVEVVETEEKTTTSADSGISRREKAALI
FT                   IWSLDEQIATEVVDLLPDASKQRLAREMAKMKEMDGGAVEEATREFLGELELLSGGIAK
FT                   LDREHLQRLFPDMTTEELNQLIYGVEAESRIGETALDILREIDDVDSLFTIISDESPQT
FT                   IAMIASYMKPEEASKLLALLPEEKMINTVIGIASLEQFDSEVMQNVSNLLRIKLDTMSN
FT                   SSLNKTDGIKNVANILNNVTRGLERTIFEHLDAEQAELSERIKEKMFMFEDIILLDNMT
FT                   LQQVLAEIQDNNKIARALKNEKEELKEKILSCVSKNRRDMITEELEVLGPIRLSDVEQA
FT                   QQDIANVVKNLEKDGKIVIQRGEQDVLI"
FT   gene            784055..784747
FT                   /gene="fliH"
FT                   /locus_tag="LM5578_0794"
FT   CDS_pept        784055..784747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliH"
FT                   /locus_tag="LM5578_0794"
FT                   /product="flagellar assembly protein H"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0794"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67548"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464242.1"
FT                   /protein_id="ADB67548.1"
FT                   /translation="MSLSNPRIPKGKVTLSDVKMELFYLDDIEEIEEIESPYSKELEQL
FT                   ESHQKELEKHLSAIEIEQQKLANEKAALQAERQAIEELRRDAEAEIEANKQAFEKEKTQ
FT                   IYLTITDFLWDESIDLAERIVHQAIDTRQIEVLPMLTEVIQKLPVAFDKLNVTTHPETL
FT                   KALKEENTGTKYDWLLENIHWNFDMRLDYGEFTVEEEKEYFDYRITEIFQTLHKQNAER
FT                   KILGGDKP"
FT   gene            784744..786045
FT                   /gene="fliI"
FT                   /locus_tag="LM5578_0795"
FT   CDS_pept        784744..786045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliI"
FT                   /locus_tag="LM5578_0795"
FT                   /product="flagellum-specific ATP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0795"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67549"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464243.1"
FT                   /protein_id="ADB67549.1"
FT                   /translation="MNWSPKTEAWQELKNTVPYIQKGKIHTVQEQVYISKGPQVKIGDT
FT                   VMVGENKVLCEVISIEKENNMLLPFNQSDKVAYGDWVYVTDTKITIPADEFLLGKVLNA
FT                   SGDILNEEAGMAKFKQKMPLEAPPIHAFSRAEITDTLETGIKAIDGMLTIGIGQKIGIF
FT                   AGSGVGKSTLLGMIARNAKADINVIGLVGERGREVKDFLRKDLGEDGLRKSVIVAATSD
FT                   ESHLMQLRAAKLATSIAEHFRDQGKTVLLMMDSVTRFADARRSVDIAVKDLPIGGKTLL
FT                   MESYMKKLLERSGKTQNGSITGIYTVLVDGDDMNGPVPDLARGILDGHIVLTRELATKN
FT                   HYPAIDVLGSVSRVMEEIVPESQWKTASKIREWMSIYQENELYFKLGTIEQTSDNAAIF
FT                   TSKEKSYFIHQFLKQLRDESVTLEETSKLMETLV"
FT   gene            786062..786730
FT                   /locus_tag="LM5578_0796"
FT   CDS_pept        786062..786730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0796"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0796"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67550"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464244.1"
FT                   /protein_id="ADB67550.1"
FT                   /translation="MNPVEQVISARQAEFQSAFEAAKQSATTFETKLNERLNETTTAKT
FT                   TSVQTVTDAELARAREAYEALINQSETNSAAPTSSTTTETPTASTGELTNWNNYQIKPI
FT                   SAENEGKYSDLIKTAATKYGVPEALIKRVIQVESNFNPNVVSSAGATGLMQLMYGSNRT
FT                   DPATNIDAGTKQLASYIKKYDGDLKLALAAYNAGPGNVHKYGGVPPFKETQNYLTKIIG
FT                   "
FT   gene            786744..787388
FT                   /locus_tag="LM5578_0797"
FT   CDS_pept        786744..787388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0797"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0797"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67551"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464245.1"
FT                   /protein_id="ADB67551.1"
FT                   /translation="MGNWQQKWESWRDMTAAMQQEIKIEAAEKVTSYIKNDQFEEAINV
FT                   IRQTENLLNELDFETKMNRVEEQLQAFTSDQEAAKSFEASQLQNIEKPSTKVSFDLSHV
FT                   KSEAINQFTKRDFNLVDSNDTHMQFLKGNRNFYMDIFNPEESEEYHYANLDEKCQYKNI
FT                   GFICQNDAAAEIATKLTNEWLETLEAPKKKFLTVNIANLNAMKQNPEVLFQ"
FT   gene            787510..787836
FT                   /locus_tag="LM5578_0798"
FT   CDS_pept        787510..787836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0798"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0798"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67552"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464246.1"
FT                   /protein_id="ADB67552.1"
FT                   /translation="MKGLTELLKGSLEGMILERISRGETYGYEITKYLNDLGFDEIVEG
FT                   TVYTILVRLEKKGLVEIEKKKSELGPPRKFYTLSPAGEEELAIFWKRWDFIQGKIMQVK
FT                   GGQA"
FT   gene            787836..788159
FT                   /locus_tag="LM5578_0799"
FT   CDS_pept        787836..788159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0799"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0799"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67553"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464247.1"
FT                   /protein_id="ADB67553.1"
FT                   /translation="MFNWYKKYREEKRDYKQYKKRIAALPEDYKTAMKAIETYLWNFAK
FT                   GAGMFEILKNVLEMFENAAADNLELKAVVGDDLAEFADNLLSEFPEETWMDKQRQKLRD
FT                   SIK"
FT   gene            complement(788205..788852)
FT                   /locus_tag="LM5578_0800"
FT   CDS_pept        complement(788205..788852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0800"
FT                   /product="putative fibronectin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0800"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67554"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464248.1"
FT                   /protein_id="ADB67554.1"
FT                   /translation="MKEFIEPYQYNFIKNQLANVSRAYRSANDTSTLKALKSLTEEKIN
FT                   ELFPESVLEEHKELFSKLHVITSTKEAEPFLEGLKAYVIPFAPPSDVKLKKLFAKTKKL
FT                   KIPAWSKLDLRDYTFYGWNDIAQQRKYIVTYEDGNLVGVQGTISTEIQKGVCSICHSHS
FT                   KVSLFMAKTKSSSDGVYTTNGNYICYDSDVCNEQIKAHETLDEFIEVVKKRK"
FT   gene            789123..790853
FT                   /locus_tag="LM5578_0801"
FT   CDS_pept        789123..790853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0801"
FT                   /product="pyruvate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0801"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67555"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464249.1"
FT                   /protein_id="ADB67555.1"
FT                   /translation="MKKVKASETLVQTLKNWGIDHVYGLPGDSIDTVVDALRKEQEAIE
FT                   FIHVRHEEVATLAAAAYTKLTGKIGVALSIGGPGAIHLLNGMYDAKMDHVPMLVLAGQV
FT                   TTDVLNTGFFQEVNLPAIFEDVAVYNKQIDNAETLADVVDEAIRTAYKEKGVAVLTIPN
FT                   DIPSQVIKASLEAKPVKFEQENPKLDEAAIQEAVTLIEKAEKPVILAGLGTKHAGPELI
FT                   AFSEKLKIPIIHSLPAKTIVPDDHPNALGNLGKIGTKPAYEAMQETDLLLMFGNDYPYS
FT                   DYLPKKTDCIQIDIDPAKISKRFPAIVGLVGDAAEIISDLTAKIAPVEERKFLQACQEN
FT                   MQEWWKWLEEDIAQTSDPIAPEVVMANIQKIADKDAVFSIDVGTATVWSTRYLHLTPEN
FT                   DFIVSAWLGTMGCGLPGAIAAKKAFPDRQAIAIVGDGGFSMVMQDFVTAVGLNMPMIVV
FT                   VLNNQQLSFIKYEQQSAGELNYAIDLPDINYAKFAESCGGIGFRVEKMADLEAAFENAK
FT                   LATKPVIIDVSVDSAAAPLPGKIVMDEALGYTKFEIQSVLEDHRFAKMPPLKTILRRFL
FT                   "
FT   gene            791015..792820
FT                   /locus_tag="LM5578_0802"
FT   CDS_pept        791015..792820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0802"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0802"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67556"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464250.1"
FT                   /protein_id="ADB67556.1"
FT                   /translation="MNLIKNRKLKTKLSINIVITTIMLIGLGATSFLGFRHVATLSDNM
FT                   VDNNVAPMKEIAKIQTNMAQINIDILTMFDTINGKSTLIKDIDNLYAENDQAIHNFKKA
FT                   NLTAEDKKQLAYFEEKLADMKASASSVISDTSSALDDAELLGAQNRYYQNVKTKFDDAT
FT                   KQLNVLNDMNYKEVENSSQAISDFGVKISLIFTAVIIAVLISLFIFNAYITRVILKGIR
FT                   HLQTAVHKVASGDLSYRSTYNGRDELGDITNDLNEMSENLRLMIEDVKKASTDVKSSSD
FT                   NVIISSEIISAMTTEMDIEMKMMGEQIQTQIGSMKESTDAMDQMTGGVQNVAEYALKVS
FT                   DLTKDSAEKTNDGIAVINNLVSQMDRISGVMRSSTDVVSQLVNRVGEVEKALDTVTNIA
FT                   DQTNLLALNAAIESARAGEHGRGFAVVAEEVRKLAEQSRLAVVDINTVLKKIQTESKTT
FT                   IEVMNTGLSESEAGQKIISETEATFTDLLNRVNDISAQMQNVSQETEEMAAGIEEVNTS
FT                   ISDVTEISNQIGEKSTAALEFAEVNKMKVDELVVISEEMQKISGSLEGYIANFNTEVSE
FT                   EAVEVTEEPESETKDPGEPVLAENV"
FT   gene            792833..793561
FT                   /locus_tag="LM5578_0803"
FT   CDS_pept        792833..793561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0803"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0803"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67557"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464251.1"
FT                   /protein_id="ADB67557.1"
FT                   /translation="MRIWIKSLLVITACIFSLTLLNTKYTFYSPTVKLESAKVVYKLNN
FT                   EPFNVRLDVPLVNQMDAPTLFNGCEVTSLAMLLQFNGKRVTKNELANNLSTTPIEQNGL
FT                   HGNPDKAFVGSISGDSPGLGVNHAPIAKLAAKYVNEAHVHDISGNSIQDIITVLSTGAP
FT                   VWIITTTDYHAPKNWQTVQTKEGKKKITYSMHSVIITGFDKNNFYINDPYGHKNRAVKR
FT                   SVLEEGWSAMGKQAIYLSRP"
FT   gene            complement(793604..793816)
FT                   /locus_tag="LM5578_0804"
FT   CDS_pept        complement(793604..793816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0804"
FT                   /product="peptidoglycan binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0804"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67558"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464252.1"
FT                   /protein_id="ADB67558.1"
FT                   /translation="MVFPKKLVASIAVFISLGFIYFRVSTAVAFENTSSASLLPSTGDA
FT                   FSVWPIVIGVVLVALAVVLFIKKKI"
FT   gene            794019..794162
FT                   /locus_tag="LM5578_0805"
FT   CDS_pept        794019..794162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0805"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0805"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67559"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464253.1"
FT                   /protein_id="ADB67559.1"
FT                   /translation="MLEGEIPEKYRSVDEEEINRSFGGSLPAVHAVVKSYLQIIWVTKW
FT                   TE"
FT   gene            794263..796068
FT                   /locus_tag="LM5578_0806"
FT   CDS_pept        794263..796068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0806"
FT                   /product="D-fructose-6-phosphate amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0806"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67560"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464254.1"
FT                   /protein_id="ADB67560.1"
FT                   /translation="MCGIVGYIGTNNAKGILLEGLEKLEYRGYDSAGIALQNKELVTVV
FT                   KEKGRIADLASLVPSDTFGTTGIGHTRWATHGKPNHENAHPHQSKSGRFTIVHNGVIEN
FT                   YTLLKEEYLKNHSFVSDTDTEVIVQLIELFAAELSTKEAFKKTLSLLHGSYAICLIDQT
FT                   NTETLYAAKNKSPLLIGKGENFNVIASDAMAVLKETDEFVEIMDKEIVIVTKDGFTLET
FT                   LEGEEITRASYKAELDASDIEKGTYPHYMLKEIDEQPAVTRKIIQAYQDEAGEINVDKT
FT                   IIDEILSSDRIHIVACGTSYHAGLVGKNLIEKMTKIPVEVHVSSEFAYNLPLMSKKPLF
FT                   IFITQSGETADSRQCLVKVKELGYRTLTLTNVPGSTLDREADHSMYLYAGPEIAVASTK
FT                   AYTAQISVLAVLAVSLGREIGDEEALNINLAAELGIVATAMEAMVSSKEVIEHIAGEYL
FT                   ATSRNAFFLGRNIDYFVAMEAALKLKEISYIQAEGFASGELKHGTIALIEDGTPVLALI
FT                   TQESINWNIRGNVNEVLARGAKTCIFAMENVAQPGDRFVIPQVHPLLTPLASVIPCQLL
FT                   AYYAALHRDCDVDKPRNLAKSVTVE"
FT   gene            796181..796921
FT                   /locus_tag="LM5578_0807"
FT   CDS_pept        796181..796921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0807"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0807"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67561"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464255.1"
FT                   /protein_id="ADB67561.1"
FT                   /translation="MEVSHVTLAPNKDSRAAVLTIGKFDGVHIGHQTILNTALSIKKEN
FT                   EILTAISFSPHPLWALKQIEIYREMLTPRMEKERWLAYYGVNHLIETEFTSRYAETTPE
FT                   EFVTDHLTNLNLSHIVVGSEFNFGKGRDSDVDLLRDLCKPYDIGVTSVPVIETNQTKIS
FT                   STNIRAFIRRGHFQEAEELLGHPWYITGIVENGEMTGLDDYVLPATGTYQTDSGIVNVT
FT                   NNRTIEVGLSDGLQQLHMKNELSE"
FT   gene            797004..797483
FT                   /locus_tag="LM5578_0808"
FT   CDS_pept        797004..797483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0808"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0808"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67562"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464256.1"
FT                   /protein_id="ADB67562.1"
FT                   /translation="MKIPTTLKHKPVIVVENYEEVDGKNAYHSDAKGLSLGLAQWNDRG
FT                   KVDISAKVWRHTGDKWSRQSEELPLHRVLDLAILIARTKVHFKDAYRLPHFYDKENPTL
FT                   DRIGLQGDALTIAVCEDNEYIDEDMQLFEQALKNDDELLSERLKTLSKLLQEAGY"
FT   gene            797497..797835
FT                   /locus_tag="LM5578_0809"
FT   CDS_pept        797497..797835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0809"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0809"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67563"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464257.1"
FT                   /protein_id="ADB67563.1"
FT                   /translation="MNKDNRKELIRAYKEKSPDAGVYRFISTKSGKSLIDNTMDLKGIA
FT                   NKLAFGVKIGAGNMLPPEMAKEAKEHGIDTIQFEILEKVDIKPEMTKEDIKEENDVLLS
FT                   LWLEREDI"
FT   gene            797980..798384
FT                   /locus_tag="LM5578_0810"
FT   CDS_pept        797980..798384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0810"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67564"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464258.1"
FT                   /protein_id="ADB67564.1"
FT                   /translation="MNPRKSEFVLTLIAGITGIIAGITGIAGGGLLAALSGSEELSNAT
FT                   AMTAADSEALAAAGGLTVIFSIIALVLGIALIVFAVLIKRNAKVFGILTLVAGVVGFFL
FT                   VGLLWIVPGVLAVIAGIMCLARKVPSDTFS"
FT   gene            798694..798825
FT                   /locus_tag="LM5578_0811"
FT   CDS_pept        798694..798825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0811"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0811"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67565"
FT                   /inference="ab initio prediction:Glimmer:3.02"
FT                   /protein_id="ADB67565.1"
FT                   /translation="MDKSATLSKNEVEFRWISMIWDVLKMLELSFETLFFELYFNWK"
FT   gene            799077..800993
FT                   /locus_tag="LM5578_0812"
FT   CDS_pept        799077..800993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0812"
FT                   /product="peptidoglycan binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0812"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67566"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464259.1"
FT                   /protein_id="ADB67566.1"
FT                   /translation="MKKAFLCLSAIVLSLNFVWINPITGSASKIETTKETNQQVNLKNN
FT                   VTDIVTSEDLGGQTWLINEVNRQLAPKTVDVNLTFEDLAKITTISLNNRSLTGEVPPEI
FT                   KNLVSLQRLYLFSNKLSGEIPAELGELTKLTELRLDYNELSGKIPDGLGNISEIALQNN
FT                   RLVGQIPLSLYENRTGKNEVNVSGNQVTINSQQSEPSVYSAYTFVYPSSTPEYSGHIKA
FT                   NNSFISNLTNDMNLTPFLKNSPTFINLQVVYMFNSELFDGHDVTITDTNDGRVLYDGTL
FT                   TSDISIPLTNFKSGVHVINVMLDNAPNNPQNQTTFLIDILPVPAHDLTVNYVDEAGAEI
FT                   HEPQTVSGNVGDDYDVTTPEFELAIDKYELDTEQMPTNGLGTLSSEAQTVTYVYKKVNG
FT                   APVTVKYEDQNGVEITTSDVLTGKLDATYQSKAKEIAGFTLDNSKLPANASGIFETNPQ
FT                   TVTYVYQAVPATIKAHDSTIYVEDKWSAEDNFDSAVNSVGAAVSFDDLEVEGTVDTTKA
FT                   GVYPVTYSFAGESVTINVTVKAKDLPAPPVTPTKPVVPIQPTNPDQPDIQAAPGEHQAS
FT                   TDKSEALKVTVAQKEQPTGAGNLKLPTTGDNLWDSVLYSVFGLIAVCVAFSLFFWRKKQ
FT                   KHS"
FT   gene            801323..801832
FT                   /locus_tag="LM5578_0813"
FT   CDS_pept        801323..801832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0813"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0813"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67567"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464260.1"
FT                   /protein_id="ADB67567.1"
FT                   /translation="MLNENIKAIRKSKGLSQEEIAIKLNVVRQTISKWEQGLSVPDSDM
FT                   LISISEVLETPVSTLLGETVMVSKVDDVKAISEKLEIINLQFAQRKTARRKMLYWLFVS
FT                   LCAVIAIISAVFIILNSPYLGWDYSDPETSVIGVAFHTFEWLFVRLAPIILIGGVVGIF
FT                   LTRKNV"
FT   gene            complement(801990..802994)
FT                   /locus_tag="LM5578_0814"
FT   CDS_pept        complement(801990..802994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0814"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0814"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67568"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464261.1"
FT                   /protein_id="ADB67568.1"
FT                   /translation="MKKTSIKDIAKLSGVSVATVSRVINDNGRFSEETREKVLAVIKET
FT                   NYQMNFSAKSLRMNKSFSVGILVPDISNYFFSSVVQQIEAILFDQGYSTIICNTGRNLD
FT                   KEMAYLNMLESKMVDGLIVISGADEFGFKYTNAENGIPYVCIDRQPKDKKDTIFISSNH
FT                   YQGAFEATEALIHAGVKSPVIFMHSRQSSSAKERLKGFQDALKKNNIRYDPDVSKFTVD
FT                   LQIHDYQKSIITFVNEVTTMDGIFAINDNIALELLNLLPTIGKKIPNDIKVIGFDDTPQ
FT                   CNYTVPKLSSVKQNIPKIAQITVDNLITIIKNPKQKKRITEIVPVELSLKDSI"
FT   gene            803209..803880
FT                   /locus_tag="LM5578_0815"
FT   CDS_pept        803209..803880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0815"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0815"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67569"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464262.1"
FT                   /protein_id="ADB67569.1"
FT                   /translation="MSKKLICPSMMCADFSGLEREVEELDKAGSDVFHVDIMDGAFVPS
FT                   FGMGLQDFEEIRQKTQKLVDVHLMIMNPGDYVEMFADKGADIIYIHPEADLHPARTLDK
FT                   IRNKGKKVGIAINPGTAIATIKELLPLVDNVMVMTVNPGFAGQKYLDYVDVKIAELVEL
FT                   KKDYTFEIMVDGAISPEKISKLSQLGVKGFVLGTSALFGKKESYAEIIKKLKQEKMEEL
FT                   R"
FT   gene            803877..804323
FT                   /locus_tag="LM5578_0816"
FT   CDS_pept        803877..804323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0816"
FT                   /product="ribose-5-phosphate isomerase B"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0816"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67570"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464263.1"
FT                   /protein_id="ADB67570.1"
FT                   /translation="MKIAIGNDHVGIELKPVIVAYLQDLGHDVDDFGAFSNERTDYPEY
FT                   GKKVAESVAAGKSDLGILICGSGVGISIAANKVNGIRAVVCSEPYSAKLSREHNNTNIL
FT                   AFGSRVVGAELAKMIVQNWLDAEFEGGRHAKRVEMIARIEDEND"
FT   gene            804336..805268
FT                   /locus_tag="LM5578_0817"
FT   CDS_pept        804336..805268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0817"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0817"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67571"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464264.1"
FT                   /protein_id="ADB67571.1"
FT                   /translation="MEQEVTRLISASKQDFEKMNGRDLKRSIFQSEGRVIMAQHLLFAS
FT                   QGLVRGVTNTELLAAFGSDMIMLNTFNLEDEKSNLGLQGLTLEDLKKRVNIPLGIYLGC
FT                   PGENKTSENIIYDAAGMLAADEHLLRAKEIGADFIVLGGNPGSGTSIQDIIETIKRARK
FT                   LLGNDVLIFAGKWEDGIDEKVLGDPLAKQDAKEVIKQLIDAGADVIDLPAPGSRHGISV
FT                   RMIQELVQFIHLYKPGTLAMTFLNSSVEGADQDTIRLIALMMKETGADIHAIGDGGFSG
FT                   CTTPENVMQLSISLKGKPYTYFRMASRNR"
FT   gene            805292..807145
FT                   /locus_tag="LM5578_0818"
FT   CDS_pept        805292..807145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0818"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0818"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67572"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464265.1"
FT                   /protein_id="ADB67572.1"
FT                   /translation="MDYQKLAKEILANVGGEENVRSVVHCATRLRFKLVNKEKADKKQI
FT                   ESISGVISVVENAGQLQVIIGNTVGDVYKALGSFTKLTDDGDSEIAKGTKDSDGNFLSK
FT                   AIDVISGIFTPILGALAGGGMLKGLLMILTTFGWLTESSGTYQILYAAADSVFYFLPLI
FT                   LAYTAARKFGANPPVAIAAAGALVYPTMINLFNEGAHITFLQIPVVLMSYSFSVIPIIL
FT                   AVWFLSILERFLNSKIHEAAKTFLTPMICLMLIVPLTFLAFGPLGTFISQGLASGYTFI
FT                   YNLSPIVAGAFMGAFWQVLVIFGIHWGFVPIMINNLSRYGRDTMIAMVGPSNFAQAGAS
FT                   LGVFLKTKKPEVKAIAGSAALTGFFGITEPSIYGVTLKYKKPFVIASIAGAIGGAIVGA
FT                   AGSSGAANAIPGILTLPIFIGKGFVGFILGIAVAYILSAIGTYFFGYKDEMADGIAPTT
FT                   KEAKETGVEAEVIVSPIRGNIVPLNEVKDEAFSAGLLGKGVAIVPQEGKLISPVNGTIE
FT                   TAFPTGHAIGIRSDKGVEILLHVGFDTVQLNGKYFKLLVAQGDRVLVGQALLEFDLEAI
FT                   KADGYDITTPIVVTNTDAYLDVLISDQKTVNYEDTLLTPVL"
FT   gene            807165..808538
FT                   /locus_tag="LM5578_0819"
FT   CDS_pept        807165..808538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5578_0819"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5578_0819"
FT                   /db_xref="EnsemblGenomes-Tr:ADB67573"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464266.1"
FT                   /protein_id="ADB67573.1"
FT                   /translation="MFNLQKGFPENFKWGSSTNAQQFEGGYKEGGKGLSIADVRVIPDM
FT                   PDESDFESFKTASDHYHHYKEDIAYYGEMGFQIYRFTMAWSRIFPNGDETEPNDAGVEF
FT                   YSNMLAELEKYNIEPVVTLYAYDMPLQLLEKYNGWLDRAIIKDYLHYVETVVKLFKGRV
FT                   KYWVPFNEQNFISIDSEYMSGYRAKNKAEVFQIQHHFNLCYAEATKLVHQIDPDAKVGG
FT                   NIGNICPYPMTCKPEDVEASDKVAQQLGYAYGDIYFRGYYPKYFLKEYEGVDFEQIILD
FT                   DDLTIIKSSEPDFMSLTYYMSSAIEAKGEEEVVVMNGIKAPNPYCETTEWGWTIDPYGF
FT                   KHYLQEFYHRYQLPILILENGMGARDEKNTDDTIDDTYRIDYLASHIARMQEAVEEGCE
FT                   IIGYLTWSATDLYSTREGFEKRYGFVYVDKDNSYKRLKKKSFYWYKKVIETNGNDLNY"
FT   gene            complement(808552..809211)
FT                   /locus_tag="LM5578_0820"
FT   CDS_pept        complement(808552..809211)
FT