(data stored in ACNUC8465 zone)

EMBL: CP001604

ID   CP001604; SV 1; circular; genomic DNA; STD; PRO; 2999054 BP.
AC   CP001604;
PR   Project:PRJNA36363;
DT   21-JAN-2010 (Rel. 103, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 7)
DE   Listeria monocytogenes 08-5923, complete genome.
KW   .
OS   Listeria monocytogenes 08-5923
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Listeriaceae; Listeria.
RN   [1]
RC   Publication Status: Online-Only
RP   1-2999054
RX   PUBMED; 20167121.
RA   Gilmour M.W., Graham M., Van Domselaar G., Tyler S., Kent H.,
RA   Trout-Yakel K.M., Larios O., Allen V., Lee B., Nadon C.;
RT   "High-throughput genome sequencing of two Listeria monocytogenes clinical
RT   isolates during a large foodborne outbreak";
RL   BMC Genomics 11:120-120(2010).
RN   [2]
RP   1-2999054
RA   Gilmour M.W., Tyler S., Graham M., Van Domselaar G., Kent H.,
RA   Trout-Yakel K., Larios O., Allen V., Nadon C.;
RT   ;
RL   Submitted (09-APR-2009) to the INSDC.
RL   National Microbiology Laboratory, Public Health Agency of Canada, 1015
RL   Arlington Street, Winnipeg, Manitoba R3E 3R2, Canada
DR   MD5; 383eb517ea3df4ef56f9188c1601b80e.
DR   BioSample; SAMN02603721.
DR   EnsemblGenomes-Gn; EBG00001008102.
DR   EnsemblGenomes-Gn; EBG00001008104.
DR   EnsemblGenomes-Gn; EBG00001008106.
DR   EnsemblGenomes-Gn; EBG00001008109.
DR   EnsemblGenomes-Gn; EBG00001008111.
DR   EnsemblGenomes-Gn; EBG00001008113.
DR   EnsemblGenomes-Gn; EBG00001008115.
DR   EnsemblGenomes-Gn; EBG00001008117.
DR   EnsemblGenomes-Gn; EBG00001008118.
DR   EnsemblGenomes-Gn; EBG00001008120.
DR   EnsemblGenomes-Gn; EBG00001008122.
DR   EnsemblGenomes-Gn; EBG00001008124.
DR   EnsemblGenomes-Gn; EBG00001008126.
DR   EnsemblGenomes-Gn; EBG00001008128.
DR   EnsemblGenomes-Gn; EBG00001008130.
DR   EnsemblGenomes-Gn; EBG00001008132.
DR   EnsemblGenomes-Gn; EBG00001008134.
DR   EnsemblGenomes-Gn; EBG00001008136.
DR   EnsemblGenomes-Gn; EBG00001008137.
DR   EnsemblGenomes-Gn; EBG00001008139.
DR   EnsemblGenomes-Gn; EBG00001008141.
DR   EnsemblGenomes-Gn; EBG00001008144.
DR   EnsemblGenomes-Gn; EBG00001008147.
DR   EnsemblGenomes-Gn; EBG00001008149.
DR   EnsemblGenomes-Gn; EBG00001008150.
DR   EnsemblGenomes-Gn; EBG00001008151.
DR   EnsemblGenomes-Gn; EBG00001008153.
DR   EnsemblGenomes-Gn; EBG00001008155.
DR   EnsemblGenomes-Gn; EBG00001008157.
DR   EnsemblGenomes-Gn; EBG00001008159.
DR   EnsemblGenomes-Gn; EBG00001008161.
DR   EnsemblGenomes-Gn; EBG00001008163.
DR   EnsemblGenomes-Gn; EBG00001008165.
DR   EnsemblGenomes-Gn; EBG00001008166.
DR   EnsemblGenomes-Gn; EBG00001008168.
DR   EnsemblGenomes-Gn; EBG00001008170.
DR   EnsemblGenomes-Gn; EBG00001008172.
DR   EnsemblGenomes-Gn; EBG00001008174.
DR   EnsemblGenomes-Gn; EBG00001008176.
DR   EnsemblGenomes-Gn; EBG00001008178.
DR   EnsemblGenomes-Gn; EBG00001008180.
DR   EnsemblGenomes-Gn; EBG00001008182.
DR   EnsemblGenomes-Gn; EBG00001008184.
DR   EnsemblGenomes-Gn; EBG00001008186.
DR   EnsemblGenomes-Gn; EBG00001008188.
DR   EnsemblGenomes-Gn; EBG00001008190.
DR   EnsemblGenomes-Gn; EBG00001008192.
DR   EnsemblGenomes-Gn; EBG00001008195.
DR   EnsemblGenomes-Gn; EBG00001008197.
DR   EnsemblGenomes-Gn; EBG00001008199.
DR   EnsemblGenomes-Gn; EBG00001008201.
DR   EnsemblGenomes-Gn; EBG00001008202.
DR   EnsemblGenomes-Gn; EBG00001008205.
DR   EnsemblGenomes-Gn; EBG00001008206.
DR   EnsemblGenomes-Gn; EBG00001008208.
DR   EnsemblGenomes-Gn; EBG00001008210.
DR   EnsemblGenomes-Gn; EBG00001008212.
DR   EnsemblGenomes-Gn; EBG00001008214.
DR   EnsemblGenomes-Gn; EBG00001008217.
DR   EnsemblGenomes-Gn; EBG00001008220.
DR   EnsemblGenomes-Gn; EBG00001008221.
DR   EnsemblGenomes-Gn; EBG00001008223.
DR   EnsemblGenomes-Gn; EBG00001008225.
DR   EnsemblGenomes-Gn; EBG00001008226.
DR   EnsemblGenomes-Gn; EBG00001008228.
DR   EnsemblGenomes-Gn; EBG00001008230.
DR   EnsemblGenomes-Gn; EBG00001008232.
DR   EnsemblGenomes-Gn; EBG00001008234.
DR   EnsemblGenomes-Gn; EBG00001008236.
DR   EnsemblGenomes-Gn; EBG00001008238.
DR   EnsemblGenomes-Gn; EBG00001008240.
DR   EnsemblGenomes-Gn; EBG00001008242.
DR   EnsemblGenomes-Gn; EBG00001008244.
DR   EnsemblGenomes-Gn; EBG00001008246.
DR   EnsemblGenomes-Gn; EBG00001008248.
DR   EnsemblGenomes-Gn; EBG00001008250.
DR   EnsemblGenomes-Gn; EBG00001008252.
DR   EnsemblGenomes-Gn; EBG00001008254.
DR   EnsemblGenomes-Gn; EBG00001008255.
DR   EnsemblGenomes-Gn; EBG00001008257.
DR   EnsemblGenomes-Gn; EBG00001008259.
DR   EnsemblGenomes-Gn; EBG00001008261.
DR   EnsemblGenomes-Gn; EBG00001008263.
DR   EnsemblGenomes-Gn; EBG00001008265.
DR   EnsemblGenomes-Gn; EBG00001008267.
DR   EnsemblGenomes-Gn; EBG00001008270.
DR   EnsemblGenomes-Gn; EBG00001008271.
DR   EnsemblGenomes-Gn; EBG00001008274.
DR   EnsemblGenomes-Gn; EBG00001008275.
DR   EnsemblGenomes-Gn; EBG00001008277.
DR   EnsemblGenomes-Gn; EBG00001008279.
DR   EnsemblGenomes-Gn; EBG00001008280.
DR   EnsemblGenomes-Gn; EBG00001008282.
DR   EnsemblGenomes-Gn; EBG00001008284.
DR   EnsemblGenomes-Gn; EBG00001008286.
DR   EnsemblGenomes-Gn; EBG00001008288.
DR   EnsemblGenomes-Gn; EBG00001008290.
DR   EnsemblGenomes-Gn; EBG00001008292.
DR   EnsemblGenomes-Gn; EBG00001008294.
DR   EnsemblGenomes-Gn; EBG00001008296.
DR   EnsemblGenomes-Gn; EBG00001008299.
DR   EnsemblGenomes-Gn; EBG00001008301.
DR   EnsemblGenomes-Gn; EBG00001008303.
DR   EnsemblGenomes-Gn; EBG00001008306.
DR   EnsemblGenomes-Gn; EBG00001008308.
DR   EnsemblGenomes-Gn; EBG00001008311.
DR   EnsemblGenomes-Gn; EBG00001008313.
DR   EnsemblGenomes-Gn; EBG00001008315.
DR   EnsemblGenomes-Gn; EBG00001008317.
DR   EnsemblGenomes-Gn; EBG00001008319.
DR   EnsemblGenomes-Gn; EBG00001008320.
DR   EnsemblGenomes-Gn; EBG00001008322.
DR   EnsemblGenomes-Gn; EBG00001008324.
DR   EnsemblGenomes-Gn; EBG00001008325.
DR   EnsemblGenomes-Gn; EBG00001008327.
DR   EnsemblGenomes-Gn; EBG00001008328.
DR   EnsemblGenomes-Gn; EBG00001008330.
DR   EnsemblGenomes-Gn; EBG00001008332.
DR   EnsemblGenomes-Gn; EBG00001008334.
DR   EnsemblGenomes-Gn; EBG00001008335.
DR   EnsemblGenomes-Gn; EBG00001008337.
DR   EnsemblGenomes-Gn; EBG00001008339.
DR   EnsemblGenomes-Gn; EBG00001008341.
DR   EnsemblGenomes-Gn; EBG00001008343.
DR   EnsemblGenomes-Gn; EBG00001008346.
DR   EnsemblGenomes-Gn; EBG00001008348.
DR   EnsemblGenomes-Gn; EBG00001008349.
DR   EnsemblGenomes-Gn; EBG00001008352.
DR   EnsemblGenomes-Gn; EBG00001008354.
DR   EnsemblGenomes-Gn; EBG00001008356.
DR   EnsemblGenomes-Gn; EBG00001008357.
DR   EnsemblGenomes-Gn; EBG00001008359.
DR   EnsemblGenomes-Gn; EBG00001008361.
DR   EnsemblGenomes-Gn; EBG00001008363.
DR   EnsemblGenomes-Gn; EBG00001008365.
DR   EnsemblGenomes-Gn; EBG00001008367.
DR   EnsemblGenomes-Gn; LM5923_rRNA01.
DR   EnsemblGenomes-Gn; LM5923_rRNA02.
DR   EnsemblGenomes-Gn; LM5923_rRNA03.
DR   EnsemblGenomes-Gn; LM5923_rRNA04.
DR   EnsemblGenomes-Gn; LM5923_rRNA05.
DR   EnsemblGenomes-Gn; LM5923_rRNA06.
DR   EnsemblGenomes-Gn; LM5923_rRNA07.
DR   EnsemblGenomes-Gn; LM5923_rRNA08.
DR   EnsemblGenomes-Gn; LM5923_rRNA09.
DR   EnsemblGenomes-Gn; LM5923_rRNA10.
DR   EnsemblGenomes-Gn; LM5923_rRNA11.
DR   EnsemblGenomes-Gn; LM5923_rRNA12.
DR   EnsemblGenomes-Gn; LM5923_rRNA13.
DR   EnsemblGenomes-Gn; LM5923_rRNA14.
DR   EnsemblGenomes-Gn; LM5923_rRNA15.
DR   EnsemblGenomes-Gn; LM5923_tRNA01.
DR   EnsemblGenomes-Gn; LM5923_tRNA02.
DR   EnsemblGenomes-Gn; LM5923_tRNA03.
DR   EnsemblGenomes-Gn; LM5923_tRNA04.
DR   EnsemblGenomes-Gn; LM5923_tRNA05.
DR   EnsemblGenomes-Gn; LM5923_tRNA06.
DR   EnsemblGenomes-Gn; LM5923_tRNA07.
DR   EnsemblGenomes-Gn; LM5923_tRNA08.
DR   EnsemblGenomes-Gn; LM5923_tRNA09.
DR   EnsemblGenomes-Gn; LM5923_tRNA10.
DR   EnsemblGenomes-Gn; LM5923_tRNA11.
DR   EnsemblGenomes-Gn; LM5923_tRNA12.
DR   EnsemblGenomes-Gn; LM5923_tRNA13.
DR   EnsemblGenomes-Gn; LM5923_tRNA14.
DR   EnsemblGenomes-Gn; LM5923_tRNA15.
DR   EnsemblGenomes-Gn; LM5923_tRNA16.
DR   EnsemblGenomes-Gn; LM5923_tRNA17.
DR   EnsemblGenomes-Gn; LM5923_tRNA18.
DR   EnsemblGenomes-Gn; LM5923_tRNA19.
DR   EnsemblGenomes-Gn; LM5923_tRNA20.
DR   EnsemblGenomes-Gn; LM5923_tRNA21.
DR   EnsemblGenomes-Gn; LM5923_tRNA22.
DR   EnsemblGenomes-Gn; LM5923_tRNA23.
DR   EnsemblGenomes-Gn; LM5923_tRNA24.
DR   EnsemblGenomes-Gn; LM5923_tRNA25.
DR   EnsemblGenomes-Gn; LM5923_tRNA26.
DR   EnsemblGenomes-Gn; LM5923_tRNA27.
DR   EnsemblGenomes-Gn; LM5923_tRNA28.
DR   EnsemblGenomes-Gn; LM5923_tRNA29.
DR   EnsemblGenomes-Gn; LM5923_tRNA30.
DR   EnsemblGenomes-Gn; LM5923_tRNA31.
DR   EnsemblGenomes-Gn; LM5923_tRNA32.
DR   EnsemblGenomes-Gn; LM5923_tRNA33.
DR   EnsemblGenomes-Gn; LM5923_tRNA34.
DR   EnsemblGenomes-Gn; LM5923_tRNA35.
DR   EnsemblGenomes-Gn; LM5923_tRNA36.
DR   EnsemblGenomes-Gn; LM5923_tRNA37.
DR   EnsemblGenomes-Gn; LM5923_tRNA38.
DR   EnsemblGenomes-Gn; LM5923_tRNA39.
DR   EnsemblGenomes-Gn; LM5923_tRNA40.
DR   EnsemblGenomes-Gn; LM5923_tRNA41.
DR   EnsemblGenomes-Gn; LM5923_tRNA42.
DR   EnsemblGenomes-Gn; LM5923_tRNA43.
DR   EnsemblGenomes-Gn; LM5923_tRNA44.
DR   EnsemblGenomes-Gn; LM5923_tRNA45.
DR   EnsemblGenomes-Gn; LM5923_tRNA46.
DR   EnsemblGenomes-Gn; LM5923_tRNA47.
DR   EnsemblGenomes-Gn; LM5923_tRNA48.
DR   EnsemblGenomes-Gn; LM5923_tRNA49.
DR   EnsemblGenomes-Gn; LM5923_tRNA50.
DR   EnsemblGenomes-Gn; LM5923_tRNA51.
DR   EnsemblGenomes-Gn; LM5923_tRNA52.
DR   EnsemblGenomes-Gn; LM5923_tRNA53.
DR   EnsemblGenomes-Gn; LM5923_tRNA54.
DR   EnsemblGenomes-Gn; LM5923_tRNA55.
DR   EnsemblGenomes-Gn; LM5923_tRNA56.
DR   EnsemblGenomes-Gn; LM5923_tRNA57.
DR   EnsemblGenomes-Gn; LM5923_tRNA58.
DR   EnsemblGenomes-Tr; EBT00001534951.
DR   EnsemblGenomes-Tr; EBT00001534952.
DR   EnsemblGenomes-Tr; EBT00001534953.
DR   EnsemblGenomes-Tr; EBT00001534954.
DR   EnsemblGenomes-Tr; EBT00001534955.
DR   EnsemblGenomes-Tr; EBT00001534956.
DR   EnsemblGenomes-Tr; EBT00001534957.
DR   EnsemblGenomes-Tr; EBT00001534958.
DR   EnsemblGenomes-Tr; EBT00001534959.
DR   EnsemblGenomes-Tr; EBT00001534960.
DR   EnsemblGenomes-Tr; EBT00001534961.
DR   EnsemblGenomes-Tr; EBT00001534962.
DR   EnsemblGenomes-Tr; EBT00001534963.
DR   EnsemblGenomes-Tr; EBT00001534964.
DR   EnsemblGenomes-Tr; EBT00001534965.
DR   EnsemblGenomes-Tr; EBT00001534966.
DR   EnsemblGenomes-Tr; EBT00001534967.
DR   EnsemblGenomes-Tr; EBT00001534968.
DR   EnsemblGenomes-Tr; EBT00001534969.
DR   EnsemblGenomes-Tr; EBT00001534970.
DR   EnsemblGenomes-Tr; EBT00001534971.
DR   EnsemblGenomes-Tr; EBT00001534972.
DR   EnsemblGenomes-Tr; EBT00001534973.
DR   EnsemblGenomes-Tr; EBT00001534974.
DR   EnsemblGenomes-Tr; EBT00001534975.
DR   EnsemblGenomes-Tr; EBT00001534976.
DR   EnsemblGenomes-Tr; EBT00001534977.
DR   EnsemblGenomes-Tr; EBT00001534978.
DR   EnsemblGenomes-Tr; EBT00001534979.
DR   EnsemblGenomes-Tr; EBT00001534980.
DR   EnsemblGenomes-Tr; EBT00001534981.
DR   EnsemblGenomes-Tr; EBT00001534982.
DR   EnsemblGenomes-Tr; EBT00001534983.
DR   EnsemblGenomes-Tr; EBT00001534984.
DR   EnsemblGenomes-Tr; EBT00001534985.
DR   EnsemblGenomes-Tr; EBT00001534986.
DR   EnsemblGenomes-Tr; EBT00001534987.
DR   EnsemblGenomes-Tr; EBT00001534988.
DR   EnsemblGenomes-Tr; EBT00001534989.
DR   EnsemblGenomes-Tr; EBT00001534990.
DR   EnsemblGenomes-Tr; EBT00001534991.
DR   EnsemblGenomes-Tr; EBT00001534992.
DR   EnsemblGenomes-Tr; EBT00001534993.
DR   EnsemblGenomes-Tr; EBT00001534994.
DR   EnsemblGenomes-Tr; EBT00001534995.
DR   EnsemblGenomes-Tr; EBT00001534996.
DR   EnsemblGenomes-Tr; EBT00001534997.
DR   EnsemblGenomes-Tr; EBT00001534998.
DR   EnsemblGenomes-Tr; EBT00001534999.
DR   EnsemblGenomes-Tr; EBT00001535000.
DR   EnsemblGenomes-Tr; EBT00001535001.
DR   EnsemblGenomes-Tr; EBT00001535002.
DR   EnsemblGenomes-Tr; EBT00001535003.
DR   EnsemblGenomes-Tr; EBT00001535004.
DR   EnsemblGenomes-Tr; EBT00001535005.
DR   EnsemblGenomes-Tr; EBT00001535006.
DR   EnsemblGenomes-Tr; EBT00001535007.
DR   EnsemblGenomes-Tr; EBT00001535008.
DR   EnsemblGenomes-Tr; EBT00001535009.
DR   EnsemblGenomes-Tr; EBT00001535010.
DR   EnsemblGenomes-Tr; EBT00001535011.
DR   EnsemblGenomes-Tr; EBT00001535012.
DR   EnsemblGenomes-Tr; EBT00001535013.
DR   EnsemblGenomes-Tr; EBT00001535014.
DR   EnsemblGenomes-Tr; EBT00001535015.
DR   EnsemblGenomes-Tr; EBT00001535016.
DR   EnsemblGenomes-Tr; EBT00001535017.
DR   EnsemblGenomes-Tr; EBT00001535018.
DR   EnsemblGenomes-Tr; EBT00001535019.
DR   EnsemblGenomes-Tr; EBT00001535020.
DR   EnsemblGenomes-Tr; EBT00001535021.
DR   EnsemblGenomes-Tr; EBT00001535022.
DR   EnsemblGenomes-Tr; EBT00001535023.
DR   EnsemblGenomes-Tr; EBT00001535024.
DR   EnsemblGenomes-Tr; EBT00001535025.
DR   EnsemblGenomes-Tr; EBT00001535026.
DR   EnsemblGenomes-Tr; EBT00001535027.
DR   EnsemblGenomes-Tr; EBT00001535028.
DR   EnsemblGenomes-Tr; EBT00001535029.
DR   EnsemblGenomes-Tr; EBT00001535030.
DR   EnsemblGenomes-Tr; EBT00001535031.
DR   EnsemblGenomes-Tr; EBT00001535032.
DR   EnsemblGenomes-Tr; EBT00001535033.
DR   EnsemblGenomes-Tr; EBT00001535034.
DR   EnsemblGenomes-Tr; EBT00001535035.
DR   EnsemblGenomes-Tr; EBT00001535036.
DR   EnsemblGenomes-Tr; EBT00001535037.
DR   EnsemblGenomes-Tr; EBT00001535038.
DR   EnsemblGenomes-Tr; EBT00001535039.
DR   EnsemblGenomes-Tr; EBT00001535040.
DR   EnsemblGenomes-Tr; EBT00001535041.
DR   EnsemblGenomes-Tr; EBT00001535042.
DR   EnsemblGenomes-Tr; EBT00001535043.
DR   EnsemblGenomes-Tr; EBT00001535044.
DR   EnsemblGenomes-Tr; EBT00001535045.
DR   EnsemblGenomes-Tr; EBT00001535046.
DR   EnsemblGenomes-Tr; EBT00001535047.
DR   EnsemblGenomes-Tr; EBT00001535048.
DR   EnsemblGenomes-Tr; EBT00001535049.
DR   EnsemblGenomes-Tr; EBT00001535050.
DR   EnsemblGenomes-Tr; EBT00001535051.
DR   EnsemblGenomes-Tr; EBT00001535052.
DR   EnsemblGenomes-Tr; EBT00001535053.
DR   EnsemblGenomes-Tr; EBT00001535054.
DR   EnsemblGenomes-Tr; EBT00001535055.
DR   EnsemblGenomes-Tr; EBT00001535056.
DR   EnsemblGenomes-Tr; EBT00001535057.
DR   EnsemblGenomes-Tr; EBT00001535058.
DR   EnsemblGenomes-Tr; EBT00001535059.
DR   EnsemblGenomes-Tr; EBT00001535060.
DR   EnsemblGenomes-Tr; EBT00001535061.
DR   EnsemblGenomes-Tr; EBT00001535062.
DR   EnsemblGenomes-Tr; EBT00001535063.
DR   EnsemblGenomes-Tr; EBT00001535064.
DR   EnsemblGenomes-Tr; EBT00001535065.
DR   EnsemblGenomes-Tr; EBT00001535066.
DR   EnsemblGenomes-Tr; EBT00001535067.
DR   EnsemblGenomes-Tr; EBT00001535068.
DR   EnsemblGenomes-Tr; EBT00001535069.
DR   EnsemblGenomes-Tr; EBT00001535070.
DR   EnsemblGenomes-Tr; EBT00001535071.
DR   EnsemblGenomes-Tr; EBT00001535072.
DR   EnsemblGenomes-Tr; EBT00001535073.
DR   EnsemblGenomes-Tr; EBT00001535074.
DR   EnsemblGenomes-Tr; EBT00001535075.
DR   EnsemblGenomes-Tr; EBT00001535076.
DR   EnsemblGenomes-Tr; EBT00001535077.
DR   EnsemblGenomes-Tr; EBT00001535078.
DR   EnsemblGenomes-Tr; EBT00001535079.
DR   EnsemblGenomes-Tr; EBT00001535080.
DR   EnsemblGenomes-Tr; EBT00001535081.
DR   EnsemblGenomes-Tr; EBT00001535082.
DR   EnsemblGenomes-Tr; EBT00001535083.
DR   EnsemblGenomes-Tr; EBT00001535084.
DR   EnsemblGenomes-Tr; EBT00001535085.
DR   EnsemblGenomes-Tr; EBT00001535086.
DR   EnsemblGenomes-Tr; LM5923_rRNA01-1.
DR   EnsemblGenomes-Tr; LM5923_rRNA02-1.
DR   EnsemblGenomes-Tr; LM5923_rRNA03-1.
DR   EnsemblGenomes-Tr; LM5923_rRNA04-1.
DR   EnsemblGenomes-Tr; LM5923_rRNA05-1.
DR   EnsemblGenomes-Tr; LM5923_rRNA06-1.
DR   EnsemblGenomes-Tr; LM5923_rRNA07-1.
DR   EnsemblGenomes-Tr; LM5923_rRNA08-1.
DR   EnsemblGenomes-Tr; LM5923_rRNA09-1.
DR   EnsemblGenomes-Tr; LM5923_rRNA10-1.
DR   EnsemblGenomes-Tr; LM5923_rRNA11-1.
DR   EnsemblGenomes-Tr; LM5923_rRNA12-1.
DR   EnsemblGenomes-Tr; LM5923_rRNA13-1.
DR   EnsemblGenomes-Tr; LM5923_rRNA14-1.
DR   EnsemblGenomes-Tr; LM5923_rRNA15-1.
DR   EnsemblGenomes-Tr; LM5923_tRNA01-1.
DR   EnsemblGenomes-Tr; LM5923_tRNA02-1.
DR   EnsemblGenomes-Tr; LM5923_tRNA03-1.
DR   EnsemblGenomes-Tr; LM5923_tRNA04-1.
DR   EnsemblGenomes-Tr; LM5923_tRNA05-1.
DR   EnsemblGenomes-Tr; LM5923_tRNA06-1.
DR   EnsemblGenomes-Tr; LM5923_tRNA07-1.
DR   EnsemblGenomes-Tr; LM5923_tRNA08-1.
DR   EnsemblGenomes-Tr; LM5923_tRNA09-1.
DR   EnsemblGenomes-Tr; LM5923_tRNA10-1.
DR   EnsemblGenomes-Tr; LM5923_tRNA11-1.
DR   EnsemblGenomes-Tr; LM5923_tRNA12-1.
DR   EnsemblGenomes-Tr; LM5923_tRNA13-1.
DR   EnsemblGenomes-Tr; LM5923_tRNA14-1.
DR   EnsemblGenomes-Tr; LM5923_tRNA15-1.
DR   EnsemblGenomes-Tr; LM5923_tRNA16-1.
DR   EnsemblGenomes-Tr; LM5923_tRNA17-1.
DR   EnsemblGenomes-Tr; LM5923_tRNA18-1.
DR   EnsemblGenomes-Tr; LM5923_tRNA19-1.
DR   EnsemblGenomes-Tr; LM5923_tRNA20-1.
DR   EnsemblGenomes-Tr; LM5923_tRNA21-1.
DR   EnsemblGenomes-Tr; LM5923_tRNA22-1.
DR   EnsemblGenomes-Tr; LM5923_tRNA23-1.
DR   EnsemblGenomes-Tr; LM5923_tRNA24-1.
DR   EnsemblGenomes-Tr; LM5923_tRNA25-1.
DR   EnsemblGenomes-Tr; LM5923_tRNA26-1.
DR   EnsemblGenomes-Tr; LM5923_tRNA27-1.
DR   EnsemblGenomes-Tr; LM5923_tRNA28-1.
DR   EnsemblGenomes-Tr; LM5923_tRNA29-1.
DR   EnsemblGenomes-Tr; LM5923_tRNA30-1.
DR   EnsemblGenomes-Tr; LM5923_tRNA31-1.
DR   EnsemblGenomes-Tr; LM5923_tRNA32-1.
DR   EnsemblGenomes-Tr; LM5923_tRNA33-1.
DR   EnsemblGenomes-Tr; LM5923_tRNA34-1.
DR   EnsemblGenomes-Tr; LM5923_tRNA35-1.
DR   EnsemblGenomes-Tr; LM5923_tRNA36-1.
DR   EnsemblGenomes-Tr; LM5923_tRNA37-1.
DR   EnsemblGenomes-Tr; LM5923_tRNA38-1.
DR   EnsemblGenomes-Tr; LM5923_tRNA39-1.
DR   EnsemblGenomes-Tr; LM5923_tRNA40-1.
DR   EnsemblGenomes-Tr; LM5923_tRNA41-1.
DR   EnsemblGenomes-Tr; LM5923_tRNA42-1.
DR   EnsemblGenomes-Tr; LM5923_tRNA43-1.
DR   EnsemblGenomes-Tr; LM5923_tRNA44-1.
DR   EnsemblGenomes-Tr; LM5923_tRNA45-1.
DR   EnsemblGenomes-Tr; LM5923_tRNA46-1.
DR   EnsemblGenomes-Tr; LM5923_tRNA47-1.
DR   EnsemblGenomes-Tr; LM5923_tRNA48-1.
DR   EnsemblGenomes-Tr; LM5923_tRNA49-1.
DR   EnsemblGenomes-Tr; LM5923_tRNA50-1.
DR   EnsemblGenomes-Tr; LM5923_tRNA51-1.
DR   EnsemblGenomes-Tr; LM5923_tRNA52-1.
DR   EnsemblGenomes-Tr; LM5923_tRNA53-1.
DR   EnsemblGenomes-Tr; LM5923_tRNA54-1.
DR   EnsemblGenomes-Tr; LM5923_tRNA55-1.
DR   EnsemblGenomes-Tr; LM5923_tRNA56-1.
DR   EnsemblGenomes-Tr; LM5923_tRNA57-1.
DR   EnsemblGenomes-Tr; LM5923_tRNA58-1.
DR   EuropePMC; PMC2834635; 20167121.
DR   EuropePMC; PMC4609684; 26311854.
DR   EuropePMC; PMC4956650; 27499751.
DR   EuropePMC; PMC6558679; 31198443.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00002; 5_8S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00038; PrfA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00522; PreQ1.
DR   RFAM; RF00555; L13_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF00559; L21_leader.
DR   RFAM; RF00615; LhrA.
DR   RFAM; RF00616; LhrC.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01457; rli22.
DR   RFAM; RF01458; rli23.
DR   RFAM; RF01459; rliE.
DR   RFAM; RF01460; rliH.
DR   RFAM; RF01461; rli24.
DR   RFAM; RF01462; rli26.
DR   RFAM; RF01463; rli27.
DR   RFAM; RF01464; rliA.
DR   RFAM; RF01465; rli31.
DR   RFAM; RF01466; rli34.
DR   RFAM; RF01467; rli36.
DR   RFAM; RF01468; rli32.
DR   RFAM; RF01469; rli33.
DR   RFAM; RF01470; rli38.
DR   RFAM; RF01471; rliB.
DR   RFAM; RF01472; rli40.
DR   RFAM; RF01473; rli41.
DR   RFAM; RF01474; rli42.
DR   RFAM; RF01475; rli45.
DR   RFAM; RF01476; rliF.
DR   RFAM; RF01477; rli43.
DR   RFAM; RF01478; rli47.
DR   RFAM; RF01479; rli48.
DR   RFAM; RF01480; rli52.
DR   RFAM; RF01481; rli53.
DR   RFAM; RF01482; AdoCbl_riboswitch.
DR   RFAM; RF01483; rli56.
DR   RFAM; RF01484; rli59.
DR   RFAM; RF01485; rli61.
DR   RFAM; RF01486; rli62.
DR   RFAM; RF01487; rliI.
DR   RFAM; RF01488; rli49.
DR   RFAM; RF01489; sbrA.
DR   RFAM; RF01490; rli51.
DR   RFAM; RF01491; rli54.
DR   RFAM; RF01492; rli28.
DR   RFAM; RF01493; rli37.
DR   RFAM; RF01494; rliD.
DR   RFAM; RF01708; L17DE.
DR   RFAM; RF01749; pan.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01776; RatA.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001604.
DR   SILVA-SSU; CP001604.
CC   Bacteria are available from Dr. Matthew Gilmour at
CC   Matthew_Gilmour@phac-aspc.gc.ca.
FH   Key             Location/Qualifiers
FT   source          1..2999054
FT                   /organism="Listeria monocytogenes 08-5923"
FT                   /strain="08-5923"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:637381"
FT   gene            188..658
FT                   /locus_tag="LM5923_0001"
FT   CDS_pept        188..658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0001"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69847"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466379.1"
FT                   /protein_id="ADB69847.1"
FT   gene            826..960
FT                   /gene="rpmH"
FT                   /locus_tag="LM5923_0002"
FT   CDS_pept        826..960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmH"
FT                   /locus_tag="LM5923_0002"
FT                   /product="50S ribosomal protein L34"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69848"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466378.1"
FT                   /protein_id="ADB69848.1"
FT   gene            1050..1409
FT                   /gene="rnpA"
FT                   /locus_tag="LM5923_0003"
FT   CDS_pept        1050..1409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnpA"
FT                   /locus_tag="LM5923_0003"
FT                   /product="ribonuclease P"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69849"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466377.1"
FT                   /protein_id="ADB69849.1"
FT                   LKVGRVLKQKPNNSK"
FT   gene            1450..2313
FT                   /locus_tag="LM5923_0004"
FT   CDS_pept        1450..2313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0004"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69850"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466376.1"
FT                   /protein_id="ADB69850.1"
FT                   GGKKRK"
FT   gene            2310..2930
FT                   /locus_tag="LM5923_0005"
FT   CDS_pept        2310..2930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0005"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69851"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466375.1"
FT                   /protein_id="ADB69851.1"
FT   gene            3015..3446
FT                   /locus_tag="LM5923_0006"
FT   CDS_pept        3015..3446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0006"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69852"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466374.1"
FT                   /protein_id="ADB69852.1"
FT   gene            complement(3496..4476)
FT                   /locus_tag="LM5923_0007"
FT   CDS_pept        complement(3496..4476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0007"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69853"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466373.1"
FT                   /protein_id="ADB69853.1"
FT   gene            4599..5867
FT                   /locus_tag="LM5923_0008"
FT   CDS_pept        4599..5867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0008"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69854"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466372.1"
FT                   /protein_id="ADB69854.1"
FT   gene            5886..7337
FT                   /locus_tag="LM5923_0009"
FT   CDS_pept        5886..7337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0009"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69855"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466371.1"
FT                   /protein_id="ADB69855.1"
FT   gene            7350..8612
FT                   /locus_tag="LM5923_0010"
FT   CDS_pept        7350..8612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0010"
FT                   /product="L-rhamnose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69856"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466370.1"
FT                   /protein_id="ADB69856.1"
FT   gene            8625..9446
FT                   /locus_tag="LM5923_0011"
FT   CDS_pept        8625..9446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0011"
FT                   /product="rhamnulose-1-phosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69857"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466369.1"
FT                   /protein_id="ADB69857.1"
FT   gene            9459..9773
FT                   /locus_tag="LM5923_0012"
FT   CDS_pept        9459..9773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0012"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69858"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466368.1"
FT                   /protein_id="ADB69858.1"
FT                   "
FT   gene            complement(9814..11226)
FT                   /locus_tag="LM5923_0013"
FT   CDS_pept        complement(9814..11226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69859"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466367.1"
FT                   /protein_id="ADB69859.1"
FT                   CFLLVFRLPKNI"
FT   gene            11381..11920
FT                   /locus_tag="LM5923_0014"
FT   CDS_pept        11381..11920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0014"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69860"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466366.1"
FT                   /protein_id="ADB69860.1"
FT                   GETYQDVQLFSWIDEI"
FT   gene            12056..14050
FT                   /locus_tag="LM5923_0015"
FT   CDS_pept        12056..14050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0015"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69861"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466365.1"
FT                   /protein_id="ADB69861.1"
FT   gene            complement(14095..14167)
FT                   /locus_tag="LM5923_tRNA01"
FT   tRNA            complement(14095..14167)
FT                   /locus_tag="LM5923_tRNA01"
FT                   /product="tRNA-Val"
FT                   /note="Cove score: 68.03"
FT                   /inference="ab initio prediction:tRNAscan-SE:1.23"
FT   gene            complement(14189..15214)
FT                   /locus_tag="LM5923_0016"
FT   CDS_pept        complement(14189..15214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0016"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69862"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466364.1"
FT                   /protein_id="ADB69862.1"
FT                   A"
FT   gene            15439..17139
FT                   /locus_tag="LM5923_0017"
FT   CDS_pept        15439..17139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0017"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69863"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466362.1"
FT                   /protein_id="ADB69863.1"
FT   gene            17136..18428
FT                   /locus_tag="LM5923_0018"
FT   CDS_pept        17136..18428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0018"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69864"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466361.1"
FT                   /protein_id="ADB69864.1"
FT   gene            18503..19384
FT                   /locus_tag="LM5923_0019"
FT   CDS_pept        18503..19384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0019"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69865"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466360.1"
FT                   /protein_id="ADB69865.1"
FT                   FARKRVDLNGGK"
FT   gene            19371..20222
FT                   /locus_tag="LM5923_0020"
FT   CDS_pept        19371..20222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69866"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466359.1"
FT                   /protein_id="ADB69866.1"
FT                   KG"
FT   gene            20241..21293
FT                   /locus_tag="LM5923_0021"
FT   CDS_pept        20241..21293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0021"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69867"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466358.1"
FT                   /protein_id="ADB69867.1"
FT                   DLSIKMGITL"
FT   gene            21306..22100
FT                   /locus_tag="LM5923_0022"
FT   CDS_pept        21306..22100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0022"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69868"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466357.1"
FT                   /protein_id="ADB69868.1"
FT   gene            22158..23189
FT                   /locus_tag="LM5923_0023"
FT   CDS_pept        22158..23189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0023"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69869"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466356.1"
FT                   /protein_id="ADB69869.1"
FT                   VSL"
FT   gene            23186..25363
FT                   /locus_tag="LM5923_0024"
FT   CDS_pept        23186..25363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0024"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69870"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466355.1"
FT                   /protein_id="ADB69870.1"
FT   gene            25360..26481
FT                   /locus_tag="LM5923_0025"
FT   CDS_pept        25360..26481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0025"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69871"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466354.1"
FT                   /protein_id="ADB69871.1"
FT   gene            26478..27140
FT                   /locus_tag="LM5923_0026"
FT   CDS_pept        26478..27140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69872"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466353.1"
FT                   /protein_id="ADB69872.1"
FT   gene            27263..27583
FT                   /locus_tag="LM5923_0027"
FT   CDS_pept        27263..27583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0027"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69873"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466352.1"
FT                   /protein_id="ADB69873.1"
FT                   AK"
FT   gene            complement(27639..28238)
FT                   /locus_tag="LM5923_0028"
FT   CDS_pept        complement(27639..28238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0028"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69874"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466351.1"
FT                   /protein_id="ADB69874.1"
FT   gene            28432..28785
FT                   /locus_tag="LM5923_0029"
FT   CDS_pept        28432..28785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0029"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69875"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466350.1"
FT                   /protein_id="ADB69875.1"
FT                   VIEFRDIIDVELL"
FT   gene            28888..29310
FT                   /locus_tag="LM5923_0030"
FT   CDS_pept        28888..29310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69876"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466349.1"
FT                   /protein_id="ADB69876.1"
FT   gene            29324..30472
FT                   /locus_tag="LM5923_0031"
FT   CDS_pept        29324..30472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0031"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69877"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466348.1"
FT                   /protein_id="ADB69877.1"
FT   gene            30843..31934
FT                   /gene="serC"
FT                   /locus_tag="LM5923_0032"
FT   CDS_pept        30843..31934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serC"
FT                   /locus_tag="LM5923_0032"
FT                   /product="phosphoserine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69878"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466347.1"
FT                   /protein_id="ADB69878.1"
FT   gene            31927..33114
FT                   /locus_tag="LM5923_0033"
FT   CDS_pept        31927..33114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0033"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69879"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466346.1"
FT                   /protein_id="ADB69879.1"
FT   gene            33203..34444
FT                   /locus_tag="LM5923_0034"
FT   CDS_pept        33203..34444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69880"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466345.1"
FT                   /protein_id="ADB69880.1"
FT                   KLLSGLFVHDLESK"
FT   gene            34453..34776
FT                   /locus_tag="LM5923_0035"
FT   CDS_pept        34453..34776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69881"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466344.1"
FT                   /protein_id="ADB69881.1"
FT                   EED"
FT   gene            complement(34821..37376)
FT                   /gene="inlJ"
FT                   /locus_tag="LM5923_0036"
FT   CDS_pept        complement(34821..37376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="inlJ"
FT                   /locus_tag="LM5923_0036"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69882"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466343.1"
FT                   /protein_id="ADB69882.1"
FT   gene            37589..39931
FT                   /locus_tag="LM5923_0037"
FT   CDS_pept        37589..39931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0037"
FT                   /product="amino-terminal domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69883"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466342.1"
FT                   /protein_id="ADB69883.1"
FT   gene            40142..41329
FT                   /locus_tag="LM5923_0038"
FT   CDS_pept        40142..41329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0038"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69884"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466341.1"
FT                   /protein_id="ADB69884.1"
FT   gene            41329..42729
FT                   /locus_tag="LM5923_0039"
FT   CDS_pept        41329..42729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0039"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69885"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466340.1"
FT                   /protein_id="ADB69885.1"
FT                   LELKAAKE"
FT   gene            42745..43935
FT                   /locus_tag="LM5923_0040"
FT   CDS_pept        42745..43935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69886"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466339.1"
FT                   /protein_id="ADB69886.1"
FT   gene            44023..45216
FT                   /locus_tag="LM5923_0041"
FT   CDS_pept        44023..45216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0041"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69887"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466338.1"
FT                   /protein_id="ADB69887.1"
FT   gene            complement(45263..45994)
FT                   /locus_tag="LM5923_0042"
FT   CDS_pept        complement(45263..45994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0042"
FT                   /product="3-ketoacyl-(acyl-carrier-protein) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69888"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466337.1"
FT                   /protein_id="ADB69888.1"
FT   gene            46155..46682
FT                   /locus_tag="LM5923_0043"
FT   CDS_pept        46155..46682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0043"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69889"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466336.1"
FT                   /protein_id="ADB69889.1"
FT                   VDLFEDVWQIVK"
FT   gene            46706..47416
FT                   /locus_tag="LM5923_0044"
FT   CDS_pept        46706..47416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0044"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69890"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466335.1"
FT                   /protein_id="ADB69890.1"
FT                   DVYMEKYLCALKNQ"
FT   gene            47436..47996
FT                   /locus_tag="LM5923_0045"
FT   CDS_pept        47436..47996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0045"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69891"
FT                   /protein_id="ADB69891.1"
FT   gene            complement(48044..48862)
FT                   /locus_tag="LM5923_0046"
FT   CDS_pept        complement(48044..48862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0046"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69892"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466334.1"
FT                   /protein_id="ADB69892.1"
FT   gene            49220..50593
FT                   /gene="trmE"
FT                   /locus_tag="LM5923_0047"
FT   CDS_pept        49220..50593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmE"
FT                   /locus_tag="LM5923_0047"
FT                   /product="tRNA modification GTPase TrmE"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69893"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466333.1"
FT                   /protein_id="ADB69893.1"
FT   gene            50618..52507
FT                   /gene="gidA"
FT                   /locus_tag="LM5923_0048"
FT   CDS_pept        50618..52507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidA"
FT                   /locus_tag="LM5923_0048"
FT                   /product="tRNA uridine 5-carboxymethylaminomethyl
FT                   modification enzyme GidA"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69894"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466332.1"
FT                   /protein_id="ADB69894.1"
FT   gene            52666..53046
FT                   /locus_tag="LM5923_0049"
FT   CDS_pept        52666..53046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0049"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69895"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466331.1"
FT                   /protein_id="ADB69895.1"
FT   gene            53071..53454
FT                   /locus_tag="LM5923_0050"
FT   CDS_pept        53071..53454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69896"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466330.1"
FT                   /protein_id="ADB69896.1"
FT   gene            53451..53834
FT                   /locus_tag="LM5923_0051"
FT   CDS_pept        53451..53834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0051"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69897"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466329.1"
FT                   /protein_id="ADB69897.1"
FT   gene            53971..54324
FT                   /locus_tag="LM5923_0052"
FT   CDS_pept        53971..54324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0052"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69898"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466328.1"
FT                   /protein_id="ADB69898.1"
FT                   ELTKQLGLLNGYK"
FT   gene            54437..54829
FT                   /locus_tag="LM5923_0053"
FT   CDS_pept        54437..54829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0053"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69899"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466327.1"
FT                   /protein_id="ADB69899.1"
FT   gene            54826..56109
FT                   /locus_tag="LM5923_0054"
FT   CDS_pept        54826..56109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0054"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69900"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466326.1"
FT                   /protein_id="ADB69900.1"
FT   gene            56102..56464
FT                   /locus_tag="LM5923_0055"
FT   CDS_pept        56102..56464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0055"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69901"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466325.1"
FT                   /protein_id="ADB69901.1"
FT                   VTAYEEELHQLKKERD"
FT   gene            56469..56735
FT                   /locus_tag="LM5923_0056"
FT   CDS_pept        56469..56735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0056"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69902"
FT                   /protein_id="ADB69902.1"
FT   gene            56888..57604
FT                   /gene="gidB"
FT                   /locus_tag="LM5923_0057"
FT   CDS_pept        56888..57604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidB"
FT                   /locus_tag="LM5923_0057"
FT                   /product="glucose-inhibited division protein B"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69903"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466324.1"
FT                   /protein_id="ADB69903.1"
FT                   NKYPRKPGTPNKLPIE"
FT   gene            57806..58519
FT                   /locus_tag="LM5923_0058"
FT   CDS_pept        57806..58519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0058"
FT                   /product="N-acetylmannosamine-6-phosphate 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69904"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466323.1"
FT                   /protein_id="ADB69904.1"
FT                   RFTNEIQKIQEERGK"
FT   gene            58521..59522
FT                   /locus_tag="LM5923_0059"
FT   CDS_pept        58521..59522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0059"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69905"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466322.1"
FT                   /protein_id="ADB69905.1"
FT   gene            59556..60962
FT                   /locus_tag="LM5923_0060"
FT   CDS_pept        59556..60962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69906"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466321.1"
FT                   /protein_id="ADB69906.1"
FT                   KIVADREQKN"
FT   gene            61025..61681
FT                   /locus_tag="LM5923_0061"
FT   CDS_pept        61025..61681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0061"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69907"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466320.1"
FT                   /protein_id="ADB69907.1"
FT   gene            61694..62140
FT                   /locus_tag="LM5923_0062"
FT   CDS_pept        61694..62140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0062"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69908"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466319.1"
FT                   /protein_id="ADB69908.1"
FT   gene            62165..63070
FT                   /locus_tag="LM5923_0063"
FT   CDS_pept        62165..63070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69909"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466318.1"
FT                   /protein_id="ADB69909.1"
FT   gene            63054..63860
FT                   /locus_tag="LM5923_0064"
FT   CDS_pept        63054..63860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0064"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69910"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466317.1"
FT                   /protein_id="ADB69910.1"
FT   gene            64032..64886
FT                   /locus_tag="LM5923_0065"
FT   CDS_pept        64032..64886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0065"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69911"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466316.1"
FT                   /protein_id="ADB69911.1"
FT                   KKK"
FT   gene            64898..65197
FT                   /locus_tag="LM5923_0066"
FT   CDS_pept        64898..65197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0066"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69912"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466315.1"
FT                   /protein_id="ADB69912.1"
FT   gene            65392..66114
FT                   /locus_tag="LM5923_0067"
FT   CDS_pept        65392..66114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0067"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69913"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466314.1"
FT                   /protein_id="ADB69913.1"
FT                   MYQKVCTVLGVKATFSVD"
FT   gene            66338..67099
FT                   /gene="parA"
FT                   /locus_tag="LM5923_0068"
FT   CDS_pept        66338..67099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parA"
FT                   /locus_tag="LM5923_0068"
FT                   /product="partition protein, ParA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69914"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466313.1"
FT                   /protein_id="ADB69914.1"
FT   gene            67092..67943
FT                   /gene="parB"
FT                   /locus_tag="LM5923_0069"
FT   CDS_pept        67092..67943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parB"
FT                   /locus_tag="LM5923_0069"
FT                   /product="partition protein ParB homolg"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69915"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466312.1"
FT                   /protein_id="ADB69915.1"
FT                   DE"
FT   gene            67956..68156
FT                   /locus_tag="LM5923_0070"
FT   CDS_pept        67956..68156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69916"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466311.1"
FT                   /protein_id="ADB69916.1"
FT   gene            68328..69158
FT                   /gene="bvrA"
FT                   /locus_tag="LM5923_0071"
FT   CDS_pept        68328..69158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bvrA"
FT                   /locus_tag="LM5923_0071"
FT                   /product="transcription antiterminator"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69917"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466310.1"
FT                   /protein_id="ADB69917.1"
FT   gene            69266..71188
FT                   /gene="bvrB"
FT                   /locus_tag="LM5923_0072"
FT   CDS_pept        69266..71188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bvrB"
FT                   /locus_tag="LM5923_0072"
FT                   /product="beta-glucoside-specific phosphotransferase enzyme
FT                   II ABC component"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69918"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466309.1"
FT                   /protein_id="ADB69918.1"
FT                   MEVSY"
FT   gene            71188..72171
FT                   /gene="bvrC"
FT                   /locus_tag="LM5923_0073"
FT   CDS_pept        71188..72171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bvrC"
FT                   /locus_tag="LM5923_0073"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69919"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466308.1"
FT                   /protein_id="ADB69919.1"
FT   gene            72319..73785
FT                   /gene="kat"
FT                   /locus_tag="LM5923_0074"
FT   CDS_pept        72319..73785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kat"
FT                   /locus_tag="LM5923_0074"
FT                   /product="catalase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69920"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466307.1"
FT                   /protein_id="ADB69920.1"
FT   gene            73996..75912
FT                   /locus_tag="LM5923_0075"
FT   CDS_pept        73996..75912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0075"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69921"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466306.1"
FT                   /protein_id="ADB69921.1"
FT                   QTL"
FT   gene            76062..77357
FT                   /locus_tag="LM5923_0076"
FT   CDS_pept        76062..77357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0076"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69922"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466305.1"
FT                   /protein_id="ADB69922.1"
FT   gene            77372..77671
FT                   /locus_tag="LM5923_0077"
FT   CDS_pept        77372..77671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0077"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69923"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466304.1"
FT                   /protein_id="ADB69923.1"
FT   gene            77705..79975
FT                   /locus_tag="LM5923_0078"
FT   CDS_pept        77705..79975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0078"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69924"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466303.1"
FT                   /protein_id="ADB69924.1"
FT                   IGG"
FT   gene            79981..80289
FT                   /locus_tag="LM5923_0079"
FT   CDS_pept        79981..80289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0079"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69925"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466302.1"
FT                   /protein_id="ADB69925.1"
FT   gene            80441..81541
FT                   /locus_tag="LM5923_0080"
FT   CDS_pept        80441..81541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0080"
FT                   /product="translation-associated GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69926"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466301.1"
FT                   /protein_id="ADB69926.1"
FT   gene            81819..82328
FT                   /locus_tag="LM5923_0081"
FT   CDS_pept        81819..82328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0081"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69927"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466300.1"
FT                   /protein_id="ADB69927.1"
FT                   MNEQLA"
FT   gene            complement(82460..83650)
FT                   /locus_tag="LM5923_0082"
FT   CDS_pept        complement(82460..83650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0082"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69928"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466299.1"
FT                   /protein_id="ADB69928.1"
FT   gene            84253..84351
FT                   /locus_tag="LM5923_0083"
FT   CDS_pept        84253..84351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0083"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69929"
FT                   /inference="ab initio prediction:Glimmer:3.02"
FT                   /protein_id="ADB69929.1"
FT                   /translation="MKKKVIFSETTTGKKTLLKADRIIYIEGGEIR"
FT   gene            84617..84724
FT                   /locus_tag="LM5923_0084"
FT   CDS_pept        84617..84724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0084"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69930"
FT                   /inference="ab initio prediction:Glimmer:3.02"
FT                   /protein_id="ADB69930.1"
FT   gene            84714..85553
FT                   /locus_tag="LM5923_0085"
FT   CDS_pept        84714..85553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0085"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69931"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466295.1"
FT                   /protein_id="ADB69931.1"
FT   gene            85650..87503
FT                   /locus_tag="LM5923_0086"
FT   CDS_pept        85650..87503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0086"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69932"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466294.1"
FT                   /protein_id="ADB69932.1"
FT   gene            87496..88944
FT                   /locus_tag="LM5923_0087"
FT   CDS_pept        87496..88944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0087"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69933"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466293.1"
FT                   /protein_id="ADB69933.1"
FT   gene            complement(88983..91313)
FT                   /locus_tag="LM5923_0088"
FT   CDS_pept        complement(88983..91313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0088"
FT                   /product="bifunctional glutamate--cysteine
FT                   ligase/glutathione synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69934"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466292.1"
FT                   /protein_id="ADB69934.1"
FT   gene            91483..92370
FT                   /locus_tag="LM5923_0089"
FT   CDS_pept        91483..92370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0089"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69935"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466291.1"
FT                   /protein_id="ADB69935.1"
FT                   TVHLANDKIDYYEI"
FT   gene            92397..93527
FT                   /locus_tag="LM5923_0090"
FT   CDS_pept        92397..93527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69936"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466290.1"
FT                   /protein_id="ADB69936.1"
FT   gene            93598..94260
FT                   /locus_tag="LM5923_0091"
FT   CDS_pept        93598..94260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0091"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69937"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466289.1"
FT                   /protein_id="ADB69937.1"
FT   gene            94360..95094
FT                   /locus_tag="LM5923_0092"
FT   CDS_pept        94360..95094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0092"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69938"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466288.1"
FT                   /protein_id="ADB69938.1"
FT   gene            complement(95134..95442)
FT                   /locus_tag="LM5923_0093"
FT   CDS_pept        complement(95134..95442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0093"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69939"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466287.1"
FT                   /protein_id="ADB69939.1"
FT   gene            complement(95435..96319)
FT                   /locus_tag="LM5923_0094"
FT   CDS_pept        complement(95435..96319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0094"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69940"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466286.1"
FT                   /protein_id="ADB69940.1"
FT                   AVYHFLQEENRHE"
FT   gene            complement(96331..97683)
FT                   /locus_tag="LM5923_0095"
FT   CDS_pept        complement(96331..97683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0095"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69941"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466285.1"
FT                   /protein_id="ADB69941.1"
FT   gene            complement(97716..98018)
FT                   /locus_tag="LM5923_0096"
FT   CDS_pept        complement(97716..98018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0096"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69942"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466284.1"
FT                   /protein_id="ADB69942.1"
FT   gene            complement(98065..99519)
FT                   /locus_tag="LM5923_0097"
FT   CDS_pept        complement(98065..99519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0097"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69943"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466283.1"
FT                   /protein_id="ADB69943.1"
FT   gene            100034..101644
FT                   /locus_tag="LM5923_0098"
FT   CDS_pept        100034..101644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0098"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69944"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466282.1"
FT                   /protein_id="ADB69944.1"
FT   gene            101702..102232
FT                   /locus_tag="LM5923_0099"
FT   CDS_pept        101702..102232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0099"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69945"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466281.1"
FT                   /protein_id="ADB69945.1"
FT                   LKLYNKLINSEVV"
FT   gene            complement(102243..102335)
FT                   /locus_tag="LM5923_0100"
FT   CDS_pept        complement(102243..102335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69946"
FT                   /inference="ab initio prediction:Glimmer:3.02"
FT                   /protein_id="ADB69946.1"
FT                   /translation="MELCQEGFPLLFYSENIVKNVSRETFEKAA"
FT   gene            102520..103986
FT                   /gene="guaB"
FT                   /locus_tag="LM5923_0101"
FT   CDS_pept        102520..103986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaB"
FT                   /locus_tag="LM5923_0101"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69947"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466280.1"
FT                   /protein_id="ADB69947.1"
FT   gene            104147..105919
FT                   /locus_tag="LM5923_0102"
FT   CDS_pept        104147..105919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0102"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69948"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466279.1"
FT                   /protein_id="ADB69948.1"
FT                   GAEFLAVLQQEASK"
FT   gene            105943..108096
FT                   /gene="topB"
FT                   /locus_tag="LM5923_0103"
FT   CDS_pept        105943..108096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="topB"
FT                   /locus_tag="LM5923_0103"
FT                   /product="DNA topoisomerase III"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69949"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466278.1"
FT                   /protein_id="ADB69949.1"
FT   gene            108205..109872
FT                   /locus_tag="LM5923_0104"
FT   CDS_pept        108205..109872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0104"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69950"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466277.1"
FT                   /protein_id="ADB69950.1"
FT   gene            110051..111388
FT                   /locus_tag="LM5923_0105"
FT   CDS_pept        110051..111388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0105"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69951"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466276.1"
FT                   /protein_id="ADB69951.1"
FT   gene            complement(111407..111646)
FT                   /locus_tag="LM5923_0106"
FT   CDS_pept        complement(111407..111646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0106"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69952"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466275.1"
FT                   /protein_id="ADB69952.1"
FT   gene            complement(111922..113694)
FT                   /locus_tag="LM5923_0107"
FT   CDS_pept        complement(111922..113694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0107"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69953"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466274.1"
FT                   /protein_id="ADB69953.1"
FT                   GFYSELYHNQFVIE"
FT   gene            complement(113694..115415)
FT                   /locus_tag="LM5923_0108"
FT   CDS_pept        complement(113694..115415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0108"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69954"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466273.1"
FT                   /protein_id="ADB69954.1"
FT   gene            complement(115576..117282)
FT                   /locus_tag="LM5923_0109"
FT   CDS_pept        complement(115576..117282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0109"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69955"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466272.1"
FT                   /protein_id="ADB69955.1"
FT   gene            complement(117279..117851)
FT                   /locus_tag="LM5923_0110"
FT   CDS_pept        complement(117279..117851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69956"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466271.1"
FT                   /protein_id="ADB69956.1"
FT   gene            117981..118400
FT                   /locus_tag="LM5923_0111"
FT   CDS_pept        117981..118400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0111"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69957"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466270.1"
FT                   /protein_id="ADB69957.1"
FT   gene            118708..120018
FT                   /gene="serS"
FT                   /locus_tag="LM5923_0112"
FT   CDS_pept        118708..120018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="LM5923_0112"
FT                   /product="seryl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69958"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466269.1"
FT                   /protein_id="ADB69958.1"
FT   gene            120038..120289
FT                   /locus_tag="LM5923_0113"
FT   CDS_pept        120038..120289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0113"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69959"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466268.1"
FT                   /protein_id="ADB69959.1"
FT   gene            complement(120343..122070)
FT                   /locus_tag="LM5923_0114"
FT   CDS_pept        complement(120343..122070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0114"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69960"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466267.1"
FT                   /protein_id="ADB69960.1"
FT   gene            122400..123089
FT                   /locus_tag="LM5923_0115"
FT   CDS_pept        122400..123089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0115"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69961"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466266.1"
FT                   /protein_id="ADB69961.1"
FT                   VMDKTRL"
FT   gene            123232..123876
FT                   /locus_tag="LM5923_0116"
FT   CDS_pept        123232..123876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0116"
FT                   /product="putative translaldolase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69962"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466265.1"
FT                   /protein_id="ADB69962.1"
FT   gene            123895..124242
FT                   /locus_tag="LM5923_0117"
FT   CDS_pept        123895..124242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0117"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69963"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466264.1"
FT                   /protein_id="ADB69963.1"
FT                   AGWVPRENLEV"
FT   gene            124359..125567
FT                   /locus_tag="LM5923_0118"
FT   CDS_pept        124359..125567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0118"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69964"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466263.1"
FT                   /protein_id="ADB69964.1"
FT                   HAN"
FT   gene            125557..125847
FT                   /locus_tag="LM5923_0119"
FT   CDS_pept        125557..125847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0119"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69965"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466262.1"
FT                   /protein_id="ADB69965.1"
FT   gene            125840..126529
FT                   /locus_tag="LM5923_0120"
FT   CDS_pept        125840..126529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0120"
FT                   /product="NAD-dependent deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69966"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466261.1"
FT                   /protein_id="ADB69966.1"
FT                   VKVFAEI"
FT   gene            126647..127981
FT                   /locus_tag="LM5923_0121"
FT   CDS_pept        126647..127981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0121"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69967"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466260.1"
FT                   /protein_id="ADB69967.1"
FT   gene            128049..129005
FT                   /locus_tag="LM5923_0122"
FT   CDS_pept        128049..129005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0122"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69968"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466259.1"
FT                   /protein_id="ADB69968.1"
FT   gene            complement(129009..130142)
FT                   /locus_tag="LM5923_0123"
FT   CDS_pept        complement(129009..130142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0123"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69969"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466258.1"
FT                   /protein_id="ADB69969.1"
FT   gene            complement(130139..131821)
FT                   /locus_tag="LM5923_0124"
FT   CDS_pept        complement(130139..131821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0124"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69970"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466257.1"
FT                   /protein_id="ADB69970.1"
FT   gene            complement(131823..134471)
FT                   /locus_tag="LM5923_0125"
FT   CDS_pept        complement(131823..134471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0125"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69971"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466256.1"
FT                   /protein_id="ADB69971.1"
FT                   KGFATILLEGE"
FT   gene            complement(134532..136490)
FT                   /locus_tag="LM5923_0126"
FT   CDS_pept        complement(134532..136490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0126"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69972"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466255.1"
FT                   /protein_id="ADB69972.1"
FT                   NIFVRYGLITRKENKIK"
FT   gene            136656..137408
FT                   /locus_tag="LM5923_0127"
FT   CDS_pept        136656..137408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0127"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69973"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466254.1"
FT                   /protein_id="ADB69973.1"
FT   gene            137492..137860
FT                   /locus_tag="LM5923_0128"
FT   CDS_pept        137492..137860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0128"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69974"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466253.1"
FT                   /protein_id="ADB69974.1"
FT                   NKKKARYTTHHYHNFAKS"
FT   gene            137874..138485
FT                   /locus_tag="LM5923_0129"
FT   CDS_pept        137874..138485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0129"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69975"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466252.1"
FT                   /protein_id="ADB69975.1"
FT   gene            complement(138528..138932)
FT                   /locus_tag="LM5923_0130"
FT   CDS_pept        complement(138528..138932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69976"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466251.1"
FT                   /protein_id="ADB69976.1"
FT   gene            complement(138932..139315)
FT                   /locus_tag="LM5923_0131"
FT   CDS_pept        complement(138932..139315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0131"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69977"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466250.1"
FT                   /protein_id="ADB69977.1"
FT   gene            complement(139272..139388)
FT                   /locus_tag="LM5923_0132"
FT   CDS_pept        complement(139272..139388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0132"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69978"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466250.1"
FT                   /protein_id="ADB69978.1"
FT   gene            complement(139473..140354)
FT                   /locus_tag="LM5923_0133"
FT   CDS_pept        complement(139473..140354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0133"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69979"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466249.1"
FT                   /protein_id="ADB69979.1"
FT                   LSTLQTNNSNHE"
FT   gene            140524..140973
FT                   /locus_tag="LM5923_0134"
FT   CDS_pept        140524..140973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0134"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69980"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466248.1"
FT                   /protein_id="ADB69980.1"
FT   gene            140970..142322
FT                   /locus_tag="LM5923_0135"
FT   CDS_pept        140970..142322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69981"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466247.1"
FT                   /protein_id="ADB69981.1"
FT   gene            142380..142823
FT                   /locus_tag="LM5923_0136"
FT   CDS_pept        142380..142823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0136"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69982"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466246.1"
FT                   /protein_id="ADB69982.1"
FT   gene            complement(142844..143305)
FT                   /locus_tag="LM5923_0137"
FT   CDS_pept        complement(142844..143305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0137"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69983"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466245.1"
FT                   /protein_id="ADB69983.1"
FT   gene            complement(143359..144093)
FT                   /locus_tag="LM5923_0138"
FT   CDS_pept        complement(143359..144093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0138"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69984"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466244.1"
FT                   /protein_id="ADB69984.1"
FT   gene            144173..144892
FT                   /locus_tag="LM5923_0139"
FT   CDS_pept        144173..144892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0139"
FT                   /product="putative 6-phosphogluconolactonase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69985"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466243.1"
FT                   /protein_id="ADB69985.1"
FT                   PNFTVVLDEEAASELNM"
FT   gene            complement(144934..146511)
FT                   /locus_tag="LM5923_0140"
FT   CDS_pept        complement(144934..146511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69986"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466242.1"
FT                   /protein_id="ADB69986.1"
FT                   AEFASVHG"
FT   gene            146706..147176
FT                   /locus_tag="LM5923_0141"
FT   CDS_pept        146706..147176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0141"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69987"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466241.1"
FT                   /protein_id="ADB69987.1"
FT   gene            147558..148964
FT                   /gene="cydA"
FT                   /locus_tag="LM5923_0142"
FT   CDS_pept        147558..148964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydA"
FT                   /locus_tag="LM5923_0142"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69988"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466240.1"
FT                   /protein_id="ADB69988.1"
FT                   DKGDESFVTK"
FT   gene            148951..149964
FT                   /gene="cydB"
FT                   /locus_tag="LM5923_0143"
FT   CDS_pept        148951..149964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydB"
FT                   /locus_tag="LM5923_0143"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69989"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466239.1"
FT                   /protein_id="ADB69989.1"
FT   gene            150006..151688
FT                   /gene="cydC"
FT                   /locus_tag="LM5923_0144"
FT   CDS_pept        150006..151688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydC"
FT                   /locus_tag="LM5923_0144"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69990"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466238.1"
FT                   /protein_id="ADB69990.1"
FT   gene            151685..153427
FT                   /gene="cydD"
FT                   /locus_tag="LM5923_0145"
FT   CDS_pept        151685..153427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydD"
FT                   /locus_tag="LM5923_0145"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69991"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466237.1"
FT                   /protein_id="ADB69991.1"
FT                   PIEL"
FT   gene            153568..154515
FT                   /locus_tag="LM5923_0146"
FT   CDS_pept        153568..154515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0146"
FT                   /product="pepdidoglycan bound protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69992"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466236.1"
FT                   /protein_id="ADB69992.1"
FT   gene            154558..155496
FT                   /locus_tag="LM5923_0147"
FT   CDS_pept        154558..155496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0147"
FT                   /product="GW repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69993"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466235.1"
FT                   /protein_id="ADB69993.1"
FT   gene            155612..157126
FT                   /locus_tag="LM5923_0148"
FT   CDS_pept        155612..157126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0148"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69994"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466234.1"
FT                   /protein_id="ADB69994.1"
FT   gene            157184..157279
FT                   /locus_tag="LM5923_0149"
FT   CDS_pept        157184..157279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0149"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69995"
FT                   /inference="ab initio prediction:Glimmer:3.02"
FT                   /protein_id="ADB69995.1"
FT                   /translation="MNKKIVWIALTLVGICVVGTIIAAIMSVYLR"
FT   gene            157824..158465
FT                   /locus_tag="LM5923_0150"
FT   CDS_pept        157824..158465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69996"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466232.1"
FT                   /protein_id="ADB69996.1"
FT   gene            complement(159037..159192)
FT                   /locus_tag="LM5923_0151"
FT   CDS_pept        complement(159037..159192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0151"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69997"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466231.1"
FT                   /protein_id="ADB69997.1"
FT                   KKTDDN"
FT   gene            159635..160999
FT                   /locus_tag="LM5923_0152"
FT   CDS_pept        159635..160999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0152"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69998"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466230.1"
FT                   /protein_id="ADB69998.1"
FT   gene            161134..161355
FT                   /locus_tag="LM5923_0153"
FT   CDS_pept        161134..161355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0153"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADB69999"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466229.1"
FT                   /protein_id="ADB69999.1"
FT   gene            161358..161540
FT                   /locus_tag="LM5923_0154"
FT   CDS_pept        161358..161540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0154"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70000"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466228.1"
FT                   /protein_id="ADB70000.1"
FT                   VFIVLKIRKDKKEKN"
FT   gene            161558..162022
FT                   /locus_tag="LM5923_0155"
FT   CDS_pept        161558..162022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70001"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466227.1"
FT                   /protein_id="ADB70001.1"
FT   gene            162313..164052
FT                   /gene="dnaX"
FT                   /locus_tag="LM5923_0156"
FT   CDS_pept        162313..164052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="LM5923_0156"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70002"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466226.1"
FT                   /protein_id="ADB70002.1"
FT                   IKD"
FT   gene            164082..164399
FT                   /locus_tag="LM5923_0157"
FT   CDS_pept        164082..164399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0157"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70003"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466225.1"
FT                   /protein_id="ADB70003.1"
FT                   M"
FT   gene            164508..165104
FT                   /gene="recR"
FT                   /locus_tag="LM5923_0158"
FT   CDS_pept        164508..165104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="LM5923_0158"
FT                   /product="recombination protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70004"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466224.1"
FT                   /protein_id="ADB70004.1"
FT   gene            165119..165364
FT                   /locus_tag="LM5923_0159"
FT   CDS_pept        165119..165364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0159"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70005"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466223.1"
FT                   /protein_id="ADB70005.1"
FT   gene            complement(165410..166252)
FT                   /locus_tag="LM5923_0160"
FT   CDS_pept        complement(165410..166252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70006"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466222.1"
FT                   /protein_id="ADB70006.1"
FT   gene            complement(166373..167212)
FT                   /locus_tag="LM5923_0161"
FT   CDS_pept        complement(166373..167212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0161"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70007"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466221.1"
FT                   /protein_id="ADB70007.1"
FT   gene            complement(167331..168182)
FT                   /locus_tag="LM5923_0162"
FT   CDS_pept        complement(167331..168182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0162"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70008"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466220.1"
FT                   /protein_id="ADB70008.1"
FT                   LE"
FT   gene            complement(168288..168662)
FT                   /locus_tag="LM5923_0163"
FT   CDS_pept        complement(168288..168662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0163"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70009"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466219.1"
FT                   /protein_id="ADB70009.1"
FT   gene            complement(168666..169262)
FT                   /locus_tag="LM5923_0164"
FT   CDS_pept        complement(168666..169262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0164"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70010"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466218.1"
FT                   /protein_id="ADB70010.1"
FT   gene            complement(169284..170273)
FT                   /locus_tag="LM5923_0165"
FT   CDS_pept        complement(169284..170273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70011"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466217.1"
FT                   /protein_id="ADB70011.1"
FT   gene            170457..171836
FT                   /locus_tag="LM5923_0166"
FT   CDS_pept        170457..171836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0166"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70012"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466216.1"
FT                   /protein_id="ADB70012.1"
FT                   R"
FT   gene            171889..172515
FT                   /locus_tag="LM5923_0167"
FT   CDS_pept        171889..172515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0167"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70013"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466215.1"
FT                   /protein_id="ADB70013.1"
FT   gene            172623..172952
FT                   /locus_tag="LM5923_0168"
FT   CDS_pept        172623..172952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0168"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70014"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466214.1"
FT                   /protein_id="ADB70014.1"
FT                   SFHHF"
FT   gene            complement(173189..174961)
FT                   /locus_tag="LM5923_0169"
FT   CDS_pept        complement(173189..174961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0169"
FT                   /product="autolysin"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70015"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466213.1"
FT                   /protein_id="ADB70015.1"
FT                   TSNMIHVGQKLTIK"
FT   gene            175123..175689
FT                   /locus_tag="LM5923_0170"
FT   CDS_pept        175123..175689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70016"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466212.1"
FT                   /protein_id="ADB70016.1"
FT   gene            176244..178814
FT                   /locus_tag="LM5923_0171"
FT   CDS_pept        176244..178814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0171"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70017"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466211.1"
FT                   /protein_id="ADB70017.1"
FT   gene            178815..179945
FT                   /locus_tag="LM5923_0172"
FT   CDS_pept        178815..179945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0172"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70018"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466210.1"
FT                   /protein_id="ADB70018.1"
FT   gene            179942..181051
FT                   /locus_tag="LM5923_0173"
FT   CDS_pept        179942..181051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0173"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70019"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466209.1"
FT                   /protein_id="ADB70019.1"
FT   gene            181216..181749
FT                   /locus_tag="LM5923_0174"
FT   CDS_pept        181216..181749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0174"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70020"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466208.1"
FT                   /protein_id="ADB70020.1"
FT                   KASVSGKKLTTSFK"
FT   gene            complement(182204..182506)
FT                   /locus_tag="LM5923_0175"
FT   CDS_pept        complement(182204..182506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70021"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466207.1"
FT                   /protein_id="ADB70021.1"
FT   gene            complement(182543..183850)
FT                   /locus_tag="LM5923_0176"
FT   CDS_pept        complement(182543..183850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0176"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70022"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466206.1"
FT                   /protein_id="ADB70022.1"
FT   gene            complement(183986..184291)
FT                   /locus_tag="LM5923_0177"
FT   CDS_pept        complement(183986..184291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0177"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70023"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466205.1"
FT                   /protein_id="ADB70023.1"
FT   gene            184632..186317
FT                   /gene="kdpA"
FT                   /locus_tag="LM5923_0178"
FT   CDS_pept        184632..186317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpA"
FT                   /locus_tag="LM5923_0178"
FT                   /product="potassium-transporting ATPase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70024"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466204.1"
FT                   /protein_id="ADB70024.1"
FT   gene            186329..188374
FT                   /gene="kdpB"
FT                   /locus_tag="LM5923_0179"
FT   CDS_pept        186329..188374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpB"
FT                   /locus_tag="LM5923_0179"
FT                   /product="potassium-transporting ATPase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70025"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466203.1"
FT                   /protein_id="ADB70025.1"
FT   gene            188389..188961
FT                   /gene="kdpC"
FT                   /locus_tag="LM5923_0180"
FT   CDS_pept        188389..188961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpC"
FT                   /locus_tag="LM5923_0180"
FT                   /product="potassium-transporting atpase c chain"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70026"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466202.1"
FT                   /protein_id="ADB70026.1"
FT   gene            188977..191667
FT                   /locus_tag="LM5923_0181"
FT   CDS_pept        188977..191667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0181"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70027"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466201.1"
FT                   /protein_id="ADB70027.1"
FT   gene            191664..192359
FT                   /locus_tag="LM5923_0182"
FT   CDS_pept        191664..192359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0182"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70028"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466200.1"
FT                   /protein_id="ADB70028.1"
FT                   GVGYRMAEE"
FT   gene            192400..193212
FT                   /locus_tag="LM5923_0183"
FT   CDS_pept        192400..193212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0183"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70029"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466199.1"
FT                   /protein_id="ADB70029.1"
FT   gene            complement(193214..194470)
FT                   /locus_tag="LM5923_0184"
FT   CDS_pept        complement(193214..194470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0184"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70030"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466198.1"
FT                   /protein_id="ADB70030.1"
FT   gene            complement(194483..194824)
FT                   /locus_tag="LM5923_0185"
FT   CDS_pept        complement(194483..194824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0185"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70031"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466197.1"
FT                   /protein_id="ADB70031.1"
FT                   ERSVEKWYK"
FT   gene            complement(195019..195516)
FT                   /locus_tag="LM5923_0186"
FT   CDS_pept        complement(195019..195516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0186"
FT                   /product="ribose-5-phosphate isomerase B"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70032"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466196.1"
FT                   /protein_id="ADB70032.1"
FT                   HA"
FT   gene            complement(195520..195990)
FT                   /locus_tag="LM5923_0187"
FT   CDS_pept        complement(195520..195990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0187"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70033"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466195.1"
FT                   /protein_id="ADB70033.1"
FT   gene            196106..196912
FT                   /locus_tag="LM5923_0188"
FT   CDS_pept        196106..196912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0188"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70034"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466194.1"
FT                   /protein_id="ADB70034.1"
FT   gene            196958..197326
FT                   /locus_tag="LM5923_0189"
FT   CDS_pept        196958..197326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0189"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70035"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466193.1"
FT                   /protein_id="ADB70035.1"
FT                   LNLLDPDGNKIMILEPAQ"
FT   gene            197323..197685
FT                   /locus_tag="LM5923_0190"
FT   CDS_pept        197323..197685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70036"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466192.1"
FT                   /protein_id="ADB70036.1"
FT                   EAKNKLPKYKQAELFD"
FT   gene            197759..198571
FT                   /locus_tag="LM5923_0191"
FT   CDS_pept        197759..198571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0191"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70037"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466191.1"
FT                   /protein_id="ADB70037.1"
FT   gene            198940..201009
FT                   /locus_tag="LM5923_0192"
FT   CDS_pept        198940..201009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0192"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70038"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466190.1"
FT                   /protein_id="ADB70038.1"
FT   gene            201043..201507
FT                   /locus_tag="LM5923_0193"
FT   CDS_pept        201043..201507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0193"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70039"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466189.1"
FT                   /protein_id="ADB70039.1"
FT   gene            201565..201846
FT                   /locus_tag="LM5923_0194"
FT   CDS_pept        201565..201846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0194"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70040"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466188.1"
FT                   /protein_id="ADB70040.1"
FT   gene            201908..203179
FT                   /locus_tag="LM5923_0195"
FT   CDS_pept        201908..203179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70041"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466187.1"
FT                   /protein_id="ADB70041.1"
FT   gene            203216..204268
FT                   /locus_tag="LM5923_0196"
FT   CDS_pept        203216..204268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0196"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70042"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466186.1"
FT                   /protein_id="ADB70042.1"
FT                   VMILPQKGDD"
FT   gene            204270..205301
FT                   /locus_tag="LM5923_0197"
FT   CDS_pept        204270..205301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0197"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70043"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466185.1"
FT                   /protein_id="ADB70043.1"
FT                   VKS"
FT   gene            205496..205936
FT                   /locus_tag="LM5923_0198"
FT   CDS_pept        205496..205936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0198"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70044"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466184.1"
FT                   /protein_id="ADB70044.1"
FT   gene            205945..206619
FT                   /locus_tag="LM5923_0199"
FT   CDS_pept        205945..206619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0199"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70045"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466183.1"
FT                   /protein_id="ADB70045.1"
FT                   HV"
FT   gene            206653..208668
FT                   /locus_tag="LM5923_0200"
FT   CDS_pept        206653..208668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70046"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466182.1"
FT                   /protein_id="ADB70046.1"
FT   gene            208665..209309
FT                   /locus_tag="LM5923_0201"
FT   CDS_pept        208665..209309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0201"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70047"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466181.1"
FT                   /protein_id="ADB70047.1"
FT   gene            209443..209922
FT                   /locus_tag="LM5923_0202"
FT   CDS_pept        209443..209922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0202"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70048"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466180.1"
FT                   /protein_id="ADB70048.1"
FT   gene            209937..211334
FT                   /locus_tag="LM5923_0203"
FT   CDS_pept        209937..211334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0203"
FT                   /product="deoxyguanosinetriphosphate
FT                   triphosphohydrolase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70049"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466179.1"
FT                   /protein_id="ADB70049.1"
FT                   QRLNGLS"
FT   gene            211527..211940
FT                   /gene="rpsL"
FT                   /locus_tag="LM5923_0204"
FT   CDS_pept        211527..211940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="LM5923_0204"
FT                   /product="30S ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70050"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466178.1"
FT                   /protein_id="ADB70050.1"
FT   gene            211971..212441
FT                   /gene="rpsG"
FT                   /locus_tag="LM5923_0205"
FT   CDS_pept        211971..212441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="LM5923_0205"
FT                   /product="30S ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70051"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466177.1"
FT                   /protein_id="ADB70051.1"
FT   gene            212507..214594
FT                   /gene="fus"
FT                   /locus_tag="LM5923_0206"
FT   CDS_pept        212507..214594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fus"
FT                   /locus_tag="LM5923_0206"
FT                   /product="elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70052"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466176.1"
FT                   /protein_id="ADB70052.1"
FT                   D"
FT   gene            214703..215890
FT                   /gene="tuf"
FT                   /locus_tag="LM5923_0207"
FT   CDS_pept        214703..215890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tuf"
FT                   /locus_tag="LM5923_0207"
FT                   /product="elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70053"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466175.1"
FT                   /protein_id="ADB70053.1"
FT   gene            216045..218111
FT                   /locus_tag="LM5923_0208"
FT   CDS_pept        216045..218111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0208"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70054"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466174.1"
FT                   /protein_id="ADB70054.1"
FT   gene            218305..218739
FT                   /locus_tag="LM5923_0209"
FT   CDS_pept        218305..218739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0209"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70055"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466173.1"
FT                   /protein_id="ADB70055.1"
FT   gene            218742..219014
FT                   /locus_tag="LM5923_0210"
FT   CDS_pept        218742..219014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70056"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466172.1"
FT                   /protein_id="ADB70056.1"
FT   gene            219041..220339
FT                   /gene="ulaA"
FT                   /locus_tag="LM5923_0211"
FT   CDS_pept        219041..220339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ulaA"
FT                   /locus_tag="LM5923_0211"
FT                   /product="ascorbate-specific PTS system enzyme IIC"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70057"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466171.1"
FT                   /protein_id="ADB70057.1"
FT   gene            220409..221401
FT                   /locus_tag="LM5923_0212"
FT   CDS_pept        220409..221401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0212"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70058"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466170.1"
FT                   /protein_id="ADB70058.1"
FT   gene            221414..222163
FT                   /locus_tag="LM5923_0213"
FT   CDS_pept        221414..222163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0213"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70059"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466169.1"
FT                   /protein_id="ADB70059.1"
FT   gene            222123..222842
FT                   /locus_tag="LM5923_0214"
FT   CDS_pept        222123..222842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0214"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70060"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466168.1"
FT                   /protein_id="ADB70060.1"
FT                   RTKPEEIEKIFAALEGN"
FT   gene            222843..223586
FT                   /locus_tag="LM5923_0215"
FT   CDS_pept        222843..223586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0215"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70061"
FT                   /protein_id="ADB70061.1"
FT   gene            223665..224477
FT                   /locus_tag="LM5923_0216"
FT   CDS_pept        223665..224477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0216"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70062"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466167.1"
FT                   /protein_id="ADB70062.1"
FT   gene            224505..225491
FT                   /locus_tag="LM5923_0217"
FT   CDS_pept        224505..225491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0217"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70063"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466166.1"
FT                   /protein_id="ADB70063.1"
FT   gene            complement(225536..226867)
FT                   /locus_tag="LM5923_0218"
FT   CDS_pept        complement(225536..226867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0218"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70064"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466165.1"
FT                   /protein_id="ADB70064.1"
FT   gene            complement(226957..227937)
FT                   /locus_tag="LM5923_0219"
FT   CDS_pept        complement(226957..227937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0219"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70065"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466164.1"
FT                   /protein_id="ADB70065.1"
FT   gene            complement(227959..228501)
FT                   /locus_tag="LM5923_0220"
FT   CDS_pept        complement(227959..228501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70066"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466163.1"
FT                   /protein_id="ADB70066.1"
FT                   QTLRMFADAKQSQAAQK"
FT   gene            complement(228534..228968)
FT                   /locus_tag="LM5923_0221"
FT   CDS_pept        complement(228534..228968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0221"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70067"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466162.1"
FT                   /protein_id="ADB70067.1"
FT   gene            complement(229144..231030)
FT                   /locus_tag="LM5923_0222"
FT   CDS_pept        complement(229144..231030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0222"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70068"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466161.1"
FT                   /protein_id="ADB70068.1"
FT   gene            231478..232377
FT                   /locus_tag="LM5923_0223"
FT   CDS_pept        231478..232377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0223"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70069"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466160.1"
FT                   /protein_id="ADB70069.1"
FT                   AQNGNTDTIKVYNLVEAE"
FT   gene            232541..233623
FT                   /locus_tag="LM5923_0224"
FT   CDS_pept        232541..233623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0224"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70070"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466159.1"
FT                   /protein_id="ADB70070.1"
FT   gene            233705..234664
FT                   /locus_tag="LM5923_0225"
FT   CDS_pept        233705..234664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0225"
FT                   /product="1,4-dihydroxy-2-naphthoate octaprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70071"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466158.1"
FT                   /protein_id="ADB70071.1"
FT   gene            234684..235484
FT                   /locus_tag="LM5923_0226"
FT   CDS_pept        234684..235484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0226"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70072"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466157.1"
FT                   /protein_id="ADB70072.1"
FT   gene            235845..236153
FT                   /gene="rpsJ"
FT                   /locus_tag="LM5923_0227"
FT   CDS_pept        235845..236153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="LM5923_0227"
FT                   /product="30S ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70073"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466156.1"
FT                   /protein_id="ADB70073.1"
FT   gene            236188..236817
FT                   /gene="rplC"
FT                   /locus_tag="LM5923_0228"
FT   CDS_pept        236188..236817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="LM5923_0228"
FT                   /product="50S ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70074"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466155.1"
FT                   /protein_id="ADB70074.1"
FT   gene            236843..237466
FT                   /gene="rplD"
FT                   /locus_tag="LM5923_0229"
FT   CDS_pept        236843..237466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="LM5923_0229"
FT                   /product="50S ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70075"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466154.1"
FT                   /protein_id="ADB70075.1"
FT   gene            237466..237750
FT                   /gene="rplW"
FT                   /locus_tag="LM5923_0230"
FT   CDS_pept        237466..237750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="LM5923_0230"
FT                   /product="50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70076"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466153.1"
FT                   /protein_id="ADB70076.1"
FT   gene            237791..238624
FT                   /gene="rplB"
FT                   /locus_tag="LM5923_0231"
FT   CDS_pept        237791..238624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="LM5923_0231"
FT                   /product="50S ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70077"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466152.1"
FT                   /protein_id="ADB70077.1"
FT   gene            238670..238990
FT                   /gene="rpsS"
FT                   /locus_tag="LM5923_0232"
FT   CDS_pept        238670..238990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="LM5923_0232"
FT                   /product="30S ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70078"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466151.1"
FT                   /protein_id="ADB70078.1"
FT                   KR"
FT   gene            239011..239367
FT                   /gene="rplV"
FT                   /locus_tag="LM5923_0233"
FT   CDS_pept        239011..239367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="LM5923_0233"
FT                   /product="50S ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70079"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466150.1"
FT                   /protein_id="ADB70079.1"
FT                   TSHITVVVSEVKEG"
FT   gene            239371..240027
FT                   /gene="rpsC"
FT                   /locus_tag="LM5923_0234"
FT   CDS_pept        239371..240027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="LM5923_0234"
FT                   /product="30S ribosomal protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70080"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466149.1"
FT                   /protein_id="ADB70080.1"
FT   gene            240030..240464
FT                   /gene="rplP"
FT                   /locus_tag="LM5923_0235"
FT   CDS_pept        240030..240464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="LM5923_0235"
FT                   /product="50S ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70081"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466148.1"
FT                   /protein_id="ADB70081.1"
FT   gene            240454..240645
FT                   /gene="rpmC"
FT                   /locus_tag="LM5923_0236"
FT   CDS_pept        240454..240645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="LM5923_0236"
FT                   /product="50S ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70082"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466147.1"
FT                   /protein_id="ADB70082.1"
FT                   VRKAIARMKTIVRERELA"
FT   gene            240673..240936
FT                   /gene="rpsQ"
FT                   /locus_tag="LM5923_0237"
FT   CDS_pept        240673..240936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="LM5923_0237"
FT                   /product="30S ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70083"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466146.1"
FT                   /protein_id="ADB70083.1"
FT   gene            241016..241384
FT                   /gene="rplN"
FT                   /locus_tag="LM5923_0238"
FT   CDS_pept        241016..241384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="LM5923_0238"
FT                   /product="50S ribosomal protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70084"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466145.1"
FT                   /protein_id="ADB70084.1"
FT                   ELRENNFMKIVSLAPEVL"
FT   gene            241422..241733
FT                   /gene="rplX"
FT                   /locus_tag="LM5923_0239"
FT   CDS_pept        241422..241733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="LM5923_0239"
FT                   /product="50S ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70085"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466144.1"
FT                   /protein_id="ADB70085.1"
FT   gene            241760..242299
FT                   /gene="rplE"
FT                   /locus_tag="LM5923_0240"
FT   CDS_pept        241760..242299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="LM5923_0240"
FT                   /product="50S ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70086"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466143.1"
FT                   /protein_id="ADB70086.1"
FT                   EESHELLTQLGMPFQK"
FT   gene            242330..242515
FT                   /gene="rpsN"
FT                   /locus_tag="LM5923_0241"
FT   CDS_pept        242330..242515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="LM5923_0241"
FT                   /product="30S ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70087"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466142.1"
FT                   /protein_id="ADB70087.1"
FT                   ELAYKGQIPGVKKASW"
FT   gene            242546..242944
FT                   /gene="rpsH"
FT                   /locus_tag="LM5923_0242"
FT   CDS_pept        242546..242944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="LM5923_0242"
FT                   /product="30S ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70088"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466141.1"
FT                   /protein_id="ADB70088.1"
FT   gene            242975..243511
FT                   /gene="rplF"
FT                   /locus_tag="LM5923_0243"
FT   CDS_pept        242975..243511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="LM5923_0243"
FT                   /product="50S ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70089"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466140.1"
FT                   /protein_id="ADB70089.1"
FT                   YEGEHVRRKEGKTGK"
FT   gene            243530..243910
FT                   /gene="rplR"
FT                   /locus_tag="LM5923_0244"
FT   CDS_pept        243530..243910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="LM5923_0244"
FT                   /product="50S ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70090"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466139.1"
FT                   /protein_id="ADB70090.1"
FT   gene            243932..244435
FT                   /gene="rpsE"
FT                   /locus_tag="LM5923_0245"
FT   CDS_pept        243932..244435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="LM5923_0245"
FT                   /product="30S ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70091"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466138.1"
FT                   /protein_id="ADB70091.1"
FT                   ELLG"
FT   gene            244452..244631
FT                   /gene="rpmD"
FT                   /locus_tag="LM5923_0246"
FT   CDS_pept        244452..244631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="LM5923_0246"
FT                   /product="50S ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70092"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466137.1"
FT                   /protein_id="ADB70092.1"
FT                   MITKVSHLVDVKEV"
FT   gene            244687..245127
FT                   /gene="rplO"
FT                   /locus_tag="LM5923_0247"
FT   CDS_pept        244687..245127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="LM5923_0247"
FT                   /product="50S ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70093"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466136.1"
FT                   /protein_id="ADB70093.1"
FT   gene            245127..246422
FT                   /gene="secY"
FT                   /locus_tag="LM5923_0248"
FT   CDS_pept        245127..246422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="LM5923_0248"
FT                   /product="preprotein translocase subunit SecY"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70094"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466135.1"
FT                   /protein_id="ADB70094.1"
FT   gene            246482..247129
FT                   /gene="adk"
FT                   /locus_tag="LM5923_0249"
FT   CDS_pept        246482..247129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="LM5923_0249"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70095"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466134.1"
FT                   /protein_id="ADB70095.1"
FT   gene            247515..247733
FT                   /gene="infA"
FT                   /locus_tag="LM5923_0250"
FT   CDS_pept        247515..247733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="LM5923_0250"
FT                   /product="translation initiation factor IF-1"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70096"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466133.1"
FT                   /protein_id="ADB70096.1"
FT   gene            247837..247950
FT                   /gene="rpmJ"
FT                   /locus_tag="LM5923_0251"
FT   CDS_pept        247837..247950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="LM5923_0251"
FT                   /product="50S ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70097"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466132.1"
FT                   /protein_id="ADB70097.1"
FT   gene            247969..248334
FT                   /gene="rpsM"
FT                   /locus_tag="LM5923_0252"
FT   CDS_pept        247969..248334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="LM5923_0252"
FT                   /product="30S ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70098"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466131.1"
FT                   /protein_id="ADB70098.1"
FT                   NARTRKGPSKTVAGKKK"
FT   gene            248357..248746
FT                   /gene="rpsK"
FT                   /locus_tag="LM5923_0253"
FT   CDS_pept        248357..248746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="LM5923_0253"
FT                   /product="30S ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70099"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466130.1"
FT                   /protein_id="ADB70099.1"
FT   gene            248856..249800
FT                   /gene="rpoA"
FT                   /locus_tag="LM5923_0254"
FT   CDS_pept        248856..249800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="LM5923_0254"
FT                   /product="DNA-directed RNA polymerase subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70100"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466129.1"
FT                   /protein_id="ADB70100.1"
FT   gene            249817..250224
FT                   /gene="rplQ"
FT                   /locus_tag="LM5923_0255"
FT   CDS_pept        249817..250224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="LM5923_0255"
FT                   /product="50S ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70101"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466128.1"
FT                   /protein_id="ADB70101.1"
FT   gene            250432..251526
FT                   /locus_tag="LM5923_0256"
FT   CDS_pept        250432..251526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0256"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70102"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466127.1"
FT                   /protein_id="ADB70102.1"
FT   gene            complement(251565..252455)
FT                   /locus_tag="LM5923_0257"
FT   CDS_pept        complement(251565..252455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0257"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70103"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466126.1"
FT                   /protein_id="ADB70103.1"
FT                   SIKLPLDYFPEMPFL"
FT   gene            complement(252574..253236)
FT                   /locus_tag="LM5923_0258"
FT   CDS_pept        complement(252574..253236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0258"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70104"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466125.1"
FT                   /protein_id="ADB70104.1"
FT   gene            253367..254206
FT                   /locus_tag="LM5923_0259"
FT   CDS_pept        253367..254206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0259"
FT                   /product="cobalt transporter ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70105"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466124.1"
FT                   /protein_id="ADB70105.1"
FT   gene            254182..255048
FT                   /locus_tag="LM5923_0260"
FT   CDS_pept        254182..255048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0260"
FT                   /product="cobalt transporter ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70106"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466123.1"
FT                   /protein_id="ADB70106.1"
FT                   YLAKGGA"
FT   gene            255051..255848
FT                   /locus_tag="LM5923_0261"
FT   CDS_pept        255051..255848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0261"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70107"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466122.1"
FT                   /protein_id="ADB70107.1"
FT   gene            255854..256600
FT                   /gene="truA"
FT                   /locus_tag="LM5923_0262"
FT   CDS_pept        255854..256600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truA"
FT                   /locus_tag="LM5923_0262"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70108"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466121.1"
FT                   /protein_id="ADB70108.1"
FT   gene            256795..257232
FT                   /gene="rplM"
FT                   /locus_tag="LM5923_0263"
FT   CDS_pept        256795..257232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="LM5923_0263"
FT                   /product="50S ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70109"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466120.1"
FT                   /protein_id="ADB70109.1"
FT   gene            257254..257646
FT                   /gene="rpsI"
FT                   /locus_tag="LM5923_0264"
FT   CDS_pept        257254..257646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="LM5923_0264"
FT                   /product="30S ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70110"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466119.1"
FT                   /protein_id="ADB70110.1"
FT   gene            complement(257841..258710)
FT                   /locus_tag="LM5923_0265"
FT   CDS_pept        complement(257841..258710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0265"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70111"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466118.1"
FT                   /protein_id="ADB70111.1"
FT                   AVYVTQAK"
FT   gene            259434..259856
FT                   /locus_tag="LM5923_0266"
FT   CDS_pept        259434..259856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0266"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70112"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466116.1"
FT                   /protein_id="ADB70112.1"
FT   gene            259878..260729
FT                   /locus_tag="LM5923_0267"
FT   CDS_pept        259878..260729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0267"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70113"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466115.1"
FT                   /protein_id="ADB70113.1"
FT                   NV"
FT   gene            complement(260771..262297)
FT                   /locus_tag="LM5923_0268"
FT   CDS_pept        complement(260771..262297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0268"
FT                   /product="GW repeat-containing surface protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70114"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466114.1"
FT                   /protein_id="ADB70114.1"
FT   gene            262566..263594
FT                   /locus_tag="LM5923_0269"
FT   CDS_pept        262566..263594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0269"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70115"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_466113.1"
FT                   /protein_id="ADB70115.1"
FT                   LS"
FT   gene            263612..263704
FT                   /locus_tag="LM5923_0270"
FT   CDS_pept        263612..263704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70116"
FT                   /inference="ab initio prediction:Glimmer:3.02"
FT                   /protein_id="ADB70116.1"
FT                   /translation="MTKGKNLGIFINVADADKTLSQQKKLTFEN"
FT   gene            263875..265429
FT                   /locus_tag="LM5923_rRNA01"
FT   rRNA            263875..265429
FT                   /locus_tag="LM5923_rRNA01"
FT                   /product="16S ribosomal RNA"
FT                   /inference="similar to DNA sequence (same
FT                   species):RefSeq:NC_003210.1"
FT   gene            265557..265630
FT                   /locus_tag="LM5923_tRNA02"
FT   tRNA            265557..265630
FT                   /locus_tag="LM5923_tRNA02"
FT                   /product="tRNA-Ile"
FT                   /note="Cove score: 92.91"
FT                   /inference="ab initio prediction:tRNAscan-SE:1.23"
FT   gene            265677..265752
FT                   /locus_tag="LM5923_tRNA03"
FT   tRNA            265677..265752
FT                   /locus_tag="LM5923_tRNA03"
FT                   /product="tRNA-Ala"
FT                   /note="Cove score: 92.94"
FT                   /inference="ab initio prediction:tRNAscan-SE:1.23"
FT   gene            265925..268855
FT                   /locus_tag="LM5923_rRNA02"
FT   rRNA            265925..268855
FT                   /locus_tag="LM5923_rRNA02"
FT                   /product="23S ribosomal RNA"
FT                   /inference="similar to DNA sequence (same
FT                   species):RefSeq:NC_003210.1"
FT   gene            268936..269045
FT                   /locus_tag="LM5923_rRNA03"
FT   rRNA            268936..269045
FT                   /locus_tag="LM5923_rRNA03"
FT                   /product="5S ribosomal RNA"
FT                   /inference="similar to DNA sequence (same
FT                   species):RefSeq:NC_003210.1"
FT   gene            269665..270183
FT                   /locus_tag="LM5923_0271"
FT   CDS_pept        269665..270183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0271"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70117"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463761.1"
FT                   /protein_id="ADB70117.1"
FT                   ALKAGGEDK"
FT   gene            270180..271202
FT                   /locus_tag="LM5923_0272"
FT   CDS_pept        270180..271202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0272"
FT                   /product="ATP:guanido phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70118"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463762.1"
FT                   /protein_id="ADB70118.1"
FT                   "
FT   gene            271231..273693
FT                   /gene="clpC"
FT                   /locus_tag="LM5923_0273"
FT   CDS_pept        271231..273693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpC"
FT                   /locus_tag="LM5923_0273"
FT                   /product="endopeptidase Clp ATP-binding chain C"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70119"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463763.1"
FT                   /protein_id="ADB70119.1"
FT                   TSKKVKAK"
FT   gene            273839..275212
FT                   /locus_tag="LM5923_0274"
FT   CDS_pept        273839..275212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0274"
FT                   /product="DNA repair protein RadA"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70120"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463764.1"
FT                   /protein_id="ADB70120.1"
FT   gene            275346..276419
FT                   /locus_tag="LM5923_0275"
FT   CDS_pept        275346..276419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0275"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70121"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463765.1"
FT                   /protein_id="ADB70121.1"
FT                   TSVLQTSAGRMIFAKPS"
FT   gene            276439..277137
FT                   /gene="ispD"
FT                   /locus_tag="LM5923_0276"
FT   CDS_pept        276439..277137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispD"
FT                   /locus_tag="LM5923_0276"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70122"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463766.1"
FT                   /protein_id="ADB70122.1"
FT                   LGELGGIAND"
FT   gene            277130..277603
FT                   /gene="ispF"
FT                   /locus_tag="LM5923_0277"
FT   CDS_pept        277130..277603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispF"
FT                   /locus_tag="LM5923_0277"
FT                   /product="2-C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70123"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463767.1"
FT                   /protein_id="ADB70123.1"
FT   gene            277622..279097
FT                   /gene="gltX"
FT                   /locus_tag="LM5923_0278"
FT   CDS_pept        277622..279097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="LM5923_0278"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70124"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463768.1"
FT                   /protein_id="ADB70124.1"
FT   gene            279495..280109
FT                   /gene="cysE"
FT                   /locus_tag="LM5923_0279"
FT   CDS_pept        279495..280109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysE"
FT                   /locus_tag="LM5923_0279"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70125"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463769.1"
FT                   /protein_id="ADB70125.1"
FT   gene            280116..281531
FT                   /gene="cysS"
FT                   /locus_tag="LM5923_0280"
FT   CDS_pept        280116..281531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="LM5923_0280"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70126"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463770.1"
FT                   /protein_id="ADB70126.1"
FT                   LEDTAQGTRFRRG"
FT   gene            281535..281945
FT                   /locus_tag="LM5923_0281"
FT   CDS_pept        281535..281945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0281"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70127"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463771.1"
FT                   /protein_id="ADB70127.1"
FT   gene            281945..282700
FT                   /locus_tag="LM5923_0282"
FT   CDS_pept        281945..282700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0282"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70128"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463772.1"
FT                   /protein_id="ADB70128.1"
FT   gene            282703..283215
FT                   /locus_tag="LM5923_0283"
FT   CDS_pept        282703..283215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0283"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70129"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463773.1"
FT                   /protein_id="ADB70129.1"
FT                   KWRRGEE"
FT   gene            283296..283901
FT                   /gene="sigH"
FT                   /locus_tag="LM5923_0284"
FT   CDS_pept        283296..283901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sigH"
FT                   /locus_tag="LM5923_0284"
FT                   /product="RNA polymerase factor sigma-70"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70130"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463774.1"
FT                   /protein_id="ADB70130.1"
FT   gene            284174..284353
FT                   /gene="secE"
FT                   /locus_tag="LM5923_0285"
FT   CDS_pept        284174..284353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="LM5923_0285"
FT                   /product="preprotein translocase subunit SecE"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70131"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463776.1"
FT                   /protein_id="ADB70131.1"
FT                   LIDFGIEQIIKLIV"
FT   gene            284483..285016
FT                   /gene="nusG"
FT                   /locus_tag="LM5923_0286"
FT   CDS_pept        284483..285016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="LM5923_0286"
FT                   /product="transcription antitermination protein NusG"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70132"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463777.1"
FT                   /protein_id="ADB70132.1"
FT                   ETPVEVDFNQIEKL"
FT   gene            285071..285541
FT                   /locus_tag="LM5923_0287"
FT   CDS_pept        285071..285541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0287"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70133"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463778.1"
FT                   /protein_id="ADB70133.1"
FT   gene            285668..286093
FT                   /gene="rplK"
FT                   /locus_tag="LM5923_0288"
FT   CDS_pept        285668..286093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="LM5923_0288"
FT                   /product="50S ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70134"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463779.1"
FT                   /protein_id="ADB70134.1"
FT   gene            286133..286822
FT                   /gene="rplA"
FT                   /locus_tag="LM5923_0289"
FT   CDS_pept        286133..286822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="LM5923_0289"
FT                   /product="50S ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70135"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463780.1"
FT                   /protein_id="ADB70135.1"
FT                   KVDPASL"
FT   gene            287070..287570
FT                   /gene="rplJ"
FT                   /locus_tag="LM5923_0290"
FT   CDS_pept        287070..287570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="LM5923_0290"
FT                   /product="50S ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70136"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463781.1"
FT                   /protein_id="ADB70136.1"
FT                   QEA"
FT   gene            287649..288011
FT                   /gene="rplL"
FT                   /locus_tag="LM5923_0291"
FT   CDS_pept        287649..288011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="LM5923_0291"
FT                   /product="50S ribosomal protein L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70137"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463782.1"
FT                   /protein_id="ADB70137.1"
FT                   EIKAKLEEVGANVEVK"
FT   gene            288169..288345
FT                   /locus_tag="LM5923_0292"
FT   CDS_pept        288169..288345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0292"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70138"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463786.1"
FT                   /protein_id="ADB70138.1"
FT                   KQFEAQGFKKKES"
FT   gene            288460..289065
FT                   /locus_tag="LM5923_0293"
FT   CDS_pept        288460..289065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0293"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70139"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463787.1"
FT                   /protein_id="ADB70139.1"
FT   gene            289412..290590
FT                   /locus_tag="LM5923_0294"
FT   CDS_pept        289412..290590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0294"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70140"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463788.1"
FT                   /protein_id="ADB70140.1"
FT   gene            290735..291730
FT                   /locus_tag="LM5923_0295"
FT   CDS_pept        290735..291730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0295"
FT                   /product="transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70141"
FT                   /protein_id="ADB70141.1"
FT   gene            291868..293094
FT                   /locus_tag="LM5923_0296"
FT   CDS_pept        291868..293094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0296"
FT                   /product="maltose/maltodextrin transport system
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70142"
FT                   /protein_id="ADB70142.1"
FT                   LVKDITPAK"
FT   gene            293112..294449
FT                   /locus_tag="LM5923_0297"
FT   CDS_pept        293112..294449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0297"
FT                   /product="maltose/maltodextrin transport system permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70143"
FT                   /protein_id="ADB70143.1"
FT   gene            294451..295281
FT                   /locus_tag="LM5923_0298"
FT   CDS_pept        294451..295281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0298"
FT                   /product="maltose/maltodextrin transport system permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70144"
FT                   /protein_id="ADB70144.1"
FT   gene            295296..296993
FT                   /locus_tag="LM5923_0299"
FT   CDS_pept        295296..296993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0299"
FT                   /product="oligo-1,6-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70145"
FT                   /protein_id="ADB70145.1"
FT   gene            296994..298436
FT                   /locus_tag="LM5923_0300"
FT   CDS_pept        296994..298436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0300"
FT                   /product="sucrose phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70146"
FT                   /protein_id="ADB70146.1"
FT   gene            298993..302547
FT                   /gene="rpoB"
FT                   /locus_tag="LM5923_0301"
FT   CDS_pept        298993..302547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="LM5923_0301"
FT                   /product="DNA-directed RNA polymerase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70147"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463789.1"
FT                   /protein_id="ADB70147.1"
FT                   NDAFNIVQPENAAAEKTE"
FT   gene            302718..306323
FT                   /gene="rpoC"
FT                   /locus_tag="LM5923_0302"
FT   CDS_pept        302718..306323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="LM5923_0302"
FT                   /product="DNA-directed RNA polymerase subunit beta'"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70148"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463790.1"
FT                   /protein_id="ADB70148.1"
FT   gene            306400..306945
FT                   /locus_tag="LM5923_0303"
FT   CDS_pept        306400..306945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0303"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70149"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463791.1"
FT                   /protein_id="ADB70149.1"
FT                   WDLAYVPEALLLLNKVST"
FT   gene            307011..308471
FT                   /locus_tag="LM5923_0304"
FT   CDS_pept        307011..308471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0304"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70150"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463792.1"
FT                   /protein_id="ADB70150.1"
FT   gene            308745..310217
FT                   /gene="inlG"
FT                   /locus_tag="LM5923_0305"
FT   CDS_pept        308745..310217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="inlG"
FT                   /locus_tag="LM5923_0305"
FT                   /product="internalin G"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70151"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463793.1"
FT                   /protein_id="ADB70151.1"
FT   gene            310355..312001
FT                   /gene="inlC2"
FT                   /locus_tag="LM5923_0306"
FT   CDS_pept        310355..312001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="inlC2"
FT                   /locus_tag="LM5923_0306"
FT                   /product="internalin H"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70152"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463794.1"
FT                   /protein_id="ADB70152.1"
FT   gene            312209..313912
FT                   /gene="inlD"
FT                   /locus_tag="LM5923_0307"
FT   CDS_pept        312209..313912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="inlD"
FT                   /locus_tag="LM5923_0307"
FT                   /product="internalin H"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70153"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463794.1"
FT                   /protein_id="ADB70153.1"
FT   gene            314121..315620
FT                   /gene="inlE"
FT                   /locus_tag="LM5923_0308"
FT   CDS_pept        314121..315620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="inlE"
FT                   /locus_tag="LM5923_0308"
FT                   /product="internalin E"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70154"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463795.1"
FT                   /protein_id="ADB70154.1"
FT   gene            315756..316895
FT                   /locus_tag="LM5923_0309"
FT   CDS_pept        315756..316895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0309"
FT                   /product="succinyl-diaminopimelate desuccinylase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70155"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463796.1"
FT                   /protein_id="ADB70155.1"
FT   gene            317043..317459
FT                   /locus_tag="LM5923_0310"
FT   CDS_pept        317043..317459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70156"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463797.1"
FT                   /protein_id="ADB70156.1"
FT   gene            317466..318425
FT                   /locus_tag="LM5923_0311"
FT   CDS_pept        317466..318425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0311"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70157"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463798.1"
FT                   /protein_id="ADB70157.1"
FT   gene            318497..319132
FT                   /locus_tag="LM5923_0312"
FT   CDS_pept        318497..319132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0312"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70158"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463799.1"
FT                   /protein_id="ADB70158.1"
FT   gene            319216..321102
FT                   /locus_tag="LM5923_0313"
FT   CDS_pept        319216..321102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0313"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70159"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463800.1"
FT                   /protein_id="ADB70159.1"
FT   gene            complement(321116..321745)
FT                   /locus_tag="LM5923_0314"
FT   CDS_pept        complement(321116..321745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0314"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70160"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463801.1"
FT                   /protein_id="ADB70160.1"
FT   gene            complement(321749..323185)
FT                   /locus_tag="LM5923_0315"
FT   CDS_pept        complement(321749..323185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0315"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70161"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463802.1"
FT                   /protein_id="ADB70161.1"
FT   gene            complement(323306..324118)
FT                   /locus_tag="LM5923_0316"
FT   CDS_pept        complement(323306..324118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0316"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70162"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463803.1"
FT                   /protein_id="ADB70162.1"
FT   gene            324254..324757
FT                   /locus_tag="LM5923_0317"
FT   CDS_pept        324254..324757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0317"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70163"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463804.1"
FT                   /protein_id="ADB70163.1"
FT                   LAIK"
FT   gene            complement(324794..325456)
FT                   /locus_tag="LM5923_0318"
FT   CDS_pept        complement(324794..325456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0318"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70164"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463805.1"
FT                   /protein_id="ADB70164.1"
FT   gene            complement(325715..326557)
FT                   /locus_tag="LM5923_0319"
FT   CDS_pept        complement(325715..326557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0319"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70165"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463806.1"
FT                   /protein_id="ADB70165.1"
FT   gene            complement(326574..327395)
FT                   /locus_tag="LM5923_0320"
FT   CDS_pept        complement(326574..327395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70166"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463807.1"
FT                   /protein_id="ADB70166.1"
FT   gene            327509..328483
FT                   /locus_tag="LM5923_0321"
FT   CDS_pept        327509..328483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0321"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70167"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463808.1"
FT                   /protein_id="ADB70167.1"
FT   gene            complement(328522..329622)
FT                   /locus_tag="LM5923_0322"
FT   CDS_pept        complement(328522..329622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0322"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70168"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463809.1"
FT                   /protein_id="ADB70168.1"
FT   gene            329913..332063
FT                   /locus_tag="LM5923_0323"
FT   CDS_pept        329913..332063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0323"
FT                   /product="anaerobic ribonucleoside triphosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70169"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463810.1"
FT                   /protein_id="ADB70169.1"
FT   gene            332056..332607
FT                   /locus_tag="LM5923_0324"
FT   CDS_pept        332056..332607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0324"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70170"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463811.1"
FT                   /protein_id="ADB70170.1"
FT   gene            complement(332865..333536)
FT                   /locus_tag="LM5923_0325"
FT   CDS_pept        complement(332865..333536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0325"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70171"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463812.1"
FT                   /protein_id="ADB70171.1"
FT                   D"
FT   gene            complement(333698..334477)
FT                   /locus_tag="LM5923_0326"
FT   CDS_pept        complement(333698..334477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0326"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70172"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463813.1"
FT                   /protein_id="ADB70172.1"
FT   gene            complement(334449..334541)
FT                   /locus_tag="LM5923_0327"
FT   CDS_pept        complement(334449..334541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0327"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70173"
FT                   /inference="ab initio prediction:Glimmer:3.02"
FT                   /protein_id="ADB70173.1"
FT                   /translation="MFQYGLATKLVLFLKEKGSEEHVEVGIMSN"
FT   gene            complement(334567..335229)
FT                   /locus_tag="LM5923_0328"
FT   CDS_pept        complement(334567..335229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0328"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70174"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463814.1"
FT                   /protein_id="ADB70174.1"
FT   gene            complement(335226..336242)
FT                   /locus_tag="LM5923_0329"
FT   CDS_pept        complement(335226..336242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0329"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70175"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463815.1"
FT                   /protein_id="ADB70175.1"
FT   gene            complement(336257..337078)
FT                   /locus_tag="LM5923_0330"
FT   CDS_pept        complement(336257..337078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0330"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70176"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463816.1"
FT                   /protein_id="ADB70176.1"
FT   gene            337460..338641
FT                   /locus_tag="LM5923_0331"
FT   CDS_pept        337460..338641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0331"
FT                   /product="transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70177"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463817.1"
FT                   /protein_id="ADB70177.1"
FT   gene            338854..339567
FT                   /locus_tag="LM5923_0332"
FT   CDS_pept        338854..339567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0332"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70178"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463818.1"
FT                   /protein_id="ADB70178.1"
FT                   TRRGVGYYLRNPEQE"
FT   gene            339752..341584
FT                   /locus_tag="LM5923_0333"
FT   CDS_pept        339752..341584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0333"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70179"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463819.1"
FT                   /protein_id="ADB70179.1"
FT   gene            341581..342903
FT                   /locus_tag="LM5923_0334"
FT   CDS_pept        341581..342903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0334"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70180"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463820.1"
FT                   /protein_id="ADB70180.1"
FT   gene            342906..343745
FT                   /locus_tag="LM5923_0335"
FT   CDS_pept        342906..343745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0335"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70181"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463821.1"
FT                   /protein_id="ADB70181.1"
FT   gene            343865..344695
FT                   /locus_tag="LM5923_0336"
FT   CDS_pept        343865..344695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0336"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70182"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463822.1"
FT                   /protein_id="ADB70182.1"
FT   gene            344793..346295
FT                   /locus_tag="LM5923_0337"
FT   CDS_pept        344793..346295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0337"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70183"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463823.1"
FT                   /protein_id="ADB70183.1"
FT   gene            346970..347449
FT                   /locus_tag="LM5923_0338"
FT   CDS_pept        346970..347449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0338"
FT                   /product="SPOUT methyltransferase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70184"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463824.1"
FT                   /protein_id="ADB70184.1"
FT   gene            complement(347481..348344)
FT                   /locus_tag="LM5923_0339"
FT   CDS_pept        complement(347481..348344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0339"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70185"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463825.1"
FT                   /protein_id="ADB70185.1"
FT                   KPAFKS"
FT   gene            348463..349200
FT                   /locus_tag="LM5923_0340"
FT   CDS_pept        348463..349200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70186"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463826.1"
FT                   /protein_id="ADB70186.1"
FT   gene            349411..350049
FT                   /locus_tag="LM5923_0341"
FT   CDS_pept        349411..350049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0341"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70187"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463827.1"
FT                   /protein_id="ADB70187.1"
FT   gene            complement(350054..351925)
FT                   /locus_tag="LM5923_0342"
FT   CDS_pept        complement(350054..351925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0342"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70188"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463828.1"
FT                   /protein_id="ADB70188.1"
FT   gene            complement(352024..353337)
FT                   /locus_tag="LM5923_0343"
FT   CDS_pept        complement(352024..353337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0343"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70189"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463829.1"
FT                   /protein_id="ADB70189.1"
FT   gene            complement(353342..353632)
FT                   /locus_tag="LM5923_0344"
FT   CDS_pept        complement(353342..353632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0344"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70190"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463830.1"
FT                   /protein_id="ADB70190.1"
FT   gene            complement(353649..355040)
FT                   /locus_tag="LM5923_0345"
FT   CDS_pept        complement(353649..355040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0345"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70191"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463831.1"
FT                   /protein_id="ADB70191.1"
FT                   KRREF"
FT   gene            complement(355033..355374)
FT                   /locus_tag="LM5923_0346"
FT   CDS_pept        complement(355033..355374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0346"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70192"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463832.1"
FT                   /protein_id="ADB70192.1"
FT                   QWKWSLSNE"
FT   gene            355538..355825
FT                   /locus_tag="LM5923_0347"
FT   CDS_pept        355538..355825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0347"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70193"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463833.1"
FT                   /protein_id="ADB70193.1"
FT   gene            355861..356415
FT                   /locus_tag="LM5923_0348"
FT   CDS_pept        355861..356415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0348"
FT                   /product="putative secreted, lysin rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70194"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463834.1"
FT                   /protein_id="ADB70194.1"
FT   gene            356621..357886
FT                   /locus_tag="LM5923_0349"
FT   CDS_pept        356621..357886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0349"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70195"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463835.1"
FT                   /protein_id="ADB70195.1"
FT   gene            357843..358931
FT                   /locus_tag="LM5923_0350"
FT   CDS_pept        357843..358931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70196"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463836.1"
FT                   /protein_id="ADB70196.1"
FT   gene            358919..359704
FT                   /locus_tag="LM5923_0351"
FT   CDS_pept        358919..359704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0351"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70197"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463844.1"
FT                   /protein_id="ADB70197.1"
FT   gene            359927..360601
FT                   /locus_tag="LM5923_0352"
FT   CDS_pept        359927..360601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0352"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70198"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463845.1"
FT                   /protein_id="ADB70198.1"
FT                   YV"
FT   gene            360594..361403
FT                   /locus_tag="LM5923_0353"
FT   CDS_pept        360594..361403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0353"
FT                   /product="hydroxyethylthiazole kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70199"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463846.1"
FT                   /protein_id="ADB70199.1"
FT   gene            361400..362203
FT                   /locus_tag="LM5923_0354"
FT   CDS_pept        361400..362203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0354"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70200"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463847.1"
FT                   /protein_id="ADB70200.1"
FT   gene            362200..362844
FT                   /locus_tag="LM5923_0355"
FT   CDS_pept        362200..362844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0355"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70201"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463848.1"
FT                   /protein_id="ADB70201.1"
FT   gene            complement(362870..364285)
FT                   /locus_tag="LM5923_0356"
FT   CDS_pept        complement(362870..364285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0356"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70202"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463849.1"
FT                   /protein_id="ADB70202.1"
FT                   WYKNVIATNGEDL"
FT   gene            364560..365219
FT                   /locus_tag="LM5923_0357"
FT   CDS_pept        364560..365219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0357"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70203"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463851.1"
FT                   /protein_id="ADB70203.1"
FT   gene            365403..365795
FT                   /locus_tag="LM5923_0358"
FT   CDS_pept        365403..365795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0358"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70204"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463852.1"
FT                   /protein_id="ADB70204.1"
FT   gene            complement(365960..366613)
FT                   /locus_tag="LM5923_0359"
FT   CDS_pept        complement(365960..366613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0359"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70205"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463853.1"
FT                   /protein_id="ADB70205.1"
FT   gene            366768..367250
FT                   /locus_tag="LM5923_0360"
FT   CDS_pept        366768..367250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70206"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463854.1"
FT                   /protein_id="ADB70206.1"
FT   gene            367511..368413
FT                   /locus_tag="LM5923_0361"
FT   CDS_pept        367511..368413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0361"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70207"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463855.1"
FT                   /protein_id="ADB70207.1"
FT   gene            368577..369449
FT                   /locus_tag="LM5923_0362"
FT   CDS_pept        368577..369449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0362"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70208"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463856.1"
FT                   /protein_id="ADB70208.1"
FT                   KNNDIKMME"
FT   gene            369756..373697
FT                   /locus_tag="LM5923_0363"
FT   CDS_pept        369756..373697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0363"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70209"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463857.1"
FT                   /protein_id="ADB70209.1"
FT   gene            373835..374515
FT                   /locus_tag="LM5923_0364"
FT   CDS_pept        373835..374515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0364"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70210"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463858.1"
FT                   /protein_id="ADB70210.1"
FT                   FENA"
FT   gene            complement(374699..376600)
FT                   /locus_tag="LM5923_0365"
FT   CDS_pept        complement(374699..376600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0365"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70211"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463861.1"
FT                   /protein_id="ADB70211.1"
FT   gene            377096..377431
FT                   /locus_tag="LM5923_0366"
FT   CDS_pept        377096..377431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0366"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70212"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463862.1"
FT                   /protein_id="ADB70212.1"
FT                   LILFLTI"
FT   gene            377860..383196
FT                   /gene="inlI"
FT                   /locus_tag="LM5923_0367"
FT   CDS_pept        377860..383196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="inlI"
FT                   /locus_tag="LM5923_0367"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70213"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463863.1"
FT                   /protein_id="ADB70213.1"
FT   gene            383417..383944
FT                   /locus_tag="LM5923_0368"
FT   CDS_pept        383417..383944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0368"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70214"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463864.1"
FT                   /protein_id="ADB70214.1"
FT                   DLNKLDGVLDRL"
FT   gene            384192..384587
FT                   /locus_tag="LM5923_0369"
FT   CDS_pept        384192..384587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0369"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70215"
FT                   /protein_id="ADB70215.1"
FT   gene            384723..384842
FT                   /locus_tag="LM5923_0370"
FT   CDS_pept        384723..384842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70216"
FT                   /inference="ab initio prediction:Glimmer:3.02"
FT                   /protein_id="ADB70216.1"
FT   gene            384947..385177
FT                   /locus_tag="LM5923_0371"
FT   CDS_pept        384947..385177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0371"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70217"
FT                   /protein_id="ADB70217.1"
FT   gene            385256..385483
FT                   /locus_tag="LM5923_0372"
FT   CDS_pept        385256..385483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0372"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70218"
FT                   /protein_id="ADB70218.1"
FT   gene            385652..386032
FT                   /locus_tag="LM5923_0373"
FT   CDS_pept        385652..386032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0373"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70219"
FT                   /protein_id="ADB70219.1"
FT   gene            386261..386479
FT                   /locus_tag="LM5923_0374"
FT   CDS_pept        386261..386479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0374"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70220"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463870.1"
FT                   /protein_id="ADB70220.1"
FT   gene            complement(386577..386909)
FT                   /locus_tag="LM5923_0375"
FT   CDS_pept        complement(386577..386909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0375"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70221"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463871.1"
FT                   /protein_id="ADB70221.1"
FT                   NQFPSN"
FT   gene            complement(386975..388972)
FT                   /locus_tag="LM5923_0376"
FT   CDS_pept        complement(386975..388972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0376"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70222"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463872.1"
FT                   /protein_id="ADB70222.1"
FT   gene            complement(388974..389630)
FT                   /locus_tag="LM5923_0377"
FT   CDS_pept        complement(388974..389630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0377"
FT                   /product="putative translaldolase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70223"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463873.1"
FT                   /protein_id="ADB70223.1"
FT   gene            complement(389677..390441)
FT                   /locus_tag="LM5923_0378"
FT   CDS_pept        complement(389677..390441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0378"
FT                   /product="short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70224"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463874.1"
FT                   /protein_id="ADB70224.1"
FT   gene            complement(390465..390911)
FT                   /locus_tag="LM5923_0379"
FT   CDS_pept        complement(390465..390911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0379"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70225"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463875.1"
FT                   /protein_id="ADB70225.1"
FT   gene            complement(390918..391682)
FT                   /locus_tag="LM5923_0380"
FT   CDS_pept        complement(390918..391682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70226"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463876.1"
FT                   /protein_id="ADB70226.1"
FT   gene            complement(391686..392336)
FT                   /locus_tag="LM5923_0381"
FT   CDS_pept        complement(391686..392336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0381"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70227"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463877.1"
FT                   /protein_id="ADB70227.1"
FT   gene            complement(392358..393353)
FT                   /locus_tag="LM5923_0382"
FT   CDS_pept        complement(392358..393353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0382"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70228"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463878.1"
FT                   /protein_id="ADB70228.1"
FT   gene            complement(393375..393716)
FT                   /locus_tag="LM5923_0383"
FT   CDS_pept        complement(393375..393716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0383"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70229"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463879.1"
FT                   /protein_id="ADB70229.1"
FT                   GGFLLSLFL"
FT   gene            complement(393732..394163)
FT                   /locus_tag="LM5923_0384"
FT   CDS_pept        complement(393732..394163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0384"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70230"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463880.1"
FT                   /protein_id="ADB70230.1"
FT   gene            complement(394248..394625)
FT                   /locus_tag="LM5923_0385"
FT   CDS_pept        complement(394248..394625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0385"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70231"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463881.1"
FT                   /protein_id="ADB70231.1"
FT   gene            394808..395572
FT                   /locus_tag="LM5923_0386"
FT   CDS_pept        394808..395572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0386"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70232"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463882.1"
FT                   /protein_id="ADB70232.1"
FT   gene            395638..396051
FT                   /locus_tag="LM5923_0387"
FT   CDS_pept        395638..396051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0387"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70233"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463883.1"
FT                   /protein_id="ADB70233.1"
FT   gene            complement(396097..397623)
FT                   /locus_tag="LM5923_0388"
FT   CDS_pept        complement(396097..397623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0388"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70234"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463884.1"
FT                   /protein_id="ADB70234.1"
FT   gene            397860..399380
FT                   /locus_tag="LM5923_0389"
FT   CDS_pept        397860..399380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0389"
FT                   /product="fumarate reductase flavoprotein subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70235"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463885.1"
FT                   /protein_id="ADB70235.1"
FT   gene            399554..400570
FT                   /locus_tag="LM5923_0390"
FT   CDS_pept        399554..400570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70236"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463886.1"
FT                   /protein_id="ADB70236.1"
FT   gene            400769..401215
FT                   /locus_tag="LM5923_0391"
FT   CDS_pept        400769..401215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0391"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70237"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463887.1"
FT                   /protein_id="ADB70237.1"
FT   gene            401229..402623
FT                   /locus_tag="LM5923_0392"
FT   CDS_pept        401229..402623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0392"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70238"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463888.1"
FT                   /protein_id="ADB70238.1"
FT                   NKEEMI"
FT   gene            402623..403483
FT                   /locus_tag="LM5923_0393"
FT   CDS_pept        402623..403483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0393"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70239"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463889.1"
FT                   /protein_id="ADB70239.1"
FT                   QADKY"
FT   gene            403540..404310
FT                   /locus_tag="LM5923_0394"
FT   CDS_pept        403540..404310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0394"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70240"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463890.1"
FT                   /protein_id="ADB70240.1"
FT   gene            complement(404294..404521)
FT                   /locus_tag="LM5923_0395"
FT   CDS_pept        complement(404294..404521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0395"
FT                   /product="putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70241"
FT                   /protein_id="ADB70241.1"
FT   gene            complement(404650..405369)
FT                   /locus_tag="LM5923_0396"
FT   CDS_pept        complement(404650..405369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0396"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70242"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463891.1"
FT                   /protein_id="ADB70242.1"
FT                   VVSGLTVRRMDKEMNNV"
FT   gene            complement(405381..405560)
FT                   /locus_tag="LM5923_0397"
FT   CDS_pept        complement(405381..405560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0397"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70243"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463892.1"
FT                   /protein_id="ADB70243.1"
FT                   DDSKEETKKEDPRP"
FT   gene            405869..407353
FT                   /locus_tag="LM5923_0398"
FT   CDS_pept        405869..407353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0398"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70244"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463895.1"
FT                   /protein_id="ADB70244.1"
FT   gene            407350..408510
FT                   /locus_tag="LM5923_0399"
FT   CDS_pept        407350..408510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0399"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70245"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463896.1"
FT                   /protein_id="ADB70245.1"
FT   gene            408528..409793
FT                   /locus_tag="LM5923_0400"
FT   CDS_pept        408528..409793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70246"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463897.1"
FT                   /protein_id="ADB70246.1"
FT   gene            409866..410375
FT                   /locus_tag="LM5923_0401"
FT   CDS_pept        409866..410375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0401"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70247"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463898.1"
FT                   /protein_id="ADB70247.1"
FT                   ATTIHF"
FT   gene            410472..411191
FT                   /locus_tag="LM5923_0402"
FT   CDS_pept        410472..411191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0402"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70248"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463899.1"
FT                   /protein_id="ADB70248.1"
FT                   EDLEDVQKVYHNVELED"
FT   gene            411228..411566
FT                   /locus_tag="LM5923_0403"
FT   CDS_pept        411228..411566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0403"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70249"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463900.1"
FT                   /protein_id="ADB70249.1"
FT                   KSEFVKKI"
FT   gene            complement(411607..412320)
FT                   /locus_tag="LM5923_0404"
FT   CDS_pept        complement(411607..412320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0404"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70250"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463901.1"
FT                   /protein_id="ADB70250.1"
FT                   HTYESFVFETVFVQN"
FT   gene            412477..413919
FT                   /locus_tag="LM5923_0405"
FT   CDS_pept        412477..413919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0405"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70251"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463902.1"
FT                   /protein_id="ADB70251.1"
FT   gene            413912..415246
FT                   /locus_tag="LM5923_0406"
FT   CDS_pept        413912..415246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0406"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70252"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463903.1"
FT                   /protein_id="ADB70252.1"
FT   gene            415264..415566
FT                   /locus_tag="LM5923_0407"
FT   CDS_pept        415264..415566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0407"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70253"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463904.1"
FT                   /protein_id="ADB70253.1"
FT   gene            415655..415849
FT                   /locus_tag="LM5923_0408"
FT   CDS_pept        415655..415849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0408"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70254"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463905.1"
FT                   /protein_id="ADB70254.1"
FT   gene            complement(415888..416808)
FT                   /locus_tag="LM5923_0409"
FT   CDS_pept        complement(415888..416808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0409"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70255"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463906.1"
FT                   /protein_id="ADB70255.1"
FT   gene            416910..417329
FT                   /locus_tag="LM5923_0410"
FT   CDS_pept        416910..417329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70256"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463907.1"
FT                   /protein_id="ADB70256.1"
FT   gene            417548..417994
FT                   /locus_tag="LM5923_0411"
FT   CDS_pept        417548..417994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0411"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70257"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463908.1"
FT                   /protein_id="ADB70257.1"
FT   gene            418012..418467
FT                   /locus_tag="LM5923_0412"
FT   CDS_pept        418012..418467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0412"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70258"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463909.1"
FT                   /protein_id="ADB70258.1"
FT   gene            418635..419291
FT                   /locus_tag="LM5923_0413"
FT   CDS_pept        418635..419291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0413"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70259"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463910.1"
FT                   /protein_id="ADB70259.1"
FT   gene            419491..419877
FT                   /locus_tag="LM5923_0414"
FT   CDS_pept        419491..419877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0414"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70260"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463911.1"
FT                   /protein_id="ADB70260.1"
FT   gene            complement(419950..420711)
FT                   /locus_tag="LM5923_0415"
FT   CDS_pept        complement(419950..420711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0415"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70261"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463912.1"
FT                   /protein_id="ADB70261.1"
FT   gene            420907..422373
FT                   /locus_tag="LM5923_0416"
FT   CDS_pept        420907..422373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0416"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70262"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463913.1"
FT                   /protein_id="ADB70262.1"
FT   gene            422386..423207
FT                   /locus_tag="LM5923_0417"
FT   CDS_pept        422386..423207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0417"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70263"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463914.1"
FT                   /protein_id="ADB70263.1"
FT   gene            423224..424201
FT                   /locus_tag="LM5923_0418"
FT   CDS_pept        423224..424201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0418"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70264"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463915.1"
FT                   /protein_id="ADB70264.1"
FT   gene            424211..426130
FT                   /locus_tag="LM5923_0419"
FT   CDS_pept        424211..426130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0419"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70265"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463916.1"
FT                   /protein_id="ADB70265.1"
FT                   ARLY"
FT   gene            426264..426635
FT                   /locus_tag="LM5923_0420"
FT   CDS_pept        426264..426635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70266"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463917.1"
FT                   /protein_id="ADB70266.1"
FT   gene            426729..427097
FT                   /locus_tag="LM5923_0421"
FT   CDS_pept        426729..427097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0421"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70267"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463918.1"
FT                   /protein_id="ADB70267.1"
FT                   GLFIFTDYTRHQDTGEER"
FT   gene            complement(427121..428236)
FT                   /gene="ltrA"
FT                   /locus_tag="LM5923_0422"
FT   CDS_pept        complement(427121..428236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ltrA"
FT                   /locus_tag="LM5923_0422"
FT                   /product="low temperature requirement protein A"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70268"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463919.1"
FT                   /protein_id="ADB70268.1"
FT   gene            428322..429032
FT                   /locus_tag="LM5923_0423"
FT   CDS_pept        428322..429032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0423"
FT                   /product="uracil-DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70269"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463920.1"
FT                   /protein_id="ADB70269.1"
FT                   EHERKPIDWDLNEQ"
FT   gene            429200..429499
FT                   /locus_tag="LM5923_0424"
FT   CDS_pept        429200..429499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0424"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70270"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463921.1"
FT                   /protein_id="ADB70270.1"
FT   gene            429496..430440
FT                   /locus_tag="LM5923_0425"
FT   CDS_pept        429496..430440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0425"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70271"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463922.1"
FT                   /protein_id="ADB70271.1"
FT   gene            430475..430924
FT                   /locus_tag="LM5923_0426"
FT   CDS_pept        430475..430924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0426"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70272"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463923.1"
FT                   /protein_id="ADB70272.1"
FT   gene            431068..431751
FT                   /locus_tag="LM5923_0427"
FT   CDS_pept        431068..431751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0427"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70273"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463924.1"
FT                   /protein_id="ADB70273.1"
FT                   VANLK"
FT   gene            431789..432232
FT                   /locus_tag="LM5923_0428"
FT   CDS_pept        431789..432232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0428"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70274"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463925.1"
FT                   /protein_id="ADB70274.1"
FT   gene            complement(432235..433035)
FT                   /gene="proC"
FT                   /locus_tag="LM5923_0429"
FT   CDS_pept        complement(432235..433035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="LM5923_0429"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70275"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463926.1"
FT                   /protein_id="ADB70275.1"
FT   gene            433163..433645
FT                   /locus_tag="LM5923_0430"
FT   CDS_pept        433163..433645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70276"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463927.1"
FT                   /protein_id="ADB70276.1"
FT   gene            433815..434273
FT                   /locus_tag="LM5923_0431"
FT   CDS_pept        433815..434273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0431"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70277"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463928.1"
FT                   /protein_id="ADB70277.1"
FT   gene            434270..434602
FT                   /locus_tag="LM5923_0432"
FT   CDS_pept        434270..434602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0432"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70278"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463929.1"
FT                   /protein_id="ADB70278.1"
FT                   KQKEAN"
FT   gene            434606..435718
FT                   /locus_tag="LM5923_0433"
FT   CDS_pept        434606..435718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0433"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70279"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463930.1"
FT                   /protein_id="ADB70279.1"
FT   gene            435740..438367
FT                   /locus_tag="LM5923_0434"
FT   CDS_pept        435740..438367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0434"
FT                   /product="alpha-mannosidase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70280"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463931.1"
FT                   /protein_id="ADB70280.1"
FT                   LFEK"
FT   gene            438401..440335
FT                   /locus_tag="LM5923_0435"
FT   CDS_pept        438401..440335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0435"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70281"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463932.1"
FT                   /protein_id="ADB70281.1"
FT                   LANDILKKK"
FT   gene            440461..440877
FT                   /locus_tag="LM5923_0436"
FT   CDS_pept        440461..440877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0436"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70282"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463933.1"
FT                   /protein_id="ADB70282.1"
FT   gene            440868..441266
FT                   /locus_tag="LM5923_0437"
FT   CDS_pept        440868..441266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0437"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70283"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463934.1"
FT                   /protein_id="ADB70283.1"
FT   gene            441375..442382
FT                   /locus_tag="LM5923_0438"
FT   CDS_pept        441375..442382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0438"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70284"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463935.1"
FT                   /protein_id="ADB70284.1"
FT   gene            442398..442778
FT                   /locus_tag="LM5923_0439"
FT   CDS_pept        442398..442778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0439"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70285"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463936.1"
FT                   /protein_id="ADB70285.1"
FT   gene            442847..443239
FT                   /locus_tag="LM5923_0440"
FT   CDS_pept        442847..443239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70286"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463937.1"
FT                   /protein_id="ADB70286.1"
FT   gene            443252..443674
FT                   /locus_tag="LM5923_0441"
FT   CDS_pept        443252..443674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0441"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70287"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463938.1"
FT                   /protein_id="ADB70287.1"
FT   gene            443901..446366
FT                   /locus_tag="LM5923_0442"
FT   CDS_pept        443901..446366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0442"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70288"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463939.1"
FT                   /protein_id="ADB70288.1"
FT                   AFYIWRKKA"
FT   gene            complement(446414..449017)
FT                   /locus_tag="LM5923_0443"
FT   CDS_pept        complement(446414..449017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0443"
FT                   /product="phosphoenolpyruvate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70289"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463940.1"
FT                   /protein_id="ADB70289.1"
FT   gene            complement(449217..450095)
FT                   /locus_tag="LM5923_0444"
FT   CDS_pept        complement(449217..450095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0444"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70290"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463941.1"
FT                   /protein_id="ADB70290.1"
FT                   AQGLTLCKFEQ"
FT   gene            450433..450624
FT                   /locus_tag="LM5923_0445"
FT   CDS_pept        450433..450624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0445"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70291"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463942.1"
FT                   /protein_id="ADB70291.1"
FT                   VNKTRAFAQGFKQGWSGK"
FT   gene            450651..451460
FT                   /locus_tag="LM5923_0446"
FT   CDS_pept        450651..451460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0446"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70292"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463943.1"
FT                   /protein_id="ADB70292.1"
FT   gene            451754..453154
FT                   /locus_tag="LM5923_0447"
FT   CDS_pept        451754..453154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0447"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70293"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463944.1"
FT                   /protein_id="ADB70293.1"
FT                   KTDSRMVK"
FT   gene            453308..453484
FT                   /locus_tag="LM5923_0448"
FT   CDS_pept        453308..453484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0448"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70294"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463945.1"
FT                   /protein_id="ADB70294.1"
FT                   RLTIEEIFQLEEN"
FT   gene            453486..453896
FT                   /locus_tag="LM5923_0449"
FT   CDS_pept        453486..453896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0449"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70295"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463946.1"
FT                   /protein_id="ADB70295.1"
FT   gene            complement(453949..454248)
FT                   /locus_tag="LM5923_0450"
FT   CDS_pept        complement(453949..454248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70296"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463947.1"
FT                   /protein_id="ADB70296.1"
FT   gene            complement(454328..454882)
FT                   /locus_tag="LM5923_0451"
FT   CDS_pept        complement(454328..454882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0451"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70297"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463948.1"
FT                   /protein_id="ADB70297.1"
FT   gene            455029..455841
FT                   /locus_tag="LM5923_0452"
FT   CDS_pept        455029..455841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0452"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70298"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463949.1"
FT                   /protein_id="ADB70298.1"
FT   gene            complement(455893..457143)
FT                   /locus_tag="LM5923_0453"
FT   CDS_pept        complement(455893..457143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0453"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70299"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463950.1"
FT                   /protein_id="ADB70299.1"
FT                   ILNVYRRKDIVESTLVN"
FT   gene            complement(457140..457571)
FT                   /gene="lstR"
FT                   /locus_tag="LM5923_0454"
FT   CDS_pept        complement(457140..457571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lstR"
FT                   /locus_tag="LM5923_0454"
FT                   /product="lineage-specific thermal regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70300"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463951.1"
FT                   /protein_id="ADB70300.1"
FT   gene            complement(457574..458122)
FT                   /locus_tag="LM5923_0455"
FT   CDS_pept        complement(457574..458122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0455"
FT                   /product="RNA polymerase factor sigma C"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70301"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463952.1"
FT                   /protein_id="ADB70301.1"
FT   gene            complement(458302..459159)
FT                   /locus_tag="LM5923_0456"
FT   CDS_pept        complement(458302..459159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0456"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70302"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463953.1"
FT                   /protein_id="ADB70302.1"
FT                   SLLK"
FT   gene            459275..461281
FT                   /locus_tag="LM5923_0457"
FT   CDS_pept        459275..461281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0457"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70303"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463954.1"
FT                   /protein_id="ADB70303.1"
FT   gene            461281..461745
FT                   /locus_tag="LM5923_0458"
FT   CDS_pept        461281..461745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0458"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70304"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463955.1"
FT                   /protein_id="ADB70304.1"
FT   gene            461742..462062
FT                   /locus_tag="LM5923_0459"
FT   CDS_pept        461742..462062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0459"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70305"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463956.1"
FT                   /protein_id="ADB70305.1"
FT                   EK"
FT   gene            462075..463181
FT                   /locus_tag="LM5923_0460"
FT   CDS_pept        462075..463181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70306"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463957.1"
FT                   /protein_id="ADB70306.1"
FT   gene            463197..465779
FT                   /locus_tag="LM5923_0461"
FT   CDS_pept        463197..465779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0461"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70307"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463958.1"
FT                   /protein_id="ADB70307.1"
FT   gene            complement(465802..466677)
FT                   /locus_tag="LM5923_0462"
FT   CDS_pept        complement(465802..466677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0462"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70308"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463959.1"
FT                   /protein_id="ADB70308.1"
FT                   LRLIQKTCSK"
FT   gene            466795..467364
FT                   /locus_tag="LM5923_0463"
FT   CDS_pept        466795..467364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0463"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70309"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463960.1"
FT                   /protein_id="ADB70309.1"
FT   gene            467378..468124
FT                   /locus_tag="LM5923_0464"
FT   CDS_pept        467378..468124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0464"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70310"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463961.1"
FT                   /protein_id="ADB70310.1"
FT   gene            468409..468507
FT                   /locus_tag="LM5923_0465"
FT   CDS_pept        468409..468507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0465"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70311"
FT                   /inference="ab initio prediction:Glimmer:3.02"
FT                   /protein_id="ADB70311.1"
FT                   /translation="MGFERGDDIEEVKKESFGGKSAGLEFVNNRPF"
FT   gene            468805..471207
FT                   /gene="inlA"
FT                   /locus_tag="LM5923_0466"
FT   CDS_pept        468805..471207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="inlA"
FT                   /locus_tag="LM5923_0466"
FT                   /product="Internalin A"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70312"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463962.1"
FT                   /protein_id="ADB70312.1"
FT   gene            471292..473184
FT                   /gene="inlB"
FT                   /locus_tag="LM5923_0467"
FT   CDS_pept        471292..473184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="inlB"
FT                   /locus_tag="LM5923_0467"
FT                   /product="Internalin B"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70313"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463963.1"
FT                   /protein_id="ADB70313.1"
FT   gene            complement(473270..473755)
FT                   /locus_tag="LM5923_0468"
FT   CDS_pept        complement(473270..473755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0468"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70314"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463965.1"
FT                   /protein_id="ADB70314.1"
FT   gene            473853..474698
FT                   /locus_tag="LM5923_0469"
FT   CDS_pept        473853..474698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0469"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70315"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463966.1"
FT                   /protein_id="ADB70315.1"
FT                   "
FT   gene            474836..475471
FT                   /locus_tag="LM5923_0470"
FT   CDS_pept        474836..475471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70316"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463967.1"
FT                   /protein_id="ADB70316.1"
FT   gene            complement(475504..476772)
FT                   /locus_tag="LM5923_0471"
FT   CDS_pept        complement(475504..476772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0471"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70317"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463968.1"
FT                   /protein_id="ADB70317.1"
FT   gene            476910..477413
FT                   /locus_tag="LM5923_0472"
FT   CDS_pept        476910..477413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0472"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70318"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463969.1"
FT                   /protein_id="ADB70318.1"
FT                   THES"
FT   gene            complement(477457..479493)
FT                   /locus_tag="LM5923_0473"
FT   CDS_pept        complement(477457..479493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0473"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70319"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463970.1"
FT                   /protein_id="ADB70319.1"
FT   gene            479665..479979
FT                   /locus_tag="LM5923_0474"
FT   CDS_pept        479665..479979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0474"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70320"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463971.1"
FT                   /protein_id="ADB70320.1"
FT                   "
FT   gene            480116..481045
FT                   /locus_tag="LM5923_0475"
FT   CDS_pept        480116..481045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0475"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70321"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463972.1"
FT                   /protein_id="ADB70321.1"
FT   gene            481265..484051
FT                   /locus_tag="LM5923_0476"
FT   CDS_pept        481265..484051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0476"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70322"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463973.1"
FT                   /protein_id="ADB70322.1"
FT   gene            484295..485782
FT                   /locus_tag="LM5923_0477"
FT   CDS_pept        484295..485782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0477"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70323"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463974.1"
FT                   /protein_id="ADB70323.1"
FT   gene            486056..487045
FT                   /locus_tag="LM5923_0478"
FT   CDS_pept        486056..487045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0478"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70324"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463975.1"
FT                   /protein_id="ADB70324.1"
FT   gene            487100..488488
FT                   /locus_tag="LM5923_0479"
FT   CDS_pept        487100..488488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0479"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70325"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463976.1"
FT                   /protein_id="ADB70325.1"
FT                   GFTH"
FT   gene            488585..490036
FT                   /locus_tag="LM5923_0480"
FT   CDS_pept        488585..490036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70326"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463977.1"
FT                   /protein_id="ADB70326.1"
FT   gene            490048..490203
FT                   /locus_tag="LM5923_0481"
FT   CDS_pept        490048..490203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0481"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70327"
FT                   /inference="ab initio prediction:Glimmer:3.02"
FT                   /protein_id="ADB70327.1"
FT                   YREKQI"
FT   gene            490501..491226
FT                   /locus_tag="LM5923_0482"
FT   CDS_pept        490501..491226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0482"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70328"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463978.1"
FT                   /protein_id="ADB70328.1"
FT   gene            complement(491269..491934)
FT                   /locus_tag="LM5923_0483"
FT   CDS_pept        complement(491269..491934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0483"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70329"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463979.1"
FT                   /protein_id="ADB70329.1"
FT   gene            complement(491955..492710)
FT                   /locus_tag="LM5923_0484"
FT   CDS_pept        complement(491955..492710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0484"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70330"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463980.1"
FT                   /protein_id="ADB70330.1"
FT   gene            complement(492828..494987)
FT                   /locus_tag="LM5923_0485"
FT   CDS_pept        complement(492828..494987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0485"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70331"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463981.1"
FT                   /protein_id="ADB70331.1"
FT   gene            complement(494984..496132)
FT                   /locus_tag="LM5923_0486"
FT   CDS_pept        complement(494984..496132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0486"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70332"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463982.1"
FT                   /protein_id="ADB70332.1"
FT   gene            complement(496137..497084)
FT                   /locus_tag="LM5923_0487"
FT   CDS_pept        complement(496137..497084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0487"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70333"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463983.1"
FT                   /protein_id="ADB70333.1"
FT   gene            497240..498835
FT                   /locus_tag="LM5923_0488"
FT   CDS_pept        497240..498835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0488"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70334"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463984.1"
FT                   /protein_id="ADB70334.1"
FT                   VAIRRLLGGNNNNK"
FT   gene            498969..500252
FT                   /locus_tag="LM5923_0489"
FT   CDS_pept        498969..500252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0489"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70335"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463985.1"
FT                   /protein_id="ADB70335.1"
FT   gene            500253..501353
FT                   /locus_tag="LM5923_0490"
FT   CDS_pept        500253..501353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70336"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463986.1"
FT                   /protein_id="ADB70336.1"
FT   gene            501346..502896
FT                   /locus_tag="LM5923_0491"
FT   CDS_pept        501346..502896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0491"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70337"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_463987.1"
FT                   /protein_id="ADB70337.1"
FT   gene            503460..504047
FT                   /locus_tag="LM5923_0492"
FT   CDS_pept        503460..504047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0492"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70338"
FT                   /inference="ab initio prediction:Glimmer:3.02"
FT                   /protein_id="ADB70338.1"
FT   gene            504044..504382
FT                   /locus_tag="LM5923_0493"
FT   CDS_pept        504044..504382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0493"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70339"
FT                   /inference="ab initio prediction:Glimmer:3.02"
FT                   /protein_id="ADB70339.1"
FT                   TQETDGNY"
FT   gene            505089..505433
FT                   /locus_tag="LM5923_0494"
FT   CDS_pept        505089..505433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0494"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70340"
FT                   /protein_id="ADB70340.1"
FT                   DIEDGINIAT"
FT   gene            506049..506396
FT                   /locus_tag="LM5923_0496"
FT   CDS_pept        506049..506396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0496"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70341"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464002.1"
FT                   /protein_id="ADB70341.1"
FT                   QFLNNFKTMEQ"
FT   gene            complement(507125..508102)
FT                   /locus_tag="LM5923_0497"
FT   CDS_pept        complement(507125..508102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0497"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70342"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464004.1"
FT                   /protein_id="ADB70342.1"
FT   gene            508208..508369
FT                   /locus_tag="LM5923_0498"
FT   CDS_pept        508208..508369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0498"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70343"
FT                   /inference="ab initio prediction:Glimmer:3.02"
FT                   /protein_id="ADB70343.1"
FT                   MKVVGNLV"
FT   gene            508838..509215
FT                   /locus_tag="LM5923_0499"
FT   CDS_pept        508838..509215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0499"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70344"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464005.1"
FT                   /protein_id="ADB70344.1"
FT   gene            509515..509892
FT                   /locus_tag="LM5923_0500"
FT   CDS_pept        509515..509892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0500"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70345"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464006.1"
FT                   /protein_id="ADB70345.1"
FT   gene            510225..510584
FT                   /locus_tag="LM5923_0501"
FT   CDS_pept        510225..510584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0501"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70346"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464007.1"
FT                   /protein_id="ADB70346.1"
FT                   EDDQVKHPPLQEQND"
FT   gene            510910..511470
FT                   /locus_tag="LM5923_0502"
FT   CDS_pept        510910..511470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0502"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70347"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464008.1"
FT                   /protein_id="ADB70347.1"
FT   gene            511580..513280
FT                   /locus_tag="LM5923_0503"
FT   CDS_pept        511580..513280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0503"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70348"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464009.1"
FT                   /protein_id="ADB70348.1"
FT   gene            513431..514534
FT                   /locus_tag="LM5923_0504"
FT   CDS_pept        513431..514534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0504"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70349"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464010.1"
FT                   /protein_id="ADB70349.1"
FT   gene            514624..515103
FT                   /locus_tag="LM5923_0505"
FT   CDS_pept        514624..515103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0505"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70350"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464011.1"
FT                   /protein_id="ADB70350.1"
FT   gene            515261..515626
FT                   /locus_tag="LM5923_0506"
FT   CDS_pept        515261..515626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0506"
FT                   /product="heme-degrading monooxygenase IsdG"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70351"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464012.1"
FT                   /protein_id="ADB70351.1"
FT                   IARFEVVHVQNPVIVEK"
FT   gene            515795..516370
FT                   /locus_tag="LM5923_0507"
FT   CDS_pept        515795..516370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0507"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70352"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464013.1"
FT                   /protein_id="ADB70352.1"
FT   gene            516435..516605
FT                   /gene="rpmF"
FT                   /locus_tag="LM5923_0508"
FT   CDS_pept        516435..516605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmF"
FT                   /locus_tag="LM5923_0508"
FT                   /product="50S ribosomal protein L32"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70353"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464014.1"
FT                   /protein_id="ADB70353.1"
FT                   GTYKGRTIIEK"
FT   gene            516697..517425
FT                   /locus_tag="LM5923_0509"
FT   CDS_pept        516697..517425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0509"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70354"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464015.1"
FT                   /protein_id="ADB70354.1"
FT   gene            complement(517462..518355)
FT                   /locus_tag="LM5923_0510"
FT   CDS_pept        complement(517462..518355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70355"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464016.1"
FT                   /protein_id="ADB70355.1"
FT                   KAFKDFALRYGKKHFL"
FT   gene            518553..520547
FT                   /locus_tag="LM5923_0511"
FT   CDS_pept        518553..520547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0511"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70356"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464017.1"
FT                   /protein_id="ADB70356.1"
FT   gene            520647..521522
FT                   /gene="aroE"
FT                   /locus_tag="LM5923_0512"
FT   CDS_pept        520647..521522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroE"
FT                   /locus_tag="LM5923_0512"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70357"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464018.1"
FT                   /protein_id="ADB70357.1"
FT                   PVDYIKEILF"
FT   gene            521588..522346
FT                   /gene="aroD"
FT                   /locus_tag="LM5923_0513"
FT   CDS_pept        521588..522346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroD"
FT                   /locus_tag="LM5923_0513"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70358"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464019.1"
FT                   /protein_id="ADB70358.1"
FT   gene            complement(522414..523322)
FT                   /locus_tag="LM5923_0514"
FT   CDS_pept        complement(522414..523322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0514"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70359"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464020.1"
FT                   /protein_id="ADB70359.1"
FT   gene            complement(523397..525157)
FT                   /locus_tag="LM5923_0515"
FT   CDS_pept        complement(523397..525157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0515"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70360"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464021.1"
FT                   /protein_id="ADB70360.1"
FT                   SYIQLPIINK"
FT   gene            525349..525942
FT                   /locus_tag="LM5923_0516"
FT   CDS_pept        525349..525942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0516"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70361"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464022.1"
FT                   /protein_id="ADB70361.1"
FT   gene            526128..527087
FT                   /locus_tag="LM5923_0517"
FT   CDS_pept        526128..527087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0517"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70362"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464023.1"
FT                   /protein_id="ADB70362.1"
FT   gene            527162..527386
FT                   /locus_tag="LM5923_0518"
FT   CDS_pept        527162..527386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0518"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70363"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464024.1"
FT                   /protein_id="ADB70363.1"
FT   gene            complement(527437..528945)
FT                   /locus_tag="LM5923_0519"
FT   CDS_pept        complement(527437..528945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0519"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70364"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464025.1"
FT                   /protein_id="ADB70364.1"
FT   gene            529141..529590
FT                   /locus_tag="LM5923_0520"
FT   CDS_pept        529141..529590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70365"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464026.1"
FT                   /protein_id="ADB70365.1"
FT   gene            529587..530255
FT                   /locus_tag="LM5923_0521"
FT   CDS_pept        529587..530255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0521"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70366"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464027.1"
FT                   /protein_id="ADB70366.1"
FT                   "
FT   gene            530262..530912
FT                   /locus_tag="LM5923_0522"
FT   CDS_pept        530262..530912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0522"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70367"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464028.1"
FT                   /protein_id="ADB70367.1"
FT   gene            531021..533081
FT                   /locus_tag="LM5923_0523"
FT   CDS_pept        531021..533081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0523"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70368"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464029.1"
FT                   /protein_id="ADB70368.1"
FT   gene            533085..533687
FT                   /locus_tag="LM5923_0524"
FT   CDS_pept        533085..533687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0524"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70369"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464030.1"
FT                   /protein_id="ADB70369.1"
FT   gene            533715..534182
FT                   /locus_tag="LM5923_0525"
FT   CDS_pept        533715..534182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0525"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70370"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464031.1"
FT                   /protein_id="ADB70370.1"
FT   gene            534199..534597
FT                   /locus_tag="LM5923_0526"
FT   CDS_pept        534199..534597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0526"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70371"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464032.1"
FT                   /protein_id="ADB70371.1"
FT   gene            534608..535258
FT                   /locus_tag="LM5923_0527"
FT   CDS_pept        534608..535258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0527"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70372"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464033.1"
FT                   /protein_id="ADB70372.1"
FT   gene            535255..536301
FT                   /locus_tag="LM5923_0528"
FT   CDS_pept        535255..536301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0528"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70373"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464034.1"
FT                   /protein_id="ADB70373.1"
FT                   GKILFFPE"
FT   gene            536317..536610
FT                   /locus_tag="LM5923_0529"
FT   CDS_pept        536317..536610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0529"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70374"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464035.1"
FT                   /protein_id="ADB70374.1"
FT   gene            536625..537896
FT                   /locus_tag="LM5923_0530"
FT   CDS_pept        536625..537896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70375"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464036.1"
FT                   /protein_id="ADB70375.1"
FT   gene            538036..538971
FT                   /locus_tag="LM5923_0531"
FT   CDS_pept        538036..538971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0531"
FT                   /product="phosphoribosyl pyrophosphate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70376"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464037.1"
FT                   /protein_id="ADB70376.1"
FT   gene            540078..540656
FT                   /locus_tag="LM5923_0532"
FT   CDS_pept        540078..540656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0532"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70377"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464038.1"
FT                   /protein_id="ADB70377.1"
FT   gene            540745..541443
FT                   /locus_tag="LM5923_0533"
FT   CDS_pept        540745..541443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0533"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70378"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464039.1"
FT                   /protein_id="ADB70378.1"
FT                   LDYLINPKTI"
FT   gene            complement(541468..541830)
FT                   /locus_tag="LM5923_0534"
FT   CDS_pept        complement(541468..541830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0534"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70379"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464040.1"
FT                   /protein_id="ADB70379.1"
FT                   KNDLMYIVNASVETGY"
FT   gene            complement(541834..542292)
FT                   /locus_tag="LM5923_0535"
FT   CDS_pept        complement(541834..542292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0535"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70380"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464041.1"
FT                   /protein_id="ADB70380.1"
FT   gene            542674..544509
FT                   /locus_tag="LM5923_0536"
FT   CDS_pept        542674..544509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0536"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70381"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464042.1"
FT                   /protein_id="ADB70381.1"
FT   gene            544607..545041
FT                   /locus_tag="LM5923_0537"
FT   CDS_pept        544607..545041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0537"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70382"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464043.1"
FT                   /protein_id="ADB70382.1"
FT   gene            complement(545088..546518)
FT                   /locus_tag="LM5923_0538"
FT   CDS_pept        complement(545088..546518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0538"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70383"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464044.1"
FT                   /protein_id="ADB70383.1"
FT                   ISKPIEGGVTEYTYFDPF"
FT   gene            complement(546639..547454)
FT                   /locus_tag="LM5923_0539"
FT   CDS_pept        complement(546639..547454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0539"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70384"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464045.1"
FT                   /protein_id="ADB70384.1"
FT   gene            complement(547735..548103)
FT                   /locus_tag="LM5923_0540"
FT   CDS_pept        complement(547735..548103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70385"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464046.1"
FT                   /protein_id="ADB70385.1"
FT                   LVKQGLPAVLALVAVLLV"
FT   gene            548250..549665
FT                   /locus_tag="LM5923_0541"
FT   CDS_pept        548250..549665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0541"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70386"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464047.1"
FT                   /protein_id="ADB70386.1"
FT                   IGLLCSLFIRKAK"
FT   gene            549794..550801
FT                   /locus_tag="LM5923_0542"
FT   CDS_pept        549794..550801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0542"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70387"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464048.1"
FT                   /protein_id="ADB70387.1"
FT   gene            551004..554066
FT                   /locus_tag="LM5923_0543"
FT   CDS_pept        551004..554066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0543"
FT                   /product="type I restriction enzyme, R subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70388"
FT                   /protein_id="ADB70388.1"
FT   gene            554114..555703
FT                   /locus_tag="LM5923_0544"
FT   CDS_pept        554114..555703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0544"
FT                   /product="type I restriction enzyme M protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70389"
FT                   /protein_id="ADB70389.1"
FT                   KEIIEATKAVFR"
FT   gene            555700..556917
FT                   /locus_tag="LM5923_0545"
FT   CDS_pept        555700..556917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0545"
FT                   /product="type I restriction enzyme, S subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70390"
FT                   /protein_id="ADB70390.1"
FT                   LQTMFI"
FT   gene            557001..557930
FT                   /locus_tag="LM5923_0546"
FT   CDS_pept        557001..557930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0546"
FT                   /product="integrase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70391"
FT                   /protein_id="ADB70391.1"
FT   gene            complement(557973..559142)
FT                   /locus_tag="LM5923_0547"
FT   CDS_pept        complement(557973..559142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0547"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70392"
FT                   /protein_id="ADB70392.1"
FT   gene            complement(559230..560546)
FT                   /locus_tag="LM5923_0548"
FT   CDS_pept        complement(559230..560546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0548"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70393"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464049.1"
FT                   /protein_id="ADB70393.1"
FT   gene            560748..561500
FT                   /locus_tag="LM5923_0549"
FT   CDS_pept        560748..561500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0549"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70394"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464050.1"
FT                   /protein_id="ADB70394.1"
FT   gene            561607..562050
FT                   /locus_tag="LM5923_0550"
FT   CDS_pept        561607..562050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70395"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464051.1"
FT                   /protein_id="ADB70395.1"
FT   gene            complement(562096..563757)
FT                   /locus_tag="LM5923_0551"
FT   CDS_pept        complement(562096..563757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0551"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70396"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464052.1"
FT                   /protein_id="ADB70396.1"
FT   gene            564013..565344
FT                   /locus_tag="LM5923_0552"
FT   CDS_pept        564013..565344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0552"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70397"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464053.1"
FT                   /protein_id="ADB70397.1"
FT   gene            complement(565390..566130)
FT                   /locus_tag="LM5923_0553"
FT   CDS_pept        complement(565390..566130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0553"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70398"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464054.1"
FT                   /protein_id="ADB70398.1"
FT   gene            566360..567835
FT                   /locus_tag="LM5923_0554"
FT   CDS_pept        566360..567835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0554"
FT                   /product="transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70399"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464055.1"
FT                   /protein_id="ADB70399.1"
FT   gene            567828..569324
FT                   /locus_tag="LM5923_0555"
FT   CDS_pept        567828..569324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0555"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70400"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464056.1"
FT                   /protein_id="ADB70400.1"
FT   gene            569335..570585
FT                   /locus_tag="LM5923_0556"
FT   CDS_pept        569335..570585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0556"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70401"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464057.1"
FT                   /protein_id="ADB70401.1"
FT                   KDTVLKRETKWYKTERF"
FT   gene            570601..572652
FT                   /locus_tag="LM5923_0557"
FT   CDS_pept        570601..572652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0557"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70402"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464058.1"
FT                   /protein_id="ADB70402.1"
FT   gene            572665..573519
FT                   /locus_tag="LM5923_0558"
FT   CDS_pept        572665..573519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0558"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70403"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464059.1"
FT                   /protein_id="ADB70403.1"
FT                   YDV"
FT   gene            573579..574409
FT                   /locus_tag="LM5923_0559"
FT   CDS_pept        573579..574409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0559"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70404"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464060.1"
FT                   /protein_id="ADB70404.1"
FT   gene            574487..574756
FT                   /locus_tag="LM5923_0560"
FT   CDS_pept        574487..574756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70405"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464061.1"
FT                   /protein_id="ADB70405.1"
FT   gene            574775..576130
FT                   /locus_tag="LM5923_0561"
FT   CDS_pept        574775..576130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0561"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70406"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464062.1"
FT                   /protein_id="ADB70406.1"
FT   gene            complement(576170..577138)
FT                   /locus_tag="LM5923_0562"
FT   CDS_pept        complement(576170..577138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0562"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70407"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464063.1"
FT                   /protein_id="ADB70407.1"
FT   gene            577310..578632
FT                   /locus_tag="LM5923_0563"
FT   CDS_pept        577310..578632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0563"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70408"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464064.1"
FT                   /protein_id="ADB70408.1"
FT   gene            578736..580007
FT                   /locus_tag="LM5923_0564"
FT   CDS_pept        578736..580007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0564"
FT                   /product="allantoate amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70409"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464065.1"
FT                   /protein_id="ADB70409.1"
FT   gene            579973..581148
FT                   /locus_tag="LM5923_0565"
FT   CDS_pept        579973..581148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0565"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70410"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464066.1"
FT                   /protein_id="ADB70410.1"
FT   gene            complement(581196..582212)
FT                   /locus_tag="LM5923_0566"
FT   CDS_pept        complement(581196..582212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0566"
FT                   /product="tagatose 1,6-diphosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70411"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464067.1"
FT                   /protein_id="ADB70411.1"
FT   gene            582450..583643
FT                   /locus_tag="LM5923_0567"
FT   CDS_pept        582450..583643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0567"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70412"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464068.1"
FT                   /protein_id="ADB70412.1"
FT   gene            complement(583683..584603)
FT                   /locus_tag="LM5923_0568"
FT   CDS_pept        complement(583683..584603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0568"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70413"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464069.1"
FT                   /protein_id="ADB70413.1"
FT   gene            complement(584714..585064)
FT                   /locus_tag="LM5923_0569"
FT   CDS_pept        complement(584714..585064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0569"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70414"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464070.1"
FT                   /protein_id="ADB70414.1"
FT                   FPTITVGDSIQF"
FT   gene            complement(585083..586069)
FT                   /locus_tag="LM5923_0570"
FT   CDS_pept        complement(585083..586069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70415"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464071.1"
FT                   /protein_id="ADB70415.1"
FT   gene            complement(586090..586611)
FT                   /locus_tag="LM5923_0571"
FT   CDS_pept        complement(586090..586611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0571"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70416"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464072.1"
FT                   /protein_id="ADB70416.1"
FT                   TKFLMRKEKV"
FT   gene            complement(586636..587016)
FT                   /locus_tag="LM5923_0572"
FT   CDS_pept        complement(586636..587016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0572"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70417"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464073.1"
FT                   /protein_id="ADB70417.1"
FT   gene            complement(587071..588321)
FT                   /locus_tag="LM5923_0573"
FT   CDS_pept        complement(587071..588321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0573"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70418"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464074.1"
FT                   /protein_id="ADB70418.1"
FT                   STTVWKLRKLQDETFSK"
FT   gene            complement(588579..589526)
FT                   /locus_tag="LM5923_0574"
FT   CDS_pept        complement(588579..589526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0574"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70419"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464075.1"
FT                   /protein_id="ADB70419.1"
FT   gene            589893..590558
FT                   /locus_tag="LM5923_0575"
FT   CDS_pept        589893..590558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0575"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70420"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464076.1"
FT                   /protein_id="ADB70420.1"
FT   gene            590576..592597
FT                   /locus_tag="LM5923_0576"
FT   CDS_pept        590576..592597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0576"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70421"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464077.1"
FT                   /protein_id="ADB70421.1"
FT   gene            592630..592926
FT                   /locus_tag="LM5923_0577"
FT   CDS_pept        592630..592926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0577"
FT                   /product="pepdidoglycan bound protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70422"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464078.1"
FT                   /protein_id="ADB70422.1"
FT   gene            592970..593812
FT                   /locus_tag="LM5923_0578"
FT   CDS_pept        592970..593812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0578"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70423"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464079.1"
FT                   /protein_id="ADB70423.1"
FT   gene            593888..594919
FT                   /locus_tag="LM5923_0579"
FT   CDS_pept        593888..594919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0579"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70424"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464080.1"
FT                   /protein_id="ADB70424.1"
FT                   NEK"
FT   gene            complement(594976..595611)
FT                   /locus_tag="LM5923_0580"
FT   CDS_pept        complement(594976..595611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70425"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464081.1"
FT                   /protein_id="ADB70425.1"
FT   gene            595821..597002
FT                   /locus_tag="LM5923_0581"
FT   CDS_pept        595821..597002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0581"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70426"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464082.1"
FT                   /protein_id="ADB70426.1"
FT   gene            597092..598570
FT                   /locus_tag="LM5923_0582"
FT   CDS_pept        597092..598570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0582"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70427"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464083.1"
FT                   /protein_id="ADB70427.1"
FT   gene            598699..599406
FT                   /locus_tag="LM5923_0583"
FT   CDS_pept        598699..599406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0583"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70428"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464084.1"
FT                   /protein_id="ADB70428.1"
FT                   LYVEAGKKAQGGV"
FT   gene            599407..600102
FT                   /locus_tag="LM5923_0584"
FT   CDS_pept        599407..600102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0584"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70429"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464085.1"
FT                   /protein_id="ADB70429.1"
FT                   IEAGKLVLV"
FT   gene            complement(600144..601184)
FT                   /locus_tag="LM5923_0585"
FT   CDS_pept        complement(600144..601184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0585"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70430"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464086.1"
FT                   /protein_id="ADB70430.1"
FT                   CIKFVK"
FT   gene            601575..602489
FT                   /locus_tag="LM5923_0586"
FT   CDS_pept        601575..602489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0586"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70431"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464087.1"
FT                   /protein_id="ADB70431.1"
FT   gene            complement(602532..603908)
FT                   /locus_tag="LM5923_0587"
FT   CDS_pept        complement(602532..603908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0587"
FT                   /product="glutamate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70432"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464088.1"
FT                   /protein_id="ADB70432.1"
FT                   "
FT   gene            complement(604401..604712)
FT                   /gene="hisE"
FT                   /locus_tag="LM5923_0588"
FT   CDS_pept        complement(604401..604712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisE"
FT                   /locus_tag="LM5923_0588"
FT                   /product="phosphoribosyl-ATP pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70433"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464089.1"
FT                   /protein_id="ADB70433.1"
FT   gene            complement(604713..605030)
FT                   /locus_tag="LM5923_0589"
FT   CDS_pept        complement(604713..605030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0589"
FT                   /product="phosphoribosyl-AMP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70434"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464090.1"
FT                   /protein_id="ADB70434.1"
FT                   F"
FT   gene            complement(605027..605782)
FT                   /gene="hisF"
FT                   /locus_tag="LM5923_0590"
FT   CDS_pept        complement(605027..605782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisF"
FT                   /locus_tag="LM5923_0590"
FT                   /product="imidazole glycerol phosphate synthase subunit
FT                   HisF"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70435"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464091.1"
FT                   /protein_id="ADB70435.1"
FT   gene            complement(605772..606494)
FT                   /gene="hisA"
FT                   /locus_tag="LM5923_0591"
FT   CDS_pept        complement(605772..606494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisA"
FT                   /locus_tag="LM5923_0591"
FT                   /product="1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]
FT                   imidazole-4-carboxamide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70436"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464092.1"
FT                   /protein_id="ADB70436.1"
FT                   YNHHISMSDIVEVEQIAY"
FT   gene            complement(606473..607099)
FT                   /gene="hisH"
FT                   /locus_tag="LM5923_0592"
FT   CDS_pept        complement(606473..607099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisH"
FT                   /locus_tag="LM5923_0592"
FT                   /product="imidazole glycerol phosphate synthase subunit
FT                   HisH"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70437"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464093.1"
FT                   /protein_id="ADB70437.1"
FT   gene            complement(607100..607684)
FT                   /gene="hisB"
FT                   /locus_tag="LM5923_0593"
FT   CDS_pept        complement(607100..607684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisB"
FT                   /locus_tag="LM5923_0593"
FT                   /product="imidazoleglycerol-phosphate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70438"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464094.1"
FT                   /protein_id="ADB70438.1"
FT   gene            complement(607685..608968)
FT                   /gene="hisD"
FT                   /locus_tag="LM5923_0594"
FT   CDS_pept        complement(607685..608968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisD"
FT                   /locus_tag="LM5923_0594"
FT                   /product="histidinol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70439"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464095.1"
FT                   /protein_id="ADB70439.1"
FT   gene            complement(608965..609606)
FT                   /gene="hisG"
FT                   /locus_tag="LM5923_0595"
FT   CDS_pept        complement(608965..609606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisG"
FT                   /locus_tag="LM5923_0595"
FT                   /product="ATP phosphoribosyltransferase catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70440"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464096.1"
FT                   /protein_id="ADB70440.1"
FT   gene            complement(609603..610784)
FT                   /gene="hisZ"
FT                   /locus_tag="LM5923_0596"
FT   CDS_pept        complement(609603..610784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisZ"
FT                   /locus_tag="LM5923_0596"
FT                   /product="ATP phosphoribosyltransferase regulatory subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70441"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464097.1"
FT                   /protein_id="ADB70441.1"
FT   gene            610936..611763
FT                   /gene="hisJ"
FT                   /locus_tag="LM5923_0597"
FT   CDS_pept        610936..611763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisJ"
FT                   /locus_tag="LM5923_0597"
FT                   /product="histidinol-phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70442"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464098.1"
FT                   /protein_id="ADB70442.1"
FT   gene            complement(611748..612044)
FT                   /locus_tag="LM5923_0598"
FT   CDS_pept        complement(611748..612044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0598"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70443"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464099.1"
FT                   /protein_id="ADB70443.1"
FT   gene            612121..613152
FT                   /locus_tag="LM5923_0599"
FT   CDS_pept        612121..613152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0599"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70444"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464100.1"
FT                   /protein_id="ADB70444.1"
FT                   YYD"
FT   gene            complement(613193..614488)
FT                   /locus_tag="LM5923_0600"
FT   CDS_pept        complement(613193..614488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70445"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464101.1"
FT                   /protein_id="ADB70445.1"
FT   gene            614804..616198
FT                   /locus_tag="LM5923_0601"
FT   CDS_pept        614804..616198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0601"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70446"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464102.1"
FT                   /protein_id="ADB70446.1"
FT                   NNGFED"
FT   gene            616242..616970
FT                   /locus_tag="LM5923_0602"
FT   CDS_pept        616242..616970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0602"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70447"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464103.1"
FT                   /protein_id="ADB70447.1"
FT   gene            617400..618863
FT                   /locus_tag="LM5923_0603"
FT   CDS_pept        617400..618863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0603"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70448"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464104.1"
FT                   /protein_id="ADB70448.1"
FT   gene            complement(618917..619375)
FT                   /locus_tag="LM5923_0604"
FT   CDS_pept        complement(618917..619375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0604"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70449"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464105.1"
FT                   /protein_id="ADB70449.1"
FT   gene            complement(619389..620141)
FT                   /locus_tag="LM5923_0605"
FT   CDS_pept        complement(619389..620141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0605"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70450"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464106.1"
FT                   /protein_id="ADB70450.1"
FT   gene            620306..620515
FT                   /locus_tag="LM5923_0606"
FT   CDS_pept        620306..620515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0606"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70451"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464107.1"
FT                   /protein_id="ADB70451.1"
FT   gene            620531..621193
FT                   /locus_tag="LM5923_0607"
FT   CDS_pept        620531..621193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0607"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70452"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464108.1"
FT                   /protein_id="ADB70452.1"
FT   gene            complement(621224..622408)
FT                   /locus_tag="LM5923_0608"
FT   CDS_pept        complement(621224..622408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0608"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70453"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464109.1"
FT                   /protein_id="ADB70453.1"
FT   gene            complement(622496..623944)
FT                   /gene="iap"
FT                   /locus_tag="LM5923_0609"
FT   CDS_pept        complement(622496..623944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iap"
FT                   /locus_tag="LM5923_0609"
FT                   /product="P60 extracellular protein, invasion associated
FT                   protein Iap"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70454"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464110.1"
FT                   /protein_id="ADB70454.1"
FT   gene            624363..626693
FT                   /locus_tag="LM5923_0610"
FT   CDS_pept        624363..626693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0610"
FT                   /product="preprotein translocase subunit SecA"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70455"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464111.1"
FT                   /protein_id="ADB70455.1"
FT   gene            626809..627981
FT                   /locus_tag="LM5923_0611"
FT   CDS_pept        626809..627981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0611"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70456"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464112.1"
FT                   /protein_id="ADB70456.1"
FT   gene            628240..628953
FT                   /locus_tag="LM5923_0612"
FT   CDS_pept        628240..628953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0612"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70457"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464113.1"
FT                   /protein_id="ADB70457.1"
FT                   HEATITWTLSDAPGV"
FT   gene            629021..630046
FT                   /locus_tag="LM5923_0613"
FT   CDS_pept        629021..630046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0613"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70458"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464114.1"
FT                   /protein_id="ADB70458.1"
FT                   K"
FT   gene            630064..632529
FT                   /locus_tag="LM5923_0614"
FT   CDS_pept        630064..632529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0614"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70459"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464115.1"
FT                   /protein_id="ADB70459.1"
FT                   IEWTLTDAP"
FT   gene            632642..634045
FT                   /locus_tag="LM5923_0615"
FT   CDS_pept        632642..634045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0615"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70460"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464116.1"
FT                   /protein_id="ADB70460.1"
FT                   SKEHYRGNI"
FT   gene            634183..634596
FT                   /locus_tag="LM5923_0616"
FT   CDS_pept        634183..634596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0616"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70461"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464117.1"
FT                   /protein_id="ADB70461.1"
FT   gene            634596..636365
FT                   /locus_tag="LM5923_0617"
FT   CDS_pept        634596..636365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0617"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70462"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464118.1"
FT                   /protein_id="ADB70462.1"
FT                   SVAVAGIKKEETI"
FT   gene            636362..637135
FT                   /locus_tag="LM5923_0618"
FT   CDS_pept        636362..637135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0618"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70463"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464119.1"
FT                   /protein_id="ADB70463.1"
FT   gene            637263..637805
FT                   /locus_tag="LM5923_0619"
FT   CDS_pept        637263..637805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0619"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70464"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464120.1"
FT                   /protein_id="ADB70464.1"
FT                   ETEGKAKDSAKKHWFSK"
FT   gene            638033..638833
FT                   /locus_tag="LM5923_0620"
FT   CDS_pept        638033..638833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70465"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464121.1"
FT                   /protein_id="ADB70465.1"
FT   gene            complement(638872..639978)
FT                   /gene="metX"
FT                   /locus_tag="LM5923_0621"
FT   CDS_pept        complement(638872..639978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metX"
FT                   /locus_tag="LM5923_0621"
FT                   /product="homoserine O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70466"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464122.1"
FT                   /protein_id="ADB70466.1"
FT   gene            complement(639995..641272)
FT                   /locus_tag="LM5923_0622"
FT   CDS_pept        complement(639995..641272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0622"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70467"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464123.1"
FT                   /protein_id="ADB70467.1"
FT   gene            641720..642247
FT                   /locus_tag="LM5923_0623"
FT   CDS_pept        641720..642247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0623"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70468"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464124.1"
FT                   /protein_id="ADB70468.1"
FT                   AIATFFFIGKNS"
FT   gene            complement(642336..643037)
FT                   /locus_tag="LM5923_0624"
FT   CDS_pept        complement(642336..643037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0624"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70469"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464125.1"
FT                   /protein_id="ADB70469.1"
FT                   QKLKENHEPYI"
FT   gene            complement(643113..643661)
FT                   /locus_tag="LM5923_0625"
FT   CDS_pept        complement(643113..643661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0625"
FT                   /product="putative biotin biosynthesis protein BioY"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70470"
FT                   /protein_id="ADB70470.1"
FT   gene            643855..644187
FT                   /locus_tag="LM5923_0626"
FT   CDS_pept        643855..644187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0626"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70471"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464126.1"
FT                   /protein_id="ADB70471.1"
FT                   GEAVNE"
FT   gene            644180..644770
FT                   /locus_tag="LM5923_0627"
FT   CDS_pept        644180..644770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0627"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70472"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464127.1"
FT                   /protein_id="ADB70472.1"
FT   gene            644763..645863
FT                   /locus_tag="LM5923_0628"
FT   CDS_pept        644763..645863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0628"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70473"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464128.1"
FT                   /protein_id="ADB70473.1"
FT   gene            645966..646469
FT                   /locus_tag="LM5923_0629"
FT   CDS_pept        645966..646469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0629"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70474"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464129.1"
FT                   /protein_id="ADB70474.1"
FT                   FEEE"
FT   gene            complement(646517..646903)
FT                   /locus_tag="LM5923_0630"
FT   CDS_pept        complement(646517..646903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70475"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464130.1"
FT                   /protein_id="ADB70475.1"
FT   gene            complement(646955..647299)
FT                   /locus_tag="LM5923_0631"
FT   CDS_pept        complement(646955..647299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0631"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70476"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464131.1"
FT                   /protein_id="ADB70476.1"
FT                   KHSDDNWARC"
FT   gene            complement(647446..648786)
FT                   /locus_tag="LM5923_0632"
FT   CDS_pept        complement(647446..648786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0632"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70477"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464132.1"
FT                   /protein_id="ADB70477.1"
FT   gene            648931..649413
FT                   /locus_tag="LM5923_0633"
FT   CDS_pept        648931..649413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0633"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70478"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464133.1"
FT                   /protein_id="ADB70478.1"
FT   gene            649421..651145
FT                   /locus_tag="LM5923_0634"
FT   CDS_pept        649421..651145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0634"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70479"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464134.1"
FT                   /protein_id="ADB70479.1"
FT   gene            651142..652959
FT                   /locus_tag="LM5923_0635"
FT   CDS_pept        651142..652959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0635"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70480"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464135.1"
FT                   /protein_id="ADB70480.1"
FT   gene            653075..653374
FT                   /locus_tag="LM5923_0636"
FT   CDS_pept        653075..653374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0636"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70481"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464136.1"
FT                   /protein_id="ADB70481.1"
FT   gene            complement(653419..655188)
FT                   /locus_tag="LM5923_0637"
FT   CDS_pept        complement(653419..655188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0637"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70482"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464137.1"
FT                   /protein_id="ADB70482.1"
FT                   GGAILFFRKRKHS"
FT   gene            complement(655349..655975)
FT                   /gene="acpD"
FT                   /locus_tag="LM5923_0638"
FT   CDS_pept        complement(655349..655975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpD"
FT                   /locus_tag="LM5923_0638"
FT                   /product="azoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70483"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464138.1"
FT                   /protein_id="ADB70483.1"
FT   gene            656144..656599
FT                   /locus_tag="LM5923_0639"
FT   CDS_pept        656144..656599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0639"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70484"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464139.1"
FT                   /protein_id="ADB70484.1"
FT   gene            656596..657537
FT                   /locus_tag="LM5923_0640"
FT   CDS_pept        656596..657537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70485"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464140.1"
FT                   /protein_id="ADB70485.1"
FT   gene            657633..658166
FT                   /locus_tag="LM5923_0641"
FT   CDS_pept        657633..658166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0641"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70486"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464141.1"
FT                   /protein_id="ADB70486.1"
FT                   DRRYLDVTMMYLVI"
FT   gene            complement(658163..658405)
FT                   /locus_tag="LM5923_0642"
FT   CDS_pept        complement(658163..658405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0642"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70487"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464142.1"
FT                   /protein_id="ADB70487.1"
FT   gene            658512..660263
FT                   /locus_tag="LM5923_0643"
FT   CDS_pept        658512..660263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0643"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70488"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464143.1"
FT                   /protein_id="ADB70488.1"
FT                   IENRLGF"
FT   gene            complement(660304..660798)
FT                   /locus_tag="LM5923_0644"
FT   CDS_pept        complement(660304..660798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0644"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70489"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464144.1"
FT                   /protein_id="ADB70489.1"
FT                   K"
FT   gene            complement(660878..662020)
FT                   /locus_tag="LM5923_0645"
FT   CDS_pept        complement(660878..662020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0645"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70490"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464145.1"
FT                   /protein_id="ADB70490.1"
FT   gene            662127..662582
FT                   /locus_tag="LM5923_0646"
FT   CDS_pept        662127..662582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0646"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70491"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464146.1"
FT                   /protein_id="ADB70491.1"
FT   gene            662638..663030
FT                   /locus_tag="LM5923_0647"
FT   CDS_pept        662638..663030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0647"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70492"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464147.1"
FT                   /protein_id="ADB70492.1"
FT   gene            663127..663867
FT                   /locus_tag="LM5923_0648"
FT   CDS_pept        663127..663867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0648"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70493"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464148.1"
FT                   /protein_id="ADB70493.1"
FT   gene            663953..664231
FT                   /locus_tag="LM5923_0649"
FT   CDS_pept        663953..664231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0649"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70494"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464149.1"
FT                   /protein_id="ADB70494.1"
FT   gene            664247..664513
FT                   /locus_tag="LM5923_0650"
FT   CDS_pept        664247..664513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70495"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464150.1"
FT                   /protein_id="ADB70495.1"
FT   gene            complement(664551..664994)
FT                   /locus_tag="LM5923_0651"
FT   CDS_pept        complement(664551..664994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0651"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70496"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464151.1"
FT                   /protein_id="ADB70496.1"
FT   gene            complement(665025..665726)
FT                   /locus_tag="LM5923_0652"
FT   CDS_pept        complement(665025..665726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0652"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70497"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464152.1"
FT                   /protein_id="ADB70497.1"
FT                   RFIQYASFHKA"
FT   gene            complement(665812..667491)
FT                   /locus_tag="LM5923_0653"
FT   CDS_pept        complement(665812..667491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0653"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70498"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464153.1"
FT                   /protein_id="ADB70498.1"
FT   gene            667797..672545
FT                   /locus_tag="LM5923_0654"
FT   CDS_pept        667797..672545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0654"
FT                   /product="pepdidoglycan bound protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70499"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464154.1"
FT                   /protein_id="ADB70499.1"
FT                   SAK"
FT   gene            672638..672916
FT                   /locus_tag="LM5923_0655"
FT   CDS_pept        672638..672916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0655"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70500"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464155.1"
FT                   /protein_id="ADB70500.1"
FT   gene            672978..673505
FT                   /locus_tag="LM5923_0656"
FT   CDS_pept        672978..673505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0656"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70501"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464156.1"
FT                   /protein_id="ADB70501.1"
FT                   SMEETIKEMEHN"
FT   gene            673864..675894
FT                   /locus_tag="LM5923_0657"
FT   CDS_pept        673864..675894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0657"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70502"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464157.1"
FT                   /protein_id="ADB70502.1"
FT   gene            675896..676348
FT                   /locus_tag="LM5923_0658"
FT   CDS_pept        675896..676348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0658"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70503"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464158.1"
FT                   /protein_id="ADB70503.1"
FT   gene            676349..677410
FT                   /locus_tag="LM5923_0659"
FT   CDS_pept        676349..677410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0659"
FT                   /product="putative fructose-like permease EIIC subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70504"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464159.1"
FT                   /protein_id="ADB70504.1"
FT                   QDIDDLDINFEDI"
FT   gene            677425..677733
FT                   /locus_tag="LM5923_0660"
FT   CDS_pept        677425..677733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0660"
FT                   /product="putative fructose-like phosphotransferase EIIB
FT                   subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70505"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464160.1"
FT                   /protein_id="ADB70505.1"
FT   gene            677760..679028
FT                   /locus_tag="LM5923_0661"
FT   CDS_pept        677760..679028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0661"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70506"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464161.1"
FT                   /protein_id="ADB70506.1"
FT   gene            679118..679822
FT                   /locus_tag="LM5923_0662"
FT   CDS_pept        679118..679822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0662"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70507"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464162.1"
FT                   /protein_id="ADB70507.1"
FT                   EQQLFAILQEIF"
FT   gene            679927..680343
FT                   /locus_tag="LM5923_0663"
FT   CDS_pept        679927..680343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0663"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70508"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464163.1"
FT                   /protein_id="ADB70508.1"
FT   gene            680357..680950
FT                   /locus_tag="LM5923_0664"
FT   CDS_pept        680357..680950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0664"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70509"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464164.1"
FT                   /protein_id="ADB70509.1"
FT   gene            complement(681030..681108)
FT                   /locus_tag="LM5923_tRNA04"
FT   tRNA            complement(681030..681108)
FT                   /locus_tag="LM5923_tRNA04"
FT                   /product="tRNA-Ser"
FT                   /note="Cove score: 63.08"
FT                   /inference="ab initio prediction:tRNAscan-SE:1.23"
FT   gene            682237..683100
FT                   /locus_tag="LM5923_0665"
FT   CDS_pept        682237..683100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0665"
FT                   /product="glutamyl endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70510"
FT                   /protein_id="ADB70510.1"
FT                   FIDGAK"
FT   gene            683100..683459
FT                   /locus_tag="LM5923_0666"
FT   CDS_pept        683100..683459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0666"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70511"
FT                   /protein_id="ADB70511.1"
FT                   KIDSMDVIKIIKLNS"
FT   gene            683557..683679
FT                   /locus_tag="LM5923_0667"
FT   CDS_pept        683557..683679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0667"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70512"
FT                   /inference="ab initio prediction:Glimmer:3.02"
FT                   /protein_id="ADB70512.1"
FT   gene            683991..684524
FT                   /locus_tag="LM5923_0668"
FT   CDS_pept        683991..684524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0668"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70513"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464166.1"
FT                   /protein_id="ADB70513.1"
FT                   VEDTDKGINFYSEG"
FT   gene            684588..685505
FT                   /locus_tag="LM5923_0669"
FT   CDS_pept        684588..685505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0669"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70514"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464167.1"
FT                   /protein_id="ADB70514.1"
FT   gene            685771..687651
FT                   /locus_tag="LM5923_0670"
FT   CDS_pept        685771..687651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70515"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464168.1"
FT                   /protein_id="ADB70515.1"
FT   gene            687747..688475
FT                   /locus_tag="LM5923_0671"
FT   CDS_pept        687747..688475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0671"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70516"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464169.1"
FT                   /protein_id="ADB70516.1"
FT   gene            688448..688585
FT                   /locus_tag="LM5923_0672"
FT   CDS_pept        688448..688585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0672"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70517"
FT                   /inference="ab initio prediction:Glimmer:3.02"
FT                   /protein_id="ADB70517.1"
FT                   "
FT   gene            688618..689268
FT                   /locus_tag="LM5923_0673"
FT   CDS_pept        688618..689268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0673"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70518"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464170.1"
FT                   /protein_id="ADB70518.1"
FT   gene            complement(689308..691149)
FT                   /locus_tag="LM5923_0674"
FT   CDS_pept        complement(689308..691149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0674"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70519"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464171.1"
FT                   /protein_id="ADB70519.1"
FT   gene            691363..692754
FT                   /locus_tag="LM5923_0675"
FT   CDS_pept        691363..692754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0675"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70520"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464172.1"
FT                   /protein_id="ADB70520.1"
FT                   ELLKK"
FT   gene            692844..693683
FT                   /locus_tag="LM5923_0676"
FT   CDS_pept        692844..693683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0676"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70521"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464173.1"
FT                   /protein_id="ADB70521.1"
FT   gene            complement(693766..694050)
FT                   /locus_tag="LM5923_0677"
FT   CDS_pept        complement(693766..694050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0677"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70522"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464174.1"
FT                   /protein_id="ADB70522.1"
FT   gene            694148..695098
FT                   /locus_tag="LM5923_0678"
FT   CDS_pept        694148..695098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0678"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0678"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70523"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464175.1"
FT                   /protein_id="ADB70523.1"
FT   gene            695122..695763
FT                   /locus_tag="LM5923_0679"
FT   CDS_pept        695122..695763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0679"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0679"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70524"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464176.1"
FT                   /protein_id="ADB70524.1"
FT   gene            695806..698496
FT                   /locus_tag="LM5923_0680"
FT   CDS_pept        695806..698496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70525"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464177.1"
FT                   /protein_id="ADB70525.1"
FT   gene            698542..699189
FT                   /locus_tag="LM5923_0681"
FT   CDS_pept        698542..699189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0681"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0681"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70526"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464178.1"
FT                   /protein_id="ADB70526.1"
FT   gene            complement(699198..699734)
FT                   /locus_tag="LM5923_0682"
FT   CDS_pept        complement(699198..699734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0682"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70527"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464179.1"
FT                   /protein_id="ADB70527.1"
FT                   TKNGFHLYQKKLPQK"
FT   gene            complement(699721..700644)
FT                   /locus_tag="LM5923_0683"
FT   CDS_pept        complement(699721..700644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0683"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0683"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70528"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464180.1"
FT                   /protein_id="ADB70528.1"
FT   gene            700832..701041
FT                   /locus_tag="LM5923_0684"
FT   CDS_pept        700832..701041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0684"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0684"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70529"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464181.1"
FT                   /protein_id="ADB70529.1"
FT   gene            701109..701816
FT                   /locus_tag="LM5923_0685"
FT   CDS_pept        701109..701816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0685"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0685"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70530"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464182.1"
FT                   /protein_id="ADB70530.1"
FT                   EEKVITKSFSVKK"
FT   gene            complement(701860..702423)
FT                   /locus_tag="LM5923_0686"
FT   CDS_pept        complement(701860..702423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0686"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0686"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70531"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464183.1"
FT                   /protein_id="ADB70531.1"
FT   gene            702543..702959
FT                   /locus_tag="LM5923_0687"
FT   CDS_pept        702543..702959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0687"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0687"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70532"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464184.1"
FT                   /protein_id="ADB70532.1"
FT   gene            703011..703646
FT                   /locus_tag="LM5923_0688"
FT   CDS_pept        703011..703646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0688"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0688"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70533"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464185.1"
FT                   /protein_id="ADB70533.1"
FT   gene            complement(703636..704532)
FT                   /locus_tag="LM5923_0689"
FT   CDS_pept        complement(703636..704532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0689"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0689"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70534"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464186.1"
FT                   /protein_id="ADB70534.1"
FT                   ILLDQFIQLEGIDILNY"
FT   gene            704636..704770
FT                   /locus_tag="LM5923_0690"
FT   CDS_pept        704636..704770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0690"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70535"
FT                   /inference="ab initio prediction:Glimmer:3.02"
FT                   /protein_id="ADB70535.1"
FT   gene            704763..705047
FT                   /locus_tag="LM5923_0691"
FT   CDS_pept        704763..705047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0691"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0691"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70536"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464187.1"
FT                   /protein_id="ADB70536.1"
FT   gene            complement(705102..705410)
FT                   /locus_tag="LM5923_0692"
FT   CDS_pept        complement(705102..705410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0692"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0692"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70537"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464188.1"
FT                   /protein_id="ADB70537.1"
FT   gene            complement(705473..706288)
FT                   /gene="thiD"
FT                   /locus_tag="LM5923_0693"
FT   CDS_pept        complement(705473..706288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiD"
FT                   /locus_tag="LM5923_0693"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0693"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70538"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464189.1"
FT                   /protein_id="ADB70538.1"
FT   gene            complement(706314..707180)
FT                   /locus_tag="LM5923_0694"
FT   CDS_pept        complement(706314..707180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0694"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0694"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70539"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464190.1"
FT                   /protein_id="ADB70539.1"
FT                   KMLETND"
FT   gene            707354..707917
FT                   /locus_tag="LM5923_0695"
FT   CDS_pept        707354..707917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0695"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70540"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464191.1"
FT                   /protein_id="ADB70540.1"
FT   gene            707914..708177
FT                   /locus_tag="LM5923_0696"
FT   CDS_pept        707914..708177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0696"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0696"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70541"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464192.1"
FT                   /protein_id="ADB70541.1"
FT   gene            708187..708564
FT                   /locus_tag="LM5923_0697"
FT   CDS_pept        708187..708564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0697"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0697"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70542"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464193.1"
FT                   /protein_id="ADB70542.1"
FT   gene            708678..709613
FT                   /locus_tag="LM5923_0698"
FT   CDS_pept        708678..709613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0698"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0698"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70543"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464194.1"
FT                   /protein_id="ADB70543.1"
FT   gene            709606..710376
FT                   /locus_tag="LM5923_0699"
FT   CDS_pept        709606..710376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0699"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0699"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70544"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464195.1"
FT                   /protein_id="ADB70544.1"
FT   gene            710509..710625
FT                   /locus_tag="LM5923_0700"
FT   CDS_pept        710509..710625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0700"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70545"
FT                   /inference="ab initio prediction:Glimmer:3.02"
FT                   /protein_id="ADB70545.1"
FT   gene            710637..711518
FT                   /locus_tag="LM5923_0701"
FT   CDS_pept        710637..711518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0701"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0701"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70546"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464196.1"
FT                   /protein_id="ADB70546.1"
FT                   QVYGITGGAPIN"
FT   gene            711536..711712
FT                   /locus_tag="LM5923_0702"
FT   CDS_pept        711536..711712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0702"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0702"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70547"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464197.1"
FT                   /protein_id="ADB70547.1"
FT                   SKAEEWYKNHKES"
FT   gene            711838..712446
FT                   /locus_tag="LM5923_0703"
FT   CDS_pept        711838..712446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0703"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0703"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70548"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464198.1"
FT                   /protein_id="ADB70548.1"
FT   gene            712972..713070
FT                   /locus_tag="LM5923_0704"
FT   CDS_pept        712972..713070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0704"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0704"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70549"
FT                   /inference="ab initio prediction:Glimmer:3.02"
FT                   /protein_id="ADB70549.1"
FT                   /translation="MSNFNIMGSLMLIAVLVLAVYVITKVINKLKK"
FT   gene            713361..713789
FT                   /locus_tag="LM5923_0705"
FT   CDS_pept        713361..713789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0705"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0705"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70550"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464199.1"
FT                   /protein_id="ADB70550.1"
FT   gene            complement(713828..714037)
FT                   /locus_tag="LM5923_0706"
FT   CDS_pept        complement(713828..714037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0706"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0706"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70551"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464200.1"
FT                   /protein_id="ADB70551.1"
FT   gene            complement(714056..714976)
FT                   /locus_tag="LM5923_0708"
FT   CDS_pept        complement(714056..714976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0708"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0708"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70552"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464201.1"
FT                   /protein_id="ADB70552.1"
FT   gene            715348..715662
FT                   /locus_tag="LM5923_0709"
FT   CDS_pept        715348..715662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0709"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0709"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70553"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464202.1"
FT                   /protein_id="ADB70553.1"
FT                   "
FT   gene            715655..716422
FT                   /gene="fliP"
FT                   /locus_tag="LM5923_0710"
FT   CDS_pept        715655..716422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliP"
FT                   /locus_tag="LM5923_0710"
FT                   /product="flagellar biosynthesis protein FliP"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0710"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70554"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464203.1"
FT                   /protein_id="ADB70554.1"
FT   gene            716435..716707
FT                   /gene="fliQ"
FT                   /locus_tag="LM5923_0711"
FT   CDS_pept        716435..716707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliQ"
FT                   /locus_tag="LM5923_0711"
FT                   /product="flagellar biosynthesis protein FliQ"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0711"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70555"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464204.1"
FT                   /protein_id="ADB70555.1"
FT   gene            716710..717471
FT                   /gene="fliR"
FT                   /locus_tag="LM5923_0712"
FT   CDS_pept        716710..717471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliR"
FT                   /locus_tag="LM5923_0712"
FT                   /product="flagellar biosynthesis protein FliR"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0712"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70556"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464205.1"
FT                   /protein_id="ADB70556.1"
FT   gene            717487..718533
FT                   /gene="flhB"
FT                   /locus_tag="LM5923_0713"
FT   CDS_pept        717487..718533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhB"
FT                   /locus_tag="LM5923_0713"
FT                   /product="flagellar biosynthesis protein FlhB"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0713"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70557"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464206.1"
FT                   /protein_id="ADB70557.1"
FT                   MDADKIKF"
FT   gene            718580..720655
FT                   /gene="flhA"
FT                   /locus_tag="LM5923_0714"
FT   CDS_pept        718580..720655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhA"
FT                   /locus_tag="LM5923_0714"
FT                   /product="flagellar biosynthesis protein FlhA"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0714"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70558"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464207.1"
FT                   /protein_id="ADB70558.1"
FT   gene            720677..721900
FT                   /locus_tag="LM5923_0715"
FT   CDS_pept        720677..721900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0715"
FT                   /product="flagellar biosynthesis regulator FlhF"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0715"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70559"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464208.1"
FT                   /protein_id="ADB70559.1"
FT                   TDRRQVVE"
FT   gene            721897..722676
FT                   /gene="flgG"
FT                   /locus_tag="LM5923_0716"
FT   CDS_pept        721897..722676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgG"
FT                   /locus_tag="LM5923_0716"
FT                   /product="flagellar basal body rod protein FlgG"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0716"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70560"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464209.1"
FT                   /protein_id="ADB70560.1"
FT   gene            722705..723493
FT                   /locus_tag="LM5923_0717"
FT   CDS_pept        722705..723493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0717"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0717"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70561"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464210.1"
FT                   /protein_id="ADB70561.1"
FT   gene            723518..723853
FT                   /locus_tag="LM5923_0718"
FT   CDS_pept        723518..723853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0718"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0718"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70562"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464211.1"
FT                   /protein_id="ADB70562.1"
FT                   NEVELVR"
FT   gene            723880..724731
FT                   /locus_tag="LM5923_0719"
FT   CDS_pept        723880..724731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0719"
FT                   /product="flagellar motor protein MotA"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0719"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70563"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464212.1"
FT                   /protein_id="ADB70563.1"
FT                   TR"
FT   gene            724691..725518
FT                   /gene="motB"
FT                   /locus_tag="LM5923_0720"
FT   CDS_pept        724691..725518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motB"
FT                   /locus_tag="LM5923_0720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0720"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70564"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464213.1"
FT                   /protein_id="ADB70564.1"
FT   gene            725528..726028
FT                   /locus_tag="LM5923_0721"
FT   CDS_pept        725528..726028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0721"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0721"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70565"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464214.1"
FT                   /protein_id="ADB70565.1"
FT                   LVN"
FT   gene            726051..727964
FT                   /locus_tag="LM5923_0722"
FT   CDS_pept        726051..727964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0722"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0722"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70566"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464215.1"
FT                   /protein_id="ADB70566.1"
FT                   NR"
FT   gene            727977..728885
FT                   /locus_tag="LM5923_0723"
FT   CDS_pept        727977..728885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0723"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0723"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70567"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464216.1"
FT                   /protein_id="ADB70567.1"
FT   gene            729123..729986
FT                   /gene="flaA"
FT                   /locus_tag="LM5923_0724"
FT   CDS_pept        729123..729986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flaA"
FT                   /locus_tag="LM5923_0724"
FT                   /product="flagellin"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0724"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70568"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464217.1"
FT                   /protein_id="ADB70568.1"
FT                   TQLINS"
FT   gene            730261..730620
FT                   /gene="cheY"
FT                   /locus_tag="LM5923_0725"
FT   CDS_pept        730261..730620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheY"
FT                   /locus_tag="LM5923_0725"
FT                   /product="chemotaxis response regulator CheY"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0725"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70569"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464218.1"
FT                   /protein_id="ADB70569.1"
FT                   FQADRVLEALEKAAK"
FT   gene            730640..732496
FT                   /gene="cheA"
FT                   /locus_tag="LM5923_0726"
FT   CDS_pept        730640..732496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheA"
FT                   /locus_tag="LM5923_0726"
FT                   /product="two-component sensor histidine kinase CheA"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0726"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70570"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464219.1"
FT                   /protein_id="ADB70570.1"
FT   gene            732506..732808
FT                   /locus_tag="LM5923_0727"
FT   CDS_pept        732506..732808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0727"
FT                   /product="flagellar motor switch protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0727"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70571"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464220.1"
FT                   /protein_id="ADB70571.1"
FT   gene            732851..733237
FT                   /locus_tag="LM5923_0728"
FT   CDS_pept        732851..733237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0728"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0728"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70572"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464221.1"
FT                   /protein_id="ADB70572.1"
FT   gene            733253..734299
FT                   /locus_tag="LM5923_0729"
FT   CDS_pept        733253..734299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0729"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0729"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70573"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464222.1"
FT                   /protein_id="ADB70573.1"
FT                   VFDLEEET"
FT   gene            734301..734723
FT                   /gene="flgD"
FT                   /locus_tag="LM5923_0730"
FT   CDS_pept        734301..734723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgD"
FT                   /locus_tag="LM5923_0730"
FT                   /product="flagellar basal body rod modification protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0730"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70574"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464223.1"
FT                   /protein_id="ADB70574.1"
FT   gene            734743..735978
FT                   /gene="flgE"
FT                   /locus_tag="LM5923_0731"
FT   CDS_pept        734743..735978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgE"
FT                   /locus_tag="LM5923_0731"
FT                   /product="flagellar hook protein FlgE"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0731"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70575"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464224.1"
FT                   /protein_id="ADB70575.1"
FT                   DDVMKQIVNLIQ"
FT   gene            735992..736228
FT                   /locus_tag="LM5923_0732"
FT   CDS_pept        735992..736228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0732"
FT                   /product="flagellar motor switch protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0732"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70576"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464225.1"
FT                   /protein_id="ADB70576.1"
FT   gene            736249..737241
FT                   /gene="fliM"
FT                   /locus_tag="LM5923_0733"
FT   CDS_pept        736249..737241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliM"
FT                   /locus_tag="LM5923_0733"
FT                   /product="flagellar motor switch protein FliM"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0733"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70577"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464226.1"
FT                   /protein_id="ADB70577.1"
FT   gene            737244..738791
FT                   /locus_tag="LM5923_0734"
FT   CDS_pept        737244..738791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0734"
FT                   /product="flagellar motor switch protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0734"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70578"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464227.1"
FT                   /protein_id="ADB70578.1"
FT   gene            738797..740200
FT                   /locus_tag="LM5923_0735"
FT   CDS_pept        738797..740200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0735"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0735"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70579"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464228.1"
FT                   /protein_id="ADB70579.1"
FT                   IFSGNRAMK"
FT   gene            740223..741389
FT                   /locus_tag="LM5923_0736"
FT   CDS_pept        740223..741389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0736"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0736"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70580"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464229.1"
FT                   /protein_id="ADB70580.1"
FT   gene            741496..741960
FT                   /locus_tag="LM5923_0737"
FT   CDS_pept        741496..741960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0737"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0737"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70581"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464230.1"
FT                   /protein_id="ADB70581.1"
FT   gene            741970..742398
FT                   /locus_tag="LM5923_0738"
FT   CDS_pept        741970..742398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0738"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0738"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70582"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464231.1"
FT                   /protein_id="ADB70582.1"
FT   gene            742418..743938
FT                   /gene="flgK"
FT                   /locus_tag="LM5923_0739"
FT   CDS_pept        742418..743938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgK"
FT                   /locus_tag="LM5923_0739"
FT                   /product="flagellar hook-associated protein FlgK"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0739"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70583"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464232.1"
FT                   /protein_id="ADB70583.1"
FT   gene            743950..744825
FT                   /gene="flgL"
FT                   /locus_tag="LM5923_0740"
FT   CDS_pept        743950..744825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgL"
FT                   /locus_tag="LM5923_0740"
FT                   /product="flagellar hook-associated protein FlgL"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0740"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70584"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464233.1"
FT                   /protein_id="ADB70584.1"
FT                   VQKLSILNYM"
FT   gene            744837..746126
FT                   /gene="fliD"
FT                   /locus_tag="LM5923_0741"
FT   CDS_pept        744837..746126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliD"
FT                   /locus_tag="LM5923_0741"
FT                   /product="flagellar capping protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0741"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70585"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464234.1"
FT                   /protein_id="ADB70585.1"
FT   gene            746145..746531
FT                   /locus_tag="LM5923_0742"
FT   CDS_pept        746145..746531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0742"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0742"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70586"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464235.1"
FT                   /protein_id="ADB70586.1"
FT   gene            746503..746784
FT                   /locus_tag="LM5923_0743"
FT   CDS_pept        746503..746784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0743"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0743"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70587"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464236.1"
FT                   /protein_id="ADB70587.1"
FT   gene            746805..747206
FT                   /gene="flgB"
FT                   /locus_tag="LM5923_0744"
FT   CDS_pept        746805..747206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgB"
FT                   /locus_tag="LM5923_0744"
FT                   /product="flagellar basal body rod protein FlgB"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0744"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70588"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464237.1"
FT                   /protein_id="ADB70588.1"
FT   gene            747218..747628
FT                   /gene="flgC"
FT                   /locus_tag="LM5923_0745"
FT   CDS_pept        747218..747628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgC"
FT                   /locus_tag="LM5923_0745"
FT                   /product="flagellar basal body rod protein FlgC"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0745"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70589"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464238.1"
FT                   /protein_id="ADB70589.1"
FT   gene            747645..747941
FT                   /gene="fliE"
FT                   /locus_tag="LM5923_0746"
FT   CDS_pept        747645..747941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliE"
FT                   /locus_tag="LM5923_0746"
FT                   /product="flagellar hook-basal body protein FliE"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0746"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70590"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464239.1"
FT                   /protein_id="ADB70590.1"
FT   gene            748009..749661
FT                   /gene="fliF"
FT                   /locus_tag="LM5923_0747"
FT   CDS_pept        748009..749661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliF"
FT                   /locus_tag="LM5923_0747"
FT                   /product="flagellar MS-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0747"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70591"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464240.1"
FT                   /protein_id="ADB70591.1"
FT   gene            749664..750770
FT                   /gene="fliG"
FT                   /locus_tag="LM5923_0748"
FT   CDS_pept        749664..750770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliG"
FT                   /locus_tag="LM5923_0748"
FT                   /product="flagellar motor switch protein G"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0748"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70592"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464241.1"
FT                   /protein_id="ADB70592.1"
FT   gene            750757..751449
FT                   /gene="fliH"
FT                   /locus_tag="LM5923_0749"
FT   CDS_pept        750757..751449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliH"
FT                   /locus_tag="LM5923_0749"
FT                   /product="flagellar assembly protein H"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0749"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70593"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464242.1"
FT                   /protein_id="ADB70593.1"
FT                   KILGGDKP"
FT   gene            751446..752747
FT                   /gene="fliI"
FT                   /locus_tag="LM5923_0750"
FT   CDS_pept        751446..752747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliI"
FT                   /locus_tag="LM5923_0750"
FT                   /product="flagellum-specific ATP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0750"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70594"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464243.1"
FT                   /protein_id="ADB70594.1"
FT   gene            752764..753432
FT                   /locus_tag="LM5923_0751"
FT   CDS_pept        752764..753432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0751"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0751"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70595"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464244.1"
FT                   /protein_id="ADB70595.1"
FT                   "
FT   gene            753446..754090
FT                   /locus_tag="LM5923_0752"
FT   CDS_pept        753446..754090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0752"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0752"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70596"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464245.1"
FT                   /protein_id="ADB70596.1"
FT   gene            754212..754538
FT                   /locus_tag="LM5923_0753"
FT   CDS_pept        754212..754538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0753"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0753"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70597"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464246.1"
FT                   /protein_id="ADB70597.1"
FT                   GGQA"
FT   gene            754538..754861
FT                   /locus_tag="LM5923_0754"
FT   CDS_pept        754538..754861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0754"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0754"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70598"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464247.1"
FT                   /protein_id="ADB70598.1"
FT                   SIK"
FT   gene            complement(754907..755554)
FT                   /locus_tag="LM5923_0755"
FT   CDS_pept        complement(754907..755554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0755"
FT                   /product="putative fibronectin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0755"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70599"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464248.1"
FT                   /protein_id="ADB70599.1"
FT   gene            755825..757555
FT                   /locus_tag="LM5923_0756"
FT   CDS_pept        755825..757555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0756"
FT                   /product="pyruvate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0756"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70600"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464249.1"
FT                   /protein_id="ADB70600.1"
FT                   "
FT   gene            757717..759522
FT                   /locus_tag="LM5923_0757"
FT   CDS_pept        757717..759522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0757"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0757"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70601"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464250.1"
FT                   /protein_id="ADB70601.1"
FT   gene            759535..760263
FT                   /locus_tag="LM5923_0758"
FT   CDS_pept        759535..760263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0758"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0758"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70602"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464251.1"
FT                   /protein_id="ADB70602.1"
FT   gene            complement(760306..760518)
FT                   /locus_tag="LM5923_0759"
FT   CDS_pept        complement(760306..760518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0759"
FT                   /product="peptidoglycan binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0759"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70603"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464252.1"
FT                   /protein_id="ADB70603.1"
FT   gene            760721..760864
FT                   /locus_tag="LM5923_0760"
FT   CDS_pept        760721..760864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0760"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70604"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464253.1"
FT                   /protein_id="ADB70604.1"
FT                   TE"
FT   gene            760965..762770
FT                   /locus_tag="LM5923_0761"
FT   CDS_pept        760965..762770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0761"
FT                   /product="D-fructose-6-phosphate amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0761"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70605"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464254.1"
FT                   /protein_id="ADB70605.1"
FT   gene            762883..763623
FT                   /locus_tag="LM5923_0762"
FT   CDS_pept        762883..763623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0762"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0762"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70606"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464255.1"
FT                   /protein_id="ADB70606.1"
FT   gene            763706..764185
FT                   /locus_tag="LM5923_0763"
FT   CDS_pept        763706..764185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0763"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0763"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70607"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464256.1"
FT                   /protein_id="ADB70607.1"
FT   gene            764199..764537
FT                   /locus_tag="LM5923_0764"
FT   CDS_pept        764199..764537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0764"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0764"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70608"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464257.1"
FT                   /protein_id="ADB70608.1"
FT                   LWLEREDI"
FT   gene            764682..765086
FT                   /locus_tag="LM5923_0765"
FT   CDS_pept        764682..765086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0765"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0765"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70609"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464258.1"
FT                   /protein_id="ADB70609.1"
FT   gene            765396..765527
FT                   /locus_tag="LM5923_0766"
FT   CDS_pept        765396..765527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0766"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0766"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70610"
FT                   /inference="ab initio prediction:Glimmer:3.02"
FT                   /protein_id="ADB70610.1"
FT   gene            765779..767695
FT                   /locus_tag="LM5923_0767"
FT   CDS_pept        765779..767695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0767"
FT                   /product="peptidoglycan binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0767"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70611"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464259.1"
FT                   /protein_id="ADB70611.1"
FT                   KHS"
FT   gene            768025..768534
FT                   /locus_tag="LM5923_0768"
FT   CDS_pept        768025..768534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0768"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0768"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70612"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464260.1"
FT                   /protein_id="ADB70612.1"
FT                   LTRKNV"
FT   gene            complement(768692..769696)
FT                   /locus_tag="LM5923_0769"
FT   CDS_pept        complement(768692..769696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0769"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0769"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70613"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464261.1"
FT                   /protein_id="ADB70613.1"
FT   gene            769911..770582
FT                   /locus_tag="LM5923_0770"
FT   CDS_pept        769911..770582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0770"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70614"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464262.1"
FT                   /protein_id="ADB70614.1"
FT                   R"
FT   gene            770579..771025
FT                   /locus_tag="LM5923_0771"
FT   CDS_pept        770579..771025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0771"
FT                   /product="ribose-5-phosphate isomerase B"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0771"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70615"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464263.1"
FT                   /protein_id="ADB70615.1"
FT   gene            771038..771970
FT                   /locus_tag="LM5923_0772"
FT   CDS_pept        771038..771970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0772"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0772"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70616"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464264.1"
FT                   /protein_id="ADB70616.1"
FT   gene            771994..773847
FT                   /locus_tag="LM5923_0773"
FT   CDS_pept        771994..773847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0773"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0773"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70617"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464265.1"
FT                   /protein_id="ADB70617.1"
FT   gene            773867..775240
FT                   /locus_tag="LM5923_0774"
FT   CDS_pept        773867..775240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0774"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0774"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70618"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464266.1"
FT                   /protein_id="ADB70618.1"
FT   gene            complement(775254..775913)
FT                   /locus_tag="LM5923_0775"
FT   CDS_pept        complement(775254..775913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0775"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0775"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70619"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464267.1"
FT                   /protein_id="ADB70619.1"
FT   gene            776177..776554
FT                   /locus_tag="LM5923_0776"
FT   CDS_pept        776177..776554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0776"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0776"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70620"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464268.1"
FT                   /protein_id="ADB70620.1"
FT   gene            776538..777227
FT                   /locus_tag="LM5923_0777"
FT   CDS_pept        776538..777227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0777"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0777"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70621"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464269.1"
FT                   /protein_id="ADB70621.1"
FT                   YKEEMNK"
FT   gene            777224..777928
FT                   /locus_tag="LM5923_0778"
FT   CDS_pept        777224..777928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0778"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0778"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70622"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464270.1"
FT                   /protein_id="ADB70622.1"
FT                   YIYMKSKKMDTI"
FT   gene            777943..779943
FT                   /locus_tag="LM5923_0779"
FT   CDS_pept        777943..779943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0779"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0779"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70623"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464271.1"
FT                   /protein_id="ADB70623.1"
FT   gene            779972..780475
FT                   /locus_tag="LM5923_0780"
FT   CDS_pept        779972..780475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0780"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70624"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464272.1"
FT                   /protein_id="ADB70624.1"
FT                   IVAE"
FT   gene            complement(780626..780865)
FT                   /locus_tag="LM5923_0781"
FT   CDS_pept        complement(780626..780865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0781"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0781"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70625"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464273.1"
FT                   /protein_id="ADB70625.1"
FT   gene            780989..781330
FT                   /locus_tag="LM5923_0782"
FT   CDS_pept        780989..781330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0782"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0782"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70626"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464274.1"
FT                   /protein_id="ADB70626.1"
FT                   QLVNIFSLS"
FT   gene            781437..781724
FT                   /locus_tag="LM5923_0783"
FT   CDS_pept        781437..781724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0783"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0783"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70627"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464275.1"
FT                   /protein_id="ADB70627.1"
FT   gene            781721..781927
FT                   /locus_tag="LM5923_0784"
FT   CDS_pept        781721..781927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0784"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0784"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70628"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464276.1"
FT                   /protein_id="ADB70628.1"
FT   gene            781920..782435
FT                   /locus_tag="LM5923_0785"
FT   CDS_pept        781920..782435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0785"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0785"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70629"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464277.1"
FT                   /protein_id="ADB70629.1"
FT                   IEVENAED"
FT   gene            782490..782786
FT                   /locus_tag="LM5923_0786"
FT   CDS_pept        782490..782786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0786"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0786"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70630"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464278.1"
FT                   /protein_id="ADB70630.1"
FT   gene            782882..783718
FT                   /locus_tag="LM5923_0787"
FT   CDS_pept        782882..783718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0787"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0787"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70631"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464279.1"
FT                   /protein_id="ADB70631.1"
FT   gene            783844..784524
FT                   /locus_tag="LM5923_0788"
FT   CDS_pept        783844..784524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0788"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0788"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70632"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464280.1"
FT                   /protein_id="ADB70632.1"
FT                   TFIE"
FT   gene            784605..785216
FT                   /locus_tag="LM5923_0789"
FT   CDS_pept        784605..785216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0789"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0789"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70633"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464281.1"
FT                   /protein_id="ADB70633.1"
FT   gene            785331..786152
FT                   /locus_tag="LM5923_0790"
FT   CDS_pept        785331..786152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0790"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70634"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464282.1"
FT                   /protein_id="ADB70634.1"
FT   gene            786124..787029
FT                   /locus_tag="LM5923_0791"
FT   CDS_pept        786124..787029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0791"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0791"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70635"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464283.1"
FT                   /protein_id="ADB70635.1"
FT   gene            787022..788002
FT                   /locus_tag="LM5923_0792"
FT   CDS_pept        787022..788002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0792"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0792"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70636"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464284.1"
FT                   /protein_id="ADB70636.1"
FT   gene            788129..789016
FT                   /locus_tag="LM5923_0793"
FT   CDS_pept        788129..789016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0793"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0793"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70637"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464285.1"
FT                   /protein_id="ADB70637.1"
FT                   EKRTEIETYFGGDL"
FT   gene            789013..789975
FT                   /locus_tag="LM5923_0794"
FT   CDS_pept        789013..789975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0794"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0794"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70638"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464286.1"
FT                   /protein_id="ADB70638.1"
FT   gene            789982..790590
FT                   /locus_tag="LM5923_0795"
FT   CDS_pept        789982..790590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0795"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0795"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70639"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464287.1"
FT                   /protein_id="ADB70639.1"
FT   gene            790600..791220
FT                   /locus_tag="LM5923_0796"
FT   CDS_pept        790600..791220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0796"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0796"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70640"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464288.1"
FT                   /protein_id="ADB70640.1"
FT   gene            791548..792804
FT                   /locus_tag="LM5923_0797"
FT   CDS_pept        791548..792804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0797"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0797"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70641"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464289.1"
FT                   /protein_id="ADB70641.1"
FT   gene            792870..793742
FT                   /locus_tag="LM5923_0798"
FT   CDS_pept        792870..793742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0798"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0798"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70642"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464290.1"
FT                   /protein_id="ADB70642.1"
FT                   ITLKAKGDA"
FT   gene            793748..794737
FT                   /locus_tag="LM5923_0799"
FT   CDS_pept        793748..794737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0799"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0799"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70643"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464291.1"
FT                   /protein_id="ADB70643.1"
FT   gene            794890..796188
FT                   /locus_tag="LM5923_0800"
FT   CDS_pept        794890..796188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0800"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70644"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464292.1"
FT                   /protein_id="ADB70644.1"
FT   gene            796205..797095
FT                   /locus_tag="LM5923_0801"
FT   CDS_pept        796205..797095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0801"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0801"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70645"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464293.1"
FT                   /protein_id="ADB70645.1"
FT                   FSIINMRVNKEDRTA"
FT   gene            797107..797982
FT                   /locus_tag="LM5923_0802"
FT   CDS_pept        797107..797982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0802"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0802"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70646"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464294.1"
FT                   /protein_id="ADB70646.1"
FT                   VEGIAHNGGK"
FT   gene            798004..799257
FT                   /locus_tag="LM5923_0803"
FT   CDS_pept        798004..799257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0803"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0803"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70647"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464295.1"
FT                   /protein_id="ADB70647.1"
FT                   LSQAEKEGNQILKEERDK"
FT   gene            799261..800289
FT                   /locus_tag="LM5923_0804"
FT   CDS_pept        799261..800289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0804"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0804"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70648"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464296.1"
FT                   /protein_id="ADB70648.1"
FT                   ER"
FT   gene            complement(800302..801420)
FT                   /locus_tag="LM5923_0805"
FT   CDS_pept        complement(800302..801420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0805"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0805"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70649"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464297.1"
FT                   /protein_id="ADB70649.1"
FT   gene            801580..802332
FT                   /locus_tag="LM5923_0806"
FT   CDS_pept        801580..802332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0806"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0806"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70650"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464298.1"
FT                   /protein_id="ADB70650.1"
FT   gene            802368..803015
FT                   /locus_tag="LM5923_0807"
FT   CDS_pept        802368..803015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LM5923_0807"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LM5923_0807"
FT                   /db_xref="EnsemblGenomes-Tr:ADB70651"
FT                   /inference="similar to AA sequence (same
FT                   species):RefSeq:NP_464299.1"
FT                   /protein_id="ADB70651.1"
FT   gene            complement(803055..804044)
FT                   /locus_tag="LM5923_0808"
FT   CDS_pept