(data stored in SCRATCH zone)

EMBL: CP001614

ID   CP001614; SV 2; circular; genomic DNA; STD; PRO; 5193164 BP.
XX
AC   CP001614;
XX
PR   Project:PRJNA30839;
XX
DT   18-JUN-2009 (Rel. 101, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 8)
XX
DE   Teredinibacter turnerae T7901, complete genome.
XX
KW   .
XX
OS   Teredinibacter turnerae T7901
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Cellvibrionales;
OC   Cellvibrionaceae; Teredinibacter.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-5193164
RX   DOI; 10.1371/journal.pone.0006085.
RX   PUBMED; 19568419.
RA   Yang J.C., Madupu R., Durkin A.S., Ekborg N.A., Pedamallu C.S.,
RA   Hostetler J.B., Radune D., Toms B.S., Henrissat B., Coutinho P.M.,
RA   Schwarz S., Field L., Trindade-Silva A.E., Soares C.A., Elshahawi S.,
RA   Hanora A., Schmidt E.W., Haygood M.G., Posfai J., Benner J., Madinger C.,
RA   Nove J., Anton B., Chaudhary K., Foster J., Holman A., Kumar S.,
RA   Lessard P.A., Luyten Y.A., Slatko B., Wood N., Wu B., Teplitski M.,
RA   Mougous J.D., Ward N., Eisen J.A., Badger J.H., Distel D.L.;
RT   "The complete genome of Teredinibacter turnerae T7901: an intracellular
RT   endosymbiont of marine wood-boring bivalves (shipworms)";
RL   PLoS One 4(7):E6085-E6085(2009).
XX
RN   [2]
RP   1-5193164
RA   Yang J.C., Madupu R., Durkin A.S., Ekborg N.A., Pedamallu C.S.,
RA   Hostetler J.B., Radune D., Toms B.S., Henrissat B., Coutinho P.M.,
RA   Schwarz S., Fields L., Trindade-Silva A.E., Soares C.A., Elshahawi S.,
RA   Hanora A., Schmidt E.W., Haygood M.G., Posfai J., Benner J., Swaim C.,
RA   Nove J., Anton B., Chaudhary K., Foster J., Holman A., Kumar S.,
RA   Lessard P.A., Luyten Y.A., Slatko B., Wood N., Wu B., Teplitski M.,
RA   Mougous J.D., Ward N.L., Eisen J.A., Badger J.H., Distel D.L.;
RT   ;
RL   Submitted (30-APR-2009) to the INSDC.
RL   J. Craig Venter Institute, 9712 Medical Center Dr, Rockville, MD 20850, USA
XX
RN   [3]
RC   Protein update by submitter
RP   1-5193164
RA   Yang J.C., Madupu R., Durkin A.S., Ekborg N.A., Pedamallu C.S.,
RA   Hostetler J.B., Radune D., Toms B.S., Henrissat B., Coutinho P.M.,
RA   Schwarz S., Fields L., Trindade-Silva A.E., Soares C.A., Elshahawi S.,
RA   Hanora A., Schmidt E.W., Haygood M.G., Posfai J., Benner J., Swaim C.,
RA   Nove J., Anton B., Chaudhary K., Foster J., Holman A., Kumar S.,
RA   Lessard P.A., Luyten Y.A., Slatko B., Wood N., Wu B., Teplitski M.,
RA   Mougous J.D., Ward N.L., Eisen J.A., Badger J.H., Distel D.L.;
RT   ;
RL   Submitted (01-JUL-2009) to the INSDC.
RL   J. Craig Venter Institute, 9712 Medical Center Dr, Rockville, MD 20850, USA
XX
DR   MD5; 411b30ccead19980e96fadcd88fcab1a.
DR   BioSample; SAMN02603454.
DR   EnsemblGenomes-Gn; EBG00001244796.
DR   EnsemblGenomes-Gn; EBG00001244797.
DR   EnsemblGenomes-Gn; EBG00001244798.
DR   EnsemblGenomes-Gn; EBG00001244799.
DR   EnsemblGenomes-Gn; EBG00001244800.
DR   EnsemblGenomes-Gn; EBG00001244801.
DR   EnsemblGenomes-Gn; EBG00001244802.
DR   EnsemblGenomes-Gn; EBG00001244803.
DR   EnsemblGenomes-Gn; EBG00001244804.
DR   EnsemblGenomes-Gn; EBG00001244805.
DR   EnsemblGenomes-Gn; EBG00001244806.
DR   EnsemblGenomes-Gn; EBG00001244807.
DR   EnsemblGenomes-Gn; EBG00001244808.
DR   EnsemblGenomes-Gn; EBG00001244809.
DR   EnsemblGenomes-Gn; EBG00001244810.
DR   EnsemblGenomes-Gn; EBG00001244811.
DR   EnsemblGenomes-Gn; EBG00001244812.
DR   EnsemblGenomes-Gn; EBG00001244813.
DR   EnsemblGenomes-Gn; EBG00001244814.
DR   EnsemblGenomes-Gn; EBG00001244815.
DR   EnsemblGenomes-Gn; EBG00001244816.
DR   EnsemblGenomes-Gn; EBG00001244817.
DR   EnsemblGenomes-Gn; EBG00001244818.
DR   EnsemblGenomes-Gn; EBG00001244819.
DR   EnsemblGenomes-Gn; EBG00001244820.
DR   EnsemblGenomes-Gn; EBG00001244821.
DR   EnsemblGenomes-Gn; EBG00001244822.
DR   EnsemblGenomes-Gn; EBG00001244823.
DR   EnsemblGenomes-Gn; EBG00001244824.
DR   EnsemblGenomes-Gn; EBG00001244825.
DR   EnsemblGenomes-Gn; EBG00001244826.
DR   EnsemblGenomes-Gn; EBG00001244827.
DR   EnsemblGenomes-Gn; EBG00001244828.
DR   EnsemblGenomes-Gn; EBG00001244829.
DR   EnsemblGenomes-Gn; EBG00001244830.
DR   EnsemblGenomes-Gn; EBG00001244831.
DR   EnsemblGenomes-Gn; EBG00001244832.
DR   EnsemblGenomes-Gn; EBG00001244833.
DR   EnsemblGenomes-Gn; EBG00001244834.
DR   EnsemblGenomes-Gn; EBG00001244835.
DR   EnsemblGenomes-Gn; EBG00001244836.
DR   EnsemblGenomes-Gn; EBG00001244837.
DR   EnsemblGenomes-Gn; EBG00001244838.
DR   EnsemblGenomes-Gn; EBG00001244839.
DR   EnsemblGenomes-Gn; EBG00001244840.
DR   EnsemblGenomes-Gn; EBG00001244841.
DR   EnsemblGenomes-Gn; EBG00001244842.
DR   EnsemblGenomes-Gn; EBG00001244843.
DR   EnsemblGenomes-Gn; EBG00001244844.
DR   EnsemblGenomes-Gn; EBG00001244845.
DR   EnsemblGenomes-Gn; EBG00001244846.
DR   EnsemblGenomes-Gn; EBG00001244847.
DR   EnsemblGenomes-Gn; EBG00001244848.
DR   EnsemblGenomes-Gn; EBG00001244849.
DR   EnsemblGenomes-Gn; EBG00001244850.
DR   EnsemblGenomes-Gn; EBG00001244851.
DR   EnsemblGenomes-Gn; EBG00001244852.
DR   EnsemblGenomes-Gn; EBG00001244853.
DR   EnsemblGenomes-Gn; TERTU_0479.
DR   EnsemblGenomes-Gn; TERTU_0544.
DR   EnsemblGenomes-Gn; TERTU_0692.
DR   EnsemblGenomes-Gn; TERTU_0701.
DR   EnsemblGenomes-Gn; TERTU_0702.
DR   EnsemblGenomes-Gn; TERTU_0869.
DR   EnsemblGenomes-Gn; TERTU_0870.
DR   EnsemblGenomes-Gn; TERTU_0872.
DR   EnsemblGenomes-Gn; TERTU_0874.
DR   EnsemblGenomes-Gn; TERTU_0875.
DR   EnsemblGenomes-Gn; TERTU_1069.
DR   EnsemblGenomes-Gn; TERTU_1070.
DR   EnsemblGenomes-Gn; TERTU_1071.
DR   EnsemblGenomes-Gn; TERTU_1072.
DR   EnsemblGenomes-Gn; TERTU_1073.
DR   EnsemblGenomes-Gn; TERTU_1137.
DR   EnsemblGenomes-Gn; TERTU_1145.
DR   EnsemblGenomes-Gn; TERTU_1213.
DR   EnsemblGenomes-Gn; TERTU_1421.
DR   EnsemblGenomes-Gn; TERTU_1422.
DR   EnsemblGenomes-Gn; TERTU_1463.
DR   EnsemblGenomes-Gn; TERTU_1622.
DR   EnsemblGenomes-Gn; TERTU_1707.
DR   EnsemblGenomes-Gn; TERTU_1876.
DR   EnsemblGenomes-Gn; TERTU_1877.
DR   EnsemblGenomes-Gn; TERTU_1927.
DR   EnsemblGenomes-Gn; TERTU_1929.
DR   EnsemblGenomes-Gn; TERTU_1930.
DR   EnsemblGenomes-Gn; TERTU_1936.
DR   EnsemblGenomes-Gn; TERTU_2404.
DR   EnsemblGenomes-Gn; TERTU_2405.
DR   EnsemblGenomes-Gn; TERTU_2576.
DR   EnsemblGenomes-Gn; TERTU_2701.
DR   EnsemblGenomes-Gn; TERTU_2792.
DR   EnsemblGenomes-Gn; TERTU_2807.
DR   EnsemblGenomes-Gn; TERTU_2983.
DR   EnsemblGenomes-Gn; TERTU_3220.
DR   EnsemblGenomes-Gn; TERTU_3259.
DR   EnsemblGenomes-Gn; TERTU_3423.
DR   EnsemblGenomes-Gn; TERTU_3850.
DR   EnsemblGenomes-Gn; TERTU_3855.
DR   EnsemblGenomes-Gn; TERTU_4159.
DR   EnsemblGenomes-Gn; TERTU_4292.
DR   EnsemblGenomes-Gn; TERTU_4554.
DR   EnsemblGenomes-Gn; TERTU_4555.
DR   EnsemblGenomes-Gn; TERTU_4556.
DR   EnsemblGenomes-Gn; TERTU_4557.
DR   EnsemblGenomes-Gn; TERTU_4558.
DR   EnsemblGenomes-Gn; TERTU_4748.
DR   EnsemblGenomes-Gn; TERTU_4749.
DR   EnsemblGenomes-Gn; TERTU_4750.
DR   EnsemblGenomes-Gn; TERTU_4753.
DR   EnsemblGenomes-Tr; EBT00001590171.
DR   EnsemblGenomes-Tr; EBT00001590172.
DR   EnsemblGenomes-Tr; EBT00001590173.
DR   EnsemblGenomes-Tr; EBT00001590174.
DR   EnsemblGenomes-Tr; EBT00001590175.
DR   EnsemblGenomes-Tr; EBT00001590176.
DR   EnsemblGenomes-Tr; EBT00001590177.
DR   EnsemblGenomes-Tr; EBT00001590178.
DR   EnsemblGenomes-Tr; EBT00001590179.
DR   EnsemblGenomes-Tr; EBT00001590180.
DR   EnsemblGenomes-Tr; EBT00001590181.
DR   EnsemblGenomes-Tr; EBT00001590182.
DR   EnsemblGenomes-Tr; EBT00001590183.
DR   EnsemblGenomes-Tr; EBT00001590184.
DR   EnsemblGenomes-Tr; EBT00001590185.
DR   EnsemblGenomes-Tr; EBT00001590186.
DR   EnsemblGenomes-Tr; EBT00001590187.
DR   EnsemblGenomes-Tr; EBT00001590188.
DR   EnsemblGenomes-Tr; EBT00001590189.
DR   EnsemblGenomes-Tr; EBT00001590190.
DR   EnsemblGenomes-Tr; EBT00001590191.
DR   EnsemblGenomes-Tr; EBT00001590192.
DR   EnsemblGenomes-Tr; EBT00001590193.
DR   EnsemblGenomes-Tr; EBT00001590194.
DR   EnsemblGenomes-Tr; EBT00001590195.
DR   EnsemblGenomes-Tr; EBT00001590196.
DR   EnsemblGenomes-Tr; EBT00001590197.
DR   EnsemblGenomes-Tr; EBT00001590198.
DR   EnsemblGenomes-Tr; EBT00001590199.
DR   EnsemblGenomes-Tr; EBT00001590200.
DR   EnsemblGenomes-Tr; EBT00001590201.
DR   EnsemblGenomes-Tr; EBT00001590202.
DR   EnsemblGenomes-Tr; EBT00001590203.
DR   EnsemblGenomes-Tr; EBT00001590204.
DR   EnsemblGenomes-Tr; EBT00001590205.
DR   EnsemblGenomes-Tr; EBT00001590206.
DR   EnsemblGenomes-Tr; EBT00001590207.
DR   EnsemblGenomes-Tr; EBT00001590208.
DR   EnsemblGenomes-Tr; EBT00001590209.
DR   EnsemblGenomes-Tr; EBT00001590210.
DR   EnsemblGenomes-Tr; EBT00001590211.
DR   EnsemblGenomes-Tr; EBT00001590212.
DR   EnsemblGenomes-Tr; EBT00001590213.
DR   EnsemblGenomes-Tr; EBT00001590214.
DR   EnsemblGenomes-Tr; EBT00001590215.
DR   EnsemblGenomes-Tr; EBT00001590216.
DR   EnsemblGenomes-Tr; EBT00001590217.
DR   EnsemblGenomes-Tr; EBT00001590218.
DR   EnsemblGenomes-Tr; EBT00001590219.
DR   EnsemblGenomes-Tr; EBT00001590220.
DR   EnsemblGenomes-Tr; EBT00001590221.
DR   EnsemblGenomes-Tr; EBT00001590222.
DR   EnsemblGenomes-Tr; EBT00001590223.
DR   EnsemblGenomes-Tr; EBT00001590224.
DR   EnsemblGenomes-Tr; EBT00001590225.
DR   EnsemblGenomes-Tr; EBT00001590226.
DR   EnsemblGenomes-Tr; EBT00001590227.
DR   EnsemblGenomes-Tr; EBT00001590228.
DR   EnsemblGenomes-Tr; TERTU_0479-1.
DR   EnsemblGenomes-Tr; TERTU_0544-1.
DR   EnsemblGenomes-Tr; TERTU_0692-1.
DR   EnsemblGenomes-Tr; TERTU_0701-1.
DR   EnsemblGenomes-Tr; TERTU_0702-1.
DR   EnsemblGenomes-Tr; TERTU_0869-1.
DR   EnsemblGenomes-Tr; TERTU_0870-1.
DR   EnsemblGenomes-Tr; TERTU_0872-1.
DR   EnsemblGenomes-Tr; TERTU_0874-1.
DR   EnsemblGenomes-Tr; TERTU_0875-1.
DR   EnsemblGenomes-Tr; TERTU_1069-1.
DR   EnsemblGenomes-Tr; TERTU_1070-1.
DR   EnsemblGenomes-Tr; TERTU_1071-1.
DR   EnsemblGenomes-Tr; TERTU_1072-1.
DR   EnsemblGenomes-Tr; TERTU_1073-1.
DR   EnsemblGenomes-Tr; TERTU_1137-1.
DR   EnsemblGenomes-Tr; TERTU_1145-1.
DR   EnsemblGenomes-Tr; TERTU_1213-1.
DR   EnsemblGenomes-Tr; TERTU_1421-1.
DR   EnsemblGenomes-Tr; TERTU_1422-1.
DR   EnsemblGenomes-Tr; TERTU_1463-1.
DR   EnsemblGenomes-Tr; TERTU_1622-1.
DR   EnsemblGenomes-Tr; TERTU_1707-1.
DR   EnsemblGenomes-Tr; TERTU_1876-1.
DR   EnsemblGenomes-Tr; TERTU_1877-1.
DR   EnsemblGenomes-Tr; TERTU_1927-1.
DR   EnsemblGenomes-Tr; TERTU_1929-1.
DR   EnsemblGenomes-Tr; TERTU_1930-1.
DR   EnsemblGenomes-Tr; TERTU_1936-1.
DR   EnsemblGenomes-Tr; TERTU_2404-1.
DR   EnsemblGenomes-Tr; TERTU_2405-1.
DR   EnsemblGenomes-Tr; TERTU_2576-1.
DR   EnsemblGenomes-Tr; TERTU_2701-1.
DR   EnsemblGenomes-Tr; TERTU_2792-1.
DR   EnsemblGenomes-Tr; TERTU_2807-1.
DR   EnsemblGenomes-Tr; TERTU_2983-1.
DR   EnsemblGenomes-Tr; TERTU_3220-1.
DR   EnsemblGenomes-Tr; TERTU_3259-1.
DR   EnsemblGenomes-Tr; TERTU_3423-1.
DR   EnsemblGenomes-Tr; TERTU_3850-1.
DR   EnsemblGenomes-Tr; TERTU_3855-1.
DR   EnsemblGenomes-Tr; TERTU_4159-1.
DR   EnsemblGenomes-Tr; TERTU_4292-1.
DR   EnsemblGenomes-Tr; TERTU_4554-1.
DR   EnsemblGenomes-Tr; TERTU_4555-1.
DR   EnsemblGenomes-Tr; TERTU_4556-1.
DR   EnsemblGenomes-Tr; TERTU_4557-1.
DR   EnsemblGenomes-Tr; TERTU_4558-1.
DR   EnsemblGenomes-Tr; TERTU_4748-1.
DR   EnsemblGenomes-Tr; TERTU_4749-1.
DR   EnsemblGenomes-Tr; TERTU_4750-1.
DR   EnsemblGenomes-Tr; TERTU_4753-1.
DR   EuropePMC; PMC2699552; 19568419.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00628; P16.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02005; group-II-D1D4-6.
DR   SILVA-LSU; CP001614.
DR   SILVA-SSU; CP001614.
XX
CC   On Jun 15, 2009 this sequence version replaced gi:237683369.
CC   Teredinibacter turnerae, T7901 (ATCC 39867), Bacterial isolate from
CC   the gill ctenidia of Bankia gouldi. Original specimens from Duke
CC   University Marine Lab, Newport River, Beaufort, NC, USA.
CC   There is a repeat structure between coords 3175857 and 3188676 in
CC   this sequence. This region was resolved computationally and has not
CC   been confirmed by additional sequencing.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5193164
FT                   /organism="Teredinibacter turnerae T7901"
FT                   /strain="T7901"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:377629"
FT   gene            541..2322
FT                   /gene="dnaA"
FT                   /locus_tag="TERTU_0002"
FT   CDS_pept        541..2322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="TERTU_0002"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="identified by similarity to SP:P03004; match to
FT                   protein family HMM PF00308; match to protein family HMM
FT                   PF08299; match to protein family HMM TIGR00362"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12930"
FT                   /db_xref="GOA:C5BKL9"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BKL9"
FT                   /protein_id="ACR12930.1"
FT                   /translation="MSDPCWEQCVSCLQNELPSQQFNTWIRPLRVEESSTLLLRLIAPN
FT                   RFVQDWVNDKYRTRIEEIISNSDAGPKSLEIAVAQRARAGFEVVRNAKVAPAVPVPDPL
FT                   PSTGRDESSFQPPKGNTSADYSGHSDLGFQSPHRRQSPFSESQERFTQPLEMSRFGSGR
FT                   PSNERSNEGAIGGSTESSADRERIPLQGVVEDLFKPTKNSNDFVEPRSTDPLLEIESRP
FT                   IIETVSPRDIQDFGSQLTSRVKKKDVEGGIQHKHNLNTTFIFDNFVVGKSNQLGLAAAS
FT                   QVAENPGGAYNPLFIYGGVGLGKTHLMHAVGNALVQRKPGARVVYLHSERFVADMVKAL
FT                   QLNAISDFKRFYRSVDALLIDDIQFFAGKERSQEEFFHTFNALLEGGQQIILTCDKYPK
FT                   EINGLEERLKSRFGWGLTVAIEPPELETRVAILKRKAESSRMPLPDDAAFFIAQRIRSN
FT                   VRELEGALKRVIANAQFTQRSISVELVREALKDLLALQDRLVSIDNIQRVVAEYYKIKV
FT                   SDLHSKRRSRSVARPRQVAMYLAKDLTHHSLPEIGDAFGGRDHTTVLHACRKIRDLQES
FT                   DADIREDVKNLLRTLTT"
FT   gene            2388..3491
FT                   /gene="dnaN"
FT                   /locus_tag="TERTU_0003"
FT   CDS_pept        2388..3491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="TERTU_0003"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00712;
FT                   match to protein family HMM PF02767; match to protein
FT                   family HMM PF02768; match to protein family HMM TIGR00663"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14540"
FT                   /db_xref="GOA:C5BKM0"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKM0"
FT                   /protein_id="ACR14540.1"
FT                   /translation="MKFTVSREALIKPLQLVAGVVERRQTMAVLANVLMEIEGDQLSLT
FT                   GTDLEVEIIGRVQLESAPGNGEITVPAKKFLDICRSLPDKSVIEFSLQDQKATVKSGKS
FT                   RFTLSTLPANEFPAVEQGSNDINISCEQKEIKRLIDRTAFAMAQQDVRYYLNGMLWELR
FT                   PGEIRVVATDGHRLAVCSRPVDVDVSEIKQAILPRKGVIELARLLNDSEDGVEVSLGSS
FT                   HMRASTAEYTFTSKLVDGKFPDYERVLPKGGDKVVLGNRSDLKQAFARTSILSNEKYRG
FT                   VRLELVAGSLTIIANNPEQEEAQDQVEVDYNGDALEVGFNVSYLQDVANVLDSENIKIT
FT                   LSDSNSSALLEEPENSDSSYVVMPMRL"
FT   gene            3542..4678
FT                   /gene="recF"
FT                   /locus_tag="TERTU_0004"
FT   CDS_pept        3542..4678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="TERTU_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="identified by match to protein family HMM PF02463;
FT                   match to protein family HMM TIGR00611"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13820"
FT                   /db_xref="GOA:C5BKM1"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BKM1"
FT                   /protein_id="ACR13820.1"
FT                   /translation="MPTLRRLDISEFRNLRSATLQPGEGINLISGENGSGKTSILESIS
FT                   VLAHGRSFRTHKFRRLINNDEKSFTLFGQIFEGTTRNIGLSRASNGDIQIRIDSKAAHT
FT                   ATELAECLPLLVMNSASFQLLEGSGQVRRKFFDWLVFHVKQEFKHYWKLYARCIKQRNS
FT                   LLRRDKITRSELLPWDQELTKAAQHIESMRSEVFELFQTHFLNEIGQFDFTETLGAELS
FT                   CTYVSGWSKTGNYNEQLEDQFERDVAAGYTHIGSHKSDVKINLARVPAVEELSRGQQKS
FT                   VIVALFLAEALVFRTTTGRTPVFLLDDLPAELDEKNLRIVGKALKNLGSQVFATAIDPK
FT                   SILTGWELVDDESLRMFHVKHGQVELKNDITLRDSFLL"
FT   gene            4675..7101
FT                   /gene="gyrB"
FT                   /locus_tag="TERTU_0005"
FT   CDS_pept        4675..7101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="TERTU_0005"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="identified by match to protein family HMM PF00204;
FT                   match to protein family HMM PF00986; match to protein
FT                   family HMM PF01751; match to protein family HMM PF02518;
FT                   match to protein family HMM TIGR01059"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13297"
FT                   /db_xref="GOA:C5BKM2"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKM2"
FT                   /protein_id="ACR13297.1"
FT                   /translation="MSDTEHNYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFE
FT                   LVDNSIDEALAGHCSEILAVIHPDESISVSDNGRGIPTEMHEEGVSAAEVIMTVLHAGG
FT                   KFDDNTYKVSGGLHGVGVSVVNALSSKLKLTIRRGGKVWEQVYKHGVPQAPLSVIGETE
FT                   LTGTEVHFWPSAETFNNIEFHFEHLAKRLRELSFLNSGVRIRLLDERSGKEEVYEYEGG
FT                   LKAFVEFLNQNKNPINKVMHFTAQREDDGVGVEVALQWNDGFQENIYCYTNNIPQRDGG
FT                   THLAGFRAALTRGLNSYIEREGIGKKEKVATTGDDAREGLVAIISVKVPDPKFSSQTKD
FT                   KLVSSEVKTAVEQEMGSAFNDYLLENPQEAKSVVGKMIEAAKAREAARKAREMTRRKGA
FT                   LDIAGLPGKLADCQEKDPALSELYLVEGDSAGGSAKQGRSRKTQAILPLKGKILNVEKA
FT                   RFDKMLSSAEVGTLITALGCGIGAQEFNPDKLRYHSIIIMTDADVDGSHIRTLLLTFFF
FT                   RQMRELIERGHIFIAQPPLYKISKGKHEEYLKDDDALQQFLTNAALEQSKLHLSADAPA
FT                   LSGEQLESLVKDYRKGIAVIDKLSRLYPNEVLHQMLYLPALQAESFTDEALVTEWNDKL
FT                   QLRLDVLNAESKTHRFISVVKENKERGEFTPVIELTAHGVAHTIRLSSDLFSSDDYQVI
FT                   TALGEKLNGLIEEGAFVAKGERTREVNNFAEALDWIMNESKKGYNIQRYKGLGEMNPEQ
FT                   LWETTMDPETRRMLQVTVEDAIAADQIFTTLMGDQVEPRRDFIETNALAVANLDV"
FT   gene            complement(7167..7877)
FT                   /locus_tag="TERTU_0006"
FT   CDS_pept        complement(7167..7877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0006"
FT                   /product="antioxidant, AhpC/TSA family protein"
FT                   /note="identified by match to protein family HMM PF00578;
FT                   match to protein family HMM PF08534"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12908"
FT                   /db_xref="GOA:C5BKM3"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKM3"
FT                   /protein_id="ACR12908.1"
FT                   /translation="MTLQHIIDAIEASPRPLQAKLDALKEAFETQLAPPEVVSIMQRAT
FT                   QALVDSRQAESALKAGNRVPQFNLPDSNGEPYSLQHLLNKGPLVLTFYRGIWCPYCNFD
FT                   LRALEESRLDLESRGAQLVAVSQQTAANSRKSKEANHLGFPILVDTKGDLGHQFGLRWQ
FT                   VPEDLKAVHKQLGADLEVFNGESSWTLPMPARYVIDQDGVIVYSEVNPDYTRRPDPSEL
FT                   LAVLDGLKKVKSRV"
FT   gene            7985..8881
FT                   /locus_tag="TERTU_0007"
FT   CDS_pept        7985..8881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0007"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14734"
FT                   /db_xref="GOA:C5BKM4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKM4"
FT                   /protein_id="ACR14734.1"
FT                   /translation="MNDRLTAYRIFTRIARLGSFSAAGRELNMPQPTVSRIVKALESEL
FT                   GVALLLRTTRAVTLTDAGRDFLLRIEAILDSLDDAEHAVRGTGELRGVLRVGLSSTIAV
FT                   REIVPILPGFMAEHAKLKVELITDDQRQALVIEGIDVAIRFGKLDDSTAVAKHLADLPR
FT                   GIVASPEYLAQYGVPESPSDIANHRIIAMQSSSPTVWNFNKNGTTTGLRLERHLLVTTN
FT                   EVALASACCGLGIACMTLAAARREISAGKLVVVLPGWTMGHVPLHAVFPAGRAAKPAAR
FT                   VFVNYLADEILADITRE"
FT   gene            9314..11095
FT                   /locus_tag="TERTU_0009"
FT   CDS_pept        9314..11095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0009"
FT                   /product="von Willebrand factor type A domain protein"
FT                   /note="identified by match to protein family HMM PF00092"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11437"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKM5"
FT                   /protein_id="ACR11437.1"
FT                   /translation="MLISIRSIGVLAVSGLLLSACGGGPGGGTTSINDPGSPQVPTNVP
FT                   SFIPTPVPSPSPSPSPTPTPSPSPSPSPTPSPVPSGQGVALYGSVDGLVSGLELELEEI
FT                   YTGQHKSITEPGEFFFPQTFTAGTDFSVIIAQQPEGQNCVLQNSEGTFNGLDFMGLSAS
FT                   CLGEEGYSLELMGFDSRLPSFVIAGLRVEDVASGEPVTQLHTDAFYVEENDQRVGVESY
FT                   LTSEQIPKESVQLRTVLLLDVSTSIDSGEMEKLKTAAKASLISYENDTKTSRLLPGQQQ
FT                   VAIYSFDSEITLLTDYTSDINLLEAAIDTIPNSVLERGNSTNLLGAMEIAAERWNDQID
FT                   LIAVERGYAVLLTDGEHNFDSRSPADIEADLTNFFGTRKKVYAIAVGNNVNLENLEAIT
FT                   ASSEQVLTVNSFESAEELEAVFTEVATTEAKAIEGLYRVFYATPKRQGINNATFSLVDN
FT                   RICVDSTACDESVSSDFFAEEFFDVSPTLFAEVSGGSEESDKSRLIGAGERLTIEAILR
FT                   WANLTPSYTLRIENLVGEVPGLQAVGEDRWVLSFPAGFTSATMIIGETATGYEQTVALN
FT                   RQTDGVLAVSSATLAAL"
FT   gene            11224..12198
FT                   /locus_tag="TERTU_0010"
FT   CDS_pept        11224..12198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0010"
FT                   /product="putative Mg2+ transporter protein, CorA"
FT                   /note="identified by match to protein family HMM PF01544"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11098"
FT                   /db_xref="GOA:C5BKM6"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKM6"
FT                   /protein_id="ACR11098.1"
FT                   /translation="MITEQTFSHALLLDGNGGARHLTSAEVDLWRQDQGILWLHMNFEE
FT                   PAALAWLAEEAGISQLAYEGLVSENTRPRVISRGEKLLMTLRGVNTNPGEDPEDMVSIR
FT                   VWTDGKRIITTYRRRLLSTIDIINSLEEGSGPTSAAEFLLELNERLVERMNDTVEQLEE
FT                   KMLELEELVLSGDTDGVRRQLAGVRLQGVVLRRYFAPQREAMNRLVFDRMPWLDENIAL
FT                   ILRDINDRLIRHIEDLDAIRERASVVQEELVNSMSDAMNQRTYVLTVAAAIFLPLGFFT
FT                   GLMGINVGGMPGVEDPNAFWVVTGMSLITIIILAIVFRMKKWL"
FT   gene            complement(12232..15333)
FT                   /locus_tag="TERTU_0011"
FT   CDS_pept        complement(12232..15333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0011"
FT                   /product="sensory box sensor histidine kinase/DNA-binding
FT                   response regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00165; match to protein
FT                   family HMM PF00512; match to protein family HMM PF00515;
FT                   match to protein family HMM PF02518; match to protein
FT                   family HMM PF07719"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12892"
FT                   /db_xref="GOA:C5BKM7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKM7"
FT                   /protein_id="ACR12892.1"
FT                   /translation="MLLWSLICAGFCAVARAESSNATEPMQSIQRLIQDANSIKRTDAT
FT                   RAIKLAHTGLSQLEDSTESPEKLILFNILAIAYLQSGELASSEEYAQNALILSGKLQQD
FT                   LAQAEALNTLGAMHWYQGDHDLAKSYFEQSLAVRMEIEDSAGLASVYNNLGILEEIQGR
FT                   YHRAIDNYLLSIENAKRTTQKDLLARPLTNLGVVNQMLKNYNEALNYYQEALTLKLELN
FT                   DFPGAALAYNNISEIYREREDLSAAEAALLAGLALLDNQQAPQQLALLSVNLAAVYVEL
FT                   NRPLEARSLFSRAEAINNTINNPRIRMHLAQGQARLFFANNHYPEALTYATQFHTLAAA
FT                   EQDQQSLKKAYYLLYQIYQATQSSADALDALLAYSNLQEILYSQDNSRYVASLQAEFEN
FT                   ERKERELAQLRENSALSALALKRQQLFNYGTILLAIIALLVLVLFFRARANRIQTSLLE
FT                   QKVAQRTQEIQDNALTIKQLLAEKEDLLQHKNELFSVISHEFRTPLTLISGPIEFLFGN
FT                   SRSQPVKDATRRIQANTHRLMRLVDQLLDLARIDQKIAPKPALVDASRYAQFLLSNMEP
FT                   LFTQRQLVLTANIGKDCQIAVNPESLEKIMVNLVSNAIKYTTKGGEIKIELARQEDHVL
FT                   FAVTDNGIGIAEADQARIFQRFTRLETDLSKSTPGTGIGLALVKELVEHAHGEIKLHSR
FT                   LHEGSRFEVLFPIALNDRASNDINNVSLQQNTYPGQANPNTTSLVYATEIQCLSIDSDS
FT                   RMPLYLRPDEDHYHAESQSKESPEHTILIVDDCAEMRDFIGLCLGPQFNCLYAEDGKDG
FT                   VRLALQEIPDLIITDLMMPTTDGYQFAKILREESLTCHIPIVMLTAKGEAEARLTAWQT
FT                   NIDEFIEKPFSTTELVLRCNNLLNIRQLLSSHLRDHLSKGSTEKGRSEIQINPSDKQFL
FT                   QKLHGFLEHNYMENIRAREISSALCITEKQLQRKVKALTHETVPTFVRNYRLQRGAERL
FT                   AAGENITRVALDVGFSSQNYFSTAFSARYGCSPTEYRKAQQAAV"
FT   gene            15471..15626
FT                   /locus_tag="TERTU_0013"
FT   CDS_pept        15471..15626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0013"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11647"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKM8"
FT                   /protein_id="ACR11647.1"
FT                   /translation="MWVKSNESAFLKVFVFLLNVCGGAFTETYGVYEAASNGVRRILAL
FT                   VNLCSQ"
FT   gene            15762..17600
FT                   /locus_tag="TERTU_0014"
FT   CDS_pept        15762..17600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0014"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14414"
FT                   /db_xref="GOA:C5BKM9"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKM9"
FT                   /protein_id="ACR14414.1"
FT                   /translation="MNGRNRKTEAFLISTIKRRWARNFAIYFASHAGLAINCALAIKRV
FT                   ALTGLVGVLCMLAGVAHGLEFRFNNDSAKPLSAEQMDAVYRAAAHWEEAFSDPVTISIN
FT                   VGWAEPHDFSSEGILASVRLARTRVAAELVVDALLAEATAGEAGWISALPQAIPVAHSA
FT                   APLADVELSFANAKVLNIAPTYDPTYGATLEHHADASIQFNLLHEERFAYREGDISGER
FT                   YDFAGVVSHELGHALGFTSVVDLQAFNGSTLLAPSLLDVFRFDPTMPGHNLTFDTRQTL
FT                   PGPAEFYDASGFVSPFAFGVNAYDVKCNALFGLCSASHWRDTTDTLMTTASPGRELKLR
FT                   SGDIAAVDRIGVDTKWRNGIPIIDARLKFYPLIYGLIPDYDPVAFDTKTLAPKFSDLLS
FT                   PSWFADPITNVFHISFDGHAGAGFAVFKRPQTNKKIKPINFNRGENGDKEGSWEEEPQP
FT                   KMLAEIPARLTEFYFETINKQYSYRFINTFSNHGSQFDPNLGPYGGFRISGYLDGNQDG
FT                   DYGSSKNERRDYDASLTLLMVLTTPRDMSSNISNAEFVLYKVKDEHVQDNIAHLIDATA
FT                   FAIPAGYGNSDSYDEALKDRIEKEMDDPEPGRDIAF"
FT   gene            17961..18521
FT                   /locus_tag="TERTU_0016"
FT   CDS_pept        17961..18521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0016"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13563"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKN0"
FT                   /protein_id="ACR13563.1"
FT                   /translation="MKPIDRLFKSASAAGAARMRLSWKQLALATCIGLPCTTALAVDEY
FT                   AESTGVRMQHASEVSSDVFVGRVLKTESRWVGKVIVTEATVAPMQVLKGKLASKSVQVV
FT                   TMGGRVGNIAMTSAHEIALKENELAVFFVKDTDEKSLYGKGKKTFAAGEGKILLKSAAT
FT                   SKDAYFNDARVQQQVRAIEAQIK"
FT   gene            18558..21191
FT                   /locus_tag="TERTU_0017"
FT   CDS_pept        18558..21191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0017"
FT                   /product="matrixin family protein"
FT                   /note="identified by match to protein family HMM PF00092;
FT                   match to protein family HMM PF00413"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11171"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKN1"
FT                   /protein_id="ACR11171.1"
FT                   /translation="MNRNGRNHQRGLLGSALLLPVLYSSLPQSAWAADNIEIPNLAETA
FT                   IHERRWVPAAYPMEWVLNENGVTNNATPISIADAEAELTAAFQAWENVPEAVISASYGG
FT                   TTSTSDLGCDLENIVTWDDSAFGFSATTIAVGWTFVYQGPPLIISDVNRDIGCGDLDPG
FT                   IYPNGSQLPTGAIFDADMIWNDTNFNYSTTPNSTPNVHDIRAVATHEFGHLFGVSHTSM
FT                   VFSGNSPATMYPAVSSTSVTWQNNVRSLEADDEMAAARSNPGMGFYPTGTAPWTTGSIS
FT                   GRVRQINGTAAQGVRVWAYNTADLSAPVYEAFTATQFDAEAGVSSGEYEFRGVPAGSYY
FT                   VCIVPWGVNVPNADLDNTGRYNLSTLNGSGNTGFATECYDDAPAGMASPDFSEIDRLRE
FT                   VDVATGETTPNINFVTGAQNTDVVLVMDRSGSMNLSSAPDPSVSKMDALKYAANVFMDF
FT                   LDLDAGHRAGLVQFHEVVVPFSPAFNLQPVNAASLSAAQTAINSMTAGGMTNIIDGVNE
FT                   GIAQLTTAVDPSDRQIMLLLTDGLHNRPVGTSVTDITAPLLASEVTLYSVGFGTSTNEA
FT                   ELTPLALSTGGVHLENKDVSDLQLRKHFLSIAASAADSTTLIDPHYDLAPGESAVLDVP
FT                   VLKSERDLTFAVMWSEPDPDRFDISLRSPRGCTIATRLNKPGVQIRKGDTHRLVNVKLP
FT                   YKCMFRDDHAGEWKVIVSSPKESNHKETSGVDIAVYGDSTTHIFAQARMTEDYPAVEAK
FT                   IVANGEIVKEARMTAEIILAAWPTGDSEAEDYYCSEGKQGNKRCRNKPVEPPLEERIKT
FT                   IELNDYGSDVDRKKGDGIYSAILPTELPGSYQVRVIADYSDDSGKGKREVLTSYYFDGK
FT                   QIVVAK"
FT   gene            21390..22001
FT                   /locus_tag="TERTU_0018"
FT   CDS_pept        21390..22001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0018"
FT                   /product="translocator protein, LysE family"
FT                   /note="identified by match to protein family HMM PF01810"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14748"
FT                   /db_xref="GOA:C5BKN2"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKN2"
FT                   /protein_id="ACR14748.1"
FT                   /translation="MQLETVIALAATMIVLAATPGPGVLLVVSRTLALNFRHGVYTSAG
FT                   IVAGDFVYIAVVVASMSFIAATLEPLFLFIQYASAAYLMWLGVQAWRNADKPLALDTEG
FT                   PKSQRSFWIGLVVTLGNPKAILFYLGFLPAFIDLTQVNAMDVLILYILAAVIVGGVMVC
FT                   YAFAVSKSKNLLADARFEAIIQRAAGSIFIVTGLWILLRR"
FT   gene            22005..23645
FT                   /locus_tag="TERTU_0019"
FT   CDS_pept        22005..23645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0019"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11955"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKN3"
FT                   /protein_id="ACR11955.1"
FT                   /translation="MNLKGMCTKGIIIGLGFGLLAACQTTTPSKPDPVYISHTAPAVAG
FT                   KPTISGLTDLGSLPQNLGNTPSTAFADERFSPGEWVMLKGKNLAVNSLHIDDQTVPVDL
FT                   YYGQNPLFKIPVGLNPTKLHNIVIDNGQGKAASTFKSSHYIVATDTDGKQRHLIRTNPD
FT                   DRGSIEEDWIDLASEAERPLFTLFSADSSYLFTVNIASRVEEDTDKEANAYVMEVRVFH
FT                   AAAPDAPALLKQFEVVVDSSPIDVTISANNQIVLLGKRSFTVIDASDPLAMVERQRVQL
FT                   PAGGEEKTTFVDVIYFADDQRLAFLETYSNRIFVYDTASLSPLADVNVLPEKSIALGVD
FT                   LEPDPKDSNSFWALMGPNYRLTGSGLVKQYKTLMGKDIPADKRGVHQLVHYSFGESGLV
FT                   ETKRHELDSDYAAYFAQADNNGDLLITATKLQFLTTDLEGKKTTEVLKMTKKLVWDALS
FT                   FGRVIKVDRDSGAMETVSSGVGIYYDLEWVPGIGQVFSLLKFGPSFSFPYITPSWGVGI
FT                   ASTGTYAKRKMNKYAVFPPYSVGDIEYQD"
FT   gene            23651..24265
FT                   /locus_tag="TERTU_0021"
FT   CDS_pept        23651..24265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0021"
FT                   /product="integral membrane protein"
FT                   /note="identified by match to protein family HMM PF01694"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13106"
FT                   /db_xref="GOA:C5BKN4"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR023826"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKN4"
FT                   /protein_id="ACR13106.1"
FT                   /translation="MPLPIKSPPLWLFILLLFVVIELLLGVLGSWLNPSLQYARSAILH
FT                   GEVWRVVTGHLVHLGLVHTLLNMSGLVLIMHLFGSLLPVRVWLCCGLLMALGISAGFLL
FT                   FNPELSYYAGMSGVLHGLLLFGIGLALLRNELYPRWLLVLIGCGVVGKLFSEQLPSYDI
FT                   YYLQEHMHAAVIVDAHLYGAIIGLSLLPVIHFWRKHGGRKS"
FT   gene            24379..26295
FT                   /locus_tag="TERTU_0022"
FT   CDS_pept        24379..26295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0022"
FT                   /product="acetoacetate-CoA ligase"
FT                   /EC_number="6.2.1.16"
FT                   /note="identified by match to protein family HMM PF00501;
FT                   match to protein family HMM TIGR01217"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14199"
FT                   /db_xref="GOA:C5BKN5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR005914"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKN5"
FT                   /protein_id="ACR14199.1"
FT                   /translation="MLWQPSPERIQRSAMWRFMKHYASEFSLTSPSYRALHNYSVAHPG
FT                   DFWLALMDFYQVKVAGEREPAVTDLGFEHYGWFPNLILNFAENLLLHGEADHPALVSLL
FT                   ESGDKRSYTYAQLRSAVAGLQAQLADCLQEDDVLACYMPNIAETVIAMLATTASGAVFT
FT                   STSADFGVDGVVDRFGQSRPRVLVTCAGYQYNGKYYDICDKVAAIVAQLPSVEKVLVVD
FT                   RYHKSPDISAIEHAELWQEPESDNPIAFVPRAFAAPLYIMYSSGTTGKPKCIVHATGGV
FT                   LLQHIKELGLHSDFSAQKRILFFTTCGWMMWNWLVSSLFFGGTTYLYEGSPAYPSFEKF
FT                   MGLIGEEQIQLFGTSPKYLKVLQDAKVPLYKCDFSSLETLLCTGSPLLPEQYDFIYHEI
FT                   KHDLLVASISGGTDIIGCFFLGNPILPVYRGELQCAGLGMAVDCVDDDGRSLVGKQGEL
FT                   ICLNSFPSRPLYFLNDPDNSKLHDAYFAGHEGVWTHGDFIEITERGGAIFYGRSDATLN
FT                   PGGVRIGTAEIYQQTERLSYIEDAVCVGKQVAGDVEVMLFVKMKADETLNEARMAEIRT
FT                   TIKTHTTPRHVPKRVIQVADIPYTRSGKKIELAVAKLINGKAVNNLEAIANPECLAEYE
FT                   GLA"
FT   gene            26402..27181
FT                   /locus_tag="TERTU_0023"
FT   CDS_pept        26402..27181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0023"
FT                   /product="putative secreted protein"
FT                   /note="identified by match to protein family HMM PF04402"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14494"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKN6"
FT                   /protein_id="ACR14494.1"
FT                   /translation="MRLLAATLLSIGAITAQAAPEIKGTPDELRQLVHPVENRVMISGE
FT                   AQEKAYTDKAIVSVVVTTEEKQLAKSLAANAALRSSIQQQLLKAGIAADAIKSSKFSTS
FT                   PQYGWFGSKPDSYKVVNRMAITISEEKQMEAIATAADSHKEIEVSSTEFEHTQKDEFDQ
FT                   KVKAAALAKIMATKKNYEKTLGITLKPVAIRDSRIFQRASVGARGVEEVLVTAQRRMKT
FT                   SATMADESSFAPTPSSGGSSFDEIVYEAFLEVEFKVE"
FT   gene            complement(27309..27725)
FT                   /locus_tag="TERTU_0024"
FT   CDS_pept        complement(27309..27725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0024"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11123"
FT                   /db_xref="GOA:C5BKN7"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKN7"
FT                   /protein_id="ACR11123.1"
FT                   /translation="MRRSLTWRGFALRSLFALLLVALSYNPTGYSFSHWLLRVFPNITP
FT                   LLALSFIVLTIGWAIYIRATFRSLGAVGTALAILLFVCIIWLFVDWGWLRLDNVSVTTW
FT                   LVELILVLVLSIGISWSFIRRRLSGQVDVDDVDA"
FT   gene            complement(27737..28444)
FT                   /locus_tag="TERTU_0025"
FT   CDS_pept        complement(27737..28444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0025"
FT                   /product="Acyltransferase domain protein"
FT                   /note="identified by match to protein family HMM PF01553"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11621"
FT                   /db_xref="GOA:C5BKN8"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKN8"
FT                   /protein_id="ACR11621.1"
FT                   /translation="MSYFRSGLFSVLYFCTGMFFGSLSVLLLVLPIRLRHKIIMSWTFM
FT                   AVQMLRFICGVKYELIGREHLQNRQGPVVILAKHQSTWETLYLQNLFWPASTVLKKELL
FT                   NIPFFGWGLRALVPIAIDRENPREALREVKVKGLKRLKHNYNLLLFPEGTRMKVGERGK
FT                   YARSGADIAIESGVSIIPVAHNAGKFWPSGEFLKKPGTIKIVLGEPISPEGKTSKMLIQ
FT                   QVEDWIETTVKTL"
FT   gene            complement(28504..30564)
FT                   /gene="glyS"
FT                   /locus_tag="TERTU_0026"
FT   CDS_pept        complement(28504..30564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="TERTU_0026"
FT                   /product="glycyl-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="identified by match to protein family HMM PF02092;
FT                   match to protein family HMM PF05746; match to protein
FT                   family HMM TIGR00211"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14756"
FT                   /db_xref="GOA:C5BKN9"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKN9"
FT                   /protein_id="ACR14756.1"
FT                   /translation="MHFLVELGTEELPPTALKTLSHAFTQGIQDGLTQKNLGFDSVESY
FT                   ATPRRLAVSVTGLADKTPQESVKIFGPPAQVAFKDGAPTKAAEAFARKNGIALEALQTG
FT                   MDGKVEKLVYETTAGGEATVDLLADLVAQSLANLPIAKRMRWGASRTEFVRPVHWLVML
FT                   ADDKVLPAEILGLTSGNETRGHRFHYNQPITLKHANQYAAALAETGHVVASFSERQAMI
FT                   VKQVNTAADKLGGTAVIDADLLDEVTALVEYPVALAGNFENEFLNVPSEALISSMKEHQ
FT                   KYFHVVDNDGELLPHFITIANIVSQDPAQVIDGNERVIRPRLSDAKFFFETDKQTSLEA
FT                   RREKLKTVVFQAKLGTIYDKTERIGKLATLIAARLGENEATVKRAAELCKSDLVSTMVY
FT                   EFTDLQGIAGYHYANNDGEDAEVAQAMVEQYMPKFAGDDLPATATGTIIALADRLDTIT
FT                   GIFGIGQKPTGSKDPFALRRASVGALRLMVEKKLDLDLRDLINAAADSFTALPNAQVVD
FT                   DVLAYMLERFRAWYEEASIPAEVFMAVSAKQLSNPLDINNRVYAVAEFSKLAEAQALAA
FT                   ANKRVSNILAKLDSAPASEVDAALLTDGAEKQLADALASYAAQARPLLAEANYTDALKV
FT                   LAGLRATVDTFFDDVMVMTDDMAVRNNRLALLQSLRDLFLEVADISLLAVK"
FT   gene            complement(30566..31516)
FT                   /gene="glyQ"
FT                   /locus_tag="TERTU_0027"
FT   CDS_pept        complement(30566..31516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyQ"
FT                   /locus_tag="TERTU_0027"
FT                   /product="glycyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="identified by match to protein family HMM PF02091;
FT                   match to protein family HMM TIGR00388"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14209"
FT                   /db_xref="GOA:C5BKP0"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BKP0"
FT                   /protein_id="ACR14209.1"
FT                   /translation="MSKPDVSTFQGLILALQQYWAEQGCVVLQPLDMEVGAGTFHPATF
FT                   LRAIGPETWNSAYVQPSRRPTDGRYGENPNRLQHYYQFQVVLKPSPDNIQELYLGSLKH
FT                   LGVDPGIHDIRFVEDNWESPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECYPVTGEI
FT                   TYGIERIAMYLQNVNSIYDLVWTISPDGTPVTYGDVFHQNEVEMSHYNFSHANVDFLFQ
FT                   TFDTCEAESSKLIDAGLPLPAYEMVMKASHAFNLLDARQAISVTERQRFILRVRTLARN
FT                   VAQAYFDARLKLGFPMAPAALRDEVIARANAEGEK"
FT   gene            31692..32576
FT                   /locus_tag="TERTU_0028"
FT   CDS_pept        31692..32576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0028"
FT                   /product="lipid A biosynthesis lauroyl acyltransferase"
FT                   /note="identified by match to protein family HMM PF03279"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11229"
FT                   /db_xref="GOA:C5BKP1"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKP1"
FT                   /protein_id="ACR11229.1"
FT                   /translation="MEKIIAKLTLLTLRSIGRLPLPAGLFFGTLLGRIAWLVGPREVHT
FT                   TRRNIEACYPQLSAREQTALARQSVIESGRLAFEINIVWQRSTEWLHGQIVSISGEHLI
FT                   TQRDKSRGLMILGPHVGNWEVLGAICSGYGPIAFLYQPPKKKHLEPLMIAARSKQGATQ
FT                   LPTDVRGVAGLMRTLKRGETIGILPDQNPDDNGGDFAELFGHQALTMTLVHKLLQKTGA
FT                   QVIMGAAIRVPSGFAIHFWEAPAGIDSADEAESLRALNVGVEQSVALAPSQYQWEYKRF
FT                   RRQPEGMPRFYHR"
FT   gene            32746..33222
FT                   /locus_tag="TERTU_0030"
FT   CDS_pept        32746..33222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0030"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12443"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKP2"
FT                   /protein_id="ACR12443.1"
FT                   /translation="MRMRALLAIGLIAIPIILPSVSAAEIYRWRDANGKLHFSDKAPEQ
FT                   AKAENVSLPDINRADAVKIRRKPTPIDTRYSNTPDDDPQVLADANRQKVCDNAAQYYER
FT                   LTRGINHNASSKRIVLQQDGETLSRREQNQYAERMRLNYNRQGCAIPQAENLRL"
FT   gene            complement(33211..35922)
FT                   /locus_tag="TERTU_0029"
FT   CDS_pept        complement(33211..35922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0029"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACR10688"
FT                   /db_xref="GOA:C5BKP3"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKP3"
FT                   /protein_id="ACR10688.1"
FT                   /translation="MRSTFVKYAPWTLLLIIVVLASKGAYMYPHDPLAQTVGSIAGHEW
FT                   QYNIWRTLGMADALADGMPGRWLSSYSHHWGYPLFEYTSPFPYTLSSVLLLLGFDAHSA
FT                   LNMVWLLTFAGAGVAMFWAMRPIFGIWSALAAATCYILAPYHLVDIFVRTNLVETSAFL
FT                   FPPFVIRGLWEAQHDRLKGVLYGSIGIALLPLSHMLSTYLIGLSLIVFCGVYFLLLPLR
FT                   EKLPFAIGALLIATVGLGLSSFFWWPALADISAIKGMDAMTGGFYSYTKHFVYPHQLIS
FT                   SKFEYGASEPGPVDYMSFSLSLERVILAGAAVALAVFALLRGLLHRDTRNEPRAELAAK
FT                   QQRARLVISAAITAACASFLTLAISEPLWKLLPGIEAAQFPWRFLFPASFYLAICAGAV
FT                   PVLAGQLSPKFRWLTPLLGGLVVLAILHLQWQAARAGSYGTVEPGEIAQLKSGELGVWT
FT                   TNQLEFMPVGTEIPYKEARREATVTLYDSFFTPQPARVSLAEIENGRAKVLLQPGAAGT
FT                   LVINQHWHPAWRASADGEPLATRPFEQHPFAPIAVDLPEGVQELEVVFGYSTSGRWGLW
FT                   LSLLAFAVVVAWAVSTQRGGLLRNAVVPLGYLCTLLVFYWLTGTPRTASKEDLFASVHT
FT                   TIAAEDYANPVNMHSEWNAKGNFIIPSSGVAVEFAEVQHNSHISLSLDSNDSFMLWLLN
FT                   NDELVTSDFLHGRNVGGMFTYTLMFNKNTMDTGFDKLVLVPVAGDGAFSLGHVVAHSQH
FT                   PVPEDHKRVQLSAGIPTVRAEDYELYKANRTEWDDPSNATMKETGLLVDFGKPVTGDRI
FT                   DLSLDWNDFYLVGFVRGEEFVGFATARKAAGTNLKGLARRNLAIPDNVKELGFDKVRIV
FT                   PTWGDGYYSLGHIRIAGLRDAPAGPVQPVSEP"
FT   gene            complement(36006..37253)
FT                   /locus_tag="TERTU_0031"
FT   CDS_pept        complement(36006..37253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0031"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11932"
FT                   /db_xref="GOA:C5BKP4"
FT                   /db_xref="InterPro:IPR016900"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKP4"
FT                   /protein_id="ACR11932.1"
FT                   /translation="MFKSSQLPTVSWVLLAGILLVATWLGTQMMPPAQTFHDESFHMPQ
FT                   IRAYHMERYSHLEKSLTMIPGYHLAVATVSKTLFGQGIKDTRLASTLLSLPALLFFFLC
FT                   ARRLGHTSPLLSTTTYYLNPIFFPFFFVIYTDVPSLTLVLAGLYFTLSQRFTLAGLVML
FT                   LSLGVRQTNVMWLALFWLFALYNLLGNPLHIRWLKPENWRQLGGALLRTWAFPIGIVAF
FT                   LVFVYQNGGVAIGDATAHKMDRIFVTQVFFLLLAVGLLFIPLHLMNARAGFDLLRFQPQ
FT                   CAVILSLLLVLYLLTFWAEHGYNLFDFFLRNRVVMWTRANEVHKVLAFVPMAIALLSLM
FT                   VTPLREKRFYWLYVVAIASLLPHSLVDQRYFMEAITMFLLFMVPQHTRLHWYTLALFIP
FT                   VTLIICIGIGDIRFFI"
FT   gene            37307..37426
FT                   /locus_tag="TERTU_0032"
FT   CDS_pept        37307..37426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0032"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12569"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKP5"
FT                   /protein_id="ACR12569.1"
FT                   /translation="MKGNDNVALSNRYLFYLFYDYGGVIIKDITMGLNDNSGY"
FT   gene            complement(37446..38894)
FT                   /locus_tag="TERTU_0033"
FT   CDS_pept        complement(37446..38894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0033"
FT                   /product="TrkH"
FT                   /note="identified by match to protein family HMM PF02386;
FT                   match to protein family HMM TIGR00933"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11938"
FT                   /db_xref="GOA:C5BKP6"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKP6"
FT                   /protein_id="ACR11938.1"
FT                   /translation="MHFAIIAKVLGILLMLFSLTLTPPILVSLYYGEQAHISFLLAFAI
FT                   TFSTGLFTWLPVHNVQSDLSTRDGFLITSLFWTVLALFGALPFIIAHSTQLSVTDAVFE
FT                   SLSGLTTTGATVLTGLDYLPRSILFYRQQLQWLGGIGIIVIAVAILPMLGIGGMQLYRA
FT                   ETPGPVKDSKLTPRITETAKALFFMYVALTAACAFSYWLAGMPPFEAVAHSFATVAIGG
FT                   FSTHDLSMGYYDSAPILIVSSLFMVLSGINFALHFVAWQSRGISHYLTDPEFRFYLTMI
FT                   LIGIVITVSYLASTGIYPTEKSILYGIFELISILTTTGFAVVDFTLWPTFLPYLIFMFA
FT                   FMGGCAGSTGGGLKMIRVVLIMKQGLREIHRLIHPNAVIPIKLGRKTISDRVVEAVWGF
FT                   FAVYVVSFLVMVIALLGLELDFVTAFTAVGACLNNLGPGLGAVAAHYGDIGDTAKWILC
FT                   FAMLLGRLEVFTLLVLFTPMFWKR"
FT   gene            complement(38912..40363)
FT                   /locus_tag="TERTU_0034"
FT   CDS_pept        complement(38912..40363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0034"
FT                   /product="TrkA"
FT                   /note="identified by match to protein family HMM PF02080;
FT                   match to protein family HMM PF02254"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11235"
FT                   /db_xref="GOA:C5BKP7"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKP7"
FT                   /protein_id="ACR11235.1"
FT                   /translation="MKIIILGAGRVGGTLASNLASEANDITVVDSNEGYLRELRDRIDI
FT                   GVVAGHASHPEVLLRAGIEDADMLIAVTGVDEINMVACQIAHSLFRTPTKIARIRSQEY
FT                   ASHPGLFRPDALPVDVIISPEQIVSAYLFRLIEQPGALQVLDFAEGAVQLVAVRAYYGG
FT                   PLVGQELRFLRKHMPNVDTRVAAIYRRNRPIMPTGSTVIEADDEVFFLAAKQDIRAVMS
FT                   ELRRLDRPYKRIIIAGGGNIGQRLAEQLENNYSVKVIENNEARCLALTERLSKSIVLLG
FT                   NSSSQELLAEEHIEDTDVFLAVTNSDEANIMSSMLAKRMGARKVLTLISNPAYADLVQG
FT                   SDIDIAISPQLATIGTLLTHVRRGDIVNVHSLRRGAAEAIEVIAHGDSRTSKVVGRAIE
FT                   DIDLPEGATIGAIVREASAEDYRDSGVRSDMSLGSTGKTYQYQEVIIAHDDVVIESGDH
FT                   VILFLVDKRYTRDIERLFQVGFTFF"
FT   gene            complement(40391..41692)
FT                   /gene="rsmB"
FT                   /locus_tag="TERTU_0035"
FT   CDS_pept        complement(40391..41692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsmB"
FT                   /locus_tag="TERTU_0035"
FT                   /product="ribosomal RNA small subunit methyltransferase B"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by similarity to SP:P36929; match to
FT                   protein family HMM PF01029; match to protein family HMM
FT                   PF01189; match to protein family HMM TIGR00563"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACR10656"
FT                   /db_xref="GOA:C5BKP8"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKP8"
FT                   /protein_id="ACR10656.1"
FT                   /translation="MADARVQAARTLGEVLAKHCSLNKPFDTGINKLDERDRGLFQELC
FT                   YGTLRWYHRLEAIAGELLQKPLRNKDQDVYALLLIGLYQLEYLRVPDHAAISETVNASR
FT                   ALKKPWASGLLNGALRSFQRDREQIFKKISGKPQASFSHPNWLVARLQQSWGAQASRIL
FT                   HANNQQPPVCLRVNLKRQSRDEYLVKLQQAGLQAQPLASSPSAVRLLSPLDIQQLPGFS
FT                   EGLVSVQDEAAQLAAYLLALEPGQRVLDACCAPGGKSCHILEAEPALTELVCLDSEQDR
FT                   MARVEENLARLQLSGATLTTGDASTCQWWNNQPFDRVLLDVPCSATGVIRRHPDIKLLR
FT                   REDDLAKLSALQQAILNNVWQMLKPGGLLVYATCSVLPEENSELITQFVTDHKDAELAP
FT                   MDADWGIEQPAGRQLLPQLEGPDGFYYARLIKAG"
FT   gene            complement(41685..42650)
FT                   /gene="fmt"
FT                   /locus_tag="TERTU_0036"
FT   CDS_pept        complement(41685..42650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="TERTU_0036"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /note="identified by similarity to SP:O85732; match to
FT                   protein family HMM PF00551; match to protein family HMM
FT                   PF02911; match to protein family HMM TIGR00460"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12466"
FT                   /db_xref="GOA:C5BKP9"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKP9"
FT                   /protein_id="ACR12466.1"
FT                   /translation="MNSHRRRLIFAGTPEFAAAHLRALLASEHDIVAVYTQPDRPAGRG
FT                   KKLTASPVKALAQEHDLPVYQPASLRAAEAQAELAALGADVMIVVAYGLILPQAVLNAP
FT                   RLGCLNVHGSILPRWRGAAPIQRAIEAGDTHSGVTIMQMDAGLDTGAMLLKRECPIQTN
FT                   DTASDLHDRLAELGPPALLDTLAQLEDLTPEAQDDSQANYAHKIEKAEAVLDWRLPALQ
FT                   LHRQIRAFNPFPICYTLLDDDRLRIHSAELCDLSGESGTVVAADRERLVIACGEASLAV
FT                   TRLQLPGKKAMTPAEFANGHSHLCPVGTRLGLPPQGEQHG"
FT   gene            complement(42684..43190)
FT                   /gene="def"
FT                   /locus_tag="TERTU_0037"
FT   CDS_pept        complement(42684..43190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def"
FT                   /locus_tag="TERTU_0037"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="identified by match to protein family HMM PF01327;
FT                   match to protein family HMM TIGR00079"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11844"
FT                   /db_xref="GOA:C5BKQ0"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BKQ0"
FT                   /protein_id="ACR11844.1"
FT                   /translation="MALLPILEFPDARLRTVAKPVEQVDERVRAIIDDMFETMYDAPGI
FT                   GLAATQVNVHEQIIVIDISENHDEPLVFINPRIDVLDETLFDYEEGCLSVPGFYEEVTR
FT                   PRHVRVTALNRDGEEFVLEPEGLLAVCIQHEIDHLKGKLFVDYVSNIKRQRIRKKLEKQ
FT                   HKERA"
FT   gene            43414..44454
FT                   /locus_tag="TERTU_0038"
FT   CDS_pept        43414..44454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0038"
FT                   /product="peptidoglycan-binding LysM"
FT                   /note="identified by match to protein family HMM PF01476"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12053"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKQ1"
FT                   /protein_id="ACR12053.1"
FT                   /translation="MNKQLSGLLAALLLLASPLFALAQAAEVPELNDPVPATYTVVKGD
FT                   TLWDISATFLKNPWMWPEIWHVNTQIANPHLIYPGDVIRLIYMDGKPRLTIESRGNVYK
FT                   LSPQARVLSAGEAIETIPLDKINSFLSRSRIVDEADLKGAPWVLAGMDEHLVVGAGDSL
FT                   YARGEFPEGKQVYGIYRRGETFVDPETREKLGVLARDIGTGSLVRVSGEVATLSISRTT
FT                   EEIRAGDLLLREEQRAIDSTFYPSPPESDINGVILAVEGGVHQVGNMDVVVINRGGREG
FT                   LAPGNVMAIYKKGGKIIDRVTQERVQLPDERAGLMMVFRVFDKVSLGLVLEAERGISVS
FT                   DRVTNP"
FT   gene            44549..45718
FT                   /locus_tag="TERTU_0039"
FT   CDS_pept        44549..45718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0039"
FT                   /product="SMF protein"
FT                   /note="identified by match to protein family HMM PF02481;
FT                   match to protein family HMM TIGR00732"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13495"
FT                   /db_xref="GOA:C5BKQ2"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKQ2"
FT                   /protein_id="ACR13495.1"
FT                   /translation="MLSVVQQKLLLQYLPGVGASTFWKLMERSPSALGVLNTSPESLAD
FT                   LLNEEARQLLREFQHEADNSRLAKLMAADLEWCENNNIEILDTDHEYYPELLREIKRPP
FT                   PVLYVAGDARLLSFPQIAVVGSRNPTPSGRGSAFDFSRELAASGFVVTSGLALGVDSAA
FT                   HQGALAAQGKTIAVLGTGIDQVYPQRNKQMADQIVQTGGALVSEFPLGTTALPANFPQR
FT                   NRVISGLSYGVLVVEAAPRSGSLITARYAIQQNREIFAIPGSIHNPLAKGCHQLIREGA
FT                   KLVDDAKDIVDELQHFLRLQWQQLDLDKVADEPQQSEIVATEEESIILEQLGYESTPID
FT                   EIAERTELPVGDVMACLLTLELKGLVANVGTGYMRLKHSSVPDLSFHAN"
FT   gene            45817..46323
FT                   /gene="purE"
FT                   /locus_tag="TERTU_0040"
FT   CDS_pept        45817..46323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="TERTU_0040"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="identified by match to protein family HMM PF00731;
FT                   match to protein family HMM TIGR01162"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13177"
FT                   /db_xref="GOA:C5BKQ3"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKQ3"
FT                   /protein_id="ACR13177.1"
FT                   /translation="MSQPFVAILMGSDSDLPIMEAAFTVLEKLEIPFEAKVTSAHRTPK
FT                   ATHDYVVDADKRGCAAFICAAGMAAHLAGAVSATTLKPVIGVPIDGSLDGLDALLSTVQ
FT                   MPGGIPVATVAIGKAGAKNAAYLAAQIIGVGDAAMHQKLIDERAANAQQVQEKDAALQE
FT                   KLKNR"
FT   gene            46335..46895
FT                   /locus_tag="TERTU_0041"
FT   CDS_pept        46335..46895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0041"
FT                   /product="protein YrdC"
FT                   /note="identified by match to protein family HMM PF01300"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14644"
FT                   /db_xref="GOA:C5BKQ4"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR023535"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKQ4"
FT                   /protein_id="ACR14644.1"
FT                   /translation="MDYRAHPAIHRCVDALNKGDVIAYPTEAVWGLGCDPFNQHAVDKV
FT                   LWLKRRKPEKGLIIVAASAAQIQWLLQGITPAQEQQLSASWPGPNTWLIPHHGRIPANV
FT                   CGQHATIAVRVSSHPVVRALCQAYGGPIVSTSANPQALRPARDATQVRHYFRDSVYYAP
FT                   GRVGGNPTPSVIRDLRSGQIIRP"
FT   gene            46911..47834
FT                   /gene="hemF"
FT                   /locus_tag="TERTU_0042"
FT   CDS_pept        46911..47834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemF"
FT                   /locus_tag="TERTU_0042"
FT                   /product="HemF/Oxygen-dependent Coproporphyrinogen III
FT                   oxidase"
FT                   /EC_number="1.3.3.3"
FT                   /note="identified by match to protein family HMM PF01218"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11453"
FT                   /db_xref="GOA:C5BKQ5"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKQ5"
FT                   /protein_id="ACR11453.1"
FT                   /translation="MANPSDTPDKAAVKSYLLDLQQRICNQLEAVDGGGRFAADTWQRA
FT                   EGGGGESRVLTDGAVIEKGGVNFSHVMGAAMPASATAHRPELAGRSFEAMGVSLVIHPS
FT                   NPYVPTSHANVRFFIAEKPGEAPVWWFGGGYDLTPYYGNEEDCRHWHRTAADACEEFGA
FT                   GVYTEYKRWCDEYFYLKHRQEPRGIGGLFFDDLNHWGFNRSFAFMQSVGDSYCRAYLPI
FT                   VERRKHLPYGERERQFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSLPPLVRWE
FT                   YDWQPEAGSPEASLYDNYLQPREWLS"
FT   gene            47831..48652
FT                   /gene="aroE"
FT                   /locus_tag="TERTU_0043"
FT   CDS_pept        47831..48652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroE"
FT                   /locus_tag="TERTU_0043"
FT                   /product="shikimate dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /note="identified by match to protein family HMM PF01488;
FT                   match to protein family HMM PF08501; match to protein
FT                   family HMM TIGR00507"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14208"
FT                   /db_xref="GOA:C5BKQ6"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKQ6"
FT                   /protein_id="ACR14208.1"
FT                   /translation="MTETIDRYCVFGNPIEHSKSPEIHRAFAQQTDQHLEYTRELVELD
FT                   AFMSAAENFFAAGGAGANVTVPFKQEAFQFAKLLTERAQLAGAVNTLARLEDGEIIGDN
FT                   TDGAGLVHDIVQRLNWPMENKKILLLGAGGAVRGVLLPILQQSPASIAIANRTRSKAEE
FT                   LAKQFTSFGKVDGYSYNNLPSEPFDLIINGTSASIAGEVPPVHFGCFGEHTAVYDMMYA
FT                   DDLTPFLEFARDMGVQQLSDGLGMLVGQAAESFRLWRGVEPAVIPVLEKLR"
FT   gene            48841..50118
FT                   /locus_tag="TERTU_0044"
FT   CDS_pept        48841..50118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0044"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACR10742"
FT                   /db_xref="GOA:C5BKQ7"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR034122"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKQ7"
FT                   /protein_id="ACR10742.1"
FT                   /translation="MSVLKQVLLIGAAFSAGWVVRDQFTGRDGLSTGKTPSTQTQIVLE
FT                   KDKYVPVFVDSPAPAADAPTESEPDNSRTVPAGDSALQQLSARNNDAATFETLLNNQQY
FT                   QQAVNFYTARESALSESELQSWRAMVYQHLELKLSNAELRAFSELAETWLNYRYNDIKV
FT                   ILLQAQYNWAKGYINEALHSFIQADSYATSRIERSQVREQLYKFVVRYDAQLASAEDWF
FT                   GLASFYEQLTLLGVASSGDKYRYAELLLMQGDDKTAFRYLDEISSDPSWRRKAQELREL
FT                   WADEGEYQASSSPGFASSVPLRPVGDHYLVELRLNNGEPVSLMLDTGASITMLNTRAFG
FT                   QQISATGWQDMGWRYFNTANGVAQGRLMQVASAQFGEFQLNDMQVSVQEVNLGGQIDGL
FT                   LGMNVLSRFHFQIDQDNHQLLLTPRS"
FT   gene            50491..51018
FT                   /locus_tag="TERTU_0045"
FT   CDS_pept        50491..51018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0045"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11198"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKQ8"
FT                   /protein_id="ACR11198.1"
FT                   /translation="MHILIALLTAITGLVWALYRQQRSGRSLNVFNPLYWLRQREWKNK
FT                   YSGNPCHNLFDPIDATALLTVGVATCETSTTRELKSAIITLFENEFNVANNRASELYSA
FT                   SHHMLREIGDLATEVRAVLQPCKHEFSTGRINALHRLLIRSAEIQHPATVAQLKIIAAV
FT                   DQVFQKPQSQPL"
FT   gene            52130..53128
FT                   /locus_tag="TERTU_0046"
FT   CDS_pept        52130..53128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0046"
FT                   /product="carbohydrate binding module family 33 and 10
FT                   domain protein"
FT                   /note="identified by match to protein family HMM PF03067"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14100"
FT                   /db_xref="GOA:C5BKQ9"
FT                   /db_xref="InterPro:IPR002883"
FT                   /db_xref="InterPro:IPR004302"
FT                   /db_xref="InterPro:IPR009031"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR036601"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKQ9"
FT                   /protein_id="ACR14100.1"
FT                   /translation="MFASKFVKASAAVALFGFAGLAFGHGYIESPPSRQQHCGAEQKPD
FT                   NPSSAKCDEAFANYRAAGGQNSHWYNFMSVVAHHEGRKVVKGTEHVCGFDGETWNPAPY
FT                   DTPANWPVTSFNSGQQTFVWDISYGPHFSDTEELVFYITKPGFSFDPTRELTWADFEDQ
FT                   PFCDESIVPGDFSTNSAVEADMANSHINVTCNVPSRSGRHVIFAEWGRNEHTYERFFSC
FT                   VDVDFGGGGSGSSTSSSSSSSSSSSSSSSSSSSSSSSSSSTGGSSSSSSSSSSSSSSSS
FT                   SSSSSSSSGSTTGGTCNWYGWMVPICQNADSGWHNENQQTCIGRNTCTNIQ"
FT   gene            53320..53919
FT                   /locus_tag="TERTU_0047"
FT   CDS_pept        53320..53919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0047"
FT                   /product="carbohydrate binding module family 2 domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00553"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12899"
FT                   /db_xref="GOA:C5BKR0"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKR0"
FT                   /protein_id="ACR12899.1"
FT                   /translation="MKKSLLLVLLLFVVVGAVLLVVNRGPSTANKVSLTPVPKMTDSPP
FT                   VQPLKFHSEKPAEKTVTSEKNIPTPAEPAQAQPLESAQEPAQPKPDKPTDKQFLLCEHI
FT                   ISSVTQYGFTGEIRLINKGNHPVNGWSVTWEYPDGSAIIDADDVALSGNNPYTGEYLSW
FT                   NAEIAPGQTVTFKFSGVKGGENAPLGVKVTGESCMN"
FT   gene            53956..55524
FT                   /locus_tag="TERTU_0048"
FT   CDS_pept        53956..55524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0048"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01564"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11398"
FT                   /db_xref="GOA:C5BKR1"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKR1"
FT                   /protein_id="ACR11398.1"
FT                   /translation="MSKQPTVQKGSQAKLDNFVFYGTVSVTGAAVMMVELLGTRIIGPY
FT                   YGVSLVVWSSLLSVSLLALAFGYYLGGFFAANRGQWRLPHAVFTASVFIAAIPVLSQPV
FT                   QLMFNGLGLRGGALASAFVLFTPALLMLGMAGPLVIQMATARVERVGATAGNVYAISTI
FT                   GSVLGTLVLGFYLLPLFGTHAILWALALVLLLLALLLVIYERHRMKLATRLWPWLIAGL
FT                   LVVIGVGAQAANASAKSYENYNVLFEQETHYGWVRVVDQPEKDLRWLMSDASTIGVEHL
FT                   PTGQGLLGYQSIVRTLPWFKLESEKALLIGLGAGHLVADLAKFGIATDAIEIDPAVAKS
FT                   AVDFFNFRPTGKVIVGDARYQVQRLENQKYDLIIHDCFTGGAEPFHLLSEEMIQLLKSR
FT                   LTPNGVLAVNFVGFTDPTRLKPVQSIAATLDAVFAHRKNYVPRLGEDFSDYVFIVSDAP
FT                   LNPGLHPSSKGTAQWLAQREVNIPAGNAPVITDDYNPLEFLQIAKAEYYRKLLIDRVGE
FT                   SVLFR"
FT   gene            complement(55547..57202)
FT                   /locus_tag="TERTU_0049"
FT   CDS_pept        complement(55547..57202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0049"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13789"
FT                   /db_xref="GOA:C5BKR2"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKR2"
FT                   /protein_id="ACR13789.1"
FT                   /translation="MRWKISQCRTKLSLRIFLLSLALIAGCVKSPRIYDVQRHTVDNAV
FT                   SLPQNWTPATRDHMNQLSFGSRLIPYEWFYALEQADSDTRFFSHQNIQELGFIPSNVSE
FT                   QNADGLPIGFVADEWRGEKWLGLTCTACHTGQLHFRGQTLLIEGAPGMFDFQAFEKGLF
FT                   RALQTLLTDNNKYQRFTRQLQPENPGELIAALNERVRFMNARLKANRTTVPYGYGRLDA
FT                   FGQIFNAVSAAALELPDNTHTANAPVSVPVLWDASHLDVVQWNASAVNKEPGPLGQNVT
FT                   TALAVYGTLELDKKTLLGYSNSVNIRNLGTIQRHYYDLMSPQWPQDILGTINTGLVQTG
FT                   AALYQSHCASCHVVIDSRNPKRQLRATVVPQNIIGTDPVMTQNFAAAKARTGKLEGRKI
FT                   VAGLKGNKLPTVAPTLDIVTHLVSSVMANRPLASINAIMTERQPQYEYEVDRKALNYKA
FT                   RPLNGLWASAPFLHNGSVPTIYDLLLPAAERPKVFLVGDVDFDPQRLGLSQSGGTYRST
FT                   YDTSLYGNSNQGHEIATHLSEKDRLALLEYLKTL"
FT   gene            complement(57299..58096)
FT                   /locus_tag="TERTU_0051"
FT   CDS_pept        complement(57299..58096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0051"
FT                   /product="high-affinity zinc uptake system membrane protein
FT                   ZnuB"
FT                   /note="identified by match to protein family HMM PF00950"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12381"
FT                   /db_xref="GOA:C5BKR3"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKR3"
FT                   /protein_id="ACR12381.1"
FT                   /translation="MIDLFTLQIIALPLIAGMGIAAIAGPLGSFVVWRRMSYFGDTLAH
FT                   SALVGVALGVFAGINLTLAMVLGGVVVSLSLWQLQKQRSLAADTLLGILSHSSLALGLI
FT                   GVSLLASAKVNLFSYLFGDLLTVNASDLLMIYLGGMICLALLVFFWRPLLMTAIDEDLA
FT                   RVEGIAVEKLRLLLMVLMAVVIALSMKLVGVLLITALLIIPAATARRLTQSPEAMALLA
FT                   ASIGVIAVVGGLFASVVLDVPAGPGIVLCAAALFVLSLLKHAR"
FT   gene            complement(58089..58832)
FT                   /locus_tag="TERTU_0052"
FT   CDS_pept        complement(58089..58832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0052"
FT                   /product="zinc import ATP-binding protein ZnuC"
FT                   /EC_number="3.6.3.-"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12264"
FT                   /db_xref="GOA:C5BKR4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017882"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKR4"
FT                   /protein_id="ACR12264.1"
FT                   /translation="MITLTDVCKSYDGRTILDRINFTLGEREICTLIGPNGAGKSTLVK
FT                   LIAGLELPDAGTIQRDPRLRIGYVPQKLRMEASMPLKVSRFLSLADPLKVNRASVLEQL
FT                   GILHIGNSQMHSLSGGELQRVLLARAILRKPQLLVLDEPLQGVDVAGQVTLYRLIASLR
FT                   TQLNCAVLMVSHDLHLVMAQTDSVICLNQHVCCHGKPESVSRHPEYLRLFGRSVADDLA
FT                   VYTHHHDHQHNLHGDVVSSCGHHHD"
FT   gene            complement(58829..59311)
FT                   /locus_tag="TERTU_0053"
FT   CDS_pept        complement(58829..59311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0053"
FT                   /product="transcriptional regulator, Fur family"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACR10720"
FT                   /db_xref="GOA:C5BKR5"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKR5"
FT                   /protein_id="ACR10720.1"
FT                   /translation="MSSTERSHDHTACIKSALHNADLVCRRAGARLTPLRRQVLELVWQ
FT                   SHKPLGAYALMEMLQANSDRKRVAPPTVYRALDFLIEQRLIHKVHSLNAYLGCSNPRSD
FT                   HSDALFICTQCGFTEEVPSHSIQQAINLSASQQRFTVQQKVLEIVGICGECRGSKG"
FT   gene            59407..60300
FT                   /locus_tag="TERTU_0054"
FT   CDS_pept        59407..60300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0054"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="identified by match to protein family HMM PF01297"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14408"
FT                   /db_xref="GOA:C5BKR6"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKR6"
FT                   /protein_id="ACR14408.1"
FT                   /translation="MLFAAALFGLANTAGAESNSPAEPFSIVTSLPPLALAVQDLVNEA
FT                   ALADKVSVESIVPRGQSAHHHALKVSQLRSLKSAGIVVWVGPEMEQYLAKAIGQRRPEN
FT                   VVGFAALMQKPVVDYHLWLSAGAMTKLVTAVAEKLALAFPEANVLVAASTYNARLRQQT
FT                   QAMQQRFAALPTEAGVLVFHESLHHLLTPLGIKQSASLVQVPEQQISVHTLMQAKSRML
FT                   PGQCLLADVEELPQAQPYAEKLGAPLVVVDLLASAATTKSYEAFLALLANKLATCFQSA
FT                   TGQDGSGQDGTSQDGE"
FT   gene            complement(60502..60798)
FT                   /locus_tag="TERTU_0055"
FT   CDS_pept        complement(60502..60798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0055"
FT                   /product="putative histidine kinase, hamp region"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11658"
FT                   /db_xref="GOA:C5BKR7"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKR7"
FT                   /protein_id="ACR11658.1"
FT                   /translation="MNKLASIALVALLSNVAVSGEVGALDPQNSSASSYDVALAEIGSS
FT                   KSWVATDDFRVVPVETVNSRQEAELNAHMISVNSKVNDSLNALIEQKVAQSLR"
FT   gene            61607..62728
FT                   /locus_tag="TERTU_0056"
FT   CDS_pept        61607..62728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0056"
FT                   /product="HAD-superfamily hydrolase subfamily IA, variant
FT                   3"
FT                   /note="identified by match to protein family HMM PF00691;
FT                   match to protein family HMM PF02412"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11045"
FT                   /db_xref="GOA:C5BKR8"
FT                   /db_xref="InterPro:IPR003367"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="InterPro:IPR028974"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKR8"
FT                   /protein_id="ACR11045.1"
FT                   /translation="MFKKSFIVAAVTVAVGLAQMSAHASDPTYEVGLGGSYFDYDDYLD
FT                   FEASPGVRGLAAYRFTPAISAGLVVEQTQTELELFNLDVDAHHYFLEGLYHFNTDGRVQ
FT                   PYLSLGWGQLVLETDLFDDYRSSITTVGAGIKFRLAENWEIRSALNHFFMTEGEDAFYN
FT                   VAAVTLSYLWGGSDAPRKSGAVRAKDTDNDGVPDPSDVCANTPSGAPVDTRGCALDTDA
FT                   DGVADYLDNCPATAARLKVDDRGCPVTLSETISINLKVNFDSGSAVVKPEFFSEIRKVA
FT                   DFMAQYENTRVEIQGHTDTSCAAAYNKSLSQRRASAVAAVLISEYGVAASRVDARGYGE
FT                   EQPIADESTAAGRLANRRVVAQVSAQIDKQQAR"
FT   gene            63048..67727
FT                   /locus_tag="TERTU_0058"
FT   CDS_pept        63048..67727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0058"
FT                   /product="AAA ATPase containing von Willebrand factor type
FT                   A"
FT                   /note="identified by match to protein family HMM PF02412"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11963"
FT                   /db_xref="GOA:C5BKR9"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR028974"
FT                   /db_xref="InterPro:IPR038081"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKR9"
FT                   /protein_id="ACR11963.1"
FT                   /translation="MLRSLLIAPLALCSLLLHAEPGRDYDLDDAGLAEINAFQGPNPIP
FT                   TPLDDAGINNDADVDGVPDEDDDFPQQFAAARDNDKDGAPDSWNLTCDQGCRDASGLIW
FT                   DAFPHTAAAFLDEDGDGLPDAWTPDCDVHCQEGSGLSLDPFLDDRDNDGLKDGDDPDDD
FT                   NNGSEDADADSDGLIDIATVEELDAVRHNLKGSGQITTLGAANDTSGCPLGVVDGIEQP
FT                   LCHGYELTANIELDTNGNGVFDEADGFWNDGTGWLPIGDTLAPFRADFQGNGFSINNLV
FT                   IDRDAYPQQGLFGAIQNATITGLALQGDHAKVHGKLQVGMLAGVASYSVVQEVYVAGEV
FT                   RAQSISKSYAGGLIGYAEQVHISAVMAAVSINAASGVCGGLIGKAVSSEIANTLATGAV
FT                   RGLNPRGSLVGVLSGDESHVSDNLALHTMMKLSLIGRVDEGLLSANHWLSILPEQSDAG
FT                   YGDTLEVLACPQIAGDANCADGLVYPHWGEARNGDDEPLWDFGSSEQLPGLALHGRVYR
FT                   DSDGDGVEDASDQFPLNGAAVADSDGDGAPDRWLLECRTDCAASSGLIIDGFPNNPAAY
FT                   EDTDLDGQPDSWAPKCDSTCQASSGLVLDPSPDDRDNDGVNDLLDSDDDGDGLADADAD
FT                   SDGLIDVVNWEELSAIRYSLAGLGQRLSAEAVLDQSGCPVVLVDGFAVRQCRGYELMGE
FT                   LDFDTNGNGEIDTADEGWNDGAGWLPVGDMDNPFTGEFSGNGHRILNLFVFRPFALSGG
FT                   LFAYLKNAQIRDLGLEGELTLIHAGQRAGMVAGVARNTAVTRSYGVGEVQSNGIGLEGI
FT                   AGGLVGQALDSVLLDVFSAAQVQAHGDYAGGLVGYSSGSAFLNTFATGAVVTGNYAGGL
FT                   VGSLYKSSIAYSYAVTQEVSLPLAGQLVAESSLLYNYWVAPGETNEGASWGLPLATLQC
FT                   PTSASDETCSNISLYQNWSSDWDFGNPHQLPGLTIGKSVFRDSDGDGILDHDDNDRDAD
FT                   GIDNTDDVFPDDPTETQDTDNDGVGDNSDAFPEDAGEGADSDGDGIGDNSDVFPDDPTE
FT                   SLDSDGDGTGDNSDAFPADPEETTDTDQDGVGDNSDRFPNDPTETSDADSDGVGDNADA
FT                   FPNDPTEIHDTDLDGVGDNADAFPTDPEEYADYDGDGIGDNQDTDDDNDGVNDEQDPAL
FT                   GPDNGKPVIVGAPDNIVRFSQGRMIEMVLDAVDVVATDLVDVAPTVSATLNGENIVADG
FT                   ETPFAVPCGENTVEWRATDTAGNISAAYTQIIAVYPSMGFTDTEILSGENNQITLTVAL
FT                   ECTSPMYPIDVKLTAEPQSTLSESDYEGPNLPTTLIFDEGELVRELKFTVLGDGQDEDD
FT                   EALVLRLENASVVLDGEAKSIAVVAEKVSATVTVTDANLPPQITLLITQGSEPTKTVES
FT                   AGGEVTVTANVNDPNGDDTHRFDWELLSLGMEIDSTKASFKFDPDELQDGAYSISVTVT
FT                   DSGEPALSNKADAEIEITSQVTPTDEPSPAPTNEPTPTFEPTPTDSPTPKLGQTPLAQE
FT                   KSGGGVFGWVWIAMLLGTCWYRRVWMLHRSTGSTESSRW"
FT   gene            complement(68036..68812)
FT                   /locus_tag="TERTU_0060"
FT   CDS_pept        complement(68036..68812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0060"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01841"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12940"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKS0"
FT                   /protein_id="ACR12940.1"
FT                   /translation="MKRLFILALLIFTTTTQAERIPYLAEISVQLGTEQNLPLSDEIRF
FT                   TVVSSNSEAILNSLRERSNIKVDQLTSSSVVITLKANSRSIGKLDNRYLSSSFVIDLEE
FT                   ESTQKFVSGYKGSNETYADIRKMAEYVRGYITNPTYIHSFNVASRTAKLRSGDCTEYAV
FT                   LATALARAEKLPSKVVLGTVILEGNDRVVSYGHAWSEVWQDGHWQILDPALYASNFNRH
FT                   FYLPAMELENEGPGYSLDLVKAMQLFPVKITHLESN"
FT   gene            complement(68809..70089)
FT                   /locus_tag="TERTU_0061"
FT   CDS_pept        complement(68809..70089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0061"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11338"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKS1"
FT                   /protein_id="ACR11338.1"
FT                   /translation="MKFNTTPIFLASLLLTSGALAPSVNSKPLPKDNAHNVVTLVDLKD
FT                   FPSWFHEAINREKSVKKKSSLKIKKFNINEKVLGKLKLQESSDTTWYYTIDIGTDSPVE
FT                   CYVFTEFDGPANSLHSMIENSLSAIAELNKKPLSSRYTSALGVGLVGDTPYLALDTLYS
FT                   VGEGKNKASGILKGLSAATNNSLQICTHNELGYKKAFLNVFTSFINAFIASEENQEFFE
FT                   SVFVMSINDLPLGYAREKYALDEDGDIVLHTDSAMLAPVDASSVARSDSGAREWSMKDG
FT                   SMINKVSYSIENNVLASSFSLEMRDSKWHVSGELQGKPVNAVLEHNNWLLSGYGSYLAA
FT                   IELQKSDKISESYPMWVPEADPTSALKVVLSKTPKDPTANLKIDMGPMVMKFLAEKSGI
FT                   FKHGTIAQGPITIGLQQLYVKGEPQLP"
FT   gene            70520..71338
FT                   /locus_tag="TERTU_0062"
FT   CDS_pept        70520..71338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0062"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13174"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKS2"
FT                   /protein_id="ACR13174.1"
FT                   /translation="MVVHILTDLYLDKIEAGRNLGPYLLEKQRELFAQVRARTSGEEIY
FT                   KITVNYDEVEDADLPIVVAAMDKFAARNSEAAMLRDVYKLAGGDLAMADEAVREQKERK
FT                   VIAFDGAGGERTGNNAAFNSLARKYGATLYDENAFSGHSNGKAALAEALNFFESNPDGE
FT                   LYLMGYSAGGDEAIWLANQVAKAGFSVSGLVTFDAHRDSFFGIKSYAVPSTVRALNFYQ
FT                   RNAVSFGPNTFRGGSVSGGLNVILPDSNHITIVSQAYAGNRALIDGWMGY"
FT   gene            71938..72375
FT                   /locus_tag="TERTU_0064"
FT   CDS_pept        71938..72375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0064"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GB:ABA58322.1"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14132"
FT                   /db_xref="GOA:C5BKS3"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKS3"
FT                   /protein_id="ACR14132.1"
FT                   /translation="MTTSRETQVCLDETPFYHCYVRCVRRAYLCGEDFSTGESYDHRKQ
FT                   WIVSRLKFLSYIYAIDICAYAVMSNHYHVLLHVDKSRAQIWSRTEVVERWMQFCKGDML
FT                   VEFVTEKFSETLDRLVTFVILGIEAAERLSGGNACKPNCFY"
FT   gene            72403..72975
FT                   /locus_tag="TERTU_0065"
FT   CDS_pept        72403..72975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0065"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF09346"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11224"
FT                   /db_xref="InterPro:IPR018958"
FT                   /db_xref="InterPro:IPR037883"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKS4"
FT                   /protein_id="ACR11224.1"
FT                   /translation="MDGYLSMKNVFDPLLHWGRYGEIINEMGTKLIGFAPHIAPKAYIN
FT                   VIYAPLKDAGIVELENRLERGLPVQYKKFLTCSNGLMIFSGSMRVFGLVPLSRTADIHI
FT                   YNYPSNVIVPNESARIKGIIDSDFVVGYYAEDGSYAVIDGNGGVFRILPQSNDIDREKW
FT                   ASFNDWLSSEILRLDKSYTENNAAHFN"
FT   gene            73152..73337
FT                   /locus_tag="TERTU_0066"
FT   CDS_pept        73152..73337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0066"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACR10640"
FT                   /db_xref="GOA:C5BKS5"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKS5"
FT                   /protein_id="ACR10640.1"
FT                   /translation="MINVSKGKIIFWVVFLCIVGLLIGDKGGGGYEKLYWACGGAILGV
FT                   AISFLFSKRIKKVETD"
FT   gene            complement(73377..73538)
FT                   /locus_tag="TERTU_0067"
FT   CDS_pept        complement(73377..73538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0067"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF08845"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12425"
FT                   /db_xref="GOA:C5BKS6"
FT                   /db_xref="InterPro:IPR014944"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKS6"
FT                   /protein_id="ACR12425.1"
FT                   /translation="MSYLFFYFKNRHQRTPIGEINLKGHWLIKAGVEIDSPVKVRVMDG
FT                   YLVLTSER"
FT   gene            73677..74360
FT                   /locus_tag="TERTU_0068"
FT   CDS_pept        73677..74360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0068"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07605"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13632"
FT                   /db_xref="GOA:C5BKS7"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKS7"
FT                   /protein_id="ACR13632.1"
FT                   /translation="MRRERLFDIGWFMRRVNETIARMANAEENCKGRFWEGRDKSQALL
FT                   DEAALLSCMAYVDLNPVRAGMEESLDTSDFTSIQQRLAEFAGKKRQLKKHPELAERTEK
FT                   QVRLKADLKLDKQPEAPLMVFDGSSHTDIHVALPFTDQDYLRLVDETGRVLRADKRGGI
FT                   SDTIKPTIERFGIDPKNRLEHVQNFSRSYGRCAGHVVRMRAYVERYGLRAAKGVGISKA
FT                   MYRAA"
FT   gene            74556..77282
FT                   /gene="polA"
FT                   /locus_tag="TERTU_0069"
FT   CDS_pept        74556..77282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /locus_tag="TERTU_0069"
FT                   /product="DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00476;
FT                   match to protein family HMM PF01367; match to protein
FT                   family HMM PF01612; match to protein family HMM PF02739;
FT                   match to protein family HMM TIGR00593"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13606"
FT                   /db_xref="GOA:C5BKS8"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKS8"
FT                   /protein_id="ACR13606.1"
FT                   /translation="MSTKPLILVDGSSYLYRAFHALPPLTTSKGQPTGAIKGVVNMLRR
FT                   LEKDYPESPIAVVFDAKGKTFRDDMYKDYKANRPPMPDDLRSQVEPLHELIRAMGLPLL
FT                   IVEGVEADDVIGTLAREGTEKGLPVVVSTGDKDMAQLVNEHITLVNTMTDTVMDIEGVK
FT                   AKFGIPPELIIDYLALMGDKVDNIPGVPGVGEKTALALLQNLGGLNDIYTRLDEIASLS
FT                   FRGSKSMAKKLEENRDNAYLSYELATIKTDVPLELPIEELKPAPADKAGLMNWYQELEF
FT                   KGWIAELENAPADDDGHAVPEAVALETEYDVVLDESAFEAWLEKLQAAALFAFDTETTS
FT                   LNYMDAEIVGVSFAVEPGKAAYVPVAHDYLGAPEQLSREHVLARLKPLLENDGLKKVGQ
FT                   NLKYDANVLANYDIALKGIAYDTMLESYVHNSTGSRHDMDTLAELHLGHKTIHFEDIAG
FT                   KGAKQLTFNQIKLEEAGPYAAEDADITLRLHQALWPKVAEAEGLKTVFNDVELPLVSIL
FT                   SRIERNGALLDTKLLGELSLQHGASIVKLEKEAYELAGEEFNLGSPKQLATILFEKMNL
FT                   PVVKKTAKGAPSTNEEVMQELALDYPLPSVILQHRSLSKLKSTYTDKLPTMVNKKTGRV
FT                   HTSYHQAVAATGRLSSSDPNLQNIPIKTDEGRRIRQAFIAPAGYKMVAADYSQIELRIM
FT                   AHLSNDPGLQKAFAEGLDVHKSTAAEVFGTALENVSSEQRRSAKAINFGLIYGMSAFGL
FT                   ARQLRIGRNDAQTYIDTYFERYPGVAEYMANIRKSAAEKGYVETLLGRRLYLPEINSSN
FT                   GMRRQAAERVAINAPMQGTAADIIKRAMIDVDAWLQTEQIDARIIMQVHDELVLEVAAA
FT                   DAEAISAKLCDIMSSAVVLSVPLLVEAGIGDNWDQAH"
FT   gene            77361..77696
FT                   /gene="phnA"
FT                   /locus_tag="TERTU_0070"
FT   CDS_pept        77361..77696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnA"
FT                   /locus_tag="TERTU_0070"
FT                   /product="alkylphosphonate utilization operon protein PhnA"
FT                   /note="identified by match to protein family HMM PF03831;
FT                   match to protein family HMM PF08274; match to protein
FT                   family HMM TIGR00686"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13030"
FT                   /db_xref="InterPro:IPR004624"
FT                   /db_xref="InterPro:IPR013987"
FT                   /db_xref="InterPro:IPR013988"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKS9"
FT                   /protein_id="ACR13030.1"
FT                   /translation="MSDLPNCPACNSEYTYEDGANLMCPECGHEWNPADAGDSDEKVIK
FT                   DSNGNPLADGDTVTVIKDLKVKGSSLVVKVGTKVKNIRLVDGDHDIDCKIDGIGAMKLK
FT                   SEFVKKV"
FT   gene            78101..78772
FT                   /locus_tag="TERTU_0071"
FT   CDS_pept        78101..78772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0071"
FT                   /product="glutathione S-transferase family protein"
FT                   /note="identified by match to protein family HMM PF02798"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14544"
FT                   /db_xref="GOA:C5BKT0"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKT0"
FT                   /protein_id="ACR14544.1"
FT                   /translation="MKLVIGNKNYSSWSLRPWLLLRHFSLPFDELPISLGETQLSEHLR
FT                   QFSPSARVPVLVDGHTTVWDSLAICEYINEQYLEGRGWPRPAAARAKARAVVAEMHAGF
FT                   AALRSEMPMNCRALRRVELSDAAKRDIARIDEIWSQTQHQELGSWLFGSFSIADCFFAP
FT                   VAFRIQTYGVHLSQPASEYCEHLLNHNGMRAWKAAALEEKEIVLDDEVGEDILPSIKAC
FT                   S"
FT   gene            79033..79308
FT                   /locus_tag="TERTU_0072"
FT   CDS_pept        79033..79308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0072"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11455"
FT                   /db_xref="GOA:C5BKT1"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKT1"
FT                   /protein_id="ACR11455.1"
FT                   /translation="MNQQQRDKLEKIIALGKWPFVLRVGVLSWGFSTAVLYCIISLFSH
FT                   GQLSFAAALATFAVCSALGALWGGYLWHRSSSRWTLLIREMIEQEH"
FT   gene            complement(79822..80316)
FT                   /locus_tag="TERTU_0073"
FT   CDS_pept        complement(79822..80316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0073"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11774"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKT2"
FT                   /protein_id="ACR11774.1"
FT                   /translation="MKLRHFAWVILALPLFAVGQTINIAKETPYYDEKIIQPNIVNECT
FT                   DLGGKLSAFAKSYSEKNGFTVALSDKFNSANPGYNLKLEITNAVSAGNAWMGHAKGVTI
FT                   SMELYKDGKQVASHTLNRNSSGGIGAGFKGSCDVLGRCTKALGKDVGKILTKWRKQGLL
FT                   K"
FT   gene            complement(80344..81483)
FT                   /locus_tag="TERTU_0074"
FT   CDS_pept        complement(80344..81483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0074"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13273"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKT3"
FT                   /protein_id="ACR13273.1"
FT                   /translation="MLTLWLAFFSQLALAAEPIQLRWEKAHTVAASDRLTSYALEIQDY
FT                   ANVQDADGLLARLGVDDFAARMRAQFDANLRQPDGKPFPPHEIQAVLAQLRPAVKNQFH
FT                   QLFSAGQQWEFIRLRKYRLRQFLLYRVDADNGKYDFLEFEIAPHRQRWQVIDWYTHSTD
FT                   KWASLAFTDTLTFSHRAQMAPSDEHGALLTYLRNKPDDLIGAFDKLAPRFRSESIIQSA
FT                   LLGFALRSAKAQMAEVYQRLVAEAPANRFLLFKLNYTIEQGDSERALSYLTGLEKQLGG
FT                   ETQLSLQKAELLYDLGKSRQADRLLAKIIDSHRDRPLVFYTTLLLLAYYEKYDHAVLVL
FT                   NALQQAFGSELTAQGLAQIDGLEGFLASDAFQRWAAQNL"
FT   gene            complement(81525..83414)
FT                   /locus_tag="TERTU_0075"
FT   CDS_pept        complement(81525..83414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0075"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13049"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR024618"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKT4"
FT                   /protein_id="ACR13049.1"
FT                   /translation="MKPAKTPKSRGKPQGQSTEYALIDTQVNAASQNFQRYKAFSYYLH
FT                   TSQAVSENSELEITFNPEYQQLAIHQLQLIREGKTVNVLRPEIFRLLQKEEDLRNGIYH
FT                   GAVTAVAIIPDTRPGDRLDYSYTISGRNPVYGNKIFGALNFGWGVDVGYSRLRVLVPRD
FT                   VKLQTRVHDLELNYKKRRKGDTVEHTWEADSVAGRTDEGDYPPWFVRYPFIEYSEYTSW
FT                   QEVVAWAEDLYGSVDANSAELDKLVKQLQKKAKTPREYALAALEFSQEQIRYLGLEFGE
FT                   NSHLPHSPAVVLENRYGDCKDKTNLLVQLLRKRGIDADPTLVSFDFGRGFTEFLPSPLA
FT                   FDHVIVHAQIDGQQVWLDPTRTHQAGRIQDRGFLEFGKGLIINNERADPVAEIAPLEGQ
FT                   IDQIDVTETFSTARFDQPVKLRIESRYTGDQANYQRYFFNSNSVAEISDKFLNFYAKIY
FT                   PNIRRNRAVTFDDNRAFNEFTIVEQYEIPEFFTAQDNLYSSTYYASAIEQYLVQPQTIR
FT                   RESPAAIGQPKRVSHRIVVEFANDVELYIDSTPVVKQQPAVEYRSRSQLIGKRFEHRAQ
FT                   LWVKKSWVDSANMADYLALTKEIQQDIDFSLTLGYPANKKPSAAINALVDALQ"
FT   gene            complement(83651..84328)
FT                   /locus_tag="TERTU_0076"
FT   CDS_pept        complement(83651..84328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0076"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14701"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKT5"
FT                   /protein_id="ACR14701.1"
FT                   /translation="MSELRILQIRESIKEAQRIEANNHQLRMFLEAKLPELHRSIALPK
FT                   SDGLHSLEEFVTRYIEHVPDFLEALTELTKSAGVYEYAETFLTIAEDYFFNPPELVERR
FT                   DGLLALIDEAYLAHRLIEEVNDRVMMASGLPLAPMDMTLSNIIVHDLLGDDFANQLDLA
FT                   VHYSIESLFESDNFFRKADFKNYLNHQNGEAWQSAMARWPCLAGDSAIKLELNHQAPGS
FT                   SMH"
FT   gene            complement(84501..85844)
FT                   /gene="dinF"
FT                   /locus_tag="TERTU_0077"
FT   CDS_pept        complement(84501..85844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dinF"
FT                   /locus_tag="TERTU_0077"
FT                   /product="DNA-damage-inducible protein F, MATE efflux
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF01554;
FT                   match to protein family HMM TIGR00797"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14592"
FT                   /db_xref="GOA:C5BKT6"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKT6"
FT                   /protein_id="ACR14592.1"
FT                   /translation="MRLNHFSFFSLPHRQAYALAWPMILSNISSPLMGMADTAMLGHLD
FT                   SSLYLGSVAIGTNVLAFLFWMFNFLRMSTTSFVGRAMGANDHATLLVQLGQSLLMACSL
FT                   GVILLLAQGVILPFALQLMAPNTKIAALAREYLQIRLFAAPAVFVTFVLMGFFIGLQNA
FT                   RVPLVITFVANGLNIGLDFVFIVLNDWASAGAAWASLCAEWSACLLAVAFAWRPLKALL
FT                   NKHPALSLTMLFRLQDWRNLARLNGDLLVRTSLLLLVFNFFTAQSGHLGPEILAANAIL
FT                   MQLVLLQSFGLDGYAHAVEAMGAKALGGRDLHRFFAACAASTFAAIALALAVTLFFAIG
FT                   KQPLIAMFTDLPGVADTVMQYYGWLLFIPLVSVWTYLLDGIFIGSGHTQLMRNAMLVCV
FT                   FCGFVPLWFFTRGYENHGLWLSFTTFNFLRGASLAIAFYTLTARHKWF"
FT   gene            86065..87204
FT                   /locus_tag="TERTU_0078"
FT   CDS_pept        86065..87204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0078"
FT                   /product="cytochrome c oxidase, subunit II"
FT                   /note="identified by similarity to SP:P08306; match to
FT                   protein family HMM PF00034; match to protein family HMM
FT                   PF00116; match to protein family HMM PF02790; match to
FT                   protein family HMM TIGR02866"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14080"
FT                   /db_xref="GOA:C5BKT7"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKT7"
FT                   /protein_id="ACR14080.1"
FT                   /translation="MLKLSSRWFAWTSSVVLAAACCGVAAGEWPLNMTKGVTDVSHNVY
FT                   GLHMTILFWCIGIGVVVFGVMFYSMAMHRKSMGAKAANFHESTTLEIIWTAIPLLILIF
FT                   MAVPATSTLKQLYDTEDADLDILVTGYQWKWKYEYLGEEVSFYSNLSDASREQIYGPKE
FT                   KSTDYLRDVDNPLIIPVGKKVRFLVTAADVIHSWWVPQLAVKRDAIPGYINESWTFVEE
FT                   PGVFRGQCAELCGKDHGFMPIVVKAVPQAEFDTWLGEQRQAALAVAEAAKQHLSFDELY
FT                   SQGESVYNARCAACHQPNGAGVPGVFPAIAGSKVATGALEKHLATVVHGVPGTAMQAFA
FT                   DQLTPVQIAAVITYQRNAFGNNMGDSLQPIDVVNFTQNQ"
FT   gene            87217..88800
FT                   /gene="ctaD"
FT                   /locus_tag="TERTU_0079"
FT   CDS_pept        87217..88800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctaD"
FT                   /locus_tag="TERTU_0079"
FT                   /product="cytochrome c oxidase, subunit I"
FT                   /EC_number="1.9.3.1"
FT                   /note="identified by match to protein family HMM PF00115;
FT                   match to protein family HMM TIGR02891"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACR10892"
FT                   /db_xref="GOA:C5BKT8"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033944"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKT8"
FT                   /protein_id="ACR10892.1"
FT                   /translation="MAHGPAPGFSRWLYTTNHKDIGSMYLWFSFAMFFIGGMFALVIRA
FT                   ELFQPGLQIVEPNFFNQMTTLHGLIMVFGAVMPAFVGLANWMIPMMIGAPDMALPRMNN
FT                   WSFWILPFAFAMLISTLFMEGGAPNFGWTFYAPLSTTYAPASVTFFIFAIHIMGASSIM
FT                   GAINIIATILNMRAPGMTMMKMPLFVWTWLITAYLLIAVMPVLAGVVTMMLMDIHFGTS
FT                   FFDAAGGGDPVLFQHVFWFFGHPEVYIMILPAFGIVSAIIPTFARKPLFGYSSMVYATA
FT                   SIAFLSFIVWAHHMFTVGMPLFGEMIFMYATMLIAVPTGVKVFNWVTTMFRGSMTFETP
FT                   MLFAIAFVILFTIGGFSGLMLAMAPADFQYHDTYFVVAHFHYVLVPGAIFSITAAVYYW
FT                   LPKWTGHMYDELMGKVHFWIAFIGLNVTFFPMHFSGLAGMPRRIPDYNPLWADWNMISS
FT                   VGAFLFGAAQVLFLYNVIKTIAVGRKATTAVWEGSHGLEWTVPSPAPYHTFTRPPDIAD
FT                   DDPHLVAGTP"
FT   gene            88835..89455
FT                   /locus_tag="TERTU_0080"
FT   CDS_pept        88835..89455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0080"
FT                   /product="cytochrome c oxidase assembly protein CtaG /
FT                   Cox11"
FT                   /note="identified by similarity to SP:P56940; match to
FT                   protein family HMM PF04442"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12294"
FT                   /db_xref="GOA:C5BKT9"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKT9"
FT                   /protein_id="ACR12294.1"
FT                   /translation="MSDLREQRGIARSIGKSVALVIAMFLFATLVMPPLYTLFCDLTGL
FT                   NGKTRGQATPVAAAVDTSRQVTVRFVSAKNDNMPWQFRPEDFSLKVHPGEQIVTHFFAQ
FT                   NPTANIMVGQAVPSMVPHNATDYFHKMACFCFNQQALGPGEAANLGLLFVVDQALPKAI
FT                   NTIILSYTLFDVTASSPQAVAEKNRQLQSVRTADTTHLIAHSP"
FT   gene            89482..90405
FT                   /locus_tag="TERTU_0081"
FT   CDS_pept        89482..90405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0081"
FT                   /product="putative cytochrome c oxidase, subunit 3"
FT                   /note="identified by match to protein family HMM PF00510"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13750"
FT                   /db_xref="GOA:C5BKU0"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKU0"
FT                   /protein_id="ACR13750.1"
FT                   /translation="MEQKIDVYYVPAQSRLPFAASVGLFLTVYGLGNWLNQLQSSSDGN
FT                   GQTLFVCGVLLLCTVLFIWFSTVINENLQGLNNAQLKRSYVWGMGWFIFSEVMFFSAFF
FT                   GALWYIRNIALPELSNGPTSALLWNNFEAQWPLMTTPDMVVNNDTARMVGPDENMSNPG
FT                   LTGWASWLPFWNTAVLLSSSVTVHIAHTGLKNNNKKQFNVFLAITVLLGIAFLTLQFEE
FT                   YMHAYQHMGLTLNAGVYGATFFILTGFHGLHVSMGTFMLLVQLLRSVSKGHFSHDNCFG
FT                   FEASSWYWHFVDVVWVALFIFVYVLG"
FT   gene            complement(90411..90671)
FT                   /locus_tag="TERTU_0082"
FT   CDS_pept        complement(90411..90671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0082"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACR10838"
FT                   /db_xref="GOA:C5BKU1"
FT                   /db_xref="InterPro:IPR021313"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKU1"
FT                   /protein_id="ACR10838.1"
FT                   /translation="MSPTVLKIIVVALLLAVIASLTSSLVFLLRDSGNTSAKRTLYTLG
FT                   IRVALATALLATIGYGIHSGKLGNTAPWAHSATPTVSSKTP"
FT   gene            90708..91439
FT                   /locus_tag="TERTU_0083"
FT   CDS_pept        90708..91439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0083"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13230"
FT                   /db_xref="GOA:C5BKU2"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKU2"
FT                   /protein_id="ACR13230.1"
FT                   /translation="MGQLRFVYSARLTTVCALVFPLLIVLGFWQLQRADEKASLEARWQ
FT                   LAQAQPAVDYREILDQTSPLRRVFAQGHFDTQRYWLLENKVYQGALGYQVIAPFKTSAG
FT                   DWLAVNAGWVPANAYRNINPEVVLPTAQIRVTGNLRKPSDSAFIGEQQASDTWPQRLLE
FT                   IDTEFMSRVYAVSGVTLLPFELQLDRDSPGAFSAVWQPINMPPARHRAYAVQWFAMAAA
FT                   LLVLWLISSVRRVPEQSPNSE"
FT   gene            91462..92115
FT                   /locus_tag="TERTU_0084"
FT   CDS_pept        91462..92115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0084"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13710"
FT                   /db_xref="GOA:C5BKU3"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKU3"
FT                   /protein_id="ACR13710.1"
FT                   /translation="MTSAIETDIPRSASPGKSWVPLWLTLVALFPIVAAYTVFFTGVGV
FT                   PAHTVNSGSLLPQPVNVTTLLAADAPEFLQAITGEKKWRLLLPVDSHCSDNLCTRNLYT
FT                   TRQVHIRLGEKSDRLERVAINLEGTAGLARLEQLREAHPRLKIVSVPVAQWQSWLRSGG
FT                   VDEHQVLDTAQLTSRYFLVDQEGYAMMEYAADIPGGALLKDLKRALKFSIDYQQ"
FT   gene            92112..93383
FT                   /locus_tag="TERTU_0085"
FT   CDS_pept        92112..93383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0085"
FT                   /product="putative cytochrome oxidase assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12910"
FT                   /db_xref="GOA:C5BKU4"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKU4"
FT                   /protein_id="ACR12910.1"
FT                   /translation="MSDIITLATPTQLHRRSKQTQSPTTKSTRAFVMLCAVAFSLALAV
FT                   VTLGAFTRLADAGLGCPDWPTCYGHLWVPNEHHEIAAANEKFSATPVEVHKTWPEQLHR
FT                   LLASSLGMVIFVLFIMACRRTQSPMRIAFSVALAILLASLFARIFLGAVMDIPVLLIFS
FT                   GYFVLLSQRWRKYKGQATELCVTALLAGMVIAQGFFGMWTVTLKLWPQVVTAHLLGGFA
FT                   TLSVIWLLLQYCGFQYCAGWGWQRAGVTLSSGCLKNLRLLAGIALGCVILQVGLGGWTT
FT                   SNYAALACPDFPRCQNQWWPAADFRHGFNMLQSVGPNYLGGQLEAEGRIAIHFAHRFGA
FT                   LGVTVAVLLLCGLLWRTGEPIVRRWSAMLIAALGLQISLGVSNVLLSLPLAVAVAHNAG
FT                   GAVLLLMLVALNHRLWANNYGVNH"
FT   gene            93367..94302
FT                   /gene="cyoE"
FT                   /locus_tag="TERTU_0086"
FT   CDS_pept        93367..94302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoE"
FT                   /locus_tag="TERTU_0086"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /EC_number="2.5.1.-"
FT                   /note="identified by match to protein family HMM PF01040;
FT                   match to protein family HMM TIGR01473"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13072"
FT                   /db_xref="GOA:C5BKU5"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BKU5"
FT                   /protein_id="ACR13072.1"
FT                   /translation="MALIIRSEIDKATQAITTALPWRDYYELTKPKVVMLMLLTSLIGM
FT                   LLATPSPAPLWLLVLGNLGIGLCAGAAAAVNHLVDRHVDVKMARTFHRPVANGRITPTN
FT                   ALLFSALLGGVGLWILSSFINALTAWLTLASLLGYAVIYTLFLKRATPQNIVIGGLAGA
FT                   APPLLGWTAVTGELDGHGLLLVLIIFAWTPPHFWALALYRKKEYAKAGIPMLPVTHGDS
FT                   YTRLHIVLYTVILIAVTLLPFATRMMGYCYLVGALVLGAGFLYRALKLLVSKDPKQGLE
FT                   TFKFSIIYLMALFVVMLVDHYLFPIPVYGV"
FT   gene            94305..94970
FT                   /locus_tag="TERTU_0087"
FT   CDS_pept        94305..94970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0087"
FT                   /product="ggdef"
FT                   /note="identified by match to protein family HMM PF02630"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11746"
FT                   /db_xref="GOA:C5BKU6"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKU6"
FT                   /protein_id="ACR11746.1"
FT                   /translation="MEILAAQKSPVQKRRIRQTVVYLLLLMALMVLGVFYRITQPRILS
FT                   SHELRANGAILFDHPRIIEDFRLQDEKGQAFTQAELTGHWTLLFLGFTHCPDICPTTLA
FT                   KLAEVHKNLQPEIAAQTRVVLLSVDPARDTPVKLAEYVHYFNPEFIGLTGDFRQIMTLT
FT                   QNLNGVFQKVVQGDDYTVDHTANLILINPEGHYQGFIQPPFELARLTTVIESIVSAYY"
FT   gene            complement(95116..95904)
FT                   /locus_tag="TERTU_0088"
FT   CDS_pept        complement(95116..95904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0088"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13484"
FT                   /db_xref="InterPro:IPR029095"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKU7"
FT                   /protein_id="ACR13484.1"
FT                   /translation="MRFFILVFLVCITGNAMALTMGEAINIAGKQRMLSQRIAQSYMLT
FT                   GIQPEKARYHDQLNKCISEFQSNLAALQNFPDARPLTQDLLKVRALWNEYHQLTKTDPN
FT                   PKNSAALVTKSNELLAAAHAYVGKLEKLSNSSSAELVNVSGRQRMLSQRIAKNYLAYYL
FT                   KLDEGKSLELLYSDLAEYELMLSYLKDSTLNTDEITRKILKTEGHLKYASKGFDGDMTL
FT                   DGDRLIFVITGTTDIMLRNMDEITKMYANLLDSNTAIASR"
FT   gene            96345..96599
FT                   /locus_tag="TERTU_0089"
FT   CDS_pept        96345..96599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0089"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11595"
FT                   /db_xref="GOA:C5BKU8"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKU8"
FT                   /protein_id="ACR11595.1"
FT                   /translation="MLRLILLFVGFGICWHYADFNSLSAYSSVLAPVGVLIFGLLLAYK
FT                   LFSGKGSSDRTGGGDSFFGLDFGGSGCDGGDSGGDCSGD"
FT   gene            complement(96843..97961)
FT                   /locus_tag="TERTU_0090"
FT   CDS_pept        complement(96843..97961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0090"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11136"
FT                   /db_xref="GOA:C5BKU9"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKU9"
FT                   /protein_id="ACR11136.1"
FT                   /translation="MKNRFLALLLLTLCLPVYANDNLILVTIDGLRWQEVFHGIDSSLA
FT                   TNKAFSARSEKLLTDFGGENSAEKLMPFFHHTLAREGAFYGNKDAGECMQLSNPWFFSY
FT                   PGYNEILTGSADPAIDSNSKKPNPNTTILEWLNQQSQFKGQVYAFGSWDVFPFIINEAR
FT                   SKVPVNAGFQPAAFSKLTPMEQTLNELQGEIPSPWETVRLDAFTHHYALETLKQRRPRV
FT                   LYIAYGETDDFAHDGEYDQYVLAAHRTDQFIAELWHTVQSSNHYRDNTTLIVTTDHGRG
FT                   STQEDWQHHASKAATQGYMKSLAHFKDGIIGANDVWFAAIGPRIDTQLKLSDTCLSTNQ
FT                   IAATAVEVLGLNWQKQNSHAGNALPILQESEL"
FT   gene            complement(98038..100422)
FT                   /locus_tag="TERTU_0091"
FT   CDS_pept        complement(98038..100422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0091"
FT                   /product="TonB-dependent receptor"
FT                   /note="identified by match to protein family HMM PF00593;
FT                   match to protein family HMM PF07715"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14527"
FT                   /db_xref="GOA:C5BKV0"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKV0"
FT                   /protein_id="ACR14527.1"
FT                   /translation="MLFKKKHLCAAILSVLSASVAAQTETNETKNEQMLEEMVVLSKKT
FT                   SFANNNTAETMIDQQSTMTSVLAVVDNLPGVLISEGDAFGGDDWSTTISIRGFQVSLDE
FT                   QQIGMTVDGIPNGGSNYGGGSKANRFIDTENLSTVEVSQGTADIASRSHEALGGTLNFI
FT                   SNDPQDDERMRFSISQGDHQGQKLFVRYDTGAFANGTKAYISLSSADGKSWIDESGEST
FT                   RDHLALKVINSGEKLTVTGYLSYDDTEEDNYQRVSLAEFEQNPEWDRLTGEWTGIPMID
FT                   QSYRRGWSTLRENTLGYVKLDWDLDSVQINGTAYYHHNSGRGDWVPQYIADVTDDGAGN
FT                   PESELTSGNTVYGGASLGSYTYVSRDGMQLTPGTDCASLSFPYGGTSNDDPSTADVDES
FT                   SGLAQDPACFPADAVPVGSYRHTHYGMDRYGLTADGSWTQSLAGGENTLRGGIWYEDRN
FT                   REEFRNWHKVLDSRVGYHYDATPYWVQYDREYPTDTFMYYIEDSFTAGIATVRLGGKQW
FT                   FVETTRNDKFGGPDATVNSDSDLLPHAGVQLQLTDNLEAFSGYAENYAAIKDAVLETNQ
FT                   DSDSIRAETAENFDIGLRYTSSRFDATITLYSTDFKDRLTYIPAGGVDGVDYLGELDGV
FT                   YTNVGGIESSGAEVSATVYVNDNFKVYSSYTYNDATYKDGFVFGSAVIPEGNTVFGSAE
FT                   EMFVLSLDWQKGNYGAGFSNKYVGARWMDPQNTQRIDAYNVADVYAAVTADLGGDVFKG
FT                   MEIRMVVNNLFDEQYIGGVAGGWGGWIGADRTASVNLTLDF"
FT   gene            100720..101202
FT                   /locus_tag="TERTU_0093"
FT   CDS_pept        100720..101202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0093"
FT                   /product="YHS domain-containing protein"
FT                   /note="identified by match to protein family HMM PF04945"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACR10825"
FT                   /db_xref="InterPro:IPR007029"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKV1"
FT                   /protein_id="ACR10825.1"
FT                   /translation="MLISLLRRIWILVFVVSANAFAGDPPVYSHPTLGAIKGADVVAYY
FT                   ALAPGDDAVIGSDDFTYVWNGATWKFASAENRDKFIANPEKYAPQYGGYCAFAVAHGYT
FT                   TSIRPDSWKIVDDKLYLNYSRISYLRWKVDMEEKIKEADANWPAVLDVCEKRGNCK"
FT   gene            complement(101217..102080)
FT                   /locus_tag="TERTU_0094"
FT   CDS_pept        complement(101217..102080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0094"
FT                   /product="carbohydrate esterase family 1 domain protein"
FT                   /note="identified by match to protein family HMM PF00756"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12326"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKV2"
FT                   /protein_id="ACR12326.1"
FT                   /translation="MRIFLLILTCLLFGCAQPSFNNDTSHNKTLFSPAMDRDMGYTVYT
FT                   PPGWSPREQLPLLVMLHGANDDETTFFRYGVDQYLDGEIAAGKLPRVIVLNPQGDRGFW
FT                   ENWHDGSRNYRDWVLNDLMPVVQTQYNTLPCPANCFVSGVSMGAHGAMRFSYYAPNTFA
FT                   SIAAISGRIVSREQATDGSLKMAIMRFMLPVNRIWGDLGKLPRDGDPYVAWTENRVLSS
FT                   KPLMLAWGKHEDADIVDSNLAFAAHLSANQRPFTQVVFNGEHRWVDWAPVIAESIRFHL
FT                   GSGDPE"
FT   gene            complement(102294..102764)
FT                   /locus_tag="TERTU_0095"
FT   CDS_pept        complement(102294..102764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0095"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13821"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKV3"
FT                   /protein_id="ACR13821.1"
FT                   /translation="MDTPTTPPKRPRRPERITVPIKQEDDGSPYLGVKDDIVLIKEGDE
FT                   LIFESAIDFDIHFIGRSPIDLSRRGKKYFSSEDGKIVIQTNPGARRARRECFDRDVDYD
FT                   ICRRELSDKARERKIITDKRPRRTSTGVELYFDVIIDGIVLDPKLNIDDPDI"
FT   gene            complement(103083..105284)
FT                   /locus_tag="TERTU_0096"
FT   CDS_pept        complement(103083..105284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0096"
FT                   /product="tetratricopeptide repeat domain protein"
FT                   /note="identified by match to protein family HMM PF00211;
FT                   match to protein family HMM PF00515; match to protein
FT                   family HMM PF07719"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11208"
FT                   /db_xref="GOA:C5BKV4"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKV4"
FT                   /protein_id="ACR11208.1"
FT                   /translation="MEHRHLTLMFTDIVGYSSLMGRDQVQTIAMLEDYRRILIEQIGKQ
FT                   QGSVIEFIGDAVFARFDTPQAGVTAAIEIQKALFSFNHFRDKSLPQLRTRIGLHCGEVA
FT                   TKNDAFFGDDVNIAARLEPIAIADGICVSDRVYQSIKGELREPCMALGVLPLKNIQSKV
FT                   RGYLIRPLGITLSIRAHYLNRRFNEKLGAYRYAIAASVICLILLGIYFIPRWLVPGYDA
FT                   NYVEIAEFKMLSTDGGTNEYLSSGISDAVRAQLADMKDVYVLKTGEGVEAPILLEGSVQ
FT                   RNGDNLRIAYQIKRKDGDVQIAGGKLDGKYNEIFILQDRLVGEIAKYLADEFDIPNFRP
FT                   ARLDTTSDILAYEYYMRGMEFYNRPKSESNSDEAIKFFSTALVHDPAYVDAEVALCRVY
FT                   TTKYLSNRNVNWVESAEQHCNAALQLAPENDNALTAMASIYTRTGHHDQAIALLSGITE
FT                   REPENGRAARALALALAKNKQVDDAIKLLQSSIEAAPKDWRNYSHLGRLYLSTGEMQLA
FT                   IEAYLAVLEITPKNSSVLSNLGTAYYFTGNLKKAREYFQKHTELVKTAQAYTNLGTLNY
FT                   FLGEYEIASKQFKIAVDLAPSDPVNHLNYADSLRNTPRMKRFAKEHYTTAIRLAKQMHK
FT                   LDPTDANNMRTLALCYLGVTDIEAAKKYLSMAAEYESGTGDYLYLKLRYEIATNQLESS
FT                   SETLEALLQTGYSPALLSHDPDLLPIRKMKGYKQLIAKY"
FT   gene            complement(105814..106329)
FT                   /locus_tag="TERTU_0097"
FT   CDS_pept        complement(105814..106329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0097"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14737"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKV5"
FT                   /protein_id="ACR14737.1"
FT                   /translation="MKIKFALGFAAILVLLTGCTCPRVCMVPPNTDEPALVRITTDDTG
FT                   MPRATPREVVVYPNQEVIFMSTEEFSLHFIGLSPVTLTRRGVKDFESSNGEVIIPAADP
FT                   EISDDEIADARSDESIKEILANKDLYGITEDTVQAKLPVRQQNSVTINYTVEINGKILD
FT                   PRFKRVDD"
FT   gene            complement(106353..108554)
FT                   /locus_tag="TERTU_0098"
FT   CDS_pept        complement(106353..108554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0098"
FT                   /product="tetratricopeptide repeat domain protein"
FT                   /note="identified by match to protein family HMM PF00211;
FT                   match to protein family HMM PF00515; match to protein
FT                   family HMM PF07719"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14293"
FT                   /db_xref="GOA:C5BKV6"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKV6"
FT                   /protein_id="ACR14293.1"
FT                   /translation="MEHRHLTLMFTDIVGYSRLMGRDQVQTIAMLEDYRRILIEQIDKQ
FT                   QGTVVEFIGDAVFARFDTPIAGVTAAIEIQKALFSFNHFRDKNLPQLQTRIGLHCGEVA
FT                   TKNEAFFGDDVNIAARLEPIAIADGICISDRVYQAVKSELHEPVLALGVLPLKNIQRKV
FT                   RGYLIRPLGITLRIRGHYINRRVKEKLGAYRYPIAASIFMLIAAGIYFVPRWLVPGYDA
FT                   NYVEIADFQMLSNDQNNNSYLSSGISDAVRAQLADMKDLYVLKAGEGVQAPIVLTGSVQ
FT                   RFGDNLRVSYQIKRRDGDVQITGGKLDGKYNEIFILQDRLVGEIAKYLADEFAIPNFRP
FT                   ARLDTTSDILAYEYYMRGMDYLSRPYTQSNNDEAIKYFTTALVHDNQYVDAEAALCEAY
FT                   KTKYGNLGDVSWFNSAKQHCELALKLDPTHTGAIRTMAEIHRQSGEYDQAIQLIDQVLA
FT                   REPDNTPAARLLALTYHDKNESAKGVRILEDCIQRHPKDFVNYKDLARIYLDNGNLEKA
FT                   ITNYKKVLEITPQNNAALNNLGISYYFLGELKQARKYFELATRLIQGLDAYSNLGSLNY
FT                   FLGDYDKAAEQFKIALAMSPTNALLQLNYADSLRNTNGKSGLAEESYNKAIALAEEIHF
FT                   VNPEDNDANITLALSYLALHNPEQAEPYLRKAELNAPDYPEVIYVRLRYDIATGNFSEA
FT                   FATLSELLDAGYSKAILERDPDLAALHNQPDFKTLLAHY"
FT   gene            complement(109033..109572)
FT                   /locus_tag="TERTU_0100"
FT   CDS_pept        complement(109033..109572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0100"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /EC_number="2.3.1.128"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13130"
FT                   /db_xref="GOA:C5BKV7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKV7"
FT                   /protein_id="ACR13130.1"
FT                   /translation="MIIRPLAVTDAPLVHDFFVRNWHHLKPWVPQLAVSYKDAAQCASG
FT                   VTRLVEAAQSGSSIRFLLLTDDQTQLVASCTLSQIVHGPFQACYMGYDIDAAYEGKGLM
FT                   RALCQHAIAHAFGPLKLHRIMANYMPHNNRSARLLKRLGFKIEGVAQNYLEINGRWENH
FT                   VLTALTHHQSPTSRFQ"
FT   gene            complement(109617..113258)
FT                   /locus_tag="TERTU_0101"
FT   CDS_pept        complement(109617..113258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0101"
FT                   /product="sensory box histidine kinase/response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00474; match to protein
FT                   family HMM PF00512; match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11234"
FT                   /db_xref="GOA:C5BKV8"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKV8"
FT                   /protein_id="ACR11234.1"
FT                   /translation="MHQGRLRQISQACIDGTHPARLPAKASVDKPLQRELLQQAPLHHH
FT                   TNKKRLVLSPVLLIVTLIAYLAMLFWIARIADRRRYNIDSRARHPLVYTLALGVYCTSW
FT                   TFYGLVGTAATHGWDYLPILLGPVLLFTVGFPIVQRIARICQQENLHSIADFIASRYGK
FT                   RQAVAVVVTVIILFVTIPYIALQLKAVSDAMAVTMSGQSFSGHDLTLIAAISMIVFALL
FT                   FGANRLDVASYHSGIMAAIAFESLVKLIALVALAVFALLFTQAPATEAAAEAATMANEV
FT                   FSETPLKPSFWVLTLVAACSVFCLPRMFQVTFVECLSENHLKFARKGFTLYMSLTALSI
FT                   FVIAWVGNTLLAGTSYDSDHYVLALPLFAGNKALGVLAFIGGFSAATAMIIVASLTLSQ
FT                   MLSNDVILPLLIRARKHRVNVPDYTRSLKLTRRSTVIAIIALAWLYHHALAENAALTEI
FT                   GLIAFTLVVQLAPAILFGLYWQRANAVGVFAGLAAGTTVWFITLMVPLLAHAGWLNPAV
FT                   LEQGLFGWSWLRPTALFGMDFSDDYTRGAVLSLLANAVALVWVSRLDITRLPDHIQAIA
FT                   FVNRERTRQDSSVQGLRINRTDLASLLSQFLGKTATQRLLDNDQAHDGVLASASLLKEA
FT                   EQALAGIIGVASTRAMLVNLSSGESLGVADVVNIFEETTRTLQFNQDMLFASFESISSA
FT                   ISVVNADLKMVAWNRRYEQMFNYPEGMLRVGKNVAELVRFNAERGMLGAGSVEQHVKTR
FT                   LDHLLAGKAYRVVRNHHQGVIEIKGRPLPAGGYVTTYDDITEFIEAQNELEKANLNLEQ
FT                   RVHERTQEIENINRSLREEIRKREETEQELLDAKSLAESANANKTQFLASASHDILQPL
FT                   NAANLYASALLERPAIDSELKDNLRHLHNAIGSAESIISNLLEISRLDTGALKPQIRSF
FT                   ALNEILEPLANEFRVQTRAEVELRWLPTRLWTESDPKFLRRILQNFVANAVKYTEQGRI
FT                   LLACKRRGEQIEIRVCDTGPGISEAHQQRIFDDFYRIHTEVEGAGLGLGIALRFSQLLH
FT                   HRLALKSQVHRGSGFSVWVPLRDPRSPQNLKTAPVEINSGLEDLHVFYVDDDENNIHAL
FT                   KTLMQNWGCRITSAATVASARALARASTEQPDALLLDYQLDAQMNGIELAEHLREVWGS
FT                   LPVCIVSAAPDDNLAAALAHNNFDFLRKPIKPSKLRALMERYSGGHR"
FT   gene            113543..115393
FT                   /gene="pepF"
FT                   /locus_tag="TERTU_0102"
FT   CDS_pept        113543..115393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepF"
FT                   /locus_tag="TERTU_0102"
FT                   /product="oligoendopeptidase F, possibly secreted"
FT                   /EC_number="3.4.24.-"
FT                   /note="identified by match to protein family HMM PF01432;
FT                   match to protein family HMM PF08439; match to protein
FT                   family HMM TIGR00181"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACR10902"
FT                   /db_xref="GOA:C5BKV9"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR004438"
FT                   /db_xref="InterPro:IPR013647"
FT                   /db_xref="InterPro:IPR042088"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKV9"
FT                   /protein_id="ACR10902.1"
FT                   /translation="MLKKLSCFLFSVSVGFAVQTYADDATTWDLSEIYATKADWAQARD
FT                   SMKDDLAQIEKVKGTLGKSPKHLQKGLDTISDAYRKMQRVYSYSSMLSDEDLRNTEHLE
FT                   MDQLSTISFGELGKALSWFEPEVLAIGSKKIEKFIGKNPELEKYRHTLDEILLAEPHTL
FT                   DAEGEKLLAQFAATLSAPQTTYGVLANSDIPWPEIAMADGKKYRIDSQGYTRWRSSQDR
FT                   ALRKKVFDAYWGRWEEYRASVGSVLYAHIQNQVAMARARNYNSVLEKELSQDNLPEAVY
FT                   RTLVEEVNASLPTLHRYFKLRKQIMGVDQLRYYDMYPSLVKLDKKFDYETSKQITLDAM
FT                   SVLGDDWVSRQRDGMNKRWAHVYPQKGKRSGAYMNSGAYDVHPFLLLNHNDDYNGLSTL
FT                   AHEWGHAMHTLYSAESQPFPTYNYATFIAEIPSTSLELILQDYMVSHAKSNQEKIFYLG
FT                   EGLENLRTTFFRQAMFAEFELELYERVEKGEALTGEKMSQIYGELLKRYHGDAEGVVKI
FT                   DDLYTNEWMFIPHFYNNMYVFQYATSITAGTALYDSIVKDGQAGVDNYINLLRAGSSDY
FT                   PYNLLTKAGVDLATPAPYRALIKKMNAIMDEMEALLAEAS"
FT   gene            115620..116828
FT                   /locus_tag="TERTU_0103"
FT   CDS_pept        115620..116828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0103"
FT                   /product="Starvation-sensing protein"
FT                   /note="identified by match to protein family HMM PF01188;
FT                   match to protein family HMM PF02746"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13430"
FT                   /db_xref="GOA:C5BKW0"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034589"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKW0"
FT                   /protein_id="ACR13430.1"
FT                   /translation="MKITEAKVIVCSPGRNFVTLKITTDEGVYGVGDATLNGREKAVVS
FT                   YLEDYLCPSLIGRDPQQIEDIWHFFYRGAYWRRGPVGMSAIAAIDTALWDIKAKVANMP
FT                   LYQLLGGRSRDRIMVYTHANGNDIESTLEQVAKYVEKGYKAVRVQCGIPGIASTYGVPK
FT                   GGKAYEPADADLPSESVWSTEKYLNHIPKLFAAVREQFGDDLHLLHDVHHRLTPIEAAR
FT                   LGKESEPFHLFWLEDCVPAENQEGWKLVRQHTTTPLAVGEVFNSIHDCRELIQSQSIDY
FT                   IRSTVVHAGGITHLRRIADLAALYHVKTGFHGATDLSPICMGAALHFDYWVPNFGIQEH
FT                   MPHTEQMLEVFPHHFEFSDGFFTPGEAPGHGVDIDEKLADKYPYKRACLPVNRLEDGTL
FT                   WHW"
FT   gene            117029..117292
FT                   /locus_tag="TERTU_0104"
FT   CDS_pept        117029..117292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0104"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13886"
FT                   /db_xref="GOA:C5BKW1"
FT                   /db_xref="InterPro:IPR019886"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKW1"
FT                   /protein_id="ACR13886.1"
FT                   /translation="MTDNNSDMRRAYWQANVKLMLVLLVIWFVISYVCGILLVDALNSI
FT                   RIGGYKLGFWFAQQGSMYGFVAIIFFYSHRMAALDRKFGVND"
FT   gene            117304..119034
FT                   /locus_tag="TERTU_0105"
FT   CDS_pept        117304..119034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0105"
FT                   /product="sodium/solute symporter family protein"
FT                   /note="identified by match to protein family HMM PF00474"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11462"
FT                   /db_xref="GOA:C5BKW2"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR019899"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKW2"
FT                   /protein_id="ACR11462.1"
FT                   /translation="MDLQTLTYIVVGITFALYIGIAFWARAGSTSEFYVAGGGIHPVAN
FT                   GMATAADWMSAASFISMAGLIAFFGYGGSVFLMGWTGGYVLLAMLLAPYLRKYGKFTVP
FT                   EFIGDRYYSRAARIVAVICLIVASVTYVIGQMKGIGVAFSRFLQVGYETGLLVGMGIVF
FT                   VYAVMGGMKGITYTQIAQYCVLILAYTIPAIFISIHLTGNPIPQLGLGSTLSGTDTFLL
FT                   DRLDQVVTELGFAEYTTSKRLSTLNTFVYTLSLMIGTAGLPHVIIRFFTVTKVSDARKS
FT                   AGWALVFITILYTTAPAVAAMARLNLHQTIEPAPGEYLSYEARPQWFKNWEVTGLLQFE
FT                   DKNGDGKILYTANAETNEMVKVDRDIMVLANPEIARLPNWVIALVAAGGLAAALSTAAG
FT                   LLLAISSAISHDLLKGVFMPDIDEKQELMASRVAMAGAIALAGYLGFNPPDFAAGTVAL
FT                   AFGLAASSIFPVLMMGIFTKSINKEGAISGMVAGITVTLLYVFQHTGIMFVASTSYLGD
FT                   MSPNWFFGIEPNAFGAVGALVNFVVAFAVSKVTAPPPDHIQHMVEDIRIPAGAGDATGH
FT                   "
FT   gene            119067..119654
FT                   /locus_tag="TERTU_0106"
FT   CDS_pept        119067..119654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0106"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12173"
FT                   /db_xref="GOA:C5BKW3"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKW3"
FT                   /protein_id="ACR12173.1"
FT                   /translation="MARAARAFFLQPLSGYNAKKFNDKTAMANPLKNKHLITAMLVAPV
FT                   LALIAYFATDHLVAERPHLAKAGDVYPLAAGSNCRYQSGSCTLKNADVKLQLNAQRLSS
FT                   EKVSLTLATDLPLQTALVAVDLKGSGDTAPVAMTHTGELWEVAVDVPQPESSRLRFVAV
FT                   IDNVNYFVETEAVFVDYETSFSRENFTHNNDN"
FT   gene            119678..121564
FT                   /locus_tag="TERTU_0107"
FT   CDS_pept        119678..121564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0107"
FT                   /product="CBS domain protein"
FT                   /note="identified by match to protein family HMM PF00571;
FT                   match to protein family HMM PF03445"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACR10869"
FT                   /db_xref="GOA:C5BKW4"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005105"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR018821"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKW4"
FT                   /protein_id="ACR10869.1"
FT                   /translation="MVAETNDVQNFIAVQALFQHLAESNLEYLSNNIYVAYQKSGGELE
FT                   VGTGEAKPVGLVMVRSGSLEIRDAQHNLIDRLSAGDFFIPRVLAQAPAEMIVRVLEDCL
FT                   YYELSESAFQSIRSNDEDISRLCDTYARSYQADASKSDNAPAPAMRKQHAFTDSYLDQS
FT                   VKDYMTAPAFCASPNITIRRAAQIMTNNKISSLLITEDERLVGIMTDRDLRTRVVAKGV
FT                   ADTEPVSGVMTPKPHCIDMRGRLHQAQLVMMSSGIHHLPVVDRDVPVGMLGMSDIMRAN
FT                   NLEPLSLTRGINNATTVAELAAVAAKLPDLVVKLIERDTRPYEVGEIITSLSDALTRRL
FT                   LRLAETVYGKPPCTWAWLAFGSQARQEQMLGSDQDNALIYGNNADDSADAYFAPFARFV
FT                   NDGLDACGIHRCPGDIMASNPKWRMTLAGWQKTFNYWIQERSPKALMHASIFFDMRPVA
FT                   GDRELVNHLRGYVLAKARSNTIFLALMTQNALEHSPPLGFFKQFVLEKDGDHNHTLDLK
FT                   KRGTITIVDIARNYSLAAAISEVNTISRLQAMERAGVMSRELVASLVDAHEFIAGIRLQ
FT                   AQGEKFHAGDTVDNQLDPKTLSPLVRHQLKEAFQLVRQAQAAMKARFGGGVL"
FT   gene            121554..122261
FT                   /locus_tag="TERTU_0108"
FT   CDS_pept        121554..122261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0108"
FT                   /product="putative exonuclease"
FT                   /note="identified by match to protein family HMM PF00929"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11219"
FT                   /db_xref="GOA:C5BKW5"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKW5"
FT                   /protein_id="ACR11219.1"
FT                   /translation="MFYSLSYRWQKKRYGKAASKTPLAGIYQATAPVSRSLMRENRFLV
FT                   VDCEMSGLDANRSQLLSIGWVVIENARITHASGKHLLIHADRGAGDSTRIHGLHDATIA
FT                   GAKSAAAAITLLAKQVPGSVLVFHHAPLDLRFLQQTAYENFRCPLLFGYVDTMLIEQRR
FT                   LQLQGAESGLRLAQCRERYGLPPISGHHNAMTDARATAELLLAQTSYLGGAGRVSLCRM
FT                   GIQCSRNQYVRGV"
FT   gene            122459..123355
FT                   /locus_tag="TERTU_0109"
FT   CDS_pept        122459..123355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0109"
FT                   /product="ggdef"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13905"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKW6"
FT                   /protein_id="ACR13905.1"
FT                   /translation="MMYRQSRWCTLWQFALLLFLFASSGHAEEGHAPLRFSYPVSDNPV
FT                   FQHRDSYFVSLLKLALEKSGESYVLEPITLSAMSEKRSKLFLRSERYNVHWLLTSEELE
FT                   QELLPVRIPLYKGLIGWRLLVISDEYRDKFSNITEPGALKALVATQGLGWPDTHILHSN
FT                   GFSLRLAVDWSGLLEMVSKHNVDYLPLAVNEVWAEMPTLKAKNLIVEPNLALHYPSAYY
FT                   FFVSKAQPEQARVLESGLRKAVSDGSFDALFYDNFGDDIERAKLEHRRIFRIDNPLLPV
FT                   KTPLDDKQLWFNVSQTH"
FT   gene            123370..124044
FT                   /locus_tag="TERTU_0110"
FT   CDS_pept        123370..124044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0110"
FT                   /product="short chain dehydrogenase family protein"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14744"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKW7"
FT                   /protein_id="ACR14744.1"
FT                   /translation="MDYSTKQVVITGANRGIGLALVKQYVSRGASVIALCREASAELEA
FT                   TGTRIEQGVDLTSDDLSQQLSERLAGSTIDILVNNAGMLASESLGSIDYDNVRAQLEIN
FT                   ALGPLRVTEALLPLMASNSRIGLVTSRMGSIADNGSGGYYGYRMSKAALNAAGMSLARD
FT                   LKPRGIAVAILHPGFVQTRMVNFAGDVSADDAAAGLVARLEALTLSATGTFWHANGDEL
FT                   PW"
FT   gene            complement(124145..125323)
FT                   /gene="uxuA"
FT                   /locus_tag="TERTU_0111"
FT   CDS_pept        complement(124145..125323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uxuA"
FT                   /locus_tag="TERTU_0111"
FT                   /product="mannonate dehydratase"
FT                   /EC_number="4.2.1.8"
FT                   /note="identified by match to protein family HMM PF01261;
FT                   match to protein family HMM PF03786; match to protein
FT                   family HMM TIGR00695"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13260"
FT                   /db_xref="GOA:C5BKW8"
FT                   /db_xref="InterPro:IPR004628"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKW8"
FT                   /protein_id="ACR13260.1"
FT                   /translation="MNAPLMEHTMRWFGPADPVSLSDLRQAGCAGVVTALHHIPNGVVW
FT                   QQADIEARKREIEAAGMRWNVVESLPVHEDIKSQQSGFEQLIENYKESLRNLAACDVRV
FT                   VTYNFMPLLDWTRTDLGYAMPDGGKALRFDMIQVAAYDIHILQRPDAAADYSEIVQQLA
FT                   AEKVAAMSDDDKIALEKTIVAGLPGSEVSFSTEAFLEAIMAYHDIGPEQYKANLIYFLQ
FT                   AICPLADELGIKLVVHPDDPPFAIYGLPRVVSTAQDLRDIFSAVPNPSNGLCFCAGSFS
FT                   IRADNNLTEMVREFGERIHFIHLRNTQREEYGSFHESQHLNGSIDMYDVVNAIMDVSEA
FT                   RNESIAMRPDHGHQILDDLKKRANPGYSAIGRLKGLAELRGLELGIYRARQH"
FT   gene            125583..125858
FT                   /locus_tag="TERTU_0112"
FT   CDS_pept        125583..125858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0112"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12808"
FT                   /db_xref="GOA:C5BKW9"
FT                   /db_xref="InterPro:IPR025424"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKW9"
FT                   /protein_id="ACR12808.1"
FT                   /translation="MTDNAVDNPLTLKLGHKELVIRRRYEVISIVNDFIVAVLFLVGSI
FT                   LFLFPQRETAAIWLFICGSFQFLLRPTIRLIGHIHISNIPPSKWEN"
FT   gene            125884..127368
FT                   /locus_tag="TERTU_0113"
FT   CDS_pept        125884..127368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0113"
FT                   /product="thermostable carboxypeptidase 1"
FT                   /EC_number="3.4.17.19"
FT                   /note="identified by match to protein family HMM PF02074"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13951"
FT                   /db_xref="GOA:C5BKX0"
FT                   /db_xref="InterPro:IPR001333"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKX0"
FT                   /protein_id="ACR13951.1"
FT                   /translation="MSAYQNLHSAFRKIAYYQHCLTILEWDQEVMMPGGGAEERANAIA
FT                   EMSALEHSAMNQPEIQTWLDVCAEADLTADEAANVREMRRAWQNSNLMPEELVREQAVA
FT                   NALCQQQWTTLRPQNDWAGFSTSFTRVVELAREQARIRQQALNTPTPYDAMLGLYSCGD
FT                   SASLIDETFAQLKAILPEMINTVCERQNKTTRVNVRGEFPVAQQQQLSHNIAATLGFDF
FT                   NAGRLDISAHPFSTGNPGDQRITTRYRTDDFLDALFGTVHETGHASYEAGLPKAWRGQP
FT                   LGLARNMSIHESQSLFFEKHIGTTDAFCALLAKQVQTLFSADVSLSADELKQAVCWVEP
FT                   GLIRVSADELSYPLHIIVRHEIESALINGDMEVSDIPDAWNQKMQQYLGLNTQGNNKDG
FT                   CMQDVHWPSGAFGYFPSYTLGAVNAAQLRAAMETKIGDLNALIAANEIAQITQWLHDNI
FT                   WQWGSRLESQELMQRATGKPTNAAALITHFERQYGL"
FT   gene            complement(128862..130145)
FT                   /locus_tag="TERTU_0115"
FT   CDS_pept        complement(128862..130145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0115"
FT                   /product="trypsin"
FT                   /note="identified by match to protein family HMM PF00089"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12819"
FT                   /db_xref="GOA:C5BKX1"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001314"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="InterPro:IPR033116"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKX1"
FT                   /protein_id="ACR12819.1"
FT                   /translation="MKNITGIAFSFLMLIGICIPSHSNTLANESIAFDELERHKDEMNS
FT                   MLYRVKKHELQVAMRAIGELAESETEIRSAVRDLITPKIVGGGVAGTWENPFQVSLVVA
FT                   SISNNKNAHFCGGAFLSSTQIVTAAHCVRGVSPSQIQVVANTRRLDGTGSRVGVSQISI
FT                   HPKFNYRTLDYDIAVVRLSSTVFNFPVDLAIEEPVAGSWLLVTGWGSLSEGGSSPTDLY
FT                   ALDIPVVSTASCNDANSYSGDITSRMFCAGYESGGKDSCQGDSGGPITGGNSNSLLTGV
FT                   VSWGFGCARPHYPGVYTKIAHPEIRSFISSLAPAPVYPYNYTSYPYTVTGYGTQTNVYV
FT                   RNAQGYTERLWGTRTYADLQATANAYCRGLGYNRANYWRSEGCGEDEDSFIRFDPAINN
FT                   WHSRNSGSANNRGGYCRYRLMSEVSCAY"
FT   gene            130729..131187
FT                   /locus_tag="TERTU_0118"
FT   CDS_pept        130729..131187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0118"
FT                   /product="transcriptional repressor of sporulation,
FT                   septation and degradative enzyme"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12660"
FT                   /db_xref="GOA:C5BKX2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKX2"
FT                   /protein_id="ACR12660.1"
FT                   /translation="MVIVKAKENDAAIIAAIGQSVWVNTYSTDGVVEAIANYVASEFTA
FT                   QNVLAVIRSRNVYLLGKEKSFIGYAVVNPGNPSELETLYILPRFQRKGYGTQLMRYIIN
FT                   FYKNLSLSCWEHNTEALRFYSKNGLAECGECYFELEGEKHRNVIFCVE"
FT   gene            131376..131513
FT                   /locus_tag="TERTU_0119"
FT   CDS_pept        131376..131513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0119"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11012"
FT                   /db_xref="UniProtKB/TrEMBL:C5BKX3"
FT                   /protein_id="ACR11012.1"
FT                   /translation="MAFEERGFELIDNLVTLDELDQLKNEVARIEIKGGGIRNAEKNSL
FT                   "
FT   gene            131627..132034
FT                   /locus_tag="TERTU_0120"
FT   CDS_pept        131627..132034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0120"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACS93527"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:C6AQY5"
FT                   /protein_id="ACS93527.1"
FT                   /translation="MVSWHQDKTVAVTKKFNDPGWGPWSLKDGVQHVQPPIDVLQQMIT
FT                   IRIHLDASTASNGCLKVMPGSHKEGVMSQGFIDQYSKSHCETVCSAPEGSALVMRPHLL
FT                   HASSKASNPGQRRVLHMEFSSYGLPAGVNWA"
FT   gene            complement(132157..132618)
FT                   /locus_tag="TERTU_0121"
FT   CDS_pept        complement(132157..132618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0121"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11002"
FT                   /db_xref="GOA:C5BLA9"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLA9"
FT                   /protein_id="ACR11002.1"
FT                   /translation="MYQNRQTVALGGLIVLFLMFVLFIILAFWSWPKYKVYKQELNGRA
FT                   SLKEAEWSKQILIEEAKAREQAALMQAKAKVTLAEAEGAAMVARAKAEGQADIERAKAA
FT                   AESNRIIGESLKGNDEYLRYIWIKGLQDGKGERIYIPTEAGLPILEAKK"
FT   gene            complement(132775..133836)
FT                   /gene="ada_1"
FT                   /locus_tag="TERTU_0122"
FT   CDS_pept        complement(132775..133836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ada_1"
FT                   /locus_tag="TERTU_0122"
FT                   /product="methylated-DNA-(protein)-cysteine
FT                   S-methyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /note="identified by match to protein family HMM PF00165;
FT                   match to protein family HMM PF01035; match to protein
FT                   family HMM PF02805; match to protein family HMM PF02870;
FT                   match to protein family HMM TIGR00589"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11112"
FT                   /db_xref="GOA:C5BLB0"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR004026"
FT                   /db_xref="InterPro:IPR008332"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR016221"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR035451"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLB0"
FT                   /protein_id="ACR11112.1"
FT                   /translation="MNDKRFQSPEARWQAIQMRDSHADGHFVYGVRTSGIYCAPSATAR
FT                   QPKRENVEFFDTAAAAEAAGYVASRRERGARPEAASERAAAVARACRLIERGEASTPLG
FT                   ELAANVGMSPYHFHRTFKAETGLTPKAYSSAFRANKLREQLQQAKGSITDAIYDAGFNA
FT                   NSRFYESANQLLGMPAKEYRDGGAGAAIRFAIGQCSLGAILVAQSERGICAILLGDDPE
FT                   RLAQQLQDQFPSADLIGGDTQFEQRVAEIVGFVEAPSIGLNLPLDVRGTAFQERVWQAL
FT                   RQIPPGTTASYTDIANQIGAPKAVRAVAQACAANRIAVAIPCHRVVRRDGNLSGYRWGV
FT                   ERKKELLRRESEE"
FT   gene            134108..134707
FT                   /locus_tag="TERTU_0123"
FT   CDS_pept        134108..134707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0123"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13812"
FT                   /db_xref="GOA:C5BLB1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLB1"
FT                   /protein_id="ACR13812.1"
FT                   /translation="MNSSTKPDLSAKAAEIVDHARSLLVTGGYKSFSYADISARVNIRK
FT                   ASIHHHFPSKAALVETVVALYRDEARQGMARLEQQIVAPLARIRGYIDYWSNCIGDAKT
FT                   AFCICAMLAYEMPTLPSEVAAQVRLHFEELSGWLEQQLQLAHSEGQLTLVLPAAAEAKS
FT                   LMASVHGAMLAARALDDSAVFDGLMQVALARLTASA"
FT   gene            134893..135420
FT                   /locus_tag="TERTU_0124"
FT   CDS_pept        134893..135420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0124"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12017"
FT                   /db_xref="GOA:C5BLB2"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLB2"
FT                   /protein_id="ACR12017.1"
FT                   /translation="MSHPISTLGVLHTAISLVPIAAGLYAFARFGGINPTLRSGKVYLA
FT                   GLTLAVVTSLGVSSSGGLNPAHLAGVVVLVAAFGGALAPKLGFLGRLRPYMAAFGLSFS
FT                   FLLSLVPGTNETLTRLPVSHPLATGPDSPAVVQTLLVWLVLFVIGYITQCRAIYQCNKS
FT                   GASTGSWTAFGA"
FT   gene            complement(135426..138467)
FT                   /locus_tag="TERTU_0125"
FT   CDS_pept        complement(135426..138467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0125"
FT                   /product="RND transporter, HAE1/HME family, permease
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00873"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12666"
FT                   /db_xref="GOA:C5BLB3"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLB3"
FT                   /protein_id="ACR12666.1"
FT                   /translation="MARVNLSSWAIEHRSLVLYTMLMSLVAGVYAFVNLGRNEDPSFTF
FT                   KAMVVQTYWPGASQTDTMAQVTDRIEQKIQEIDNLDYVKSYTTAGESTVFVFLRQDTPK
FT                   QAVPEAWQQVRNKVQDIVYQLPDGIRGPFFNDDFGDTFGVILALTADGFSQRELRDYAE
FT                   QIKTRVQQVDDVAKVQIVGAQSERIYVEFNSRRLAQLGLDSSAIIQALASQNAVVQSGV
FT                   MRTADNRVLVGVSGELRTIDDFANINLALGGRVLSLRDLATISRATADPADPMFRFNGQ
FT                   PAIGIAIAMRDGGDILRMGTKLETTIAQLTKDLPVGIEPHLVANQPHIVDTAVGEFTQA
FT                   LFEAVVIVLAISFLSLGVRAGSVVAMSIPLVLAAVFVAMDILGIDLQRVSLGALIIALG
FT                   LLVDDAMITVESMVTRLEQGHALKPAATYAYTATAFPMLTGTLVTIIGFVPIGFAKSNA
FT                   GEYTFSLFAVVALALIISWFVAVLCAPLIGTWLLQQRTEQHSGSQRFMTYFQRLLVRAM
FT                   RHAKTTVAIITGIFVLSLFLLPFIQQQFFPSADREELIVDITLPQDATIDATAAAAQAL
FT                   DGLLAQDEAVAHWSTYVGRGAVRFYLPLDVKLQNPFFAEAVVVAKSLDVRDELQQRLAR
FT                   DLRERLPGALVRIYPLELGPPVGWPVQYRISGSDPVKLREIAQQVAVAMAQNPHADNIN
FT                   FDWMEPIRKLEVEVDQSQARRLGLSSASIAQAINRAVRGDVATQVRDNIYLIDVVVRAD
FT                   ASERDDIEHLQTLAIPLPNGVSVPLATVANVRYSQALPMVWRRDRMPTLSVRADLREGV
FT                   MPATVVAELQPAMSQIRAHLPAGYRIDDGGAVEESRQSQQSVAAVFPIAIILMLTVLMV
FT                   QLQRFSYLLLVVSVAPLGLIGVVAALLALSQPLGFVALLGIVALIGMIVRNSVILVHQI
FT                   HVEQEAGHSPWDAVIHATTLRFRPIMLTSVAAILGMVPIANTVFWGPMATAIMGGLAVA
FT                   TVLTLLFLPALYVICFRVNVPATP"
FT   gene            complement(138467..139531)
FT                   /locus_tag="TERTU_0126"
FT   CDS_pept        complement(138467..139531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0126"
FT                   /product="RND efflux membrane fusion protein"
FT                   /note="identified by match to protein family HMM PF00529;
FT                   match to protein family HMM TIGR01730"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12840"
FT                   /db_xref="GOA:C5BLB4"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLB4"
FT                   /protein_id="ACR12840.1"
FT                   /translation="MRTLWLLCVVLLATGCGKDTVPDTTVRPVRTITVRLSDNADTRIL
FT                   SGQIQAHRELELSFRVGGELKTRFADVGDVKIAGQPIAELDGAVQKDAQRSAQAALDSA
FT                   LAVRDQVEKNEARLRDLLRENAVSKSAYDNALRELRTAQEQVTSARAQLDSATSHLAYT
FT                   RLNAPIDGVITRKWAEPGEVVAAGQPIVSLAGSHDWDLLLDVPAELLRQGLATGQQLRV
FT                   WLAGAPDVATTATIHEVSPLADTVTLTHPVRARLDQRPRGLLLGSTVMAEIHLQPRPGF
FT                   VVPAAALTSKADHPAVWVLDRQTMKVQRRTVETARYNKNSVLISRGLADGELVVTAGVQ
FT                   LLHEGQQVRLLGAD"
FT   gene            139656..140270
FT                   /locus_tag="TERTU_0127"
FT   CDS_pept        139656..140270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0127"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12185"
FT                   /db_xref="GOA:C5BLB5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039536"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLB5"
FT                   /protein_id="ACR12185.1"
FT                   /translation="MTSSSDEQLKIRLLAAAKTEFLSNGYAGANVGRIASAAGISKKTV
FT                   YKYVASKQALLFEVMADVLSGPAQRMAQASPEQSLASRLELYLEGFSTLAFSEQGLASY
FT                   RLLMSEGARFPELAEAYVNSLDQYALQPVARELEQAARMGHIVQQDYRLATRMLFSMVA
FT                   AETLRDAAIGLGEVPGEAQRKALVGQALSIFLHGISGPARG"
FT   gene            complement(140283..140858)
FT                   /locus_tag="TERTU_0128"
FT   CDS_pept        complement(140283..140858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0128"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14021"
FT                   /db_xref="GOA:C5BLB6"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLB6"
FT                   /protein_id="ACR14021.1"
FT                   /translation="METLIVSSVTVALAEIGDKTQLLSLFLATRFRNKWAIIAGILVAT
FT                   LLNHSASAWLGTWLADYLQSRIGQGLIAISFIALGCWLLVPDKDDSEESSLQKYGAFVA
FT                   ATVLFFLAEIGDKTQVATVLLGAQFDSIVWVTLGTTLGMLAANVPVVFAGDYLMRRLPL
FT                   NGARWTAAAVFIGVGVYELCTHVLLPGS"
FT   misc_feature    complement(140923..141050)
FT                   /note="TERTU_4742; yybP-ykoY leader"
FT   gene            141487..142314
FT                   /locus_tag="TERTU_0129"
FT   CDS_pept        141487..142314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0129"
FT                   /product="carbohydrate binding module family 13 domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00652"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACS93528"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="InterPro:IPR035992"
FT                   /db_xref="UniProtKB/TrEMBL:C6AQY6"
FT                   /protein_id="ACS93528.1"
FT                   /translation="MIKKRWVYLLWLVFVAHSGYTQTLSDGRYTIYSRHSGLVLDVAGG
FT                   SNADGANIQQWGHAGSANQQFDVRYQGNGYYSIVSASSGKAVEVYNFSADPGGEIRQWE
FT                   YWGGDNQLWSLTNINGEFFTVTSKYSGLNLDVWNWSTASGGDIRQWNATAALNQQFRFE
FT                   RIDNSTEEQVSCDKPNHGGRHLIINYSSGKSLDITGASGSDGANAIQWRTTGGENQAFF
FT                   LERVGNSEYWTIKPAHSGRALEVAGAATNNGANIQQWAYSGNCSSAVAVTAIK"
FT   gene            142271..143539
FT                   /locus_tag="TERTU_0130"
FT   CDS_pept        142271..143539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0130"
FT                   /product="pectate lyase"
FT                   /note="identified by match to protein family HMM PF00544"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACS93529"
FT                   /db_xref="GOA:C6AQY7"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="InterPro:IPR002022"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR035992"
FT                   /db_xref="UniProtKB/TrEMBL:C6AQY7"
FT                   /protein_id="ACS93529.1"
FT                   /translation="MGTAHQQWRLLQSNNFNGAYAIVNVNSGKSLTVAGGSDGDNIYQN
FT                   SDAAVSSQRWYITSLENGCGSSSGSSSSSSSGTPNYAQGVDGFAAQYGADGLATTTGGG
FT                   NATPVTISSCAQLQQLAEDNTLKTLILPNRTLDCRSANRSQRVCVLSCGNGISTPLYRV
FT                   ATSSQSCADLGGSDNNVAYLNQNESTIRVGSNTTIVGAGRDAKVIGGSFDLGSASNVIL
FT                   KNFTITEVNAGIIEAGDAISLNNSSHVWIDHMRLSKISDGLLDSYDSHNITVSWSHFDG
FT                   VNTELCWGTDPYVSLLQNTEATFHHNFFDSGYGRNPKIGGSASRVHMYNNYWKDIYYFS
FT                   MSVSDGARAKVEGNYYQNANRPHWNDGGYIDANTGSNRYTGRSVSSSQDDSGESSWDVS
FT                   LYNYTRDSVDNLPSTLPAAVGPQ"
FT   gene            144074..145906
FT                   /locus_tag="TERTU_0131"
FT   CDS_pept        144074..145906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0131"
FT                   /product="PAS sensor diguanylate cyclase/phophodiesterase"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00563; match to protein
FT                   family HMM PF00990; match to protein family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14002"
FT                   /db_xref="GOA:C5BLB7"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLB7"
FT                   /protein_id="ACR14002.1"
FT                   /translation="MENFRVLLVDDNPVNLDVLRVTLKQIADCQVLIANSGQRALELMQ
FT                   RSPPDLVLLDVMMPDMNGFDVCRKIRSTEQLQAIPVIFVTACTEDVSTGFEVGGNDYIG
FT                   KPINSSEVIARVNHQRERARLHRELEQLNCELEEKVRDRTAALVVSNRQLREEIKERRY
FT                   MQDRLQYLATHDFVTRLYNRNAFDDRATKAVQAAQLGVEEGCLVQLDLDRFRLINESCG
FT                   YIAGDELLRQFADMLASVIEPDDFLARLGSDKFALICHDLNHGRRLVKFLQQQVKDFEF
FT                   SWDDRVFSLDASFALVRINRSIVSFDQLMLMVDEVVYQLKQQKVPFLTYDDITQSNPEG
FT                   RGKVKWAIRIMDGLKREKFRIFFQKVVPLTAPAGADKGRPLVRIETLVRLWDSQKSRVI
FT                   FPDEFIPSAERYNLIGEIDRWMVASVLQYFSAHVDLLDAVDKISINLSAVSIRDPQLVN
FT                   FITKILQETGVPPNKVSFEITETEAIINMGSAKQFIDELHRVGVSFALDDFGSGFCSFN
FT                   YLRELPFDALKIDGVFIKDIDKNTTHLELVKSIIDVGKQLDKVIVAEFVENQAIAEILI
FT                   SLGVGWGQGYFFHKPAPIEELQQGVALLLASGKR"
FT   gene            145903..149193
FT                   /locus_tag="TERTU_0132"
FT   CDS_pept        145903..149193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0132"
FT                   /product="PAS domain containing histidine kinase"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00512; match to protein
FT                   family HMM PF00989; match to protein family HMM PF02518;
FT                   match to protein family HMM PF08447; match to protein
FT                   family HMM PF08448; match to protein family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14153"
FT                   /db_xref="GOA:C5BLB8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLB8"
FT                   /protein_id="ACR14153.1"
FT                   /translation="MRLWRPAKNRLFWLSAALGIVAACVYEFYSYYSEYNALRAGIDKR
FT                   LHTAGSAIDFILGKHYHDVPFSAETISDAAYQQKAIELTRFAVEAGLAYVYTMVLTDDG
FT                   KVRFVSSSLTPEKLAAGEQEDYYWVEYSEADDAVYRAFGEGQAQYAEYVDRWGSYRSLF
FT                   LPRKNAAGVPYVIGVDISTTHLKLLKRRALGKAVSDLIVVFGILFLWQLSQRSHNRQLN
FT                   ASNRRFNLAMSAGASGIWEWDIEKNQLYVSPVFFTSLGYQQDAPPQSYKALANLIYPDD
FT                   LPVFSQHNAYALAGEPFSPRPDEYQMRMRRQDGDYVWLHIKGESLEWYKNGKPRLRAGV
FT                   LENIDGLKRLQIQLEASQEELSARETFLASLLNSIPDLVTLKDPNGRYLLCNDAFREIV
FT                   AVEHTEIIGKDDFDFLPMHLAESLRANDDKALASDQATTVREWLVYASDDKPHLVETVK
FT                   TRLFNAQIQGHCVLSLGRDITETHRILEELDKFHRFAEFSGQGLVITTLDARITYTNPM
FT                   FTRLTGSDTTPESGRSLRDFYPAETADFLDKDVFPITRQRGVWRGELALLNAQGANTTT
FT                   LHTIFTVMSEYDTPLFLGVIITDISEQKRIEQELEKAKEDAEFANRSKSMFLANMSHEI
FT                   RTPLNAIIGYAQLLTHDTELRGETHNQIEHIYSAGNHLLGLINDILDLSKMESGKSRLT
FT                   MTTFDLSVELNTLLGMMEHRAVTKGLRLNADLDLPSPALVTSDRQKLAQILINLLGNAI
FT                   KFTSEGEVSLQCRHQADRIRLVVSDTGEGISAEEQKYLFTPFVQGVQGERVGSGTGLGL
FT                   ILVKNFTALLGGELTLESTAGRGTRVIVSLPLHIHVNRDVSDAEATPETSTFAMGSLPV
FT                   ANQAKQRARLRSEQETRVLVVDDDLDSREVLARLLRLSGFEVDAVASALPVLGLVNEHH
FT                   YQAIFTDIRMPEMDGVELLRALRSSIWGNAPVFAVSASSMEHERSFFIAQGFDDFISKP
FT                   VQLDELVRSLQTHMNLEWTAAEDEHAPASAPYFATDGVQELAGSDRSVIENIHAAALEG
FT                   DVDKLFELLQQLSSEARANNAVRTLERAAAAYDLAQVERTVDTLLAQI"
FT   gene            149280..149453
FT                   /locus_tag="TERTU_0133"
FT   CDS_pept        149280..149453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0133"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACR10844"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLB9"
FT                   /protein_id="ACR10844.1"
FT                   /translation="MSPILFAALALQAAKLPFYKHFFRPIKSWPIGQLSGVLIAPTVYI
FT                   VPPELFVAYLIT"
FT   gene            149497..151992
FT                   /locus_tag="TERTU_0134"
FT   CDS_pept        149497..151992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0134"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF07624;
FT                   match to protein family HMM PF07626; match to protein
FT                   family HMM PF07627; match to protein family HMM PF07631;
FT                   match to protein family HMM PF07637"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13242"
FT                   /db_xref="InterPro:IPR011478"
FT                   /db_xref="InterPro:IPR013036"
FT                   /db_xref="InterPro:IPR013039"
FT                   /db_xref="InterPro:IPR013042"
FT                   /db_xref="InterPro:IPR013043"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLC0"
FT                   /protein_id="ACR13242.1"
FT                   /translation="MTCDFFRHMRIAMPLLISAVVAHASDDNPMDFLDSYCERCHNDER
FT                   FSGNLSLSDLDTNDIFHGRANSDWENILRMVKRGEMPPPGRRKMPAAAERAAFTSWLEN
FT                   GLDEYASANPNPGRATLRRLNRTEYSNAIRDLLAVDLDIREQLPADDTGYGFDNIADVL
FT                   SVSPTLMDRYLAVAGKVSRLAVGVAPQMAQTTSYLLPKDGSILNQGIPSYDWRMSDKLP
FT                   LDSRGGGEFTYYAPYDGEYIISGYLNANTNNEVDRLEDNRVTQRVFLTAGEHSVGISFR
FT                   KQLALDESVQTLRNSTDIVPLPDAPPHKLTLDFIVDSARVGSTQVESYYMSPRYAQHNF
FT                   LRDVIEIDVEGPYQVSGVSATVSREKIFSCRPNLLPFSESRCAKKIIGGLARQAYRRPV
FT                   SGSDIAPLLTLYQQVADAQGFDAGIATAIQAILVSPRFLFLHERDNSGAKPGEVHPLDD
FT                   YEYAARLALFLWSSLPDEALLKAAEKGNLREPEHLRQQITRMLQDEKSRALATNFAGQW
FT                   LYLRNLEHHRADVYLYPEFDAPLRQAMRQESEYYFAGITRENRSILEFLDSDYSYLNER
FT                   LAKHYGISGVSGPQFRRVTLPENAQRGGLLGQASVLTVTSYANHTSVVKRGKWVLDNIL
FT                   AAPPPPPPPDVPALKSREGGKALSAREQLALHREDPACASCHVKMDPLGLALENYDPIG
FT                   RFRTQDIGLDIDASAVMPDGTAFAGLTGLQQVLMARGEQFAEAFTQRLMTYALARGVES
FT                   IDQPAVRNIVRAARGGQFKMQDIIFGIAQSEPFNYRKTPDHEQTALKHAAPVSARNGNC
FT                   ARSAGDALTDVDCERQSQL"
FT   gene            151961..153214
FT                   /locus_tag="TERTU_0135"
FT   CDS_pept        151961..153214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0135"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07586"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13717"
FT                   /db_xref="InterPro:IPR011447"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLC1"
FT                   /protein_id="ACR13717.1"
FT                   /translation="MWTASAKASSNTPKRLSIFYMPNGMRMPEFTPTETGVGYTTTPLL
FT                   QALAPHKDKFTVVSGLAHYNASALGDGPGSHGRSCGAYLTGAHPKRTEGADIFCGESMD
FT                   QYVANHLGRNTQLASLELGIEPPSLLGSCDVGYSCTYTNTLSWRSPTSPLPVTVKPRDA
FT                   FEQMFGDTIGLDKASRQALLACKASILDFVVADAKNLSPQLGARDRRKLEEYLQSVRDI
FT                   ELRIEKAAAQDHDFSGSQLALPAGIPDDFEQHVRLMVDLQVLAFESDVTRVCSFMSGRE
FT                   LSNRAYPEIGVPDSHHSLSHHGGNREKIAKLIKINELHLKQFGYLLERLSTTADGEEGS
FT                   LLDSTLVLGGASLGEPNDHDNMNLPAMVAGAGIAGNRHIAMPAHTPMCNLMVNLMQDLG
FT                   VPAQQFGDSTGTIPGLRA"
FT   gene            153211..154551
FT                   /locus_tag="TERTU_0136"
FT   CDS_pept        153211..154551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0136"
FT                   /product="ankyrin repeat protein"
FT                   /note="identified by match to protein family HMM PF00023"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12269"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLC2"
FT                   /protein_id="ACR12269.1"
FT                   /translation="MKSYRQPRLSAPRYVLLLILACVPLHGQELRTAIVEGNLLRVQNL
FT                   LADGVDPNQPFADTSTPLAWATDKQSVPLVKALLEAGAKPVSSADSFSALVLACLRGNS
FT                   EIIHLLLDAGAEVNQTNAEGITPLALCAGNADLASVKRILEQGAELTRRDLQGQTALMW
FT                   AAAKGREDIFRFLVGRGADINAASNNGFSPLFFAIKSGSKNTAFAALELGADVTHRGPE
FT                   NTSAVQLAMYQQLYPLAQALIERGVDLNAFDRNGYQLLHAAVIAQQAGLVKLLLDKGAD
FT                   PNSVTGESRITWRYEVNFTSRPYVVHPKSPLLLAAERGSKEMMAAMIAAGAKPDFRSDD
FT                   GNNVLLAAAQSNPEAMAYALTLVKNVNRQNQAGQTALHRLMTLGTDKETTNEDMAAMFK
FT                   LLAAAGARTDIADNNGTTAYDIGSRDQYRAKDAFLATFNSTKESVQL"
FT   gene            154548..155033
FT                   /locus_tag="TERTU_0137"
FT   CDS_pept        154548..155033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0137"
FT                   /product="cytochrome c, class II"
FT                   /note="identified by similarity to SP:P00149; match to
FT                   protein family HMM PF01322"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13229"
FT                   /db_xref="GOA:C5BLC3"
FT                   /db_xref="InterPro:IPR002321"
FT                   /db_xref="InterPro:IPR010980"
FT                   /db_xref="InterPro:IPR012127"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLC3"
FT                   /protein_id="ACR13229.1"
FT                   /translation="MSQSVLFAFKPGFRKTLQLGMSVAVLFVCQHSVAADSDIIKTRQE
FT                   GFKAMGGAMKTLHKALKRDELGTAAVVDAATKLTELAPKIHDWFPAGTDMDSAPDTDAL
FT                   PYIWKKPEKFKEYADALVPATAKLMNVANQADAAVFKSALGGVKDQCSGCHKSFRAD"
FT   gene            155033..155758
FT                   /locus_tag="TERTU_0138"
FT   CDS_pept        155033..155758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0138"
FT                   /product="nickel-dependent hydrogenase, b-type cytochrome
FT                   subunit"
FT                   /note="identified by match to protein family HMM PF01292"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11318"
FT                   /db_xref="GOA:C5BLC4"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLC4"
FT                   /protein_id="ACR11318.1"
FT                   /translation="MQETKPTVRAAVKATIKAEAKVTAKVAVWDLPLRLCHWGLVASIA
FT                   VCWWSAENHNMAWHVTAGYTALGVVLFRIYWGFVGSTQARFVHFLQGPAAILTYLKKFH
FT                   HRESSASPGHNPLGALSAIALLLCALLQAGLGLFAIDVDGYEGGPYADYLEFDTARAFA
FT                   QWHEWNFNLLLALIALHLVAIVYYQVWKKQPLARAMITGKKALSVEHAVPESAELKSVL
FT                   VPALIGLFLSVGIVLLIRG"
FT   gene            155816..155998
FT                   /locus_tag="TERTU_0139"
FT   CDS_pept        155816..155998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0139"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11805"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLC5"
FT                   /protein_id="ACR11805.1"
FT                   /translation="MLKVDKWPMPDCDSRFALAGEFPGLKLTCARTIVVRRKRQCQRIM
FT                   IEKTMILVGKARNRH"
FT   gene            complement(156098..157261)
FT                   /locus_tag="TERTU_0140"
FT   CDS_pept        complement(156098..157261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0140"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14568"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLC6"
FT                   /protein_id="ACR14568.1"
FT                   /translation="MRLCCIFILLLLQACQTLDEPIPEKYTGETAQISDSITRRTASTG
FT                   EIYYLESISGQKVDNALIQTRQRSGSSPLTAVLVSLAVGAPAYGSSAAATYTPLERKVP
FT                   AGDQDLHVVGVLRKQITGGTSPLKVEADFTLHMEANKKYYIRGRIEEPIAAIWIENFAG
FT                   KIVTPVVQSQLLSGRPVQLKTEIVDPADYQKLIATTPQESFFTLKYGDSYDYVLAKLGN
FT                   PNNQAFKPSHGGPAKTRFFYDDFGEVRFLDYENGVVFVEQVLPTALTEKSQAANLKRIF
FT                   YIGNKLAIQNLAKAYPDAESVDVEILDILAEKVWQERFTDDDHISDTMAWFCKALAKFG
FT                   DGRYRDFIGKVANTATTKRLIRHATNTYKKMPPSSTEQFTVIENPAG"
FT   gene            complement(157606..158202)
FT                   /locus_tag="TERTU_0141"
FT   CDS_pept        complement(157606..158202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0141"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11372"
FT                   /db_xref="GOA:C5BLC7"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLC7"
FT                   /protein_id="ACR11372.1"
FT                   /translation="MKKIHVIQLVSALLLAAHLTSANAITIDILPTEQTVLLGDQVGVD
FT                   IWVSDLGDNFALGDFDFDLAFDSSIISFDSVSFGSGLGESWQDYSATDGLLNLNELSWE
FT                   TAGSLLTNQAMNFSLATILFNTEAIGSTQVSFSTVWALGDQWGNPFDFTTSDGTINVIG
FT                   GVNPVPLPGSLPLMLSGLIAAGFVRYKKQLLSRFK"
FT   gene            complement(158237..160123)
FT                   /locus_tag="TERTU_0142"
FT   CDS_pept        complement(158237..160123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0142"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14485"
FT                   /db_xref="InterPro:IPR035234"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLC8"
FT                   /protein_id="ACR14485.1"
FT                   /translation="MDRKRNRPLTGWIGRVATLCLCFVVGAMAARSYAAQDNFGKEFLL
FT                   PFLPNAYGAVTLQVHLTGNTTTDVSLSYPMNNPTFTTTVTVLPGTVTVVDIPLSADDWI
FT                   EGAVADNLVFAESDEEFVAYLVNLYPQSSDAALALPVDTMNTQYIVASYPSTFSTYGFN
FT                   SQMMVYAAYDGTVVTVTPKVAAGSHGAGTPYTVNLDRGEAYYITGNTNGAGGDLSGTEI
FT                   SSTRPVGVINGNQCTQIPNGTPACDHIFEVAQPVQSWGQSALVANLPNRSGGSIYRIYA
FT                   SEDGTDIGMDQGILAMGLNKGEFHETGILNGNYLIESNNPIFVTQLMTGQNSYGADFGD
FT                   PAMGNMIPSAQYLSSYTFSTVGANQFAEHYLTLFARDSNIGSVLLDGAPIPASQFSSIL
FT                   FTGYSVAILPLSQGVHSTWSPNPHGITVEGYNGYDSYIYPGGALFKSINPTGDAWQPVC
FT                   SIAEVNGVYEGLVTDNKPSEDVNGNGVLDPGEDTNGNSVIDVDSGVFLLESLTLVNMIF
FT                   APTPFVPGDPQTSFELTVLDPTLAASASIRATDGAGNTCLAEVDVTPPPMMCDVDGDRD
FT                   VDRDDVTLIRAARNTPATDDSDPRDVDGDQMITLNDARVCVTQCTRASCAVN"
FT   gene            complement(160414..160542)
FT                   /locus_tag="TERTU_0143"
FT   CDS_pept        complement(160414..160542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0143"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13958"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLC9"
FT                   /protein_id="ACR13958.1"
FT                   /translation="MPAFRAKPFPPYSLPVPYSDTPLSRHLIFLNIDAPEKSNMFI"
FT   gene            160761..162659
FT                   /locus_tag="TERTU_0144"
FT   CDS_pept        160761..162659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0144"
FT                   /product="BNR/Asp-box repeat domain protein"
FT                   /note="identified by match to protein family HMM PF02012"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11526"
FT                   /db_xref="GOA:C5BLD0"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR036278"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLD0"
FT                   /protein_id="ACR11526.1"
FT                   /translation="MNETETLNEQGISDYVRALGEKSKENRDVYKTQHYWAIGLLLLGV
FT                   GAVLFLPYLVAYLDNRFVPSTEIKTIKQKIYANKSDVSDLRKSVSPLSISRIDIVGYDV
FT                   GWIKKSKRGSLIVELNGKGVVELTFEELDQSGSVEIKEEQFIFEASEGNVHIRSDSYSA
FT                   GAVMEMLVFSDNTVVYNVFSRRVGEQYWYRQEVDVSLDKYFGSVDVAYSKDHVFLFRSG
FT                   GYIYRSSDLGKSWRLIGHGIKFRDFLVDDNCRIAILLFDGNIKYSSDCGENWIVVDSGI
FT                   DEQEYYVSGLIAPSGKAILICSDGYLAEFNMTTGSLSYGIGTGFDYNNYQGMFFSPKNI
FT                   GVLIHGNSYPIVSVDGGQSWKAVKLDEDARTSMSLRRVEFYDDGSAFAFDWQGEISLVS
FT                   NDSGRSWGFATGIPSIKRVASSVSADDYRVIFGKESDAIIKRPQSRGWEKIQIYLDDFL
FT                   PKDPVFSGDKKGYLVSDNKLYEFELYSDKFMNNLSDSDIVKFAQSSNTSQSHIPIRNLL
FT                   VAQKSLEESLSLRTRVEQVDNKKYIEKIVLRSLIVTIFAYFIGVLINNARYAMKLSVFY
FT                   DSVASSVRLAQSLSDDPVSVQDLVKIINVCMPSIEYGKQLKLSAQEMLRINQMRFG"
FT   gene            complement(162755..164260)
FT                   /locus_tag="TERTU_0145"
FT   CDS_pept        complement(162755..164260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0145"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="identified by match to protein family HMM PF00015"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACR10959"
FT                   /db_xref="GOA:C5BLD1"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLD1"
FT                   /protein_id="ACR10959.1"
FT                   /translation="MLEKNHLLADYHQKADRLMVMVSYLLAIFSLILAPKYDTWVPAIV
FT                   VGVGTAVMLTVLLKMAAGTWVMRCVVGVAFMVQTALHIHQGHGMIEYHFGVFVLIAVLL
FT                   YYRDWRPPLVAGVTIAVHHVSFYVLQSQGAGVYVLIPENSSFAIIELHALYVIAETALV
FT                   CWMARDTEKDAYATLGLAYAIKQITRDPAHMDVTFRTGQDDIESNRIFDNFLTTTDNFI
FT                   GAVQNLTSDLNAAGVDLGKVTTSMRSALDGQQQETNLASTAVEQMSVSIREVAENANHA
FT                   SSLTATISEDVDAGVSSSDAALSGIERLSRQIQETSEAVECLAGESSNIGSVSDVIKGI
FT                   AEQTNLLALNAAIEAARAGEQGRGFAVVADEVRTLASKTQESTGEIQTIINKLQSLSET
FT                   SVNNMASSRQLVEECVTSNRNSNKALQNIHGNLSKVRDMNYMIAQATLEQENVSNNVAG
FT                   NVSQISHVAATTAEDAKSLAEKSHNLITQAEKISAQIAKFKTS"
FT   gene            complement(164266..164838)
FT                   /locus_tag="TERTU_0146"
FT   CDS_pept        complement(164266..164838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0146"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12222"
FT                   /db_xref="GOA:C5BLD2"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLD2"
FT                   /protein_id="ACR12222.1"
FT                   /translation="MYVQHWKIIALLSLWALLTALTFWWYQFRQIQPFAQTNAFFAAAD
FT                   LPAPPEFSGLPGLKLVHFWREGCLCNPANLEHLRELLSEYRTSDLHLFVVASGKLPSHW
FT                   LNTSYTTLDKNTNAGLVSAIPSAPGLAIWDTNNRLAYFGPYSVGPTCSARNSVIGLVLD
FT                   SLLAGQNTELTTMAGNGCFCDWNTKQG"
FT   gene            165307..166866
FT                   /locus_tag="TERTU_0147"
FT   CDS_pept        165307..166866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0147"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="identified by match to protein family HMM PF00924"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11491"
FT                   /db_xref="GOA:C5BLD3"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLD3"
FT                   /protein_id="ACR11491.1"
FT                   /translation="MLFMIVNFLSSRYGTRAVPKRAYRSSPSAFIVMLLMLCLTAIPIG
FT                   VQAQVVNPADNNDNAEQVDDGGQSSGEESAADEDSGLDLGISELVDTAVSSEDWAGSVT
FT                   KLLDDYGLSASLAGKLIATVGLALVFFLVFFILEKVLRKLLHKLQTSVDTISISFRRTG
FT                   TYLSTLNKIVVLMMVCVYLMVLTGIWAENPTQTFIYAKSSVAFEFIATLGFLLALGALV
FT                   FEVVSGVMDRVFHRWSSANSTRVQTLLPIARNVVNIALFLMLGITLISELGIDIMPLLA
FT                   GAGVIGFAVGFGAQTLIKDLITGFIIIFEDLVQVGDVVTVGGKSGLVEKITIRKIQLRG
FT                   LDGTVFTVPFSEIAIVENMTKEFSYYLMNVGVAYRESTDDVIEHLQAIGEEMQNEDDYK
FT                   DLILAPIEILGVDSFADSAVIIKARIKTVPIKQWMVGREFNRRMKYRFDEAGIEIPFPH
FT                   QTIYFGEDKNGKAPPANILLSKAEPANDSADDAAQKRDRSKDGVNSDGYKDDDDVESAV
FT                   ED"
FT   gene            167049..168731
FT                   /locus_tag="TERTU_0148"
FT   CDS_pept        167049..168731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0148"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="identified by match to protein family HMM PF00015;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF08269"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13118"
FT                   /db_xref="GOA:C5BLD4"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLD4"
FT                   /protein_id="ACR13118.1"
FT                   /translation="MLELSVKTRVMAVAILPLVVLSAIILVVIVGEVNSAAEGQLASSE
FT                   EIFVEAKREEIKDLVELAWTTVRPLYQSGADREEAVQLLRRMSYGKDGYIFGYDGDAVR
FT                   IFSGSSDASIGKSYYDFKDVNGVYLIRELIDAGRKNGFAEGNHFVTYHFPRLGEDVASP
FT                   KLSYAIYLPRWNMMIGTGIYIDTIDAQLKNLASHLQSARNGLVTTLGIVALVLAIVLTI
FT                   VALFLAQSIVGPLSSIGDSLYEIATGKGDLTRRLEVHGKDEVGLVSSRLNTLLDSLHRM
FT                   VSDIKGIANEVSAETESLTRTVEETQQVSHQQHEEVDQVASAMTEMSHTSRETAQNANE
FT                   AAASAKAANKASISIANSVNESCDSMRMLGEDIARTSEVITQVGTDVENISAVLQVIES
FT                   IAEQTNLLALNAAIEAARAGEQGRGFAVVADEVRNLASKTQGSTEEIQQMIAKLQSGSR
FT                   SAVSVMAESRKRSDLTEASISQTASLLSEISDAVSVINNMNSQIATAAEEQSLVGSDIS
FT                   ERIVSISNQTNISSEIAAKNGTAAAKLRQKTRELNGIVDRFVL"
FT   gene            complement(168852..171023)
FT                   /locus_tag="TERTU_0149"
FT   CDS_pept        complement(168852..171023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0149"
FT                   /product="glycoside hydrolase family 26 domain protein"
FT                   /note="identified by match to protein family HMM PF00553;
FT                   match to protein family HMM PF02013; match to protein
FT                   family HMM PF02156"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12952"
FT                   /db_xref="GOA:C5BLD5"
FT                   /db_xref="InterPro:IPR000805"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR002883"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR009031"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022790"
FT                   /db_xref="InterPro:IPR036601"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLD5"
FT                   /protein_id="ACR12952.1"
FT                   /translation="MNNNWFNKLWRGAACSALAVFASASLANTVTSAGGTAAATINVNN
FT                   DWGAGYCATVAISNQGSAPVTGWQVELALNGATISNLWNGSLTGNLVSNLSYNGTINVN
FT                   GSSEFGYCANGSGGNYLPSLASLTVQGGGTTSSSSSNSSSSSSSSSSSSSSSSSSNSSS
FT                   SSSSSSSSSSSSSSSSSSSSSSGGACQVCNWYGEIRPLCANQDSGWGWENSQSCIGANT
FT                   CNSQWGGGGVVNNCGSTSSSSSSSSSSSSSSSSGASSSSSSSSSSSSSSSSSSSSSSSS
FT                   SSSSSSSSSSSSSSSSSSGGIPNAASNGWPYCRSADSDPDGDGWGWENSYSCIVFGSAA
FT                   DPGPGDFDYCLIGDSELTLCSADNGSWGAENGEICLSASMCPGMGSGVQGAMRDTPVNP
FT                   DASAKTQSLYSYLQSIWGNHMLSGQMDLTWQDAIDQYQRCINDTGRAPAMMGYDFLNYG
FT                   LYWNGISGITQTEEAIEHWNRGGIVSFTWHWRDPDAADGTIGEFYTEDTSFTIPIANGE
FT                   LDTSSPSYANIQADIAMIAAELQKLEDENVPVLWRPLHEASGGWFWWGRSDRTDGVPAA
FT                   YAQVVLWRHLYETLTNEYGLDNLIWVWNGQSGAWYPGDNYVDIVSVDIYDGQQNYESQI
FT                   GPYALTANYPQQVKMVALSENSNIPDPDLMAADGAWWLWFMVWNDSDTAEGVSSSGNFW
FT                   TGEYYNTNAHKTHVYNHEYVITLDELPAF"
FT   gene            171609..172712
FT                   /locus_tag="TERTU_0151"
FT   CDS_pept        171609..172712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0151"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13433"
FT                   /db_xref="GOA:C5BLD6"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLD6"
FT                   /protein_id="ACR13433.1"
FT                   /translation="MKSVPPVQNPASPRDIKLALPKRPPQERKRLKKALPELLWLERLI
FT                   NTYSSTLDASCEGLLPWQGLQLPFYCLTLGGSAADKKTPVLLITGGVHGIERIGSQVIL
FT                   AWLSSLLSRLEWDSALQQKLSRLRLVVVPIVNPVGMFANRRANGNGVDLNRNGLVTAED
FT                   KVPFLVGGHRIGSWLPWYRGSAGQPQELEYRLLQQVVEREVYPRAMAMALDLHSGFGTH
FT                   DRLWFPYAYRKKLIGSIENYLALKLLWERCFPHHNYIFEPQSIHYLSHGDIWDDFYLQA
FT                   KKRENHTFIPLTLEMGSWAWVKKRPAQIFNFAGMFNPQKAHRHSRVLRRHLSLLDFLLS
FT                   AAIDYREWLPVDEQVKLLKQAAHVLWN"
FT   gene            172696..173469
FT                   /locus_tag="TERTU_0152"
FT   CDS_pept        172696..173469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0152"
FT                   /product="alpha/beta hydrolase family protein"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13726"
FT                   /db_xref="GOA:C5BLD7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLD7"
FT                   /protein_id="ACR13726.1"
FT                   /translation="MSCGINVILLRGLGRESEHWFGFAELLKRRCAEIAPYIYFTFATP
FT                   DTAGCGTEYQRKASHRLTELTDDLVRRLPTKTKDACTVVVGLSMGGLIALDLANRYESL
FT                   VDGVVVINSSTGNQPWYRRMCPQALLTALTALALPLRQRENCIFNLVSNTQPEQARQGW
FT                   WQIQRARPVSRLNLVRLLLAAAGFTLNETLAQKGLVIASQRDRLVDARCSGELAHYLNW
FT                   PLEVHPSAGHDVPIDNPEWLADVVAQWLVREYVIL"
FT   gene            175126..175611
FT                   /locus_tag="TERTU_0155"
FT   CDS_pept        175126..175611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0155"
FT                   /product="lectin"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12741"
FT                   /db_xref="InterPro:IPR001229"
FT                   /db_xref="InterPro:IPR036404"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLD8"
FT                   /protein_id="ACR12741.1"
FT                   /translation="MKKIIAGVLMLSSMVAGAQKFEAGVSGGWGGTPFADNPPTDFSQI
FT                   HDITLCGGSVVDSISTNIEDVYGNVQSYGKKGGNGGTCSTLYFYSGEYITSVTGRYGSR
FT                   VDSMVITTNYGRTLSKGGNGGGGDFKYTANDQFQIAGFAGRSGSKLDAVGVIYLRSY"
FT   gene            175830..176441
FT                   /locus_tag="TERTU_0156"
FT   CDS_pept        175830..176441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0156"
FT                   /product="carbonate dehydratase"
FT                   /note="identified by match to protein family HMM PF00484"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13974"
FT                   /db_xref="GOA:C5BLD9"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLD9"
FT                   /protein_id="ACR13974.1"
FT                   /translation="MISADEAITRLKEGNQRFVAGVRSVDAIVKQMNLADHAQGQAPFA
FT                   IVLGCSDSRVPAEIIFDQSLGDLFVIRVAGNIVAPSQVGSVEFAAETFGTPLVIVLGHT
FT                   RCGAINATLDLLEKPAAEQSSNVMSIVNRIRPAVEPLFHTELRNDREKLVPACIHANIM
FT                   ASTNQLSHGSEILEQLVEQGKLKIVGAEYSLETGEVTFFD"
FT   gene            176791..177909
FT                   /locus_tag="TERTU_0158"
FT   CDS_pept        176791..177909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0158"
FT                   /product="response regulator receiver domain protein"
FT                   /note="identified by match to protein family HMM PF00196"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12427"
FT                   /db_xref="GOA:C5BLE0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLE0"
FT                   /protein_id="ACR12427.1"
FT                   /translation="MPDERCSELIYRIYNTVNAPDTWQEVLADVATDLGASHFFIAARA
FT                   SVDAQPFAFIEHGFSHGHFDQYHQHYYKVDVWTKALAQHEPNQFRSSHEVYDDRAFLNS
FT                   EIYHDFARPADIRHGLGCLLVSGDSFDPPMMTELALMRGGDQKHFDESEKRRAQHYVSH
FT                   FEQALQLGRQMQQLTAQQRAFAGLFAAQTQPALICDYHLRVYEHNHALDGLAQNGELLG
FT                   IGCERKLTFVDERNQSQLEACIAGFRMATFNSAESFSVVAGGVGYRVKVSPWLYTGVHL
FT                   PGQQQGALLVQIQPLRTATQLSPGLIMCWTALSAAEAEVVAHLCEGTGLAQIAELRKVS
FT                   LGTVRQQLKSAMHKVGCHSQAQLIARILTLSV"
FT   gene            complement(177898..178203)
FT                   /locus_tag="TERTU_0157"
FT   CDS_pept        complement(177898..178203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0157"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11276"
FT                   /db_xref="GOA:C5BLE1"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLE1"
FT                   /protein_id="ACR11276.1"
FT                   /translation="MSNFGSEQGYRIAHTLGVLMIVGAVGWSLLRITGITSSPALLPLV
FT                   FFMVFQMLLGGLLLYAAQLKKNHSLLSQKFYPASIAAAILYLLMLWHWLQSPALHA"
FT   gene            178337..178939
FT                   /locus_tag="TERTU_0159"
FT   CDS_pept        178337..178939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0159"
FT                   /product="glutathione S-transferase"
FT                   /note="identified by match to protein family HMM PF00043;
FT                   match to protein family HMM PF02798"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11714"
FT                   /db_xref="GOA:C5BLE2"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLE2"
FT                   /protein_id="ACR11714.1"
FT                   /translation="MIKVYGDIYSGNCYKIKLLLSFLNIPYTWKHMDILAGETRTPEFL
FT                   QKNSNGKIPLVELDSGEYLAESNAILNYFAEGSPYLPNDRLLRAQVLQWQFYEQYSHEP
FT                   CIAVARYIQRYLGMPEHRRADYDSAQAGGITALQLMNTHLATHQFFVGERLTIADISLY
FT                   AYTHVAEEGGFDLAPYNFISDWFARIEAHPNYIAMEG"
FT   gene            178963..179565
FT                   /locus_tag="TERTU_0160"
FT   CDS_pept        178963..179565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0160"
FT                   /product="translocator protein, LysE family"
FT                   /note="identified by match to protein family HMM PF01810"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11377"
FT                   /db_xref="GOA:C5BLE3"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLE3"
FT                   /protein_id="ACR11377.1"
FT                   /translation="MYVSHELISMLTFCLAASITPGPNTLMLMTSSLNHGVARSWPHFW
FT                   GVILGFNFMLATIALGLGAVFTAYPMAHQIIKILGGAYLLYLAWKIATSSGLNEEKSRS
FT                   EPLTFWQAVLFQWLNPKAWIISIGAVASFTQVGDFIAQFLRLLVVFFTIGTASMLVWLF
FT                   FGALLNRLIHNDRVLKRFNIAMGLLLAVSIVPMLGVV"
FT   gene            179803..180423
FT                   /locus_tag="TERTU_0161"
FT   CDS_pept        179803..180423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0161"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACR10885"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLE4"
FT                   /protein_id="ACR10885.1"
FT                   /translation="MLKKMMPVVAGLMAFLSGSAFADMGLAAGISSDDSAEIRLPIRSQ
FT                   NTIYEPYVSFASISYNSDELFESRKSDDQSFSVGLSVLRVRALQDSLFWQYGIRAGYLQ
FT                   RDGELSAVYGTNIEQNYQTLYSEEKLSGYLVSPRIGVFYSINDKVNLGIDVGYTYQNLS
FT                   GDVTEVHVSYYDDEPPETYRDAKEDVDVSQWNSFSLIFMRVYF"
FT   gene            complement(180527..181414)
FT                   /locus_tag="TERTU_0162"
FT   CDS_pept        complement(180527..181414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0162"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12960"
FT                   /db_xref="GOA:C5BLE5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLE5"
FT                   /protein_id="ACR12960.1"
FT                   /translation="MKTTLEQWQTFKTVIDEGSFAKAAEVLNKSQSSVSYIIARLQEQL
FT                   PVPPLVQKGRKAELTEAGKLLYRHASDLLAQAEQLEETAGHLAKGWEAEVSIAADALVP
FT                   INRVFCGLQAFSSFCPNTRIRIIETTLSGTDEALLTKQADIALSGRVPPGFLAKPLTDV
FT                   TMLPVAGAQHPLAKLDIVTEQDLKQHRQIVVRDSGTKRSQDAGWLEAEQRWTVSWFSTS
FT                   IEALKSGLGFAFVPHHRAQPYLENGELCALPLEGGGTRRIPLYLIVAAQSYAGPAVKAV
FT                   AERLLAAFNAEHKA"
FT   gene            181517..182107
FT                   /locus_tag="TERTU_0163"
FT   CDS_pept        181517..182107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0163"
FT                   /product="FMN-dependent NADH-azoreductase"
FT                   /EC_number="1.7.-.-"
FT                   /note="identified by match to protein family HMM PF02525;
FT                   match to protein family HMM PF03358"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14061"
FT                   /db_xref="GOA:C5BLE6"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023048"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLE6"
FT                   /protein_id="ACR14061.1"
FT                   /translation="MSTQVLHIDSSILGDNSVSGALGKTLTDALTEKLVDVSVIHRDLG
FT                   QDPVPYLDGATFAAMGEGKAELSNQLIEELLAADIIVIGAPMYNFGIPAQLKSWLDHLA
FT                   RAGTTFKYTSEGPVGLVSGKKVFVLASRGGAYRDTPLDTHTPYLKSFLGFLGISDVEFI
FT                   YAEGLAMGEEARANTLTEAEAAIAAAVESLTIA"
FT   gene            182122..182970
FT                   /locus_tag="TERTU_0164"
FT   CDS_pept        182122..182970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0164"
FT                   /product="pirin"
FT                   /note="identified by match to protein family HMM PF02678;
FT                   match to protein family HMM PF05726"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13880"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLE7"
FT                   /protein_id="ACR13880.1"
FT                   /translation="MRKVVEQIRAQQASDGDGVKLLRVFGGARPERFDPFLMLDEFGSD
FT                   VASDYIGGFPPHPHRGFETVTYMLQGKMEHRDHMGNVGLLNDSDVQWMTAGRGIIHSEM
FT                   PRQTEGRMRGFQLWVNLPAANKMKPAHYQDIPGDDIPVYTFSNFSVKAIAGQITLGDTL
FT                   VKGYFDVPDTQAMMLDIHLAPGSIVELPLESSMTSLVYTYDGAVTLGEDRVPARQQTLS
FT                   RMAGEGALQVTNNGTEEARLLVLAGEPLREPIVQHGPFVMNSVAEIEQAIQDYQAGVLA
FT                   G"
FT   gene            complement(183103..184233)
FT                   /locus_tag="TERTU_0165"
FT   CDS_pept        complement(183103..184233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0165"
FT                   /product="beta-lactamase"
FT                   /note="identified by match to protein family HMM PF00144"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11295"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLE8"
FT                   /protein_id="ACR11295.1"
FT                   /translation="MKNLTLLLAPIVLLTACGGQGQMTQAPALTSLAESSTSAECSRLS
FT                   LESAIDSTLQSIVTDVNDFSFYVEDINGDSYEFNRGNSTLQTPYESASTSKWVTAAVIM
FT                   QLVDSGLLSLTDMPNTFLSQDEWPMPARDPLSGLTLAQLLSFTSGLNRTPICTNAPNSD
FT                   FFACINNIARNNRLFNSTPGAEFYYGSSHLQVAGAMAIKALGGEDADYGWSDVFANFKS
FT                   LTGLFPTSAYNLPSVENPRLAGGMTWTGEEYINFIRAFRDLDFYTSPAIVDQMTSDQLN
FT                   GAVVANSPALDGIGEDWHYGFGMWVECHQSSFSDACLPTEQVSSPGAYGAYPFLNIAEG
FT                   YFGLVARQGELGTFSEGYAIYDAIRDDVEAWAACPN"
FT   gene            complement(184241..184909)
FT                   /locus_tag="TERTU_0166"
FT   CDS_pept        complement(184241..184909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0166"
FT                   /product="nitroreductase family protein, FMN binding"
FT                   /note="identified by match to protein family HMM PF00881"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11758"
FT                   /db_xref="GOA:C5BLE9"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLE9"
FT                   /protein_id="ACR11758.1"
FT                   /translation="MDVRDALTKRKSVRAFTNESVSREQVERILCAARHAPSGTNTQPW
FT                   QVVAVSGEAKAKLDTQLEAAFDEAIEENMDYIYYPLEWVEPYKSRRRACGLQMYTTLQI
FT                   TREDKARQRAQWRLNYSAFGAPVALYFFIDPVMKTGSFMDYGMFLQSIMLAAVEEGLAT
FT                   CAQAALGQYPDIVKSALEMPAEATLLCGMALGYEDTDADVNSYRTPREPVEVFTQFFGF
FT                   "
FT   gene            185167..185976
FT                   /locus_tag="TERTU_0167"
FT   CDS_pept        185167..185976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0167"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13510"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLF0"
FT                   /protein_id="ACR13510.1"
FT                   /translation="MEKRLLAGVVLAVIGLAGCNERDADSFIENRHDNDQFVMHVDLVY
FT                   RSEENKTRYIAADEISTIGSEELWVRVELKESDFGIFVVADDDEQLQVDYCGSQYFIGD
FT                   NLVYDDGDPKYYELVVPPAYDNCEMKVSFFHAKERTLAFNVPTFLKLYVSDNDVWSYDH
FT                   TAEPFFVNWRTLDRDAEFEFRWTMEASACPLDAPCEREFTRNMDKDALGYTVPANLFDV
FT                   ADGDMEKLVISLAQPRYDLERDRYGLHKESDVELDQKASLGYRIVNP"
FT   gene            complement(186005..186937)
FT                   /gene="oxyR"
FT                   /locus_tag="TERTU_0168"
FT   CDS_pept        complement(186005..186937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oxyR"
FT                   /locus_tag="TERTU_0168"
FT                   /product="redox-sensitive transcriptional activator OxyR"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13191"
FT                   /db_xref="GOA:C5BLF1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLF1"
FT                   /protein_id="ACR13191.1"
FT                   /translation="MTLTELRYIVTLAQEQHFGRAADRCHVSQPTLSIAVKKLEEELNV
FT                   SIFERSKTRVSPTPLGDTIIQQAQKVLEEAAAIKDIASSGKNQLTSPFHIGAIFTIGPY
FT                   LFPRLIPELQRQAPQMPLYVEESYTATLRRRIRHGDLDAIVIALPFTEADVVTQPLYEE
FT                   PFVVLMGKNHPLAGAKEIHPDELTQCNVLLLGEGHCFRDQVLEACPNLKPSLDDPRGNI
FT                   RTAAEGSSLETLKYMVASGLGVTILPQSAAMIGHYSADDLLIKPFADPVPYRTVALAWR
FT                   ASFPRLQAIDVIRESIKHCKVGESFLNKH"
FT   gene            187182..187886
FT                   /locus_tag="TERTU_0169"
FT   CDS_pept        187182..187886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0169"
FT                   /product="putative 2-phosphosulfolactate phosphatase"
FT                   /note="identified by match to protein family HMM PF04029"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14421"
FT                   /db_xref="GOA:C5BLF2"
FT                   /db_xref="InterPro:IPR005238"
FT                   /db_xref="InterPro:IPR036702"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLF2"
FT                   /protein_id="ACR14421.1"
FT                   /translation="MQIEFVDFVAGAKKAAGIAVVIDVFRAFTTACYCVQQGAARILAV
FT                   GDSDQALAYRNTLPDTVLLGERFGKCLPGFDFGNSPSEISEVNLQGKTVVHTTHAGTQG
FT                   LVNAIRADRVFTGALVNAAATVRAIKALEPRQVTLVRMGLNANEASDEDWLCADYLAAL
FT                   LRGETIAHQDIYQQLRGSPYAARFFDDAQPWSPAADFECCLDIDRFDFALQANPMPDGA
FT                   CELTLCSPQGDL"
FT   gene            187883..189130
FT                   /gene="nhaA"
FT                   /locus_tag="TERTU_0170"
FT   CDS_pept        187883..189130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaA"
FT                   /locus_tag="TERTU_0170"
FT                   /product="Na+/H+ antiporter NhaA"
FT                   /note="identified by match to protein family HMM PF06965;
FT                   match to protein family HMM TIGR00773"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14090"
FT                   /db_xref="GOA:C5BLF3"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLF3"
FT                   /protein_id="ACR14090.1"
FT                   /translation="MTLSERITGWFHHEAAGGILLIIAAILAMIMANTPLSHIYDLLLS
FT                   TPITVAIGTFEIQKALLLWVNDGLMTVFFLLVGLELKREFLEGELANPRNIALPAVAAL
FT                   GGMAIPSALYAAINWHDPLAINGWAIPAATDIAFALGILSLLGSRVPVSLKIFLTSVAI
FT                   FDDVGAIIVIALFYTNDISFTALGFAAVCLVILGLMNWRGVTSIRVYGLVGLIMWVALL
FT                   KSSVHATLAGVLLAFFIPLKAPVREKAKEFGKVYIKSPLRYLEHELHSPVAFFVLPVFA
FT                   FANAGVSLLGSGSEAFLHSVPMGIAVGLFFGKQLGVFFFSWVAVKVGAAKLPQGMGYSQ
FT                   LYGVSLLCGIGFTMSLFIGSLAFPMPDSMLVFDERTGILVGSFVSAIAGYWVLRKSLPQ
FT                   QAVATVPTPEVSNAQH"
FT   gene            complement(189181..189564)
FT                   /locus_tag="TERTU_0171"
FT   CDS_pept        complement(189181..189564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0171"
FT                   /product="putative endoribonuclease L-PSP"
FT                   /note="identified by match to protein family HMM PF01042;
FT                   match to protein family HMM TIGR00004"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11540"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLF4"
FT                   /protein_id="ACR11540.1"
FT                   /translation="MPNKAIIHSDKAPKAIGTYSQAVKVSNTVYLSGQIPLIPETMEMV
FT                   DGDFRAQAEQVFKNLSAVCEAADGSLQSIVKLNIYLTDLSNFPVVNEVMSQFFQQPYPA
FT                   RAAIGVKELPKGAQVEADGIAVI"
FT   gene            complement(189577..191691)
FT                   /gene="spoT"
FT                   /locus_tag="TERTU_0172"
FT   CDS_pept        complement(189577..191691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoT"
FT                   /locus_tag="TERTU_0172"
FT                   /product="guanosine-3',5'-bis(diphosphate)
FT                   3'-pyrophosphohydrolase"
FT                   /EC_number="3.1.7.2"
FT                   /note="identified by similarity to SP:P0AG24; match to
FT                   protein family HMM PF01842; match to protein family HMM
FT                   PF01966; match to protein family HMM PF02824; match to
FT                   protein family HMM PF04607; match to protein family HMM
FT                   TIGR00691"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12552"
FT                   /db_xref="GOA:C5BLF5"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLF5"
FT                   /protein_id="ACR12552.1"
FT                   /translation="MLTIDSLSHRLSSYLEPAQVNCVKRAYYYAEQAHTGQFRRSGEPY
FT                   ITHPLAVANILASIHMDHQSLMAAMLHDVIEDTGIGKSAISHQFGDQVAEIVDGVSKLA
FT                   KIDYESQAEKQAKNFQKMAMAMARDLRVIVVKLSDRLHNMRTLGALPPEKKRRIAKETL
FT                   EIYAPIAHRLGMNDWRIEFEDRGFAAMHPLRATRLHASLQQVRGNRKAIVEKIQSSIEM
FT                   RLQRETIEGLVIGREKHLYSIYNKMRGKHKSFEEIMDVYAFRIIVENIDTCYRALGAIH
FT                   NLYKPKPNEFKDYIAIPKENGYQSLHTVVVGTQGVPIEVQIRTKEMDELASRGIAAHWL
FT                   YKSNGDEESKNGSYDRANRWIKRLLEIQQHTNSSVEFVENVKIDLFRDEVYVFTPKGEI
FT                   IELPAGATAVDFAYAVHTQVGNSCVACRVNDRPAPLSQALESGQKIKIITSSGSQPNPN
FT                   WLNFVITAKARAAIRHYLKNQRHTESVELGKRMLQRALSNQELQLDKLSDAQIQNVLET
FT                   TSRESMEKLFEDIGLGQITAMAITNILSPGSENDTNRNSHAPISIESPDGLLISFARCC
FT                   RPIPGDPVLAHLSTGKGVVVHRETCKNINDLRNKRGSLSEINWSPKVEGEFRSEIRVEV
FT                   KSERGIIASLATRIANTKTSIEGIQVDERDAEHSVITLTVAVTNRVHLANVMRSIRNMR
FT                   SVASVSRAKT"
FT   gene            complement(191710..191991)
FT                   /gene="rpoZ"
FT                   /locus_tag="TERTU_0173"
FT   CDS_pept        complement(191710..191991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoZ"
FT                   /locus_tag="TERTU_0173"
FT                   /product="DNA-directed RNA polymerase, omega subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="identified by match to protein family HMM PF01192;
FT                   match to protein family HMM TIGR00690"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12092"
FT                   /db_xref="GOA:C5BLF6"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BLF6"
FT                   /protein_id="ACR12092.1"
FT                   /translation="MARITVEDCLDHVDNRFELVIVGTKRARQLAVQGKTPMVPEENDK
FT                   PTVIALREIEEGFIDASILDEKDEPQDTLIMGDADHSLDLGMHNSPEA"
FT   gene            complement(192085..192702)
FT                   /gene="gmk"
FT                   /locus_tag="TERTU_0174"
FT   CDS_pept        complement(192085..192702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmk"
FT                   /locus_tag="TERTU_0174"
FT                   /product="guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /note="identified by match to protein family HMM PF00625;
FT                   match to protein family HMM TIGR03263"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13474"
FT                   /db_xref="GOA:C5BLF7"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLF7"
FT                   /protein_id="ACR13474.1"
FT                   /translation="MLSTGTLYTVSAPSGAGKTSLVKAVVDAVDNLLVSVSHTTRAQRP
FT                   GEVDGINYHFVDRTQFEQMVENGDFLEHAQVFTNAYGTSKNWVLETLGAGKDVILEIDW
FT                   QGAHQVRQLIPSAVSLFILPPSRETLRQRLTGRGQDNDSVIDARMAEAESEMSHYGEAD
FT                   YLIVNDNFNVALNEFRAIIIANRLTLEKQRLRHQSLLNNLLS"
FT   gene            complement(192771..193637)
FT                   /locus_tag="TERTU_0175"
FT   CDS_pept        complement(192771..193637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0175"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03755;
FT                   match to protein family HMM PF08340; match to protein
FT                   family HMM TIGR00255"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12995"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLF8"
FT                   /protein_id="ACR12995.1"
FT                   /translation="MPRSMTGFARQESQHPWGSLSCEIRTVNHRYLEPTLRLSETLRAL
FT                   EPELRDRMRKQLSRGKVEVNLQLKTDAAAGTDLALNQAFAQHLISLAETVGTQLQQGSP
FT                   INPLDILRWPGVLQTAEIDPQDVAAAAQSLFEETLAMLVANREREGAELKTFIAQRMQT
FT                   IASHVGVVRDKLPAIQQALRDKMRSRIEALAVDVDEERFNQEVVYLCQKSDVAEELDRL
FT                   EAHIQETQHALEQNGPIGRRLDFLMQEFNREANTLSSKSTASDTTQIAVDLKVLIEQMR
FT                   EQVQNIE"
FT   gene            193767..194486
FT                   /gene="rph"
FT                   /locus_tag="TERTU_0176"
FT   CDS_pept        193767..194486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rph"
FT                   /locus_tag="TERTU_0176"
FT                   /product="tRNA nucleotidyltransferase"
FT                   /EC_number="2.7.7.56"
FT                   /note="identified by match to protein family HMM PF01138;
FT                   match to protein family HMM PF03725; match to protein
FT                   family HMM TIGR01966"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14374"
FT                   /db_xref="GOA:C5BLF9"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BLF9"
FT                   /protein_id="ACR14374.1"
FT                   /translation="MLRPSGRAANQLRDISITRHYTRHAEGSVLVCFGDTKVICTATVE
FT                   EGVPRFLKGEGQGWVTAEYGMLPRSTGSRMGREAARGKQGGRTVEIQRLIGRSLRAAVD
FT                   LTLLGEHSITIDCDVIQADGGTRTASITGACVALVDALRFMQRSKMIQTDPLRHLVASV
FT                   SVGMYQGEAVLDLDYPEDSNADTDMNMVMTEQGGLIEIQGTAEQAPFSEDEFIQMFTLA
FT                   KEGISELCEFQRQSLTD"
FT   gene            194933..195382
FT                   /locus_tag="TERTU_0177"
FT   CDS_pept        194933..195382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0177"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14695"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLG0"
FT                   /protein_id="ACR14695.1"
FT                   /translation="MNKKLLSAGALWALVMGGQAVADTVELSVPANSSDGSFVLRIENE
FT                   QFASDMGRKGLSLEILRNKDGGEFKRLLLGPACSALSELVLENGVYGYKARWLSPDGKQ
FT                   VDKSASEFSSPVFIKVSSAVKRIIPPRKDRIVSINAIAGPGARTP"
FT   gene            complement(195433..196251)
FT                   /gene="mutM"
FT                   /locus_tag="TERTU_0178"
FT   CDS_pept        complement(195433..196251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutM"
FT                   /locus_tag="TERTU_0178"
FT                   /product="DNA-formamidopyrimidine glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /note="identified by match to protein family HMM PF01149;
FT                   match to protein family HMM PF06831; match to protein
FT                   family HMM TIGR00577"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12438"
FT                   /db_xref="GOA:C5BLG1"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BLG1"
FT                   /protein_id="ACR12438.1"
FT                   /translation="MPELPEVETTRRGIAPHILHHPITAVTLRHTQLRWPIDKALSRNL
FT                   PGRTLVRADRRGKYLLLAVDDGRTLIWHLGMSGSLRIVEPTEPPGKHDHIDLRFAHGRV
FT                   LRYHDPRRFGAFLATADDPAQHALICHLGPEPLTDDFNGEYLYERSRKRSTAVKSWIMD
FT                   SRVVVGVGNIYANESLFLAKIHPLRAAGKLTRPACHRLADIIKAVLARSITQGGTTLRD
FT                   FVGGDGKPGYFAQQLNVYGRGGEPCPVCAKPLTEKPLSQRTTVYCTHCQN"
FT   gene            196401..197066
FT                   /locus_tag="TERTU_0179"
FT   CDS_pept        196401..197066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0179"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACS93530"
FT                   /db_xref="InterPro:IPR021747"
FT                   /db_xref="UniProtKB/TrEMBL:C6AQY8"
FT                   /protein_id="ACS93530.1"
FT                   /translation="MKKIISGLLAALLISGCSSSPTVTSIPVSEGDIEGFYEVLNLRQF
FT                   DSVFIRSSDALQGYSAAVFADLDLANLEIDRSRLRANSEKWRFDRRDRQRMEEQFAEQL
FT                   ALLFAGKSVHLTQAASPGTGVLTIEFALTRYKPNAPKDALQDRPVGRTYITEGAGRLYM
FT                   QARVRDSVSGELLALFEDDRELGQEWEEDNRVNNARRFEQGLGLWLRRLDAAIADLQT"
FT   gene            complement(197109..197264)
FT                   /gene="rpmG"
FT                   /locus_tag="TERTU_0180"
FT   CDS_pept        complement(197109..197264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /locus_tag="TERTU_0180"
FT                   /product="ribosomal protein L33"
FT                   /note="identified by match to protein family HMM PF00471;
FT                   match to protein family HMM TIGR01023"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12043"
FT                   /db_xref="GOA:C5BLG2"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLG2"
FT                   /protein_id="ACR12043.1"
FT                   /translation="MRDKIRLNSTAGTGHFYTTDKNKRTMPGKMEIKKYDPVVRKHVVY
FT                   KEGKIK"
FT   gene            complement(197290..197526)
FT                   /gene="rpmB"
FT                   /locus_tag="TERTU_0181"
FT   CDS_pept        complement(197290..197526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="TERTU_0181"
FT                   /product="ribosomal protein L28"
FT                   /note="identified by match to protein family HMM PF00830;
FT                   match to protein family HMM TIGR00009"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12168"
FT                   /db_xref="GOA:C5BLG3"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BLG3"
FT                   /protein_id="ACR12168.1"
FT                   /translation="MAKVCQVTGKRPVTGHNVSHAKNHTKRRFLPNLHTHRFWVESEKR
FT                   FVKLRVSSKGMRIIDKNGIETVLSDIRARGEKI"
FT   gene            complement(197745..198851)
FT                   /locus_tag="TERTU_0183"
FT   CDS_pept        complement(197745..198851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0183"
FT                   /product="glycoside hydrolase family 5 domain protein"
FT                   /note="identified by match to protein family HMM PF00150"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12128"
FT                   /db_xref="GOA:C5BLG4"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLG4"
FT                   /protein_id="ACR12128.1"
FT                   /translation="MPFNLLKHAFILLFIALSLCLSQPGSAATHAAAKPGEWWNLPYPE
FT                   PFDATSLSRQQSTIRVSGNRLVDNKGETITLRGVNISDPDKLVKNGHWEKAHFAAVKSF
FT                   GANVIRVPVHPIAWRSRGGEHYLELLDQAVHWANELDMYLIIDWHSIGNLHTGLFQHPM
FT                   YDTNLQETRVFWRTIAARYKGVPTIAVYELFNEPTKMGGQLGELSWTTWKAINEDLIDI
FT                   IFAHDPSAIPLVAGFNWAYDLRSARENPIARKGIAYAAHPYPEKTRAPVAQKAADWEQT
FT                   WGFIAKRAPLVATELGWMREGEPGAHVPVRDDGSYGPAIVKYLEKIGASWTVWCFDPDW
FT                   PPQMIADWQYTPTEQGKFFRKEMLRMNK"
FT   gene            complement(198973..199647)
FT                   /gene="radC"
FT                   /locus_tag="TERTU_0184"
FT   CDS_pept        complement(198973..199647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radC"
FT                   /locus_tag="TERTU_0184"
FT                   /product="DNA repair protein RadC"
FT                   /note="identified by similarity to SP:P25531; match to
FT                   protein family HMM PF04002; match to protein family HMM
FT                   TIGR00608"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12266"
FT                   /db_xref="GOA:C5BLG5"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BLG5"
FT                   /protein_id="ACR12266.1"
FT                   /translation="MAISDWPASERPREKLLERGPDALSDAELLAIFLRTGCKGRSAVD
FT                   LARELLSTFGGLRALLAADCKAFCQGLGLGEAKYVQLQAVLEMSKRHLGETLQRQTQFA
FT                   NSQSVKDFLNSQLRHRRSEVFAALFLDSQHRLLSFDILFNGTIDGAAVYPREVVKKCLA
FT                   HNAAAVIFAHNHPSGVAEPSEADRQITDRLCRALQLLDIRTLDHIVVGEGDAVSFADRG
FT                   WL"
FT   gene            199839..201068
FT                   /gene="coaBC"
FT                   /locus_tag="TERTU_0185"
FT   CDS_pept        199839..201068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaBC"
FT                   /locus_tag="TERTU_0185"
FT                   /product="phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase"
FT                   /EC_number="4.1.1.36"
FT                   /EC_number="6.3.2.5"
FT                   /note="identified by match to protein family HMM PF02441;
FT                   match to protein family HMM PF04127; match to protein
FT                   family HMM TIGR00521"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12882"
FT                   /db_xref="GOA:C5BLG6"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLG6"
FT                   /protein_id="ACR12882.1"
FT                   /translation="MSVPDSTLSLANKNIVLGVTGGIAAYKSAELVRQLQNAGAEVHVV
FT                   MTAAATEFITPLTLQALSGNPVHTSMLDPAAEAGMGHIELARWADALVIAPATADFIAR
FT                   FAQGEGNELLLALCLATAAPVMIAPAMNQEMWRKDITQENVARLLARGVIVCGPDEGVQ
FT                   ACGDVGPGRMLQVEALTECIAAQFQLGSLAGRHVVITAGPTREAIDPVRYLTNRSSGKM
FT                   GYALAEAALDAGAQVTLVSGPVNLSPPPKVRLVAVESALEMHAATLAAAESADVVIGAA
FT                   AVADYRPQVAAQDKLKKHAGEPMQLTLVENPDIIADVAALPGLRFVVGFAAETQHLEEY
FT                   AQAKLKLKRLHAIIANNVADGGVFEQDENEVTVFSRDGGTVSFARRGKKQLARGLIQWI
FT                   AAALAEKPCD"
FT   gene            201152..203689
FT                   /locus_tag="TERTU_0186"
FT   CDS_pept        201152..203689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0186"
FT                   /product="phosphomannomutase"
FT                   /EC_number="5.4.2.8"
FT                   /note="identified by match to protein family HMM PF00408;
FT                   match to protein family HMM PF02878; match to protein
FT                   family HMM PF02879; match to protein family HMM PF02880"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13976"
FT                   /db_xref="GOA:C5BLG7"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLG7"
FT                   /protein_id="ACR13976.1"
FT                   /translation="MTEQFQKFSDPGRSKPKSAEVDPPVEPKGKISPVLVSVLACVVLA
FT                   AALSSWLCYHTYQTQIVAQRDAQLAELSQQRASLTAQNIHLYMARVSEAIAQFADKPLL
FT                   KTALEANDETQLQRFVAGFQGQLDGALKVRVFPRGTARLDNDIYPPIRFSELELIGLAE
FT                   RQEVALPEAARINNEWLITMVAPVVQDNTRLVYGTVMVSLRAAVLAPLLAQNNTGLGQV
FT                   TLQQVFDTGAPTTLISVAGAPVAPAVVVPVKDSHWQVVFAAGPALVAQTGTNGLWQLAG
FT                   VALGCIFLIALSAWFGRQLGTRIAAAREDKAKGTWKTIQAVASAGKDVAFTDPIFQRRD
FT                   ILDVEIANEDEALLALDEKAQKPEQTIKDEQLDDSANETEQSSIAISETIFRAYDIRGI
FT                   YGREITKDVAYLVGQALGSEAMDVGDDTLIVARDARLHSPQLTEFLIRGILSTGCHVLN
FT                   IGTVPTPLLYFATETLADSGSGVMVTASHNPADHNGFKVVMGGKCRSEEDIKAIRSRIL
FT                   SKNIYTGSGEERRKDIVPDYINTIFSDVALAGDISIVIDAANAVPGVIAPRLFEELGCH
FT                   VTPLNCELDGSFPNHSPDPSIEENLQPLIAKVQEVGADLGIALDGDGDRLVVVTPQGKI
FT                   LWPDRLLMLFAKDIVARNPGADVVFDVKSTRHLANVITSSGGRPIIWKTGHSPMKLKMA
FT                   ESGALLGGEYSGHIFIKDRWYGFDDGLYAAARLIEIVSLQGQTLDEVFADFPESPSTPE
FT                   IRVSVPEESKFALVEQLIERGEFGDGKKTTLDGLRIDYSNGWGLVRASNTSAHLTMRFE
FT                   ADDEASLHTLKALFVRQLREIDSTLKIDWDQTN"
FT   gene            203689..204615
FT                   /gene="argB"
FT                   /locus_tag="TERTU_0187"
FT   CDS_pept        203689..204615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argB"
FT                   /locus_tag="TERTU_0187"
FT                   /product="acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="identified by match to protein family HMM PF00696;
FT                   match to protein family HMM TIGR00761"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11013"
FT                   /db_xref="GOA:C5BLG8"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLG8"
FT                   /protein_id="ACR11013.1"
FT                   /translation="MRENESSIASAAHVAEVLTEALPYIQKFTNKTIVVKYGGNAMTDP
FT                   ALQKSFARDIVLMKLVGMNPIVVHGGGPQIGELLNRLNIKSEFVQGMRVTDSETMDVVE
FT                   MVLGATVNKQIVSLINSAGGQAIGVTGKDGHLIQAKKLILNRTMSEEQEENIKASEIID
FT                   VGHVGEVKSINRAVIDLLVQSDFIPVIAPIGVGADGASYNINADLVAGKVAEILQAEKL
FT                   MLLTNVAGLQDKNGEVLTGLSTRKVDELIADGTIYGGMLPKIRCALDAVNSGVSSAHIV
FT                   DGRVAHAVLLEIFTDAGVGTLITNSAH"
FT   gene            204859..205452
FT                   /locus_tag="TERTU_0188"
FT   CDS_pept        204859..205452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0188"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11468"
FT                   /db_xref="GOA:C5BLG9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023769"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLG9"
FT                   /protein_id="ACR11468.1"
FT                   /translation="MTTNNKKPRKQQILEALAHMLEVSPGARITTAALAKEVGVSEAAL
FT                   YRHFPSKSKMFEGLIEFIEQTLFTRISMINDEEGTALDRCQKIIHLLLAFSERNPGITR
FT                   ILTGDALAGETDRLRQRVIQLFDRLETQLRQMFRTAELEEGLKLVLSVNETVALLTAVV
FT                   EGKMVQYVRSEFKRLPTEAWPSHWRGMIDGLVPR"
FT   gene            complement(205616..206254)
FT                   /locus_tag="TERTU_0189"
FT   CDS_pept        complement(205616..206254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0189"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12079"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLH0"
FT                   /protein_id="ACR12079.1"
FT                   /translation="MHSKTALRGVNAFLSALLFALGCSFAVNASAQHVYYRYVNKEGVK
FT                   VLEHSIPPEYAQLGYEVLNASGQVVKVVPPAPTDEEVAKNAQEREAREIYARLKRRYSS
FT                   AAEIESAKRRRLANIDTNIAILKGNISSVTNEIQKIMGKAADYERRNQKVPAPILQSLS
FT                   DAKAELGIAQELLQSRQEEYQEVIEKYDSDKDAFVRGETLEAKEDARIQ"
FT   gene            complement(206254..206895)
FT                   /gene="pyrE"
FT                   /locus_tag="TERTU_0190"
FT   CDS_pept        complement(206254..206895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="TERTU_0190"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR00336"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12111"
FT                   /db_xref="GOA:C5BLH1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BLH1"
FT                   /protein_id="ACR12111.1"
FT                   /translation="MHAYQQQFIEMAIASQALKFGEFTLKSGRVSPYFFNAGMLHMGSN
FT                   IAHLGRAYAQALVDSGHPVDMIFGPAYKGIPLAAATAIALADHHNRDLPYAYNRKEAKD
FT                   HGEGGTLVGAPLTGKVAIVDDVITAGTAIREVLALLEQAKAEPAAIVIGLNRKERGQGS
FT                   LSAIDELQQSTGVPVVSIIDLDHIMMYLEKAGDQQTSEKIALYREQYGSD"
FT   gene            207209..207982
FT                   /locus_tag="TERTU_0192"
FT   CDS_pept        207209..207982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0192"
FT                   /product="histidine kinase"
FT                   /note="identified by match to protein family HMM PF03372;
FT                   match to protein family HMM TIGR00633"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11426"
FT                   /db_xref="GOA:C5BLH2"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLH2"
FT                   /protein_id="ACR11426.1"
FT                   /translation="MRVISLCVDGIHQAAQRGLFDWIEEQDADIICLQDLRALEYELDD
FT                   DIFHPDGYFAYFFDSGVKHYNGVAIYTRHQPKALIYGLGFASGVDMEGRYLQVDFERYS
FT                   IGSLLAPTAFSETESQEVKIKFFDDFQALLHKVTRKRRHFIFCGNWAMAHSKKDVENWQ
FT                   NNTNQSGYLPHEQQWMNQLFRQLGYADAFRVAVPEAGEYSWWPSGKIGEGDGWRTDYQV
FT                   VSEALTRKVEYAAMYKTRHFSSHLPVIVDYDIDDL"
FT   gene            complement(208037..209434)
FT                   /gene="argH"
FT                   /locus_tag="TERTU_0193"
FT   CDS_pept        complement(208037..209434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argH"
FT                   /locus_tag="TERTU_0193"
FT                   /product="argininosuccinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /note="identified by match to protein family HMM PF00206;
FT                   match to protein family HMM TIGR00838"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11014"
FT                   /db_xref="GOA:C5BLH3"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLH3"
FT                   /protein_id="ACR11014.1"
FT                   /translation="MSHDENSVKPWGGRFSEATDAFVERFTASVNFDQRLYHHDINGSI
FT                   AHATMLASVGVLSDDEKNAIIEGLEGIRKDIESGAFTWSVSLEDVHMNIEAELTKRIGI
FT                   TGKKLHTGRSRNDQVATDIRLYLRDEIDVIGKELTRLQQGLLFLAEREAHTIMPGFTHL
FT                   QTAQPVTFGHHLLAWYEMLSRDYGRLMGCRKRLNQSPLGAAALAGTTYPIDREQTAALL
FT                   GFNHPTRNSLDSVSDRDFAIEFSAFAALLMTHLSRASEELVLWTSAQFNFIDLPDRFCT
FT                   GSSIMPQKKNPDVPELVRGKTGRVNGHLIALLTLMKSQPLAYNKDNQEDKEPLFDTVDT
FT                   VKDCLRAFADMVPALNANKAAMLEAAKRGFSTATDLADYLVRKGIPFRDSHEIVGKSVA
FT                   FGIAQNKDLSEMTLAELQQFSDVIENDVFDVLTLEGSVAARDHIGGTAPAQVLKAVELA
FT                   KEELAAR"
FT   gene            209508..210596
FT                   /locus_tag="TERTU_0194"
FT   CDS_pept        209508..210596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0194"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06580"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACR10855"
FT                   /db_xref="GOA:C5BLH4"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLH4"
FT                   /protein_id="ACR10855.1"
FT                   /translation="MAEKRPITEKPLAGGDFLPDLCGVQSVLGLVLVSELLVMALLVSD
FT                   TGLTEFNWSEFGVVSMLVLWIVLTSAAGLCRLRPLLARMAPLAAGILSYSITLLSTGVF
FT                   SLSYQHFILQVPLQSDVTFSHLMVAGVIAGITLRYLYLQQQLRNQQKAEMMARIQALQS
FT                   RIRPHFLFNSMNSIASLIGFDPEAAERMVVDLSQLFRASLKEAGLTPLREEIALCESYI
FT                   GIEQIRMGARLQSEWRYWCDGQPSSLEETRMGLIIIPSFLLQPLVENAIYHGIQPLPEG
FT                   GRIEVSIALDKQRVEICVRNPVLLNPSAGQAKSTAEGNGMALENIRHRLMAYYEKNAEL
FT                   KVEQPEGEYIIYLRFPARPRMS"
FT   gene            210611..211342
FT                   /locus_tag="TERTU_0195"
FT   CDS_pept        210611..211342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0195"
FT                   /product="positive alginate biosynthesis regulatory
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF04397"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14582"
FT                   /db_xref="GOA:C5BLH5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLH5"
FT                   /protein_id="ACR14582.1"
FT                   /translation="MHMLIVDDEPLARQRLIRMIEQLDGYEVVGEASNGVDAVAAVDKF
FT                   DPDIVLLDIRMPGEDGLETARKIAQLPEPPAIIFCTAYDEYALEAFQTLAVGYLLKPVQ
FT                   QQQLVDTLQNAMRLNKVQRNAVSNTAPDGQRQHITAKTRKGMELIPIASIQCFIADQKY
FT                   VTVRHSAGETLIDDTLKELEQEFPDRFLRVHRNALVSISEIEAMERNNSGQFELRLKSV
FT                   DYRPVVSRRHVSSVRELLSRL"
FT   gene            211504..212478
FT                   /gene="hemC"
FT                   /locus_tag="TERTU_0197"
FT   CDS_pept        211504..212478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemC"
FT                   /locus_tag="TERTU_0197"
FT                   /product="hydroxymethylbilane synthase"
FT                   /EC_number="2.5.1.61"
FT                   /note="identified by match to protein family HMM PF01379;
FT                   match to protein family HMM PF03900; match to protein
FT                   family HMM TIGR00212"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13369"
FT                   /db_xref="GOA:C5BLH6"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLH6"
FT                   /protein_id="ACR13369.1"
FT                   /translation="MIAARFKNHQGPSVKHTLRIATRKSALALWQAEFVKSELCRHHPE
FT                   LAVELVPLTSRGDKILDVPLAKVGGKGLFVKELEQAIIAGEADIAVHSMKDVPMEFPQG
FT                   LGLAVICEREDPRDALVSNKYSNLDAIPAGAVIGTSSLRRQSQLLAMRPDLEVTFLRGN
FT                   VNTRLAKLDAGEYDAIILASAGLKRLQMVDRIAEFIAPEVMLPAGGQGAVGIECRTDDQ
FT                   ETLALLQPLHHGVTEQAVLAERAMNRKLEGGCQVPIGGFAIHQDNQLWVRGLVADPDGS
FT                   EVLYDQVIGDPADAETLGVVLAEKLLAAGADAILKRVYGDASA"
FT   gene            212462..213262
FT                   /gene="hemD"
FT                   /locus_tag="TERTU_0198"
FT   CDS_pept        212462..213262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemD"
FT                   /locus_tag="TERTU_0198"
FT                   /product="uroporphyrinogen-III synthase"
FT                   /EC_number="4.2.1.75"
FT                   /note="identified by match to protein family HMM PF02602"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12069"
FT                   /db_xref="GOA:C5BLH7"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLH7"
FT                   /protein_id="ACR12069.1"
FT                   /translation="MTHPHNWRILASRPLAQNSSWSSKLQAAGYRVLALPLLAIAQVQE
FT                   PAQQQSIKNCILDFDHYDAVIFVSQNAVEATWQWLDQYWPQLPQGITYYAVGIKTAAQV
FT                   QHFLGSEATVHAALTAMNTEELLALPGLQQVAHQRILICRGLGGRPRLGDELENRGAAV
FT                   TYCELYQRTLPAEAVTQFTDANLNPAQDVLCVFSGETLQNLLYVATTAGADLSAFALVV
FT                   PGERVAALAAEQGFQQIQIARNAGEAAMLAAIDEIIATLDKTDL"
FT   gene            213259..214524
FT                   /locus_tag="TERTU_0199"
FT   CDS_pept        213259..214524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0199"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF04375"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11481"
FT                   /db_xref="GOA:C5BLH8"
FT                   /db_xref="InterPro:IPR007470"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLH8"
FT                   /protein_id="ACR11481.1"
FT                   /translation="MTDDKTPSPQEDSQAKPEADQPVDQTAIIVAPAADGPDSTAAAAQ
FT                   ERKPDPEAEPGPPPEFPTEPRKGSGIPWFSLLLLLLILLVAGAVAGLGWYGYGYYQQTQ
FT                   SKAGELAELQQQLAAQNQQLTQLRQALSTVGRDREQAVGAMGDRLTAAEQRLQAQNKRL
FT                   LAMSTITREDWLLAEAEYLLKLANQRILIERSAEGADALLTEADAILRDLDDPDLFALR
FT                   KAVNNDLAALRLINKIDREGLYLQINGLITQVVMLPVRPDREQVLGRGKNPEGEMLDEN
FT                   LTTDNWWAAMKKSLRAFGKSLSNYININNHAERPAPLMSAESAQYLQQNVRLMLERAQL
FT                   ALLREQQAIYTNSLEQAEGYLAQFYPASAPVERYREELNALAQRDIVIELPDISGSLEL
FT                   LHSYIEDLHNLKGAGKPSAGGN"
FT   gene            214526..215731
FT                   /locus_tag="TERTU_0200"
FT   CDS_pept        214526..215731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0200"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="identified by match to protein family HMM PF07219"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11132"
FT                   /db_xref="GOA:C5BLH9"
FT                   /db_xref="InterPro:IPR005254"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLH9"
FT                   /protein_id="ACR11132.1"
FT                   /translation="MKRLHLLGILTLCAIVAAPLILELIKADTGYILISLGSTTIETSF
FT                   WFAIFAVIFGVLVLRWSYMLLRAILRSLGVSWAFLAEGRSRQLNARTQRGLIHYIEGNW
FT                   QAAKKDLLSVAKYADQPLVHYLAAAHSAHQLGDMETCQALLSKAEEVAPENELAVLLSQ
FT                   AKMQLANQQCEQCLATLERARSVAPRHPVVLDLLLTVYQRVNDWAAVQALLPELKKSKA
FT                   YTQEQLHSLEVDAVCAVLDTHKFNLDELKSYWQKLDKSLKQSQVLVLQYCGHLQRLGAE
FT                   EAAEQQLRRVLTKQWDARLVELYGRVRGGSDNEQLLVAEQWLRERPGDPDLLLALARIA
FT                   MRNQLWGKARSYFESSLQLQKNPQAYAEFAALLAQLGDHQKSTELYQLGLLQLTTHQQE
FT                   KI"
FT   gene            215728..216429
FT                   /locus_tag="TERTU_0201"
FT   CDS_pept        215728..216429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0201"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14749"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLI0"
FT                   /protein_id="ACR14749.1"
FT                   /translation="MKKNLKGKWALVTGSSRGIGQQIALGLAQLGCNLVVHGRTQENLT
FT                   ATLGMLTDFDVTVHPVAGELDGEAPLNAVIEQVNKVAPQVDILYNNAAISCPSTPVFEF
FT                   DMATWMSVFQVNVFAMVKLVNAFGPGMKARNWGRIVNVSSGIADQPNLAPYSVSKAAVD
FT                   KLTQDLAFEFKDTAVRVNAVDPGWIRTDLGGPDAWDSVESTLPGMLAPVIVADNGPNGD
FT                   YFRAQDFKFFD"
FT   gene            complement(216672..217661)
FT                   /locus_tag="TERTU_0202"
FT   CDS_pept        complement(216672..217661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0202"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14321"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLI1"
FT                   /protein_id="ACR14321.1"
FT                   /translation="MPFLIIAISNSSLPGLERHDRLIVENPCAQAKLIVRRRNEPEREL
FT                   GAIKTVYVNITEPDGLMTFTALTVIAQKTFVLTIIAQTVANKDDKACDINVVRTAPNVN
FT                   QTHAALPPTMVSYNAHGTIIDSPTGRLSGTRTAQDRLRAQGMVNFIIDKINQSTIKAPL
FT                   HHDPFAEGDEFILDQVITADPSRDRWGELRKNDRIMENTDGVKRCRIQSLAGDRFRYWY
FT                   LVFATEQHAEDTQNQVDTTNDSHPHTLVVEQYPQTPPAPGSSRLNFYFRFIGLEDITTC
FT                   TELRTYIESLPPDTSTWEGLMEFFDNHNEIVNRVLSHLQGSGGGYINI"
FT   gene            complement(217699..218355)
FT                   /locus_tag="TERTU_0203"
FT   CDS_pept        complement(217699..218355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0203"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13911"
FT                   /db_xref="GOA:C5BLI2"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLI2"
FT                   /protein_id="ACR13911.1"
FT                   /translation="MTHNSVTDDQIDNYVNGRMSEEDEITFEAHYLENPALLARVESAQ
FT                   ALKDGLKLAPAAESQRRPSTAGINSAWLSYIVAPQTAIGAIAASLLLIPLILKHDPAVS
FT                   PEAITTTQFYLVANDVYRNESAAPKTHRITLDKRALALGFEVPPAFGKPQSWTVSIRDA
FT                   DGALIFSSEPLQPNLQSVIALTLTPGFLEQNKIYHYSLAPENSQTLLTGEFITQH"
FT   gene            complement(218451..219002)
FT                   /locus_tag="TERTU_0204"
FT   CDS_pept        complement(218451..219002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0204"
FT                   /product="RNA polymerase sigma factor, sigma-70 family"
FT                   /note="identified by match to protein family HMM TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13399"
FT                   /db_xref="GOA:C5BLI3"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLI3"
FT                   /protein_id="ACR13399.1"
FT                   /translation="MIPPEQLVTRIEQGDTVAEHQLVVQYQRGLMLALSRKSSIDVAED
FT                   VCQETWRVVLENIRAGKVREPERLAAYVVQTGRNQLLMHFRKYPAHTGAPHEADSDLTT
FT                   DETPETQLRHQRLRTAIGALLNELPQERDRELLRRFYLQEQEKGEICKSLTLTERHFHR
FT                   VLHRARQRFRELWEQTEMHW"
FT   gene            complement(219025..222093)
FT                   /locus_tag="TERTU_0205"
FT   CDS_pept        complement(219025..222093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0205"
FT                   /product="putative peptidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12943"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR024983"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLI4"
FT                   /protein_id="ACR12943.1"
FT                   /translation="MLQPRLLIIAVTSSALTAAALCFADENLPADTSMQSERILFEPEN
FT                   NRFHKTISVPHGQRLTLQFQPEHASLRIQVFNHLGEDLFANRHADLLYRHRLSLTDSDC
FT                   APCAIEVDVVPRHQAPAALTLESQVTDCQREPAFCDADTALEFARRKELSVSPTDISQH
FT                   FALAVQQWQALPPSIEKLNAQFLALHAAESTSANSTAFTQLASQARQFKAWPALAQIQF
FT                   MQLHEALAQDDTALTQQYLRELEQTLTRVQTTDTHVFYTLSAQAELVRAELFLHTEQLE
FT                   KHAAAIARASAKLDKIDDVAQVARILNGVGFLHRINKHLDQAAASHQLALSFSSETTDL
FT                   ALQMQSAYYLGVVSALRGRYFYAQSLLARAEREALALKAPIWQAHITAALARIAMELGS
FT                   VQESEALYQKAQTLYQLSGANRELKTVYLNQARLFSLQGKPDTSAEFLRLAQRHLSEAP
FT                   LDRRHYSETLAEAHLNAGQCTDAQHALTSLTDPGSVNSAPLLTAKIHLCLQNWRDAAAN
FT                   ARAAVTQFTRDQDDLGMLSARFVLASARWHEGFASEALAIIAAATHSIETLRDDLQRDD
FT                   MRRQFLALQRSLYDLQLQITREESPSNILAALQVAEKFKARTLFDALLRRNTPVPDTEA
FT                   KVAQLPFADLMATTLARLQATPESAVPSSEQESRSLEDALSQLPEGTALLYFFMGTRQS
FT                   YLWELSAGHQQVYSLPAEPELHGAIDAYLAQLNPQTGNRDALYQAGSRLSEYLLGSVAP
FT                   QLDQYQNLVIVPDGALHRVPFAALFNPQNESRLLLTHNISYARSLSTFNYFSEHPSHPQ
FT                   APTLSREHILLVAPDLAGGELEAREAELAAITRAWPSTNPPRVLAGHAADLAGVTAALA
FT                   QPFDIVHFASHTRLDWDYPSRSLIALNGDFASQPDSQLGIQTIRDSSLNAELVVLSACA
FT                   TAAGKNLAGEGPMGLSRAFFEAGAKRVLASLWPVEDRATAQIMAQFYRNLLTEQDEPTS
FT                   ALRKAQLALARNPRWNHPYYWAAFAFYGNPHAF"
FT   gene            complement(222248..222682)
FT                   /locus_tag="TERTU_0206"
FT   CDS_pept        complement(222248..222682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0206"
FT                   /product="glyoxalase family protein"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14370"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLI5"
FT                   /protein_id="ACR14370.1"
FT                   /translation="MKAYLEHLNIHVTQLDAIAEFISTAIPAFKVRFDSGTSCDERWLH
FT                   IGDEQHYFALYQATEAANARKNYGNTPGLNHVGIVVEEEVANLRKRLLKAGYTETTIEN
FT                   FHPARKRIYFADPDGNDWEFIQYLHADPVLRNSYDDAKTN"
FT   gene            222780..223337
FT                   /locus_tag="TERTU_0207"
FT   CDS_pept        222780..223337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0207"
FT                   /product="DNA-binding protein"
FT                   /note="identified by match to protein family HMM PF01381;
FT                   match to protein family HMM PF07883"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13918"
FT                   /db_xref="GOA:C5BLI6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLI6"
FT                   /protein_id="ACR13918.1"
FT                   /translation="MKLETLARNLAGNVRQLRSERGFTQQQMATLAQIPRPTWASIESG
FT                   AANPTLSVLSKLANALQVSIEELVSAPRSQAAFFAAGFGPHRKRRGGIFSPMVPELVPG
FT                   VEISRLQIEPAATVQGAPHTHGTREYLTCERGKLELRLDDGSWFLLPGDAVAFRGDQKH
FT                   AYVNCLHNEPSIAFSVVCFAPN"
FT   gene            223424..224848
FT                   /locus_tag="TERTU_0208"
FT   CDS_pept        223424..224848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0208"
FT                   /product="diguanylate cyclase with PAS/PAC sensor"
FT                   /note="identified by match to protein family HMM PF00989;
FT                   match to protein family HMM PF00990; match to protein
FT                   family HMM PF08447; match to protein family HMM PF08448;
FT                   match to protein family HMM TIGR00229; match to protein
FT                   family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13443"
FT                   /db_xref="GOA:C5BLI7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLI7"
FT                   /protein_id="ACR13443.1"
FT                   /translation="MRVEHLDRKEKSTHYLARELAEIIRVDPELFDFIDRYVFDGLWYW
FT                   NLQKPEDEWMSPQFWLTLGYAPEEKKHLAAEWQDIIDPDDLLVAQQNFEQHCKDPGHPY
FT                   DQIVRYTHQSGETVWLRCRGFAIRDAEGVATRMLGIHTNVSRLKHIEERYKKIIATMDR
FT                   VYADLRVALDESEQLFETIPDAILQVDQDGRIVKSNSRATEMFGYSASHLQELTVEDLV
FT                   PDAIRIKHSKLRHRFQDAPEVREMGNDAMNLSAVTKSGKEIFVDIRLSPYNTKYGLHTI
FT                   AVVRDITERRKMVSRLKAQEEEEQKLFKLSSTDSMTGVFNRGYFLELANRAHHQGERYD
FT                   HNFCVMMLDVDNFKSINDRFGHAEGDRALTQIGNILKNSVRKTDIIGRVGGEEFAIVLP
FT                   ESSIDQGVVLADKILYNIEDARMHSDDPDGLGGCPTLSIGLVAKGDENETFNELLYRAD
FT                   QLLYKAKHTGKAKVVY"
FT   gene            complement(224868..226328)
FT                   /gene="ubiD"
FT                   /locus_tag="TERTU_0209"
FT   CDS_pept        complement(224868..226328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiD"
FT                   /locus_tag="TERTU_0209"
FT                   /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
FT                   /EC_number="4.1.1.-"
FT                   /note="identified by match to protein family HMM PF01977;
FT                   match to protein family HMM TIGR00148"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12938"
FT                   /db_xref="GOA:C5BLI8"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR023677"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLI8"
FT                   /protein_id="ACR12938.1"
FT                   /translation="MFKDLRDFIALLEKRGELKRISHPVSAHLEITEICDRTLRVGGPA
FT                   LLFENVEGSDIPLLGNLFGTPERVALGMGQESVAALREVGELLAFLKEPEPPKGMKDAW
FT                   EKLPIFKQVLNMAPKQVSRAACQQVVLEGDDVDLHKLPIQTCWPGDAAPLVTWPLVITR
FT                   GPHKERQNLGIYRMQLIGKNRLIMRWLSHRGGALDFREWQAEHPGENFPVSVALGADPA
FT                   TILGAVTPVPDTLSEYAFAGLLRGSKTEVTKSLGNALQVPASAEFILEGYLAPGDMADE
FT                   GPFGDHTGYYNEVDQFPVFTVERITHRKEPIYHSTYTGRPPDEPAVLGVALNEVFVPLL
FT                   KKQFPEIVDFYLPPEGCSYRLAVVTIKKQYPGHAKRVMLGVWSFLRQFMYTKFVIVTDD
FT                   DVNARRWEDVIWALTTRVDPTRDTTLIDNTPIDYLDFASPVSGLGSKMGIDATNKWPGE
FT                   TTREWGVPIEMDADIKSKVDAIWDELGL"
FT   gene            complement(226651..227910)
FT                   /gene="rho"
FT                   /locus_tag="TERTU_0210"
FT   CDS_pept        complement(226651..227910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rho"
FT                   /locus_tag="TERTU_0210"
FT                   /product="transcription termination factor Rho"
FT                   /note="identified by match to protein family HMM PF00006;
FT                   match to protein family HMM PF07497; match to protein
FT                   family HMM PF07498; match to protein family HMM PF08206;
FT                   match to protein family HMM TIGR00767"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12559"
FT                   /db_xref="GOA:C5BLI9"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLI9"
FT                   /protein_id="ACR12559.1"
FT                   /translation="MNLTDLKTKPIEELIDIAKEMGMESLARSRKQDVIFNILKRHARS
FT                   GEDIYGDGVLEILQDGFGFLRSSGSSYLAGPDDIYVSPSQIRRFNLRTGDSIAGKIRPP
FT                   KEGERYFALLKVNEINFDKPENSRNKILFENLTPLFPTSRLVLETGNGSSEDLTGRIID
FT                   LISPIGKGQRGLIVAPPKAGKTIMMQNVAQAITRNNPECHLIVLLIDERPEEVTEMQRS
FT                   VRGEVVASTFDEPPSRHVQVAEMVIERAKRLVEHKKDVVILLDSITRLARAYNTVIPSS
FT                   GKVLTGGVDAHALERPKRFFGAARNIEEGGSLSIVATALIDTGSKMDEVIYEEFKGTGN
FT                   LELHLDRKVAEKRVYPAINIRRSGTRREDLLMREDELSRVWILRKLLHDMEDIAATEFL
FT                   VDRLKGFKTNDEFFLSMKSK"
FT   gene            complement(228333..228659)
FT                   /gene="trx"
FT                   /locus_tag="TERTU_0211"
FT   CDS_pept        complement(228333..228659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trx"
FT                   /locus_tag="TERTU_0211"
FT                   /product="thioredoxin"
FT                   /note="identified by similarity to SP:Q9X2T1; match to
FT                   protein family HMM PF00085; match to protein family HMM
FT                   TIGR01068"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12074"
FT                   /db_xref="GOA:C5BLJ0"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLJ0"
FT                   /protein_id="ACR12074.1"
FT                   /translation="MSDAIVHTSDASFEQDVLTADGPVLVDFWAAWCGPCKMIAPVLDE
FT                   LAQEYEGKIKICKMDVDANKETPAKFNIRGIPTLIIFKNGSAEGTKVGALSKAQLKEFI
FT                   DANV"
FT   gene            complement(228759..230894)
FT                   /gene="ppk"
FT                   /locus_tag="TERTU_0212"
FT   CDS_pept        complement(228759..230894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppk"
FT                   /locus_tag="TERTU_0212"
FT                   /product="polyphosphate kinase"
FT                   /EC_number="2.7.4.1"
FT                   /note="identified by match to protein family HMM PF02503"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12121"
FT                   /db_xref="GOA:C5BLJ1"
FT                   /db_xref="InterPro:IPR003414"
FT                   /db_xref="InterPro:IPR024953"
FT                   /db_xref="InterPro:IPR025198"
FT                   /db_xref="InterPro:IPR025200"
FT                   /db_xref="InterPro:IPR036830"
FT                   /db_xref="InterPro:IPR036832"
FT                   /db_xref="InterPro:IPR041108"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLJ1"
FT                   /protein_id="ACR12121.1"
FT                   /translation="MDNKLIEIQSMSDDTAVDTSDTPSLDNPAYYINREISHLAFNRRV
FT                   LKQALDDRHPLLERLKFLLIFSSNLDEFFEIRVAGLMQSIKFERETTGPDGMHPTEVLR
FT                   EISQICHATVDLQYKTLNDVLIPALAEQGIRFLRRKRWTQAQAKWVEEYIEREVLPIVS
FT                   PIGIDPAHPFPRLVNKSLNFIVELEGKDAFGRDLNYAIVPAPRTLPRVIRLPTELGDPG
FT                   QNFIFLSSMIHAHAEKMFPGMQVMGCYQFRITRNADLDVDMEGIADLARALRGELHSRR
FT                   FGTAVRLEVADNCPEELTQFLLREVGLTDQQLYQVNGPVNLKRLMQVPFEVDRPDLQYP
FT                   PFTPSMPKGLNRKDVIFDAVARKDYLLQHPFESFSPVIQLVRQAAKDPQVVAIKQTLYR
FT                   SGGLQSSLVEALIDAARNGKEVTAVVELRARFDEEENLELASRLQEAGAVVVYGVVGYK
FT                   THSKMMLLVRREGGELKRYVHLGTGNYHSGNARLYTDYSLLTADPVLCEDVHRVFQQLT
FT                   GMGKAERMTKLLHAPFTLKRQLLRLIDAEVKAQKEGGEGHIILKCNGLTEPKVIQALYK
FT                   ASQAGVKIDLIIRGMCCLRPGIPGVSDTITVRSIVGRFLEHTRAYYFANSEYKVFCASA
FT                   DLMERNLNHRVETCFPVESPEHSERILKELNLYLKDNLRSWQLQTDGTYSNNRAESEEA
FT                   PMGAQEELLQIYASQGQ"
FT   gene            complement(231020..233365)
FT                   /locus_tag="TERTU_0213"
FT   CDS_pept        complement(231020..233365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0213"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00512; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13529"
FT                   /db_xref="GOA:C5BLJ2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLJ2"
FT                   /protein_id="ACR13529.1"
FT                   /translation="MFNPAAAFRQLSIARKVTVLVMMIGALLVSGIIAERLFFGEKFVG
FT                   GIAETLDDTHQNVAPWLLQSLSRGDKSSAVLLLKDSSHRNPQLAFRLQQQAVEQPGPIF
FT                   DNFAQLRAGGWQRSLEKTYPLATADANYLLKIRGVGPYFNDEFISHLLYNLVVEAILIL
FT                   GLAAIILVMLEQLVFRHLRHIAAQTEKLSIDTIGNPITLERQPSDSESEDELDSVVNAL
FT                   NSMRETILIDIKQQAQIEDALLAAKEEKIETRRMIERVKAANQAKSQFIATMSHEIRTP
FT                   MNGVIGMIEMLRDTPLNDSQKHYLDVIFRSGESLLEIINDILDYSKIEAGKMNLENVDF
FT                   DLNELLNDCVQLFSATTHKRDIEFVCAISPETPTQLRGDPTRLRQIVVNLIGNAFKFTS
FT                   NGHVMVLVKSLQDRTSEHPLLRFSIVDSGIGISKEIQRNLFQAFNQADTSTTRRYGGTG
FT                   LGLAICKQLAELMGGTIGVESEYGKGSTFWFTIRFDLPEDRQRQPPSSSLALSGKRILA
FT                   IHSSPVLVTAFADNCEGYNMKCHHVSKASDALKRLTNQTPDQIYDFLFLDQRIDGEDGF
FT                   ALAQSIREIPAYAETPILMLTHERTTKFTMEQLMPITSILPRPLTAHGLRTALLAQSTG
FT                   VALNELISMESKAIAPAQKLNVLVAEDNAVNRMVIEGLLNKHEIEPVFAEDGQEAVTAF
FT                   ETASPRFDLIFMDCEMPNMDGFEATEKIREYEKNRALTPMPIIALTAHVEAEHRQRVFN
FT                   VGMNYYLTKPVTMDKLREALTSVGVLKD"
FT   gene            complement(233436..234602)
FT                   /locus_tag="TERTU_0214"
FT   CDS_pept        complement(233436..234602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0214"
FT                   /product="putative oxygen-independent coproporphyrinogen
FT                   III oxidase"
FT                   /note="identified by match to protein family HMM PF04055;
FT                   match to protein family HMM PF06969; match to protein
FT                   family HMM TIGR00539"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14611"
FT                   /db_xref="GOA:C5BLJ3"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLJ3"
FT                   /protein_id="ACR14611.1"
FT                   /translation="MTQPAQLALPPLSLYVHIPWCVRKCPYCDFNSHSVRSELPVDAYI
FT                   DALLADCSADRHFAQQRKIRSVFFGGGTPSLLPGKAIARLLDGLRERLDFTRDCEITLE
FT                   TNPGTAEYSNFADYRAAGVNRISLGAQSFNALQLQQLGRIHQPENIQIAFTQARDAGFD
FT                   NINLDLMFALQGQNCADAMRDLEAAIALEPEHISWYQLTIEPNTAFYSNPPSLPDDDTS
FT                   WEIQQAGMQLLADSNYAQYEVSAYARAGKQAAHNINYWEFGDYMAIGAGAHGKITWPEE
FT                   NRIERYQKTRLPDHYLAAAQTCAFTSHRETLAEHNLPFEFMMNALRLNQGVASELFTAR
FT                   TGLPLASLEPQLTPLREKGLLGTDPQRLYTTTLGHQYLNSVLESLLSD"
FT   gene            234700..235983
FT                   /locus_tag="TERTU_0215"
FT   CDS_pept        234700..235983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0215"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14112"
FT                   /db_xref="InterPro:IPR032811"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLJ4"
FT                   /protein_id="ACR14112.1"
FT                   /translation="MFSRFSALLPLSLCTAGVMVASSAQAISYGIYDPRGLAMGGAGVG
FT                   VASFHQAQYYNPALLALNDESENRTRDSRFVFPNLVVQVDDSVEAVIDAADDNLQENLE
FT                   RAVDGYNSSRSAEAAGEVANRARQLETLLVDLGNQQIEGEVVFGLSVSEPSKFEGGAFF
FT                   ISSRSISFADSTIPAADYALLADYINAMDVLAAGGSFADISPALLDGNGNLIDPSDRFN
FT                   SSANITAFNLLEWGVSLSRKFEFFGQSVALGVTPKVLNIYAISDSTDFGDDDLDFDDDE
FT                   QSYLSVNGDVGVLFELFDHYRVGVAAKDLVPEKFTTNSGAELQLKTRSRLGLGYVRERF
FT                   SLGLDMDLSENQPVAAEAPLQEVALGLEVTPLRGLDLRLGYRQDLSGNREDTLSGGLAY
FT                   QIKRLVIELSYGQSDATTSGALQFGWRF"
FT   gene            complement(236012..236623)
FT                   /gene="rdgB"
FT                   /locus_tag="TERTU_0216"
FT   CDS_pept        complement(236012..236623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rdgB"
FT                   /locus_tag="TERTU_0216"
FT                   /product="non-canonical purine NTP pyrophosphatase,
FT                   RdgB/HAM1 family"
FT                   /note="identified by match to protein family HMM PF01725;
FT                   match to protein family HMM TIGR00042"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13938"
FT                   /db_xref="GOA:C5BLJ5"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLJ5"
FT                   /protein_id="ACR13938.1"
FT                   /translation="MNKTVVLASGNPGKLREFQQMLQTCGLDVVPQGNFAVPDIEETGL
FT                   TFVENAILKARNACEHTGHPAIADDSGIEVDALNGAPGIYSARFSNGWQGENASDDRNN
FT                   AYLLERLAGVPDAQRTARYQCVLVYMRHAADPTPLICQASWEGRILTAPQGENGFGYDP
FT                   LFWLDELNCTSAQLPKDEKNRISHRAKAMAMLLAALQNAR"
FT   gene            complement(236672..237109)
FT                   /locus_tag="TERTU_0217"
FT   CDS_pept        complement(236672..237109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0217"
FT                   /product="conserved hypothetical protein"
FT                   /note="possible secreted protein, N-terminal signal
FT                   sequence"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11288"
FT                   /db_xref="InterPro:IPR025218"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLJ6"
FT                   /protein_id="ACR11288.1"
FT                   /translation="MKTMISLLALFALSLSVHADVSSQASHRFGAYELHYSILPSTFIP
FT                   ADVAAAAGIKRSKYESLINVSVTRTGEYGGLPVTLRGTVANLMQQQKPLVFQTIEEQNA
FT                   VYYLAPLRHTGEEQIHITLEATVEGGEPINLKFTTKLYPDN"
FT   gene            complement(237106..237705)
FT                   /gene="metW"
FT                   /locus_tag="TERTU_0218"
FT   CDS_pept        complement(237106..237705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metW"
FT                   /locus_tag="TERTU_0218"
FT                   /product="methionine biosynthesis protein MetW"
FT                   /note="identified by similarity to GB:AAK29459.1; match to
FT                   protein family HMM PF07021; match to protein family HMM
FT                   PF08241; match to protein family HMM TIGR02081"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14143"
FT                   /db_xref="InterPro:IPR010743"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLJ7"
FT                   /protein_id="ACR14143.1"
FT                   /translation="MRIDHKIILDWVEPNSRVLDLGCGDGSLLKNLTASKQIHGYGLEI
FT                   NSENILQCIANGVNVIEQDIDAGLGDYDDQSFDLVIMSQTIQTMMYPERTLEEMLRIGR
FT                   QVIVTFPNFGHWKARVQLALHGRMPVSDLLPYEWYNTPNIHFCTFRDFEHLCNDLKVKT
FT                   LNREVIGGDGMASFFQKLHPNLFAATALYRITKGDL"
FT   gene            complement(237705..238856)
FT                   /gene="metX"
FT                   /locus_tag="TERTU_0219"
FT   CDS_pept        complement(237705..238856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metX"
FT                   /locus_tag="TERTU_0219"
FT                   /product="homoserine O-acetyltransferase"
FT                   /EC_number="2.3.1.31"
FT                   /note="identified by similarity to SP:P45131; match to
FT                   protein family HMM PF00561; match to protein family HMM
FT                   TIGR01392"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11399"
FT                   /db_xref="GOA:C5BLJ8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BLJ8"
FT                   /protein_id="ACR11399.1"
FT                   /translation="MPDSIPANSVGLVTPQLMQFDEPLALACGRTLDSYQLMVETYGTL
FT                   NASRTNALLICHALSGHHHAAGYHSMDERKPGWWDAYIGPGKPLDTNKFFIVSLNNIGG
FT                   CHGSTGPVTPNPSTGQPWGGDFPTLRVRDWVHSQARLADALGIQKWAAVVGGSLGGMQA
FT                   MRWSLEYPDRVGHCVVIASAMKLSAQNIAFNHAAREAILTDPDFHDGNFLSHSTVPKRG
FT                   LSTARVIAHLTYLSDDGMGQKFGRELRSGSFEQGTEEPVEFQIESYLRYQADSFSKVFD
FT                   ANTYVLMTRALDYFDLAREYGDDPVEAFKQAQCKYMVISFTSDWRFSPERSREIVNALI
FT                   RADRDVVYGELESDFGHDAFLIPNQPRYWDLLTSYMSQIEVAD"
FT   gene            complement(238865..239164)
FT                   /locus_tag="TERTU_0220"
FT   CDS_pept        complement(238865..239164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0220"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02594;
FT                   match to protein family HMM TIGR00251"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACR10788"
FT                   /db_xref="InterPro:IPR003746"
FT                   /db_xref="InterPro:IPR005228"
FT                   /db_xref="InterPro:IPR036591"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLJ9"
FT                   /protein_id="ACR10788.1"
FT                   /translation="MPDHYQWHADHLILHCVLQPKASSDAFAGLQADRLKIRITAPPTD
FT                   GKANAHLVKYLARQFGVAKSDIEIVRGQLSRQKTLQINHPKHIPADALVEQPKI"
FT   gene            complement(239227..239814)
FT                   /locus_tag="TERTU_0221"
FT   CDS_pept        complement(239227..239814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0221"
FT                   /product="yggt family protein"
FT                   /note="identified by match to protein family HMM PF02325"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12399"
FT                   /db_xref="GOA:C5BLK0"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLK0"
FT                   /protein_id="ACR12399.1"
FT                   /translation="MNPFIEIGIYVVHTLGSVFLLFVILRFLLQLARADFYNPFSQTVV
FT                   KVTNPVLLPLRKIIPGFFGIDLASLVLALLVQLVIGELSAVIGHHQLVNPGYVLIMGAL
FT                   GTLKMTTYIVYVCLLVLVVTSFIAPYSTHPALVLVRQLMEPLLRPVQKVIPPMGGLDFS
FT                   VLFVFMGVTIIQKLLDATAYSVGVIPGLIIGY"
FT   gene            complement(239888..240721)
FT                   /gene="proC"
FT                   /locus_tag="TERTU_0222"
FT   CDS_pept        complement(239888..240721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="TERTU_0222"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="identified by match to protein family HMM PF01210;
FT                   match to protein family HMM PF02737; match to protein
FT                   family HMM PF03446; match to protein family HMM PF03807;
FT                   match to protein family HMM TIGR00112"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14289"
FT                   /db_xref="GOA:C5BLK1"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLK1"
FT                   /protein_id="ACR14289.1"
FT                   /translation="MTDSQPTVAFIGAGNMAGSIFGGLVANGYNAQRIIASDPKPDALA
FT                   KLQASLNIRTTTDNREALAAADIVVLAVKPQVMKAVCCDLAPHLKPGTLVISIAAGISA
FT                   ASLHTWLGGNQDLALVRCMPNTPSLVQAGASGLFATPSVSDKQKQQAESIMAAVGSVCW
FT                   VNNEEDIHAVTAVSGSGPAYFFLMIEAMTDAGVAQGLNKDTAARLALDTAYGAAKLAVN
FT                   SDVDVVELRRRVTSPNGTTAEAIASFENNNYRVIVANAMQACADRSRQLAEQLAD"
FT   gene            complement(240771..241457)
FT                   /locus_tag="TERTU_0223"
FT   CDS_pept        complement(240771..241457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0223"
FT                   /product="pyridoxal phosphate enzyme, YggS family"
FT                   /note="identified by match to protein family HMM PF01168;
FT                   match to protein family HMM TIGR00044"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14731"
FT                   /db_xref="GOA:C5BLK2"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLK2"
FT                   /protein_id="ACR14731.1"
FT                   /translation="MHKIQDRITQVNIRIKNAASNAGRNPQAITLLAVSKRQPNALIQA
FT                   AYDAGLRDFGENYLQEAVEKIAVLAMPEARWHFIGPIQSNKTRAIAEHFQWVHSVDRLK
FT                   IAQRLSEQRSPALPPLQICLQVNIDNEDTKSGVNVTELETLALAVAELPHLQLRGLMTI
FT                   PATQYTADNSPFVRLQTLFERLKKHPQLANMDTLSMGMSGDMEDAIAAGSTQVRIGTAL
FT                   FGERTH"
FT   gene            241503..242537
FT                   /locus_tag="TERTU_0225"
FT   CDS_pept        241503..242537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0225"
FT                   /product="twitching mobility protein"
FT                   /note="identified by match to protein family HMM PF00437;
FT                   match to protein family HMM TIGR01420"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13629"
FT                   /db_xref="GOA:C5BLK3"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLK3"
FT                   /protein_id="ACR13629.1"
FT                   /translation="MDITELLAFSAKQGASDLHLSAGLPPMIRVDGDVRRINLPPMEHK
FT                   QVHGLIYEIMNDKQRKDYEEFLETDFSFEVPGVARFRVNAFNQNRGAGAVFRTIPSKVL
FT                   TMEELGMGQVFRDVSSVPRGLVLVTGPTGSGKSTTLAAMMDYINENKYHHILTIEDPIE
FT                   FVHESKKCLVNQREVHRDTHGFAEALRSALREDPDIILVGEMRDLETIRLALTAAETGH
FT                   LVFGTLHTTSAAKTIDRVVDVFPANEKAMVRSMLSESLEAVVSQTLMKKNGGGRVAAHE
FT                   IMRGTPAIRNLIREDKVAQMYSAIQTGGAIGMQTMDQCLADLVERRIISREVAREKAKM
FT                   PDAF"
FT   gene            242586..243728
FT                   /locus_tag="TERTU_0226"
FT   CDS_pept        242586..243728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0226"
FT                   /product="twitching mobility protein"
FT                   /note="identified by match to protein family HMM PF00437;
FT                   match to protein family HMM TIGR01420"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13855"
FT                   /db_xref="GOA:C5BLK4"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLK4"
FT                   /protein_id="ACR13855.1"
FT                   /translation="MDFDRLLALMVEKGASDLFITAGVPPSMKLHGKVVPVSSTPLSPE
FT                   KSRETVLSVMNEKQRKEFLETKELNFAISARGIGRFRASAFYQRNLAGMVLRRIETQIP
FT                   KIDDLGLPETIKELAMVKRGLVLFVGATGTGKSTSLAAMIGHRNRNSKGHIISIEDPIE
FT                   FIHQHQGCVITQREVGIDTESFEVALKNTLRQAPDVILIGEVRARETMDHAIAFAETGH
FT                   LCLATLHANNANQALDRIIHFFPADRHSQLWMDLSLNLRAIVAQQLIPTPDGQGRRACL
FT                   EIFLNTPLAQDLIRKGEVHELKELMKKSNEQGMQTFDQALYELYDAGEITYEDALSHAD
FT                   SPNDLRLMIKLGSESDAEYLKNAADELSIQEDDSHRTRKF"
FT   gene            complement(243767..244207)
FT                   /locus_tag="TERTU_0227"
FT   CDS_pept        complement(243767..244207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0227"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03652;
FT                   match to protein family HMM TIGR00250"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14369"
FT                   /db_xref="GOA:C5BLK5"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLK5"
FT                   /protein_id="ACR14369.1"
FT                   /translation="MPEPRSEETILAFDFGTRSIGVAVGQTLTQSASELPTLKAKDGIP
FT                   DWQQLEQLFSDWRPNLVVVGLPVNMDGSEMEMTRRARKFGNRLNGRFNQTVAFFDERLT
FT                   TRAAKEEAAAHGHRGNYRAKPVDSIAARLILEGWMSERASNS"
FT   gene            complement(244200..244778)
FT                   /locus_tag="TERTU_0228"
FT   CDS_pept        complement(244200..244778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0228"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02622"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13001"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLK6"
FT                   /protein_id="ACR13001.1"
FT                   /translation="MTRYLSQDTPESLRDHFLVAMPGLNDPIFSRSVTYVCDHSEQGAM
FT                   GIVINQPLDLKLGDIFEQLAIEHTPQPVDRPVLAGGPVNMQRGFVLHRDTGNWESTLHI
FT                   TAEICLTASRDIVSAMAMDEGPKSAIFALGYAGWSPGQLEGELANNSWLVVPAETGIIF
FT                   DTPVEERWNATAKLLGIDLNLISSEAGHA"
FT   gene            complement(244862..245737)
FT                   /locus_tag="TERTU_0229"
FT   CDS_pept        complement(244862..245737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0229"
FT                   /product="TonB domain protein"
FT                   /note="identified by match to protein family HMM TIGR01352"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13386"
FT                   /db_xref="GOA:C5BLK7"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLK7"
FT                   /protein_id="ACR13386.1"
FT                   /translation="MAAVADGGGSDRLIFGMFLASALHAMLILGVDTGAHNGTKLAPTL
FT                   NITLATHKSNNSPDKADFLAQFNQQASGTADSVKEVTTDKLAEIEDTQVRDVNPLPQRK
FT                   ASTDTPSTAQLLATTRPRDRAITRQDDTAIKSVSDISDGALVDAPLESTEIASLRAKLD
FT                   RERQALANKPRTRRLTSASTKASYDAAYLNDWAFKVESVGNANFPAEALQQAIFGSLRV
FT                   AVLIDRYGKVKRVEILESSGHRLLDDATRQIVRLASPFPPLPEEMLEHADQLEIIRTWR
FT                   FELSGMSTTR"
FT   gene            complement(245743..246702)
FT                   /gene="gshB"
FT                   /locus_tag="TERTU_0230"
FT   CDS_pept        complement(245743..246702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gshB"
FT                   /locus_tag="TERTU_0230"
FT                   /product="glutathione synthase"
FT                   /EC_number="6.3.2.3"
FT                   /note="identified by match to protein family HMM PF02951;
FT                   match to protein family HMM PF02955; match to protein
FT                   family HMM PF08443; match to protein family HMM TIGR01380"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13609"
FT                   /db_xref="GOA:C5BLK8"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLK8"
FT                   /protein_id="ACR13609.1"
FT                   /translation="MSHTLRIGVVMDPISNISFKKDTTLAMLLAAQERGHQLFYMEIQD
FT                   LLLDQGSARANMATLSVANDAANWFTLGEKSLLDLSELDVVLMRKDPPFDNQYIYATYI
FT                   LERAEQQGTLIVNKPQSLRDCNEKVFATQFPQCCPPVTVSRDTRLLREFHQQHDDVIFK
FT                   PLDGMGGSGIFRCRADDPNVSVILETLTDAGASFIMAQKFIPDIRNGDKRVLVVNGEPI
FT                   PYCLARIPAEGETRGNLAAGGSGVAQPLSERDRWIVAQVAPTLKEKGLLFVGLDIIGDY
FT                   LTEINVTSPTCVREIDAAFDTRIAEKLMLAIEGIRNNR"
FT   gene            246949..247344
FT                   /locus_tag="TERTU_0231"
FT   CDS_pept        246949..247344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0231"
FT                   /product="protein PilG"
FT                   /note="identified by match to protein family HMM PF00072"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11960"
FT                   /db_xref="GOA:C5BLK9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLK9"
FT                   /protein_id="ACR11960.1"
FT                   /translation="MDVNLEHLKVMVIDDSKTIRRTAETLLQKVGCTVVTATDGFDALA
FT                   KIADTRPDIIFVDIMMPRLDGYQTCALIKNNSEFKSTPVIMLSSKDGLFDKAKGRIVGS
FT                   DQYLTKPFSKGELIGAIEAHVKVARAS"
FT   gene            247390..247752
FT                   /locus_tag="TERTU_0232"
FT   CDS_pept        247390..247752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0232"
FT                   /product="response regulator receiver domain protein"
FT                   /note="Name was changed to response regulator receiver
FT                   domain from protein PilH; identified by match to protein
FT                   family HMM PF00072"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12335"
FT                   /db_xref="GOA:C5BLL0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLL0"
FT                   /protein_id="ACR12335.1"
FT                   /translation="MAKVLIVDDSPTETYKLTGMLEKNGHSVITATNGEEGVATAKAEL
FT                   PDVILMDIVMPGLNGFQATRQLTKAAETGHIPVIIVTTKDQETDRVWGMRQGAKAYLTK
FT                   PIDEKELFSTMEKVGV"
FT   gene            247797..248336
FT                   /locus_tag="TERTU_0233"
FT   CDS_pept        247797..248336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0233"
FT                   /product="CheW domain protein"
FT                   /note="identified by match to protein family HMM PF01584"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11639"
FT                   /db_xref="GOA:C5BLL1"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLL1"
FT                   /protein_id="ACR11639.1"
FT                   /translation="MSDSAFHVLANLAQRSRTSAAGLPARQDAAPRWSGIGFALLGQKF
FT                   VAPMSHVSELMELPSATRLPGVQPWVIGLSNVRGRLLPLFDLALFFGGSMTSPKKHQRV
FT                   LVLETDSLYSGIVVDRAFGMQHFTSDSYTQVDDGMPESIEGFVEGAYNDMHGEKWPVFS
FT                   MARLAGDNRFTNAALV"
FT   gene            248496..250697
FT                   /locus_tag="TERTU_0234"
FT   CDS_pept        248496..250697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0234"
FT                   /product="putative protein PilJ"
FT                   /note="identified by match to protein family HMM PF00015"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11324"
FT                   /db_xref="GOA:C5BLL2"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029095"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLL2"
FT                   /protein_id="ACR11324.1"
FT                   /translation="MKSDSEGLLARAKTNPVLAILITGLVVLTGLIGLIIYELFSYAQR
FT                   DQQYLQQASDLRASSFRLASLSRDATAGREEAFGDLKEVVSSMERSWSQLQSADPQTRI
FT                   VLAEPLAAFNGVWTRVKQNIQVITENEDTIIFLHDVATTLNESLPELQAEHNNIVEILL
FT                   ENRAPADQVSVAQMQSWRAERIGRNVDKMLRGGEDADRAADQFNLDASLFGKVLEGMKN
FT                   GDVAMSISRVTDPEAISSLEEISELFEFVSGSVREIFEAAPALFRARQATTSVLDDGPL
FT                   ILQTLGALSDAIVQLPSKRSWNNNILLVVGAVWLLFLIGIGYSLIRATNRRAKETAETN
FT                   ERNQNAILRLLDELADLADGDLTTTATVTEDFTGAIADSINYTIDQLRVLVSRINETSE
FT                   RVVDGSKDTQQTALHLAEASEHQAQEIAGASAAVNEMAVTIDQVSANAAESAGVAERSV
FT                   SIANNGAKVVQNTIRGMDTIREQIQDTSKRIKRLGESSQEIGDIVSLINDIADQTNILA
FT                   LNAAIQASMAGDAGRGFAVVADEVQRLAERSATATKQIESLVKTIQNDTNEAVISMEQT
FT                   TAEVVRGARLAQDAGVALEEIEAVSASLAELIQNISNAARQQASSAGHISNTMNVIQEI
FT                   TSQTSAGTNATAAAIGNLSDLAVELRGSVSGFKLPDEMTEASGDDDDDYDMAMEDGADM
FT                   DVDDLDEEVVDLSLDDALDDDDPTLLHPLEEEDDENARV"
FT   gene            250715..251572
FT                   /gene="cheR_1"
FT                   /locus_tag="TERTU_0235"
FT   CDS_pept        250715..251572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheR_1"
FT                   /locus_tag="TERTU_0235"
FT                   /product="chemotaxis protein methyltransferase"
FT                   /EC_number="2.1.1.80"
FT                   /note="identified by match to protein family HMM PF01739"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11004"
FT                   /db_xref="GOA:C5BLL3"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036804"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLL3"
FT                   /protein_id="ACR11004.1"
FT                   /translation="MIWSLQAAPDLTDKQFAQWSKLLEDRAGICLSDQQRVFLQTQVTM
FT                   RMRELGQTDYSQYYNRVVDGVSGMIEWAVLIDRLVVKETSFFRHRPSIDFVRGYLQNQI
FT                   NNKTLKGSFDIWSVGCSSGEEPYTLSMVLNDCFSLAQLDPYYGVIATDISRAALGIARS
FT                   GVYPQRKVEMLEPHVRQRYFKQLENGRYQIDPELKQRVCFNHANVLNINEMPGIDQNVI
FT                   FCQNLLIYFRRWLRHEIMNAFVDHLKPGGVLVVGLGEVVDWSHPDMVRAPVDDVQAYIR
FT                   KAAV"
FT   gene            251608..258459
FT                   /locus_tag="TERTU_0236"
FT   CDS_pept        251608..258459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0236"
FT                   /product="putative CheA signal transduction histidine
FT                   kinase"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF01584; match to protein
FT                   family HMM PF01627; match to protein family HMM PF02518;
FT                   match to protein family HMM PF02895"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14381"
FT                   /db_xref="GOA:C5BLL4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLL4"
FT                   /protein_id="ACR14381.1"
FT                   /translation="MSDKRNFAALDWVIEEIDETLKEARQALESFVEDSKDATKMRFCL
FT                   TYIHQVHGSLQMVEFHGASLLAEEMEHLAQALMDNKVTSVPEAQEVLMRSLLQLPTYLD
FT                   HVKAHKEDNPGLVLPLLNDLRAVRNQSYLSETNLFSPDLSLTASVSGQRHPITTDKSKL
FT                   QQVLKKLREMYQFAAASVLRGIKVDENLGYLDKVFSRLEALTSGTQCHPIWEVSAALIE
FT                   GLLRDDIELSVAVRGLLRHLARELRLMGEKAPGSLDATPRESLLKNLLYYVARAEDGGK
FT                   KINRVKARYNLKNALLAGVTIGDSNDKNSLSAPDPDAIRSVVVALNEEINSIKHVLDTC
FT                   LTGQGQPEDLREVLPVVKRVADTLAILGIGDLRKHINQQIDVLTELSGLNTVDEARLLD
FT                   VAGKIIEIEHRLEAIAKVVGTNRDLASVNEREIEIDQAKVTVIKECQHGLEQAKDAIVE
FT                   YISSKWDKSHLLNVGSLLHDIRGGLEIIPLPRPAAILDRCAAYIQAELIERDEQPGWNS
FT                   LDTLADAIASVEYYLERRLDDMDGDPSSLLDVAEESMASLGYPLLAATSAAETPAPDQS
FT                   EVPTAAVNDAPAAEPEQQPQPGVSLDAITVDDDEPEIESDIDDEIIEIFIEEAGEVRET
FT                   LDEYFPKWRANFQDQDSLVVVRRAFHTLKGSGRMVEAYDIGELAWSIENMLNRVIDNTV
FT                   NVGPAHGHMIELVLHVLPVLVTAFERRKRNPQKALCEQYMAWAESLAAGDTPAELASVP
FT                   DGGHPQLPDLTAPPKKVVAAEQQQEPAAAEPETQADISGDEDDSDNENLVLWEIFSSEA
FT                   HSHLATMNAFIAKMEADAPLYSPPSDDFQRALHTLKGSAKMAQVTPIAAMAEPLEAFAK
FT                   ELISYQVDINEDILQLYRDAVSYTAQALTQLEAGENLEIRQLDQFVARTAELRELAVGH
FT                   LIRLKDQEKEGQQQVDPRLLSIFMAEEMNLLLDADQLIADWQEKGGAFEHGASVVSELS
FT                   TLGTGARQANLPDMAGLAAQLCQLYKQADAGHQLLNEDFFTILSAGHNTLLDMVDAVAA
FT                   GQNVSSPSEEITSALASLIHHGEESAALSTPVVEPYTASDTGAEALFDEPVEEPNSAAV
FT                   DEPSIDESGESAAEEDLVIRIEAPAENVLTADFSSPFSDEELNDDDHEPLGDEHQITLS
FT                   DDEQPPVLDAPFEGDLLPDADTYTVDELPTLTVDESIPSFELDANPTDSEVEPGFEADT
FT                   PAESLIEQPGSDDFSGDDGVIEIDTSDALSSEAISVDEITLEEPLGSDPGSASFVGEDL
FT                   GTNDFGVEVIGTSDDLPPQNDVSELAPAEFGQDLSADATVLSSEAGLTTTPASPEDSAP
FT                   GEDYVPSENFVPGENFVPGENFVPGEHYASDEEGSADGAPVSLEAIDNGISEVADMGEQ
FT                   LLADLDSPDIVEPPSVENFEIEAEAPQEIAQPGQESETVHSAQVEDAVQPAAGATVAGL
FT                   LDTIDVNDEDFDQDILDIFLEEADELIEQLDEAVHAWEGDWSDLSQAEEIKRVLHTLKG
FT                   GARLAGMTNLGELTHNYESFLIGSKLQEVDEPFFRTMHSYQDQVLSGVRAIQAFVAGDL
FT                   DSAQASADVPAEVTAEVTAEVQPGDASVSGAEVEEIPPVADAAPLQTVTPAAESNVVPF
FT                   APKPKAPDVGEFTMPSPAATPGGQAIARKPSGPQEVIKVSAELLEELVNLAGETSINRA
FT                   RIEQQVSDFSNSLDDIDSTLFRLQEQLRRLDIETEAQVLFRQEQMAAHEDFDPLEMDRY
FT                   SHLQQLSRSLIESASDLIDLRETLTDNIRDTETLLLQQSRINTTLQEGLMRSRMVPFSR
FT                   LVPRLRRIVRQVSSELGKSVSFELDNVEGELDRSVLERMVPPLEHMLRNAVDHGIEAPD
FT                   DRLGAGKSETGRIVLTLGREGGDVIIRLADDGRGIDLRRVREKAIERGLMSADAGLSDF
FT                   DVMQFILHAGFSTAEKVTQISGRGVGLDVVTSEIKALGGSVTIDSAWGKGTEFIVRLPF
FT                   TVSVNRALMVEIGQDTYAIPLNTIEGIVRVSPFELEHYYTTEDARFEYAGENYQVRYLG
FT                   SMLSNDILPQLDGHALPLPVLLVRSADNAMAVQVDNLLGSREVVVKSLGVQFSAVQGLS
FT                   GATLMGDGSVVVILDPHALMRKEIANAKVIEMRLRDALPPVEAPVDTTKTVMVVDDSVT
FT                   VRKVTTRFLEREGFNVITAKDGVDALRVLQDDDIPDLMLLDIEMPRMDGFEVAKNIRSS
FT                   SRLRHLPIIMITSRTGDKHRERAMSLGVNKYLGKPYQEELLLSSIAELLEEAKAR"
FT   gene            258464..259399
FT                   /locus_tag="TERTU_0237"
FT   CDS_pept        258464..259399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0237"
FT                   /product="protein-glutamate methylesterase CheB"
FT                   /note="identified by match to protein family HMM PF01339"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14039"
FT                   /db_xref="GOA:C5BLL5"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLL5"
FT                   /protein_id="ACR14039.1"
FT                   /translation="MAAETLTFGVLADSQAQLNDLVSLVEATGHRVAIAKMASVRNLLA
FT                   ELPAVDAWVVRLNLQQDSALAIVEHLESSDCPVIYDDMECYGNLGGHDRAKRFAAKLQL
FT                   CTGVAKPEEGAKAQEVWVLAASTGGPEAVTRFLKALSPELEGVAFVYAQHINAEISLSL
FT                   QKALLLSTQWSVVTCERSRVLREKSIYVVPPDNQVDIYDSGVIAPNSLAWLGPYRPSAD
FT                   QVMARLARHYGNRAGAIVFSGMGDDGSKSCSYMRRSGGMVWAQSPGTCAVDSMPVSAIA
FT                   TGAVSYQGSPENLARQFVYRRQIPPKAINN"
FT   gene            259440..259925
FT                   /locus_tag="TERTU_0238"
FT   CDS_pept        259440..259925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0238"
FT                   /product="CheW domain protein"
FT                   /note="identified by match to protein family HMM PF01584"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11807"
FT                   /db_xref="GOA:C5BLL6"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLL6"
FT                   /protein_id="ACR11807.1"
FT                   /translation="MSGDETLPADPADNIACLLVPVLGATLLIPSVTVAEMAPMQPVQS
FT                   VPNSPQWMLGKYEWRNAYVPVVVFEAINGGKLTPLNPQGRMAVLNNTGVDSRLPFIAIP
FT                   TQGIPRMVRIGEADIVENTLGMKSPFVDMAVKVGMEELVIPNVTALEQAYVDTGLLD"
FT   gene            complement(260003..260875)
FT                   /gene="hslO"
FT                   /gene_synonym="hsp33"
FT                   /locus_tag="TERTU_0239"
FT   CDS_pept        complement(260003..260875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslO"
FT                   /gene_synonym="hsp33"
FT                   /locus_tag="TERTU_0239"
FT                   /product="HSP33 chaperonin HslO"
FT                   /note="identified by match to protein family HMM PF01430"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12246"
FT                   /db_xref="GOA:C5BLL7"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="InterPro:IPR023212"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BLL7"
FT                   /protein_id="ACR12246.1"
FT                   /translation="MTDATHRFVFENTDIRGNLATLSGSYRAIVSNQSLPVSLQPLLGE
FT                   FVAAVALLSETLKYDGILTLQVRGNGPVPLIVADCTNDGDLRGIIELGEHQPLPDYSGL
FT                   TLPELIGDGVLSLTVDPEHGQRYQGLVPLEGDTLADCLALYFAQSEQLPTKLWLFADQN
FT                   HCGGLMLQGLPAQQVTDLDQRKEQWQTAVQLANTVTPDELFSLPANDLLYRLFNELGCR
FT                   LFAAREFRFHCSCNRARGENAISSLGKEEAFALLAEQNGKIAVDCHFCGQHYAFKEEDL
FT                   QRLFSGSMH"
FT   gene            complement(260877..261269)
FT                   /locus_tag="TERTU_0240"
FT   CDS_pept        complement(260877..261269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0240"
FT                   /product="putative ribosome-associated heat shock protein
FT                   15"
FT                   /note="identified by match to protein family HMM PF01479"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13205"
FT                   /db_xref="GOA:C5BLL8"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025708"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLL8"
FT                   /protein_id="ACR13205.1"
FT                   /translation="MEKVRIDKWLWAARFFKTRSLAKQAIDGGKVHVQGHRVKPSKDLE
FT                   LGMTLSIRQGWDEKVVEVTALSDQRRGAPEAAQLYRETEASIAARELKAAQRKAMGSAD
FT                   LRTASKPTTKQRRQIHRFKRITLEDD"
FT   gene            complement(261274..261927)
FT                   /locus_tag="TERTU_0241"
FT   CDS_pept        complement(261274..261927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0241"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01509"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13674"
FT                   /db_xref="GOA:C5BLL9"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLL9"
FT                   /protein_id="ACR13674.1"
FT                   /translation="MIDWQKIDTVLLDMDGTLLDLHFDNYFWLTHLPLRYAEIKGVSEA
FT                   EATALLMHHIRQHEGTLQWYCLDHWSALLELDIPLLKRELLHKIQLRPYVEDFLRALRG
FT                   QRKKVMLITNAHPKGLELKLSVTAIDQWLDLVVSSHEYFHPKESEAFWQKLQAEENFDP
FT                   KTTLFIDDTPRVLASAENFGIAHLVHICAPDSQREPARSHRYIDINHFDEIMPH"
FT   gene            261966..262508
FT                   /locus_tag="TERTU_0242"
FT   CDS_pept        261966..262508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0242"
FT                   /product="nudix hydroxylase"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13473"
FT                   /db_xref="GOA:C5BLM0"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLM0"
FT                   /protein_id="ACR13473.1"
FT                   /translation="MPRKPEILNCQEVARSRLFRVESVDLRFSNGEERVYERLAARGSA
FT                   AVLIVPMLDDKTVLLIREYGVGVEDYELGLPKGRVEAGEDPLEAANRELMEEVGYGAKS
FT                   LTKLKLLSQSPNYMQHHTQVVLAQGLYPQTAEGDEPEPLIVEQYPLADLDQLVLRDDFT
FT                   EARSLAALFLARAHLSR"
FT   gene            262529..263353
FT                   /gene="cysQ_1"
FT                   /locus_tag="TERTU_0243"
FT   CDS_pept        262529..263353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysQ_1"
FT                   /locus_tag="TERTU_0243"
FT                   /product="3'(2'),5'-bisphosphate nucleotidase"
FT                   /EC_number="3.1.3.7"
FT                   /note="identified by match to protein family HMM PF00459;
FT                   match to protein family HMM TIGR01331"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13975"
FT                   /db_xref="GOA:C5BLM1"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006240"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLM1"
FT                   /protein_id="ACR13975.1"
FT                   /translation="MNDSALLEPVIAASEQAGAAIAAIFRDFKQQNVERKADDSPVTAA
FT                   DLAAHRILVQALSGLTPHIPVLSEESVLPSFAQRQTWQRYWLVDPLDGTQEFIDGGSEF
FT                   TVNVALIDNHRPVLGVVHAPMLDLTYCAAVGVGAWKRHHGNHRAIRTRSLAARLARGDA
FT                   LELVCSRRHGVEEIETLAAELEQKLGLVVTKSVGSSLKFCLVAEGEADVYPRLAPCCEW
FT                   DTAASQAIVEAAGGAIVDMQFQPLAYNRTEGLLNDHFFAFGDPAFEWQSYLP"
FT   gene            263568..263783
FT                   /locus_tag="TERTU_0244"
FT   CDS_pept        263568..263783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0244"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12039"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLM2"
FT                   /protein_id="ACR12039.1"
FT                   /translation="MNRAHQMQQLSVAYNNTSVMRQQLIREITCLERQLERLRLRDEML
FT                   DFATLQTYEEMISSRKELLDSLPWGN"
FT   gene            complement(263864..266749)
FT                   /gene="cyaA"
FT                   /locus_tag="TERTU_0245"
FT   CDS_pept        complement(263864..266749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyaA"
FT                   /locus_tag="TERTU_0245"
FT                   /product="adenylate cyclase, class I"
FT                   /EC_number="4.6.1.1"
FT                   /note="identified by match to protein family HMM PF01295"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12528"
FT                   /db_xref="GOA:C5BLM3"
FT                   /db_xref="InterPro:IPR000274"
FT                   /db_xref="InterPro:IPR024685"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLM3"
FT                   /protein_id="ACR12528.1"
FT                   /translation="MKPIFPKPESIHDGLDRQNLTKIRKRFLAINQDRLTRMRDALTVR
FT                   QQLVLDAIPLLFHTNHPMMPGFESRDTPAGVCHFKITKGAVQLGRGIARSFTASQDAVH
FT                   EPQITAIFVMGSVGTIAQSESSDLDFWLCFKPGLTREQLELLNRKCEKITQWALQCRLE
FT                   VHFFLMDNAAFKRGQLSALNEESSGSAQRLLLLDEFYRTAIHLAGRTPIWWFVPPGNEH
FT                   EYDEYTDILQQRRFLNSEDVLDFGGIPTIPDSEFLGASRWQLYKGIESPYKSVLKLLLL
FT                   ESYADQYPNIQPLSLVFKEMVYAGEHDIDQLDSYVMIYRHIERYLQEKNAVRRLELARR
FT                   CFYFKVNYPLTRSNPNRDKTWQHRLLESLTEEWGWQRKDLLKLDQRNQWKAPAVHEERS
FT                   LLKNELSHGFQVLKLFAERYSVEHDISAEEWSILGRKLQAAFETRPGKITWINPGISSD
FT                   LTEQLVTFAQSAVERPGNIWSALIHPDGTLTQNPIHIKTSASLVELYLWCYCNQIVNLT
FT                   TRYELQQAPHIEERTLHRLLKVFANWLPLPLKSLDHNVFKRSAEPVDALFLLNVGSVAQ
FT                   AGLEQRGIKRLSSQTDALHYSGFGENLIISVDLVLRNSWNELTTRRFDSSTALLDSLQD
FT                   YLKLSLPGSHHRPPKLQVECVSPNHANTIATRTRDWLNEIIHCYYGGEYMSATRYVFEM
FT                   AGLFHILQFKGPRLITRQYPSLDAVLDALGDAQPSISPIYLDSHALVRHPLKAMCRAIS
FT                   SEGGGRSWAGAIHIFFQRAQDHTDVYVVDEHGSLVHRFYRNSQAVFVLKTLHYFFRSVI
FT                   DRQTQLNQQLLHDFGIFPIHFYELKRDSRQCYVSEPKRVANESVVPVELELRAIGYDRG
FT                   DQKLRFNFYCGDQFFSCDELEEQIYLVVAQQVLSRRKSREDYPLYLTDLDLTKCAHLIA
FT                   PDARLTTSHYMKVKNRLETTLNRAIGILVKR"
FT   gene            complement(266846..267334)
FT                   /gene="coaD"
FT                   /locus_tag="TERTU_0246"
FT   CDS_pept        complement(266846..267334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaD"
FT                   /locus_tag="TERTU_0246"
FT                   /product="pantetheine-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /note="identified by similarity to SP:P0A6I6; match to
FT                   protein family HMM PF01467; match to protein family HMM
FT                   TIGR00125; match to protein family HMM TIGR01510"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13672"
FT                   /db_xref="GOA:C5BLM4"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BLM4"
FT                   /protein_id="ACR13672.1"
FT                   /translation="MKRVVYPGTFDPITNGHIDLVQRASKLFDSVVIAVAASNRKGPLF
FT                   TLEERVSLAQKALSHLSNIEVCGFDCLLKDLVEEKQAYGVVRGLRAVSDFEYEFQLANM
FT                   NRALAPSMESLFLTPAEHLSYISSSLVKEIASLGGDVSKFVPKLVQSALTDKYNELKA"
FT   gene            complement(267446..268021)
FT                   /gene="rsmD"
FT                   /locus_tag="TERTU_0247"
FT   CDS_pept        complement(267446..268021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsmD"
FT                   /locus_tag="TERTU_0247"
FT                   /product="16S rRNA m2G966 methyltransferase"
FT                   /note="identified by match to protein family HMM PF03602;
FT                   match to protein family HMM TIGR00095"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13223"
FT                   /db_xref="GOA:C5BLM5"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLM5"
FT                   /protein_id="ACR13223.1"
FT                   /translation="MQRQSKNSQKSSLRIIGGQWRGRKLSIADAEGLRPTGDRVRETLF
FT                   NWLAPWLPGARCLDLFAGTGALGLEALSRGAAHTTFIETNPHAAATLCEHLNTLDCKQA
FT                   DVLRNDGIAWLNSAAHTPYDIIFVDPPFAKDLWEQALTSIERCAVASAQALVYIETPVD
FT                   HALNTPPNWQPLKSKTAGKVRFGLWQVA"
FT   gene            268082..269086
FT                   /gene="ftsY"
FT                   /locus_tag="TERTU_0248"
FT   CDS_pept        268082..269086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsY"
FT                   /locus_tag="TERTU_0248"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /note="identified by match to protein family HMM PF00448;
FT                   match to protein family HMM PF02881; match to protein
FT                   family HMM TIGR00064"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACS93531"
FT                   /db_xref="GOA:C6AQY9"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:C6AQY9"
FT                   /protein_id="ACS93531.1"
FT                   /translation="MFFKSKKSKSESPESEAVAQPAEKPTEKVSFFTRIKQGLSRTSNQ
FT                   LSGGLASLLLGKKAIDDELLEEIETLLLMADVGVEATTDIIDDLTARVARKQLADSDAL
FT                   YAALRQSLADLLLDVEAPLDVECAQKPFVILVVGVNGVGKTTTIGKLAKRFQNQGKSVM
FT                   LAAGDTFRAAAVEQLQVWGERNKVPVVAQHTGADSASVIYDAVQSAQARQIDVVIADTA
FT                   GRLHNKSNLMEELAKVKRVMAKLDDSAPHEVLLVLDAGTGQNALSQAGHFKEAAGVTGL
FT                   ALTKLDGTAKGGIIFALSKQYGLPVRYIGVGEGIDDLQPFQATSFIDALFGTE"
FT   gene            269109..269786
FT                   /gene="ftsE"
FT                   /locus_tag="TERTU_0249"
FT   CDS_pept        269109..269786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsE"
FT                   /locus_tag="TERTU_0249"
FT                   /product="cell division ATP-binding protein FtsE"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM TIGR02673"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11205"
FT                   /db_xref="GOA:C5BLM6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLM6"
FT                   /protein_id="ACR11205.1"
FT                   /translation="MISFSNVSKRYASGQQALANLSFDVNAGEMVFLTGHSGAGKSTLM
FT                   KLVMLMERASTGQVVIAGRNLNRMRTGQIPYHRRQVGVVFQNHQLLFDRTVFENVALPL
FT                   YIAGHQSREVGRRVRAALDKVGLLEKEKHNPITLSGGEQQRVGIARAVVNKPPLLLADE
FT                   PTGNLDPKLSEEIMTLFRQFNAFGVTVLIASHDLALVRQLGHRVLTLAGGELVHDGLLP
FT                   EDM"
FT   gene            269788..270762
FT                   /locus_tag="TERTU_0250"
FT   CDS_pept        269788..270762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0250"
FT                   /product="putative cell division protein FtsX"
FT                   /note="identified by match to protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACR10792"
FT                   /db_xref="GOA:C5BLM7"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLM7"
FT                   /protein_id="ACR10792.1"
FT                   /translation="MARSEIPQGAVQSKSRVRDRLGAWGSQHRASFGGSLSRLLSTPIQ
FT                   TLMTALVVAIALALPATLLVALGNIQQLGDSWDASPKISVYIKLRARDAAITQLIDSLE
FT                   QRSQVSSVRYLTPDQVLADFQRMSGFGEALDSLDDNPLPATLIVSPTQQGSAPQALAAL
FT                   ADEIALSPIVDEVSMDMEWVRRLRELMILGKKIVAALAGLLGLGVLLAIGNTIRLAIEN
FT                   RREEIVVAKLVGGTNSFVRRPFIYSGGWYGFMGGILACIIVSLGYWVLEGTVARLATLY
FT                   QSDFELSGLGFAGNVQLLLTGIVLGWLGAWLAVGRHLATIEPK"
FT   gene            270930..271784
FT                   /gene="rpoH"
FT                   /locus_tag="TERTU_0251"
FT   CDS_pept        270930..271784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoH"
FT                   /locus_tag="TERTU_0251"
FT                   /product="alternative sigma factor RpoH"
FT                   /note="identified by match to protein family HMM PF04542;
FT                   match to protein family HMM PF04545; match to protein
FT                   family HMM TIGR02392; match to protein family HMM
FT                   TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14512"
FT                   /db_xref="GOA:C5BLM8"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLM8"
FT                   /protein_id="ACR14512.1"
FT                   /translation="MGKSLQALDVLAPGQNLNAYMQAVNNFAVLSAEEEKQLAEDLYYR
FT                   QDLDAARRLVMAHLRFVVHIAKSYAGYGLAQGDLIQEGNVGLMKAVKRFNPEKGVRLVS
FT                   FAVHWIKAEIHEFILRNWRIVKVATTKAQRKLFFNLRGQKKRLAWLTNDEANAVAQDLN
FT                   VDVKNVREMESRLSAYDAAFDAGADDDDETAYQAPANYLEDRRYDPSTMLENADWTENS
FT                   VAGLERAMDQLDDRSRDILQQRWLSDSKATLHELADKYGVSAERIRQLEKNAMKKMRVA
FT                   MEA"
FT   gene            271765..272235
FT                   /locus_tag="TERTU_0252"
FT   CDS_pept        271765..272235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0252"
FT                   /product="conserved hypothetical protein"
FT                   /note="possible membrane protein, similar to Bacillus YwdK;
FT                   identified by match to protein family HMM PF04241"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13896"
FT                   /db_xref="GOA:C5BLM9"
FT                   /db_xref="InterPro:IPR006696"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLM9"
FT                   /protein_id="ACR13896.1"
FT                   /translation="MWRWKLSYRQRKLIRESRSYLRLFYFVEKIMLDGGRIFLAIGAGF
FT                   GALAVVLGAFGAHALKSILAEHPMSIWQTAVQYQFYHALALVAVGVLISQGFALKVLYA
FT                   SGWLFAIGVVLFSGSLYGLALGGPRLLGPVTPLGGIAFIAAWICLLFAVVKP"
FT   gene            272269..272958
FT                   /gene="trmB"
FT                   /locus_tag="TERTU_0253"
FT   CDS_pept        272269..272958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmB"
FT                   /locus_tag="TERTU_0253"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /note="identified by match to protein family HMM PF02390;
FT                   match to protein family HMM TIGR00091"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14228"
FT                   /db_xref="GOA:C5BLN0"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLN0"
FT                   /protein_id="ACR14228.1"
FT                   /translation="MKPEFKEKPIRSFVIRGGRMTEGQRNAFDTWWPKYGLSMFDGPLD
FT                   PLAVFGRVAPLVVEVGFGMGDSLLHMALAEPEKDFVGIEVHPPGVGRLIHLAGKEGVEN
FT                   LRVYMADAQDVLTDCIPTGAVDRFQLYFPDPWHKKKHHKRRILQAAFADKVHGLLRTGG
FT                   HFHMATDWENYADYMMEVMSLQQGYSNTAGEYCFAPKPDYRPNTKFEARGERLGHGVWD
FT                   LVFEKRD"
FT   gene            273389..273955
FT                   /locus_tag="TERTU_0255"
FT   CDS_pept        273389..273955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0255"
FT                   /product="conserved hypothetical protein TIGR02444"
FT                   /note="identified by match to protein family HMM PF09523;
FT                   match to protein family HMM TIGR02444"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12532"
FT                   /db_xref="InterPro:IPR012659"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLN1"
FT                   /protein_id="ACR12532.1"
FT                   /translation="MTEPATSAAWRTTLWDYATKVYAYKEVERALLNLQDNYYANVNIL
FT                   LWLCWLEEEAIVLERSLLDDVLITVDTVNQATLIKLRESRRFIKSAGSFTDVQVKLITK
FT                   QLLNAELMIEKILIHRLQDITRKNLGGDGGAEPLTVTYYLDFLGIPDARAIARSVRSVC
FT                   RSAQSQGVHSQIYQRSHPAPPKTSN"
FT   gene            complement(274013..275053)
FT                   /locus_tag="TERTU_0256"
FT   CDS_pept        complement(274013..275053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0256"
FT                   /product="putative CheA signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12052"
FT                   /db_xref="GOA:C5BLN2"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLN2"
FT                   /protein_id="ACR12052.1"
FT                   /translation="MAAKKKSVDSVVDLQKQIDALTDKLDKTRAQNVAQADKAVKSATA
FT                   ALSKAKTKLSSLQTKAKSAAAVKRKTAATEKKIATAKAAVAEQKDAVAELQQSLAAAKA
FT                   EYASVKQAATQAAVLAKIAANVMKASAKKTPAKKKATRKTAAKKAETETAPVEKAATKK
FT                   APAKKTTAKKAAPKKAAPKKAVAKKAPAKKAAAKKAPEAVAEPTAEPTAEPAAPKKAPA
FT                   KKAAAKKAPAKKAPAKKAAAKKAPAKMEAETKPTAAEPEKSTATPAPSEPEVSKAPEVV
FT                   ADTPAPAADKAPTETPKSEPVPAPVSLPVEPEPAAAKTEDEPTKDTDEDKPATANPTGS
FT                   LFGDNI"
FT   gene            275449..276210
FT                   /gene="mip"
FT                   /locus_tag="TERTU_0257"
FT   CDS_pept        275449..276210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mip"
FT                   /locus_tag="TERTU_0257"
FT                   /product="peptidyl-prolyl cis-trans isomerase, FKBP-type"
FT                   /EC_number="5.2.1.8"
FT                   /note="identified by match to protein family HMM PF00254;
FT                   match to protein family HMM PF01346"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13413"
FT                   /db_xref="GOA:C5BLN3"
FT                   /db_xref="InterPro:IPR000774"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR036944"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLN3"
FT                   /protein_id="ACR13413.1"
FT                   /translation="MTKTQFLAVAATTLILAGCKEAAQPEKEVKVETLPEKVSYLLGFN
FT                   MASQAKQNDFEINPDVMALAIQEVNAGGEPRFSDEEMQATMRAFQTEQNAKRQEKVNTL
FT                   IEKNSAAATAFLEENAKKEGVVQTESGLQYKILEKGDGPIPTAKDMVLAHYRGTTLDGK
FT                   EFDSSYKRGEPATFPVSGLIPGWVEALQIMPVGSKWELYIPGDLAYGPGGKMNPATREY
FT                   DIEPNALLIFELELLDINPEEKAAAEEKAAE"
FT   gene            complement(276287..277312)
FT                   /locus_tag="TERTU_0258"
FT   CDS_pept        complement(276287..277312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0258"
FT                   /product="WD40 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12975"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLN4"
FT                   /protein_id="ACR12975.1"
FT                   /translation="MPAPLSPVTSNRASTLALLFFCSLLCACNGAQSPSESLEVATVGL
FT                   HAGTLDATGTRAVVGSLYQGGSFWQLDSRARKFNWNHNRDEFTTIIHTAFASNSDYALT
FT                   ADASALVLWNTRTGEALRYWSAPGEILDAALGPMGNIALLGLSDHTAVLFDIQRGGILY
FT                   RLPSDNRVRSVDLSRNGRMAITGSEDATATLWDTSTGKPLRKIKHNDDVQLVRLSPDGN
FT                   LALSVSKYDKALIWQTRDGKALGELPLNAEHLKRGMMFSAARFSDDNTKLLTGRPDQMV
FT                   QLWRLPNLVEVERWRLPKRKRWKPGGAAVLDVSFDAQVARFHAIASNGFIHTLASAPTA
FT                   P"
FT   gene            complement(277404..277868)
FT                   /locus_tag="TERTU_0259"
FT   CDS_pept        complement(277404..277868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0259"
FT                   /product="transcriptional regulator AlgQ"
FT                   /note="identified by match to protein family HMM PF04353"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13986"
FT                   /db_xref="GOA:C5BLN5"
FT                   /db_xref="InterPro:IPR007448"
FT                   /db_xref="InterPro:IPR038309"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLN5"
FT                   /protein_id="ACR13986.1"
FT                   /translation="MLENCKTAQERWGGVSEIIDKWLKNRQQLLVLYCNLSEIVDQHSS
FT                   DDIGQALRGLCQVMVDYVSAGHFEVYDQLVQEGRAFNDKDALTEAKALFESVDTTTETV
FT                   LDFNDKYQEIDDLESLPGDLSQLGETLASRFEAEDRAIEVLHLAHKDHVA"
FT   gene            278068..278487
FT                   /gene="fliL_1"
FT                   /locus_tag="TERTU_0260"
FT   CDS_pept        278068..278487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliL_1"
FT                   /locus_tag="TERTU_0260"
FT                   /product="flagellar basal body-associated protein FliL"
FT                   /note="identified by match to protein family HMM PF03748"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11177"
FT                   /db_xref="GOA:C5BLN6"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLN6"
FT                   /protein_id="ACR11177.1"
FT                   /translation="MLPCLSWAQDDGEEAAEEPAAAEEGEEGVPSSSAIYLPIKPAFVV
FT                   NFGGPGKLRYIKAEVSVRVDSSDAANSVRHHLPYIRNNLVMLFASQTEDTVDSQAGKEA
FT                   LRQDALAEVRKILFEEDGLETGVVDIFFNTLIVQR"
FT   gene            complement(278526..280136)
FT                   /gene="gshA"
FT                   /locus_tag="TERTU_0261"
FT   CDS_pept        complement(278526..280136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gshA"
FT                   /locus_tag="TERTU_0261"
FT                   /product="glutamate--cysteine ligase"
FT                   /EC_number="6.3.2.2"
FT                   /note="identified by match to protein family HMM PF04262;
FT                   match to protein family HMM TIGR01434"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACR10713"
FT                   /db_xref="GOA:C5BLN7"
FT                   /db_xref="InterPro:IPR006334"
FT                   /db_xref="InterPro:IPR007370"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLN7"
FT                   /protein_id="ACR10713.1"
FT                   /translation="MFNIENIPPELAEKDNAALLTGILRGAERESLRVDSNGTLAFTPH
FT                   PQGLGSALAHPEITTDFSEALMEFITPPTHSTCDLINHLHLLQNFTAHQLPENELLWSH
FT                   SMPCALGPDSEIPVAQYGSSNNGQMKTVYRVGLGHRYGRSMQTVAGVHYNFSLPNAFWA
FT                   FLLRRENLLMDLQQFKNHAYFGLIRNFRRHYWLLIYLFGASPALCRSFVAGRNHHLQPV
FT                   AELEHTLHLPYATSLRMGDLGYQSSAQESLYVCYNQQKSYIETLCSAITTPHIAYETIG
FT                   VKDTAGEYRQLNTGLLQIENEFYSSIRPKRTAKPGETALMALANRGVEYIEVRCLDANP
FT                   SSPEGITEEQIRFLDTFLLYCALQKSPDTNREETEMILANQKAVVDRGREPGLMLARPG
FT                   GSLPMSSWASGLLAAMGPVAELLDNAHETTRYSASLQQQKAKVDNPDLTPSAQLLNTLK
FT                   STRTEYARFALQQSKANHTQLLDSPLSGDVYDRMVEMAANSVLEQHNLEEKSRQSGLDF
FT                   DEFLKRYYSQYRMCCGAFV"
FT   gene            281007..281999
FT                   /gene="gspC"
FT                   /locus_tag="TERTU_0264"
FT   CDS_pept        281007..281999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspC"
FT                   /locus_tag="TERTU_0264"
FT                   /product="general secretion pathway protein C"
FT                   /note="identified by match to protein family HMM TIGR01713"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11470"
FT                   /db_xref="GOA:C5BLN8"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001639"
FT                   /db_xref="InterPro:IPR024961"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLN8"
FT                   /protein_id="ACR11470.1"
FT                   /translation="MATSFADNPVLFKANRFGSATYGYLRSLPLDFWRNAVFYLSILWI
FT                   VHSLAGFFWLVFPVPAEPQPSKLAAPIKVESSAVAAGVDVDVAALQEMKIFGDAANAPV
FT                   DVAPESEPVVASDGIEDNASTTSLNLKLHGVIASSNQEEARAIIDNGSEQGLFRIGEEI
FT                   PKNAGVKLAKVMEERVILDNKGKYESLWLYSEEDFKKSQGNRKNNYRVPTSPAQSGSPV
FT                   TQRPEPVRKSISPQQIPKSISDVVRFSVHREDGRMVGYKIRPGRDRELFEQVGLQAGDI
FT                   VTNVNGRTMNDPRQLREVYQELKTATEANLGVRRGDEELQITIRVDNGG"
FT   gene            281989..283974
FT                   /gene="gspD"
FT                   /locus_tag="TERTU_0265"
FT   CDS_pept        281989..283974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspD"
FT                   /locus_tag="TERTU_0265"
FT                   /product="general secretion pathway protein D"
FT                   /note="identified by match to protein family HMM PF00263;
FT                   match to protein family HMM PF03958; match to protein
FT                   family HMM TIGR02517"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11924"
FT                   /db_xref="GOA:C5BLN9"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR013356"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLN9"
FT                   /protein_id="ACR11924.1"
FT                   /translation="MVGKTVLKHFRVILCMTIVFCASSGWAQQQTWTVNFKDSDINEVI
FT                   KFVAEVTGKTMVIDPRVKGRVKVISQKPLNERELIELFRSVLEVHDFTLVEVGNVVRIV
FT                   PLKDARSSPLPVKDDADIDEGYITQVIQLKNIAAAKVLPVLRPLVPQHSHLAAYDPSNA
FT                   IVVSDTAANIERIKEVIEKIDTAAMPVTEVIELKYADSESLVATLAKLDGANKQGNSAN
FT                   QITMVADKRNNAILLSGEDLQRQRVKQLIRRLDRPQLQTGNVRVVYLEYATAKDVATVL
FT                   SKVVQNMAKMTPGGDKGAARQGATVEADEATNSLLITAEGDQLDAIMAVVDRLDIRRAQ
FT                   VLVEAIIVEMTLGDKESLGIDWMFKNATQGLIGASTAGGTGAAGVAAALFGGAEDAAAQ
FT                   LLTALGGSDGQTLGVAGESGGEDFLVLVNMLQSNSNANILSTPTLLTMDNNEAMISVGQ
FT                   NVPFVTGSFTNAGGNGGTNPFQTIQRQDVGITLTVTPHVNEGDKVILDIQQEISSVSEE
FT                   AGSASDVITNQRKVETQVMAKDRSVIVLGGLIRDELQKSENRVPVLGSIPVMGRLFRSN
FT                   SETLRKSNLMIFIRPTIIRDDETLEGATAEKYTYIRDLQRMQSGERPLKITPEMLQMLP
FT                   ELESANLHLPEEGTTSLMTNGNDNDE"
FT   gene            283981..285525
FT                   /gene="gspE"
FT                   /locus_tag="TERTU_0266"
FT   CDS_pept        283981..285525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspE"
FT                   /locus_tag="TERTU_0266"
FT                   /product="general secretory pathway protein E"
FT                   /note="identified by match to protein family HMM PF00437;
FT                   match to protein family HMM TIGR02533"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12548"
FT                   /db_xref="GOA:C5BLP0"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013369"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="InterPro:IPR042181"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLP0"
FT                   /protein_id="ACR12548.1"
FT                   /translation="MNVNDEIANEVLSDPLLANAAELEVVEGETAAVMTRFPFSFATNY
FT                   GVMLHEGRVLHQPGVSAQTLLEVRRFLGRPFEIEELDEAAFKARLTRVYQSTDGEALQA
FT                   VEDMGAEFDLTALADDIPDDSELLSGDGDAPVIRLINAVLSQAVQEKASDIHVEPYEDR
FT                   VSIRFRVDGILSEVLSPKPQLAPVLVSRLKVMARLDIAEKRIPQDGRITVKLAGHAVDI
FT                   RVSTIPSAHGERVVLRLLDQAAGQLSLEQLRMPVGVIETFKGALHKPHGIILVTGPTGS
FT                   GKTTSLYAGISHLNSRSRNILTVEDPIEYLLPGIGQTQVNTKVDMTFARGLRAILRQDP
FT                   DVVMIGEIRDQETASIAVQASLTGHLVLSTLHTNTAIGAITRLQDMGVEPFLLSSSLEA
FT                   LMAQRLVRMLCTHCKEETISGESELVRLGIPEGSTVFRPVGCDHCHNTGYRGRGGLYEF
FT                   IQVDDQLRQLIHEGAGEQVMLAHARKNSKSIDQCGRDKVLSGETSVEEVLRVTAIS"
FT   gene            285525..286757
FT                   /gene="gspF"
FT                   /locus_tag="TERTU_0267"
FT   CDS_pept        285525..286757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspF"
FT                   /locus_tag="TERTU_0267"
FT                   /product="general secretion pathway protein F"
FT                   /note="identified by match to protein family HMM PF00482;
FT                   match to protein family HMM TIGR02120"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12321"
FT                   /db_xref="GOA:C5BLP1"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR011850"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:C5BLP1"
FT                   /protein_id="ACR12321.1"
FT                   /translation="MGAYSYQALDAKGKTVKGVIEGDSERHVRNQLRSKQLKPLQVKTT
FT                   RQRGPAAGSKDSGFSLFNRRPHMGYRDVSLVTRQLASLVQSGLPLDEVLASTAKQSRKP
FT                   AAKTIMLQVRSRVLEGLSLAQAMAEIPRVFDGLYRAMVRAGESSGYLGPVLERLADYTE
FT                   RSQETKQKLKGAMVYPIIMMLVSISVVTLMMVKVVPNLVGMFERNKQELPFVTKFLIGA
FT                   SNFLVNYGVFLLLGIVGLIIAFQWALRAESRRKKWHSILLRAPVTGNLILQAESARYAS
FT                   TLGLLANSGVPLLEALRIAAQVLTNHELRAAAKEVAVLVQEGSSLHKALDSVEVFPPLL
FT                   VQMAASGEANGKLAEQLLHAARNQERELEFTVNTALGLMEPFMVLFMGGVVTFIVIAIL
FT                   LPIFQMNQMVS"
FT   gene            286784..287233
FT                   /gene="gspG"
FT                   /locus_tag="TERTU_0268"
FT   CDS_pept        286784..287233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspG"
FT                   /locus_tag="TERTU_0268"
FT                   /product="general secretion pathway protein G"
FT                   /note="identified by match to protein family HMM PF07963;
FT                   match to protein family HMM PF08334; match to protein
FT                   family HMM TIGR01710; match to protein family HMM
FT                   TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12190"
FT                   /db_xref="GOA:C5BM23"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR010054"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR013545"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM23"
FT                   /protein_id="ACR12190.1"
FT                   /translation="MKHIKQNKGFSLIEIMVVLVIMGLLASIVAPNVMEVLSGSKEKKV
FT                   QADFANIETALKMYKLDNFVYPTTEQGLEALVSRPSSSPEPRNWRKGGYLDELPVDPWD
FT                   TPYQYLSPGEGHAYEIYTLGADGVRGGEEEGRDLSNWDSAANTNE"
FT   gene            287253..287819
FT                   /gene="gspH"
FT                   /locus_tag="TERTU_0269"
FT   CDS_pept        287253..287819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspH"
FT                   /locus_tag="TERTU_0269"
FT                   /product="general secretion pathway protein H"
FT                   /note="identified by match to protein family HMM PF07963;
FT                   match to protein family HMM TIGR01708; match to protein
FT                   family HMM TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11441"
FT                   /db_xref="GOA:C5BM24"
FT                   /db_xref="InterPro:IPR002416"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR022346"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM24"
FT                   /protein_id="ACR11441.1"
FT                   /translation="MVMSRHSGFTLLEILIVMVVIAVAMGGATLAINSGGPEKELKEVV
FT                   EKFTAYADHAGEMAVISNEPMGLLLEPPGWQENLDAGWRFRWQKLTYQGWVDYEKLPPV
FT                   ELPPTIQLYVTIEGNLWEWEDAPKVKLPAIAFYPGGDMTQFEIEFTLNDFSDESQHVAV
FT                   NEWGEVIWVEQAEAMAELDEEMGYQ"
FT   gene            287816..288226
FT                   /gene="gspI"
FT                   /locus_tag="TERTU_0270"
FT   CDS_pept        287816..288226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspI"
FT                   /locus_tag="TERTU_0270"
FT                   /product="general secretion pathway protein I"
FT                   /note="identified by match to protein family HMM PF02501;
FT                   match to protein family HMM PF07963; match to protein
FT                   family HMM TIGR01707; match to protein family HMM
FT                   TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACR10981"
FT                   /db_xref="GOA:C5BM25"
FT                   /db_xref="InterPro:IPR003413"
FT                   /db_xref="InterPro:IPR010052"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM25"
FT                   /protein_id="ACR10981.1"
FT                   /translation="MMLQANRGFTLIEAMIALVIVGVTLVALVERVQSVSDNTGNIEEK
FT                   TFAYWIAQNKLEEIFLDYRLKKTFPRTEQHDKEEYAGKDWYWEVKPEVRPTELGNMYRL
FT                   EVRVGNAEDDILASVAGLLHEEKQQQTVQQQP"
FT   gene            288186..288878
FT                   /gene="gspJ"
FT                   /locus_tag="TERTU_0271"
FT   CDS_pept        288186..288878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspJ"
FT                   /locus_tag="TERTU_0271"
FT                   /product="general secretion pathway protein J"
FT                   /note="identified by match to protein family HMM TIGR01711;
FT                   match to protein family HMM TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14506"
FT                   /db_xref="GOA:C5BM26"
FT                   /db_xref="InterPro:IPR010055"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM26"
FT                   /protein_id="ACR14506.1"
FT                   /translation="MKKSSSKPYSNSRKQQGMTLLEVLIATFVMAMIATMAFGALNVSD
FT                   RSREVSEDRMKDIQRLDRIWLMMENDLNNALGYARGSENAFSSVGGTDYNGVLPAMQVS
FT                   YGGEFSLVLMRGGWANPLHFPRTELARVAYKLDQDNILWRYSWMDPANVDEDYARKQKV
FT                   MAGVDDLKIQVLPGNNQAKGYKEGPWVEEWPNGPPDQLPLAIEITIELKDRGEIKRLFT
FT                   LAPGKFQG"
FT   gene            288890..289936
FT                   /gene="gspK"
FT                   /locus_tag="TERTU_0272"
FT   CDS_pept        288890..289936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspK"
FT                   /locus_tag="TERTU_0272"
FT                   /product="general secretion pathway protein K"
FT                   /note="identified by similarity to SP:P31706; match to
FT                   protein family HMM PF03934"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13401"
FT                   /db_xref="GOA:C5BM27"
FT                   /db_xref="InterPro:IPR005628"
FT                   /db_xref="InterPro:IPR038072"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM27"
FT                   /protein_id="ACR13401.1"
FT                   /translation="MQTQKQSGMALVLALLVVAIVTAISVELSWRFDLAITRAENRWYG
FT                   VQANAYLKGAEEFAFMALKFDKEEDNRKGVQVDSLDEFWAAQAAEFPTDEGWVSGRLED
FT                   AQARFNVNQLRAKVDDKARRSAEIYKHFTAPQRRFIRLLQSVNLGDEESPLYLDSTTAQ
FT                   NITEAVIDWLDNDANVTGFGGAESDFYGQLDPPYTVPNGPMASVTELNLIRGMTPVLYE
FT                   KLLPLVIALPENQTMNINTAPAELLRTLNRQDDLYPLSIEDGDVLAQNRAGGGYDKVED
FT                   FVADAKQFFPDSDNGKNNFVADGLGVFTEYFIFYGETQVGEHIRTSKALLYRNGTEVTT
FT                   IRRTDANF"
FT   gene            289979..291211
FT                   /gene="gspL"
FT                   /locus_tag="TERTU_0273"
FT   CDS_pept        289979..291211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspL"
FT                   /locus_tag="TERTU_0273"
FT                   /product="general secretion pathway protein L"
FT                   /note="identified by match to protein family HMM PF05134"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14249"
FT                   /db_xref="GOA:C5BM28"
FT                   /db_xref="InterPro:IPR007812"
FT                   /db_xref="InterPro:IPR024230"
FT                   /db_xref="InterPro:IPR025691"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM28"
FT                   /protein_id="ACR14249.1"
FT                   /translation="MAEKIFARQTIDGLWQWRRANADGQWYSDVYHTGDDEALAESLAG
FT                   KSVPVTLLIPGQDVVVCELEVDAQEKRHLAKLLPFELEEQVIENIDDIHLAFGTLTENR
FT                   VPVCYASTRLIAEALEELTAQGLDVRTVAADYLCLRRLNNGVTIIREANRVVVRTGEYT
FT                   GFAVETFLAPQVLAEQQTALDFTATISLVAEDETALAELRSWLPEVWTQENGPEISEEI
FT                   GSFWDWLDLAQAPSINMRSGAFSRQLPFKRWIELWKIPMIAVAAAYLIAVAITFAQYQV
FT                   AKQEQRVLVDQMNDVYLQAVPNGRRGDPEGALRALVKNLKGGAEPTNLMALINGVASTM
FT                   KSVAGITVSSFRYNSDQRELTLNIEAGSFEDLERLRSTVTEKGFVAELLRVEARGDKQS
FT                   ARMKVAEVVTP"
FT   gene            291208..291687
FT                   /locus_tag="TERTU_0274"
FT   CDS_pept        291208..291687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0274"
FT                   /product="general secretion pathway protein M"
FT                   /note="identified by match to protein family HMM PF04612"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14330"
FT                   /db_xref="GOA:C5BM29"
FT                   /db_xref="InterPro:IPR007690"
FT                   /db_xref="InterPro:IPR023229"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM29"
FT                   /protein_id="ACR14330.1"
FT                   /translation="MNELKEWWNKASTRDQLSLAIGGGILLLYLCYMVLLKPVTEMRDN
FT                   QLHRNMAQAEALERVRELAATWVNREGNGDSSDNGRSLVDVVNSSLQQNSLRMTGMQPS
FT                   GANDVRLRLEQVPFDNLLAWLYDIEVSQRLQVKDISVATGSNEGLVSVNIRLHRE"
FT   gene            291705..292469
FT                   /gene="gspN"
FT                   /locus_tag="TERTU_0275"
FT   CDS_pept        291705..292469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspN"
FT                   /locus_tag="TERTU_0275"
FT                   /product="bacterial type II secretion system protein N"
FT                   /note="identified by match to protein family HMM PF01203"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14639"
FT                   /db_xref="GOA:C5BM30"
FT                   /db_xref="InterPro:IPR022792"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM30"
FT                   /protein_id="ACR14639.1"
FT                   /translation="MTVSSTLLKPLIYLFFIGYFLYLVLSRAPAELAASAVHAAVPNVW
FT                   LTGVEGSLWHGRAASGQLDLPQSAIPLGNVTWDLDPLSLVLLSPCVKLNAVRPGLQLDG
FT                   TVCHSITGTSKIKDLMLETSVDPVNELIAVQISGQASINVLSAEVKNMQVEALDARASW
FT                   LNGSVYTGESWLAVGSYGANLNGLGNGEVSAKLFDIDAPVAVDMGATWNMQQGWKTQGT
FT                   VKPAPLAPDLIKGAVQLVGEELEPGVYRVMWP"
FT   gene            292484..293485
FT                   /locus_tag="TERTU_0276"
FT   CDS_pept        292484..293485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0276"
FT                   /product="membrane protein"
FT                   /note="identified by match to protein family HMM PF02424"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14085"
FT                   /db_xref="GOA:C5BM31"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="InterPro:IPR042159"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM31"
FT                   /protein_id="ACR14085.1"
FT                   /translation="MKKLAARCVILLAGIYSAHAHCEWYSDTQGIMGTEVSITFWHDDP
FT                   AQAQQLLADGMAEMRRLDRELSPWIESSELATLNRLAAKAPQKISSEMLFLVDKSLYFS
FT                   HLTHGAFDITFASVGWFYDYREKKQPSEAQRSALLPAINYRWLKLDKTAGTLAYAHDNV
FT                   RIDLGGIAKGYAVDRVAQLLENAGVRNATISAGGDSQIVGDKRGKPWIIGIKNPRDGGK
FT                   EEAEAAILLPLENTAISTSGDYERYFIDQKTGERVHHIINPRTGKSVEGVVSVTILGPR
FT                   GSDTDPMSTSVFVLGVEKGLALVNSLANFECIIIDKTGKVFYSDGLMPPQQN"
FT   gene            294375..294683
FT                   /locus_tag="TERTU_0277"
FT   CDS_pept        294375..294683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0277"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13730"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM32"
FT                   /protein_id="ACR13730.1"
FT                   /translation="MLKLLFVILFACFSYSSYAVDCPAAKVVHLQVEQDKVLVLLENQN
FT                   WHLVGFFSSVWTEKMYSALLAAQMANNRVVIRYPDGFDCSGYNLQVAPLAVRTFPQY"
FT   gene            296381..296713
FT                   /locus_tag="TERTU_0282"
FT   CDS_pept        296381..296713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0282"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13944"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM33"
FT                   /protein_id="ACR13944.1"
FT                   /translation="MELKKYLIGVLFLGVTVFSNAYEAGEWTKVAQIYAQNNGTVFVYL
FT                   GSNSMTGCYNDNAAYLKGDNIDKLYSTILAAHMSEKQIKPLYQFDNTDEGYSGWGLCYI
FT                   YGVYIK"
FT   gene            297010..297126
FT                   /locus_tag="TERTU_0284"
FT   CDS_pept        297010..297126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0284"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACR10829"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM34"
FT                   /protein_id="ACR10829.1"
FT                   /translation="MRLKNLLFFVLNHHLRAYINIFFSIFDLFEDLLCQIKY"
FT   gene            complement(297948..299774)
FT                   /locus_tag="TERTU_0285"
FT   CDS_pept        complement(297948..299774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0285"
FT                   /product="chitinase"
FT                   /EC_number="3.2.1.14"
FT                   /note="identified by match to protein family HMM PF00704;
FT                   match to protein family HMM PF00801; match to protein
FT                   family HMM PF02839"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACS93532"
FT                   /db_xref="GOA:C6AQZ0"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR001579"
FT                   /db_xref="InterPro:IPR003610"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR029070"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="InterPro:IPR036573"
FT                   /db_xref="UniProtKB/TrEMBL:C6AQZ0"
FT                   /protein_id="ACS93532.1"
FT                   /translation="MLSIVIASAVAANTYAVDCGGLDNWSSGSVYVGGNQIQYNGSAYQ
FT                   AKWWTTNEDPASSSVWLNLGQCDDGSTGGNPNTGNCAGLSVWNSTIAYGGGDYAIYDGV
FT                   KYRANWWTQGDNPATQSGPTGSGLPWTMIEDCEGDTGGPGGPGENLSPTATVNGPYTAQ
FT                   VNTGVQFSSAGSGDTDGGIASYSWSFGDGASSNAANPSHSYSLAGTYTVSLTVTDDDGA
FT                   DSTATTYATITSIDTPPPSGDKKVIGYFTEWGVYGRDYHVKNLVTSGSADRLTHILYSF
FT                   GNTTGGLCSVGDTYAAYDKAYSAADSVDGIADTWDTGALRGNFNQLRKLKAQYPNIKVI
FT                   WSFGGWTWSGGFSAAAANPQAFAESCYNLVNDPRWAGVFDGIDIDWEYPNDCGLSCDNS
FT                   GYDSYRNLMAALRARFGNQLVTSAITASASKMDSADYGGAAQYLDFFMVMTYDFFGAFA
FT                   AAGPTAPHSPLYDYPGMPIAGFSSHTGIQKLKSLGVPYEKILLGIGFYGRGWTNVAQAA
FT                   PGGSAGGAAPGTYEQGIEDYKVLKNTCPASGTIGGTAYAYCGGNWWGYDTPSTIAGKMN
FT                   YVNQQDLGGAFFWEFSGDTADGELIRAISEGL"
FT   gene            299831..300028
FT                   /locus_tag="TERTU_0287"
FT   CDS_pept        299831..300028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0287"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13149"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM35"
FT                   /protein_id="ACR13149.1"
FT                   /translation="MHNLRWVLSRRKRLRFDICRLARLFFVGRYFEMAVPEKTTLSDGI
FT                   ARRQRCQFHVNTLTLLIFIF"
FT   gene            complement(300262..300708)
FT                   /locus_tag="TERTU_0288"
FT   CDS_pept        complement(300262..300708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0288"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14662"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM36"
FT                   /protein_id="ACR14662.1"
FT                   /translation="MLAALCQVISTNAADATLSNAPPSRLERLYLQHAAPLSGKYTAKN
FT                   IAVVMLFARHAQEKSLPALRAQLAHDLLPIFSQEPDLFVDQLKQLPSLTQPVCELLGAF
FT                   AQTQQDPAHHRQLPPALTAKLHDVLPEQQARACLAEITKASAQS"
FT   gene            complement(300776..301237)
FT                   /locus_tag="TERTU_0289"
FT   CDS_pept        complement(300776..301237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0289"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13498"
FT                   /db_xref="GOA:C5BM37"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM37"
FT                   /protein_id="ACR13498.1"
FT                   /translation="MFRVFSSLTVCLSGFILWVIYLANTGSQNPLLALVQQMPYGDKIG
FT                   HLCLFGSLNFVAILGLRFHRIRYRKLCIYTATAALAVFVLGEEITQVANPLRTFDWLDL
FT                   SADALGIALANLAAWGAQRRLAASATTAIPPKAMPPETMPQKESIGHGP"
FT   gene            complement(301344..301754)
FT                   /locus_tag="TERTU_0290"
FT   CDS_pept        complement(301344..301754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0290"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12013"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM38"
FT                   /protein_id="ACR12013.1"
FT                   /translation="MKIITTVALLSLTLTFSQAQAAKNSESFEMKVDKVTLLKGFILKG
FT                   LALEATVKQGCIASHDIYQVYRDGKKVYETNTQILDVEGQEAYEAKAGDHTNFYAPDAK
FT                   EGQIIAGDILKSSVTHCKAAAESPQPAKAAKS"
FT   gene            complement(301981..302865)
FT                   /locus_tag="TERTU_0291"
FT   CDS_pept        complement(301981..302865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0291"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12631"
FT                   /db_xref="GOA:C5BM39"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM39"
FT                   /protein_id="ACR12631.1"
FT                   /translation="MALLALALLALAGNSLLCRAALLTFHTDPALFTGLRIASGCVALA
FT                   LLVWLTQGKHVPAAGKSAAAYTLLSASVLYLYFLGFSYAYITLDTGTGALVLFGCVQLT
FT                   MSVASLWRGQRLQLTQWVGMSLAMSGLYLLVAKGISGGEWHGYVFMAAAGLGWGIYTLL
FT                   GRNSLAPVRDTYRNFLACLPLCGLSCAALLSFGYPLEWQWHWGGLLAVLSGAITSALGY
FT                   ALWFYVVRDLDRASAGICQLTVPLLAAGGGALLLGEPFTATMFIGALLILGGVLLSLLT
FT                   APRRQATNAAPEP"
FT   gene            302887..303624
FT                   /locus_tag="TERTU_0292"
FT   CDS_pept        302887..303624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0292"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACR10918"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR034242"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM40"
FT                   /protein_id="ACR10918.1"
FT                   /translation="MIHGAFLFEVLNYWEPVTILNRGIFVVLTQVVIMVSRWALPALLI
FT                   LASMLAHQAAAANSRITVKVVDAQMRPLSGAVVELPGVQAPLVVGQPAVMDQIDKRFVP
FT                   ELLLIQRGRAVSFPNSDNIRHHVYSFSPAKTFELKLYAGKPKNPVIFDTAGVVLLGCNI
FT                   HDSMVGYIYVAEGPSAMTTDAGEVYFDVDEIPGHVYVWHPLQSGGPEVRARHVLDAETT
FT                   HTIMVHTTQPAPRDTFGDRFGAP"
FT   gene            303628..305940
FT                   /locus_tag="TERTU_0293"
FT   CDS_pept        303628..305940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0293"
FT                   /product="hamp domain/ggdef domain/eal domain protein"
FT                   /note="identified by match to protein family HMM PF00563;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF00990; match to protein family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12586"
FT                   /db_xref="GOA:C5BM41"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029150"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM41"
FT                   /protein_id="ACR12586.1"
FT                   /translation="MNKLSHQVIALCIGLVLVTCTLVLSSFWWFSSRYTQEHIRITVNG
FT                   ATQVFSQYSSTRAELLSTAAQVLTADYGFKQAVATRDQSTIASALANQAGRIDADLMVI
FT                   SDRNGAIISNTEGTEFENRSFEGLVASLVQQLGVTVFAEADGRLYQVIALPVRAPVTIA
FT                   YAIVGFEIDENDARQLKALTELDITFYHDREVLVSSLAGDTAAIHRNLNDVERSWGFWS
FT                   RPTFANSQRQIPSVRGQTLSVVLSDDLTGIYYNFDRLVFTTIIIAFAIVALGLVVSILL
FT                   VNNLTVPLARLAIKVRRFAGGDFNSQIAIKGGSKEIRELLHAYNDMVGEIKNREAHILY
FT                   QAQHDLLTGLMNRDTLLQAIDLVVKDQQPFYLFALQLRDLQGINDNLGFDAGDACLKEI
FT                   ADRLRRLFGGNLAKHGRLEGDVFLSLAVCPQDVPCAEKLAEILDQLGEPVIFHGLNLYV
FT                   SFSVGVCRFPEDGNTGKTLVRRTQIALDTARKQGLSVRYYQAGEDEAHMERLSMVEDLK
FT                   VALNANDGQLFMNYQPKMNLANNRIEKLEALIRWVRPKTGFVPPDVFIELAERAGLILE
FT                   LTHWVIDSVLAQLAAWKQEGISIQVAINISAQDLMHPEFFNRLQASTQRHGVDARFITL
FT                   ELTERDLMSNEERGVALMQQLRDAGYTLSVDDYGIGQSSLGKLKQLPIHELKIDKSFIL
FT                   KLDESDTDQMIVRSTIDLGHNLGLSVVAEGVENLASQQLLREMGCDYIQGYYLSKPLSV
FT                   DAVRPWLLDHENPRKHA"
FT   gene            305915..306778
FT                   /locus_tag="TERTU_0294"
FT   CDS_pept        305915..306778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0294"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12199"
FT                   /db_xref="InterPro:IPR021393"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM42"
FT                   /protein_id="ACR12199.1"
FT                   /translation="MKIPVNMRRAALVSVVIAGLVSSAQAIAGGKLLATPGVSQVEGAG
FT                   GGGIVPWAQLAGYATENSWSASGFCSRADITDYQLDVCGLQANFFDRVEVSYARQTFEV
FT                   PALKTDISQDILSAKIRLYGDIVYSRWPQVSLGVQHKKLLDSDVAFALGAEEKSGTDFY
FT                   LAASKLHLAALLGRNVFWNVSVRNTRANQLGLLGFGRREHTLSTADTFQLETSVALFVS
FT                   PNWALGYEYRQKPDNLGLGEQAWQDAFIAWFPNKRVNVTAAYLDLGSIAGAAEQTGWYL
FT                   SLMGNL"
FT   gene            306778..307209
FT                   /locus_tag="TERTU_0295"
FT   CDS_pept        306778..307209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0295"
FT                   /product="protozoan/cyanobacterial globin protein"
FT                   /note="identified by match to protein family HMM PF01152"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13346"
FT                   /db_xref="GOA:C5BM43"
FT                   /db_xref="InterPro:IPR001486"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM43"
FT                   /protein_id="ACR13346.1"
FT                   /translation="MYRLWIAVIFFIGIGACSHAPERNNSNTLYADLGGQQGLENLVDS
FT                   FIHNIGQDPAMLPFFKDAKVSRFRDLFIVHLCSLANGPCSYSGDSMEDIHTGMHIDEAH
FT                   FNRVVELLIDAMNENRISVVTQNRLLARLAPLRASIIHR"
FT   gene            complement(307390..308430)
FT                   /locus_tag="TERTU_0296"
FT   CDS_pept        complement(307390..308430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0296"
FT                   /product="extracellular solute-binding protein, family 7"
FT                   /note="identified by match to protein family HMM PF03480;
FT                   match to protein family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12785"
FT                   /db_xref="GOA:C5BM44"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM44"
FT                   /protein_id="ACR12785.1"
FT                   /translation="MKSRRNFIASAAALAGAATLTPPRLYAAKPKIKWRMQTYAGPALA
FT                   EHVVKPAIESFNRIAGDEMQIELYFADQLVPTGELFRALKKGTLDAVQSDDDSMASPTD
FT                   VTVFGGYFPFGSRYSLDVPVLFNQYGLGKIWEEEYAKVGVKHLSAGAWDPCHFATKKPI
FT                   NSLKDLKGLRVFTFPTAGRFLAQFGVVPVSLPWEDVEVAVQTGELDGIAWSGITEDYTV
FT                   GWANVTDYFLTNNISGAWIGSFFANMDRYNELPDKLKELLKLTMDSSHYYRQWWYWGGE
FT                   AKLRVDGTKMKLTSIPDEEWDQVEAAAHVFWDKIAKESKTKAKVVEIFKKYNADMAKAG
FT                   RPYRYS"
FT   gene            complement(308485..309807)
FT                   /locus_tag="TERTU_0297"
FT   CDS_pept        complement(308485..309807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0297"
FT                   /product="TRAP transporter, DctM family protein"
FT                   /note="identified by match to protein family HMM PF06808"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14539"
FT                   /db_xref="GOA:C5BM45"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM45"
FT                   /protein_id="ACR14539.1"
FT                   /translation="MSHSMIATMMFALMMLLMVTGQRVFAAIGAVAAVAALLLWGTGGA
FT                   DIPFTAAMKLMKWYPLLTLPMFIFMGYILSESKIADDLYKMFHVWMGPVHGGLAIGTIG
FT                   LMVLVSAMNGLSVAGMAIGATIALPELLRRGYDKKMVTGVVQAGSSLGILVPPSVVLVL
FT                   YAMIARQPVGQLWLAGIVPGLIMAALFIVYIAIRCRMNKELGPVLPKEERQVSMAEKLR
FT                   LLRAGLLPLGIFAVMMVPFVNGWTSLVESSALGAMAALLAAIFKKRMNKVVFENSVRNT
FT                   LAISCMFMWIILAALGFGAVFDGLGAVKAIEALFTEQWGLSPWTILILMQLSFIIMGTF
FT                   LDDTAMLVIVAPLYVPLVQALGFDLIWYGVLYTVTTQIAYMTPPFGYNLFLMRAMAPPE
FT                   ISLRDIYGSILPFVMIMVFALALIMVFPQLALWLPEYVYQK"
FT   gene            complement(309807..310412)
FT                   /locus_tag="TERTU_0298"
FT   CDS_pept        complement(309807..310412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0298"
FT                   /product="TRAP transporter, DctQ family protein"
FT                   /note="identified by match to protein family HMM PF04290"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13984"
FT                   /db_xref="GOA:C5BM46"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM46"
FT                   /protein_id="ACR13984.1"
FT                   /translation="MDIPNGSTGKLFGYGNHIQPTINGRTAFIPGTCMPRFIKGYVHYV
FT                   ELFNRRIGRLMMYGIFAMVAILMWSSISKTFFLPSLWTLEAAQFSMVVYYILGGAYAMQ
FT                   LRANVRMDLFYGEWSTKTKAWVDVFTIFFLIFYLGVLLYGGFESTSYSFEYDERSRTAW
FT                   RPYMWPIKAIMCFGLVMMILQSFAELFKDIARIRGEKI"
FT   gene            complement(310615..311433)
FT                   /gene="eutC"
FT                   /locus_tag="TERTU_0300"
FT   CDS_pept        complement(310615..311433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eutC"
FT                   /locus_tag="TERTU_0300"
FT                   /product="ethanolamine ammonia-lyase, light chain"
FT                   /EC_number="4.3.1.7"
FT                   /note="identified by similarity to SP:P19265; match to
FT                   protein family HMM PF05985"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11596"
FT                   /db_xref="GOA:C5BM47"
FT                   /db_xref="InterPro:IPR009246"
FT                   /db_xref="InterPro:IPR042251"
FT                   /db_xref="InterPro:IPR042255"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM47"
FT                   /protein_id="ACR11596.1"
FT                   /translation="MKRPHVVANPWQQLRRFTDARIGLGRAGTSLPTHELLAFQLDHAR
FT                   AQDAVHLPLDLARLCADLSALPALAPLGEIVQLRSRAADRNQYLQRPDFGRRLHEDEIP
FT                   RLHHLSSNTEYDLAIVVADGLSSQAVQQNTAPMCEALLSALHNDDQPWQLAPTCVVQQG
FT                   RVAVGDEVAEQLKAKAVVVLIGERPGLSSPDSLGIYLTWQPKVGRHDGERNCISNVRPQ
FT                   GLSFSEAARRLLYLLKESRRLQLSGVDLKDRTTSDTSTIQNGAKNFLLPS"
FT   gene            complement(311430..313013)
FT                   /gene="eutB"
FT                   /locus_tag="TERTU_0301"
FT   CDS_pept        complement(311430..313013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eutB"
FT                   /locus_tag="TERTU_0301"
FT                   /product="ethanolamine ammonia-lyase, large subunit"
FT                   /EC_number="4.3.1.7"
FT                   /note="identified by similarity to SP:P19264; match to
FT                   protein family HMM PF06751"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11105"
FT                   /db_xref="GOA:C5BM48"
FT                   /db_xref="InterPro:IPR010628"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM48"
FT                   /protein_id="ACR11105.1"
FT                   /translation="MYNLGIKPEFRKNFMSTAQSLLMWKIQNDAYWHFLCISSLINSFK
FT                   ALPLVCNMRYSYTLGSTRYHFTNLAELMAKATPARAGDRLAGVIAHTAQERVIAQMALA
FT                   DVPLKNFLNEALVPYEEDEVTRLIIDTHSADAFAPISHFTVGDFRNWLLSDAADGATLA
FT                   QIRPGLTPEMVAAVSKIMRNQDLILVAKKCQVTTAFRNTIGLPGRFSTRLQPNHPTDDS
FT                   TGIAASILDGLMYGSGDAVIGINPATDNLAQCQNLLHMLDEIIQRYQIPTQSCVLTHVT
FT                   NAIEAIELGAPLDLVFQSIGGTEATNTSFGFNLAHLAQAEAAAQSLARGTVGNNVMYFE
FT                   TGQGSSLSANAHWGLDQQTCEVRTYAVARQYNPLLVNTVVGFIGPEYLFDGKEIIRAGL
FT                   EDHCCGKLLGLPMGVDVCYTNHAQADQNDMDTLLTLLAVAGCTYIMGIPGADDIMLNYQ
FT                   TTSFHDALYARQVLGLRAAPEFEAWLEKMQIVETDQPAKLVDAMPDTFARTLEHLSDSD
FT                   SSDARAETGQ"
FT   gene            313034..314275
FT                   /locus_tag="TERTU_0302"
FT   CDS_pept        313034..314275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0302"
FT                   /product="inner membrane protein"
FT                   /note="identified by match to protein family HMM PF05684"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11420"
FT                   /db_xref="GOA:C5BM49"
FT                   /db_xref="InterPro:IPR008537"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM49"
FT                   /protein_id="ACR11420.1"
FT                   /translation="MQAPLFTNDATVLGLLTVILGAVFFSTQSNHPVFRKFYSVVPAIL
FT                   LCYFLPSLLNTLGVIDGDHSQLYFVASRYLLPTTLVLFVISVDIRQILRLGPKALILFF
FT                   TGTFGVVIGGPIALLVISWVSPELIGNNGPDAVWRGMTTVAGSWIGGGANQAAMKEIYA
FT                   VGNDVFSAWVAVDVIVANLWMAVLLTLAAKSKGIDRRNGADTTAIVQLQESIAKYQAEN
FT                   ARIPTLNDVMIIVAVGFGVTGLSHFCADLIAPYLQENYPGLARFSLHSRFFWMVVIAST
FT                   IGIALSFTRARHLEAAGASRLGSAMLYILVATIGTHMNLMAIFETPIYFVIGFIWMFCH
FT                   AGLMLLMAKLLRAPLFFMAVGSQANVGGAASAPVVAAAFHPALAPVGILLAVLGYAVGT
FT                   YMAWICGQLLIVIN"
FT   gene            314415..315788
FT                   /locus_tag="TERTU_0303"
FT   CDS_pept        314415..315788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0303"
FT                   /product="putative peptidase"
FT                   /note="identified by match to protein family HMM PF00041;
FT                   match to protein family HMM PF04389"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13840"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM50"
FT                   /protein_id="ACR13840.1"
FT                   /translation="MVFRLRFIVIGALLALPVHAKEKVSRVNTDELHTIAAEVSAVHIE
FT                   QDVRTLVGFGTRHTASETASDTRGIGAARRWIKNEFDKISAACGGCIEVYYQSETVSGE
FT                   TRIPDPVEVVSVIAVQRGVTDPGRYVIMSGDIDSRVTDVMNATSDAPGANDNASGVAGV
FT                   LETARVLSQYRFQGSIVYAALAGEEQGLFGGKIMAAQAQKDGWRIKAVLNNDMIGNIEG
FT                   INGVIDNTTARIFAEGTRHTETPEEATTRRYTGGEVDSPSRNLARYIDKMADTYIPNLD
FT                   TMVIYRLDRFGRGGHHKPFNDLGFPGVRIMETNENYNRQHQDIRTENGIAYGDTIEGVN
FT                   FPYAAKLTALNAVSLASMAWAPNPPSGVTIKGAVQPSTTLSWTALNKKQNPNLAGYKIY
FT                   WRYTDAPQWQYSRFVGDVTEFTLENIVIDNYFFCVASVSKDGFESPVVFPGAAGSFGE"
FT   gene            316839..317135
FT                   /locus_tag="TERTU_0306"
FT   CDS_pept        316839..317135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0306"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13198"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM51"
FT                   /protein_id="ACR13198.1"
FT                   /translation="MPQRPPEIGVVITRVPQSASKEIKNKQIADTILQGNFIEVLPLWM
FT                   YFCSEFLTKTFHGSGSEPERPKKLTNISFIAERIVRHFSDVNCYPLFGERQKN"
FT   gene            complement(317489..317935)
FT                   /locus_tag="TERTU_0307"
FT   CDS_pept        complement(317489..317935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0307"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF08327"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13623"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM52"
FT                   /protein_id="ACR13623.1"
FT                   /translation="MDGSTTNDAVLQTTRTYPWPADTIYQAFADPERLAKWWGPNGFSN
FT                   TFETFGFAEGGEWRYTMHSPDGQDFKNVCVFVELIPAEKLVIKHDSAPRFTLTITLEES
FT                   NNQTLLTWTQKFEDPQVASAVRHLAEPGNEQNLDRLGENLNRSA"
FT   gene            complement(317966..318331)
FT                   /locus_tag="TERTU_0308"
FT   CDS_pept        complement(317966..318331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0308"
FT                   /product="transcriptional regulator, PadR family"
FT                   /note="identified by match to protein family HMM PF01638"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11650"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM53"
FT                   /protein_id="ACR11650.1"
FT                   /translation="MQEKNYFSVECPSRAIFSEIADKWSMMILSVLESQPRRFNDIKRR
FT                   LEGVSQKSLTQSLRKLERNGILERTVISSSPVSVEYSLTPLGQSLLGPFKTLYLWIVDN
FT                   VGEVYEARQLFDARQTD"
FT   gene            318438..319562
FT                   /locus_tag="TERTU_0309"
FT   CDS_pept        318438..319562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0309"
FT                   /product="FAD/FMN-binding NADH:flavin oxidoreductase,
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF00724"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14127"
FT                   /db_xref="GOA:C5BM54"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM54"
FT                   /protein_id="ACR14127.1"
FT                   /translation="MSETTLADSVLFEPLKIGSLELKNRIVMAPMTRNMAPEGVPNEKN
FT                   AAYYQRRAEGDVGLILTEGTVIDRPASRNEQHIPFVYGEAAMGGWRTVVDAVHAASGRI
FT                   GPQLWHVGAMPGQSGWEPAQSPESPSGLMAPDAPRGVAMTDADIADAIAAFARSAADSK
FT                   AAGFDVVEIHGAHGYLIDEFFWDKTNQRADAWGGASLVERSRFAVEVVKAVRQAVGDDF
FT                   PVILRLSQWKQQDYTVKLAPTPDDMAAWLTPLADAGVDIFHCSQRRYWEPEFVDIDGED
FT                   GLNFAGWAKKLTGKATISVGSVGLNNDVMSTFSGESAGVAAIDKLLSRMDKGEFDLIAV
FT                   GRALISDPHWVQKVKEGRFSDLIPFEPSQLGELN"
FT   gene            319863..326960
FT                   /locus_tag="TERTU_0310"
FT   CDS_pept        319863..326960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0310"
FT                   /product="cadherin"
FT                   /note="identified by match to protein family HMM PF05345"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACR10709"
FT                   /db_xref="GOA:C5BM55"
FT                   /db_xref="InterPro:IPR003644"
FT                   /db_xref="InterPro:IPR008009"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="InterPro:IPR038081"
FT                   /db_xref="InterPro:IPR039005"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM55"
FT                   /protein_id="ACR10709.1"
FT                   /translation="MRKEFVVPARLWQIFTALSKAFIVLITIAASSNALALAWQEGSTK
FT                   TIDYVQGQNIGVIYIETDVDYDNHPISAVQEISGSHPPGINFHNAGPCPGSGKLCTAYS
FT                   GIPTSTAVYTVTIRATDGADTADMVITWRPALSASGVSQTTAIVGSSYSNSITPTGGVA
FT                   PYSYAVTSGSLPAGMTLNTSTGAIDGTPITVGAYPFTVTVTDTNTTTATATQTVNVYNP
FT                   LSITTTSLVGGRVGSAYSATLVSTGGDGSDLWSVTAGSLPAGLGLNSSTGVISGTPSTE
FT                   ENASFTVSNTCCSNLTNDTQSLSIAVLPQFDSDGDLLTGATAEATVLNFSADTSGEAIG
FT                   ALDFILRDGGATDALPLTVSQVVLHVSGTSTDAERGNIRFVLNGPDAVDVIGTYSALND
FT                   TVTFSSLAISITDGNDETYAVSAYVTDASSLTHGHTVILSLDGDTDLSVGGSDTQMGTT
FT                   SAVTNGSGFALVDDIAPAVGSVSVPANATYIAGNNLDFMVNFSEAVTVDTNAGTPRLSL
FT                   TIGSSTRYASYLSGSGSAAAVFRYTVQSGDLDTDGVALAASIDLASGTISDAVGNGATT
FT                   TLASVGSLSGVLVDAVLPQLAETTAVAALGNDASPSVTFTTDEAGTLAVGGSCGSASEG
FT                   AIASGSHTITLLQSNNVSDLVDGTYSDCTLTVTDAAGNSSASLALSSFEIDLLAPSVSE
FT                   LTQVVTPGNDSTPDVTLTLGEAGILAVGGSCGSGDEGAVGLGNTTITLTQTDNTAPLAD
FT                   GTYSDCTVTVTDAAGNVSTPLTLSSFLVDTLVPVLAEVSQVSTPTNNTAPGITISSSEA
FT                   GTLSVGGSCGSASEGAVTSGNTALVLTQPDNMSALADGTYSDCTLTVADASGNISSALT
FT                   LSSFTIDASAPTLATNLGVALTEGDTGVAVTASALSATDNLSAAGQITFTLTAAASNGT
FT                   LYRSGNALAANGTFTQADLVNGLLTYDHDGGETTSDTVAFTLADALGNVSTPLTFAFTV
FT                   APSNDAPLTSDDSATTNEDTPVTVDVLANDFDSDDAINAASVIVVTQPMHGSTSVNTVN
FT                   GKITYTPATDYYGSDSFTYTVQDQSTAVSAAAAVAITVTSVNDIPVASDDTGATIMNVA
FT                   TTIDVAANDSDVDLGDVPDVNTIVIVSPAAHGTAVVNAGKVDYTPNLDFFGADSFTYTI
FT                   ADSNSGVSAPATVSISVIDPNTAPTAVDDSVTTAEDIAQVIDVLANDSDDDGTLVATSV
FT                   NVVAGATHGTAVVDATTGRVTYTPAANYFGTDSFSYTVRDDDDALSAAATVSITVTAVN
FT                   DAPVAANDAVVLLEDASLSINVLGNDIDIDGTLNSATIAIVDEPASGMALFDNGTIMYT
FT                   PFSDYAGDDSFTYTVADNNGLVSNLATVSLSVTAVNDAPVAEDDSFVVVTNGASPLNVL
FT                   VNDSDVDGTLDIASIIITVAPTQGTLVNNNEGSLSYTPNSSLDAQAGDSFAYTVGDDAG
FT                   AVSSEATVSVSFKPAAAPVIGGAPETEVLEAQVYSFTPEVTVGDANFPLTFSATGVPSW
FT                   MTFSPATGTLTGTPALADVGTHTDIVIGVSDGFSSQQLPAFSVTVIDAVDSDGDTLTDY
FT                   QEGVDGTDPTDPLDYRDVTAPELTAPADIIVDATGLFTDVSLQQLLSLAANAEQTSIDA
FT                   ARNALATDNVDGSDCCNPVAVNLQNGKFTLAPGLHTVQWRAEDFMGNSSVAQQQVYVRP
FT                   LVSLSKNQFAAEGATVTVKVLLNGEAPVYPFTVPYVIDSSSTADSDDHSLQNGTVTFED
FT                   GETEVAFSFNTVADGVTEGDETLIVRLDDRTSDNEDLLDGFDADMFDINAGTSDAFQLT
FT                   LQESNVAPTIALQLTQNNKPTILVQPSAGDVVITADVTDTNVDDTYSLVWSSTSLGIGP
FT                   GSSGDELRLSAAELSLGVHKIKVQVTDAAGASSSASLNFKVVSSLPVLSSATDSDGDGN
FT                   DDASEGTGDADGDGIADYLDNISLPNVLPEVLDDSTHFLMECDPGVRCRLGEFAMQQTQ
FT                   GGSRLASDDLVAMEGINPDPNYSMDFVFDFDMEDLPLAGQEVSVVIPQISQLPAGAVYR
FT                   KFTNGQWRNFVEDANNRLHSAPGSEGLCPPPGDAAYRSGLNEGDWCVQLTIEDGGPNDA
FT                   DGEANNAVVDPGGVGTQNTRKLHAGGGSLGAGLLVLLLMAVALRALNARALPIVAVVFA
FT                   VGLLPQHSRAQAQPIFVEASLLQTSSSQDESGFMKDLAAEGIDANLEAYDADSSGYLVK
FT                   VGIQFTPHFAGYVGFVDLGEGELDMAFPAEDDDVIEDGLRESFAKMGNGVVYGGRAHVN
FT                   PFNRVNLYADVGIYTWKSKVSVSGSDISASTSGVDPFAGVGCTVDITEKVALGLTYNYF
FT                   KLDDQSVSAPGISLTYTFD"
FT   gene            complement(327307..327969)
FT                   /locus_tag="TERTU_0311"
FT   CDS_pept        complement(327307..327969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0311"
FT                   /product="riboflavin biosynthesis protein RibD domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01872"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11179"
FT                   /db_xref="GOA:C5BM56"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM56"
FT                   /protein_id="ACR11179.1"
FT                   /translation="MGMVRVSGYSVSLDGFGAGPNQSMENPLGVGGGQLHGWLFPTQTF
FT                   QKMLFDKEEGSTGIDNDFAAQGFVNIGAWILGRNMFGPERGPWKDMSWEGWWGDTPPYH
FT                   APTFILTNHPREPIQKEGGTTFYFVTEGIHAALEQAQAAAGEKDVRIVGGANTINQYLD
FT                   AGLVDEMHYVISPVFLGDGERLFAGVDLAARGYKCARMVASDNATHVILERAAKDAD"
FT   gene            complement(327983..328396)
FT                   /locus_tag="TERTU_0312"
FT   CDS_pept        complement(327983..328396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0312"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12639"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM57"
FT                   /protein_id="ACR12639.1"
FT                   /translation="MRSVISFIFFSVFILIGSSAWAGKPINNLDGQVPPQLDGEPRGLE
FT                   EVKTAVIAACSKRGWTPVIVGPNDIEAEINVRDKHFAKVKIHFTPETYSIDYLDSKNLG
FT                   YDSADQTIHRNYNKWVILLGRSISRGFSVQTQI"
FT   gene            complement(328525..328734)
FT                   /locus_tag="TERTU_0313"
FT   CDS_pept        complement(328525..328734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0313"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11771"
FT                   /db_xref="InterPro:IPR025629"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM58"
FT                   /protein_id="ACR11771.1"
FT                   /translation="MADEAKVKGPASYFPAIEKKYGFPIDHWLTLLKSQQGLKHMEMVA
FT                   WLKEAHGLGHGHANALVAYYRNMK"
FT   gene            complement(329174..329581)
FT                   /locus_tag="TERTU_0314"
FT   CDS_pept        complement(329174..329581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0314"
FT                   /product="glyoxalase family protein"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11534"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM59"
FT                   /protein_id="ACR11534.1"
FT                   /translation="MNPRISMITLGVKDLQKSVAFYEKGLGFPRIDSSPGVAFFSLNGT
FT                   WLGLYNRDALAEDIGIEARGNGFNGVTLAHNVASNEQVDDVMAQAEKAGANIIKPAQTV
FT                   FWGGYSGYFKDLDNHFWEVAHNPFLWIGPED"
FT   gene            complement(330034..332124)
FT                   /locus_tag="TERTU_0316"
FT   CDS_pept        complement(330034..332124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0316"
FT                   /product="putative 5'-nucleotidase"
FT                   /note="identified by match to protein family HMM PF00149;
FT                   match to protein family HMM PF02872"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14118"
FT                   /db_xref="GOA:C5BM60"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM60"
FT                   /protein_id="ACR14118.1"
FT                   /translation="MKQWIKPLAVLAASASLFACDGDDYDSDIKSLRQTNDELSGEVSD
FT                   LNSENTQLASDIADLRAQLTQAGADQTALQAQITALEEQLALLQGGKPLTVTLLHMNDH
FT                   HSHLEAESLRFPVDQLSLAAKAEGDAAITSVDINYGGFPMLVSLFDDLAKQSVNPVKIH
FT                   AGDAMTGTLYNTLFKGEADAAMMNQVCFDVFAPGNHEFDAGDAGLARFLDDLNGSGCNT
FT                   ATVAANVQPHANSALAQGYLQPYTIKDFAGEKVGFIGIDIAGKTKNSSFPDEGTTFSDE
FT                   TATAQAVIDQLTAEGVNKIVLVTHYQYAKDQALASALHNVDVIVGGDSHSLLGDDTFTA
FT                   LGFNTVGDYPTQVQNLDGNPVCIVHAWEYAHLLGRLEVNFNAAGVVESCTGNPIIPMEA
FT                   SFSYAYSDSETRVLEGDDAYQVRKALAAHDEIAFVAADAATADILQTYQAQTDVLKQTL
FT                   IGTVNEDLCLVRWPGDSRSSLCDRMDTYAYGSDISNIVAKAFLMVTPEADIAIQNGGGV
FT                   RVDVPMGNYSIGDAYVLLPFSNTLVVLEMTGQQVVNVLEDALSYALDEAQSTGAYPYAS
FT                   GLRYNVDASAAKGSRVSNVEVNSRVSGSWTPINLANTYKVVTNNFIASGQDGYTTFETP
FT                   FKAGNYVDTYTEYAQGFVSYMQLLADDNENLMKLPVSEYSTQVYIGRDGCNHSTQTNCV
FT                   DY"
FT   gene            332510..333322
FT                   /locus_tag="TERTU_0317"
FT   CDS_pept        332510..333322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0317"
FT                   /product="triacylglycerol lipase"
FT                   /note="identified by match to protein family HMM PF01764"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14566"
FT                   /db_xref="GOA:C5BM61"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM61"
FT                   /protein_id="ACR14566.1"
FT                   /translation="MTHSRSPDFTLIEWYAQRAAMAYNGEAAIRAAFPNTTLVATSRDQ
FT                   VQFFLEVDHTKKQQIIVVRGTANLSNAREDADYIQGLNSRLGIWVHRGFDADAQVVYEM
FT                   VRGHLVPEYEIILTGHSLGAAISTLLMMYFSLDGLPLGPSINFGQPKVTNKKGVQLFAN
FT                   LPLARVVDENDLVPLVPPIDLIDEIHGGYEHLGTELVLLAGEYYCLLDEARAEHISLTD
FT                   FWANLGNMSVHEHYMANYLANIQTKLLKSLAVPYVDRKKYYRLAASGE"
FT   gene            complement(333442..333762)
FT                   /locus_tag="TERTU_0318"
FT   CDS_pept        complement(333442..333762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0318"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12781"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM62"
FT                   /protein_id="ACR12781.1"
FT                   /translation="MRNKIIATIALTLGLVGTASAAKIFEYNDPTYGNYPASCTLTPLY
FT                   GGGSGYTLWNVYSLSCPGHPQLQITREFTQQQYYTNCVVKVNNSNYYTSFNNCDNWRVY
FT                   SN"
FT   gene            complement(334513..335289)
FT                   /locus_tag="TERTU_0320"
FT   CDS_pept        complement(334513..335289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0320"
FT                   /product="hydrolase, alpha/beta fold family protein"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11842"
FT                   /db_xref="GOA:C5BM63"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM63"
FT                   /protein_id="ACR11842.1"
FT                   /translation="MPYAYTQDNTRIFFETYGSGAPLLLIPGQGLDHKGWGSFVNALAE
FT                   QFRVIVLDNRGTGNSDKPDAPEYSTRGMAADAIAVLNTLQIFSAHVLGFSMGGRIAQWV
FT                   AVDHPKRVNKLVLVATTPGNTHGVARAQSVDFIFASGNRERMLELMVSPSWYDSNPEFQ
FT                   QLWQYQAENRPPAYAQRLHFVASECHDCWHELSSVTTPTLIVHGNDDTINLPANARLLA
FT                   EQIPKAEVVFIPEGRHYIFLEKQDECSEAIIQFLGK"
FT   gene            complement(335453..336457)
FT                   /gene="cydB_1"
FT                   /locus_tag="TERTU_0321"
FT   CDS_pept        complement(335453..336457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydB_1"
FT                   /locus_tag="TERTU_0321"
FT                   /product="cytochrome D ubiquinol oxidase, subunit II"
FT                   /EC_number="1.10.3.-"
FT                   /note="identified by match to protein family HMM PF02322;
FT                   match to protein family HMM TIGR00203"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12331"
FT                   /db_xref="GOA:C5BM64"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM64"
FT                   /protein_id="ACR12331.1"
FT                   /translation="MSEATLLPVIFIGLMGLAILVYALLDGYDLGVGILLPMKSDEEHL
FT                   RDRMIASIGPFWDANETWLVLAVGLLLIAFPSAHSLVLYHLYLPATFMLLGLILRGVAF
FT                   DFRAKAAVSHKYLWDLGFKSGSLLTTLTQGYMLGKYVTGFIPGWGAEVFCLLSALGVTA
FT                   AYTLIGGAWLVLKTESDLQGRAIRWARNANRLTFLGVIAVCLVNLWVNPSVFQRWFEFP
FT                   LVMFVLLIPAICLAAFMGNEWLLRKLPFPDDRYCAYPFAFTAMIFTTCFTGLAFSFYPA
FT                   IVPGKLTIWEAASAPESLQFILVGALVVVPVILIYTAYAYWVFRGKASDLKYH"
FT   gene            complement(336454..337818)
FT                   /locus_tag="TERTU_0322"
FT   CDS_pept        complement(336454..337818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0322"
FT                   /product="bacterial cytochrome ubiquinol oxidase, subunit 1
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF01654"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12208"
FT                   /db_xref="GOA:C5BM65"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM65"
FT                   /protein_id="ACR12208.1"
FT                   /translation="MLDTLELSRIQFAANISFHILFPTINIAMCWVLFFFKIRHDMTQN
FT                   PVWMRAYRFWVKVFALTFALGVVSGITMSFQFGTNWPGFMETVGNIAGPLLGYEVLTAF
FT                   FLEATFLGVMLFGINRVPPKLHTLATLLVALGTTMSAFWILALNSWMHTPAGFEMREGV
FT                   AHVTSWWEVIFNPSFPYRLMHMLVASGLTAAFFVAGISAYRIRKGDTKRAPLLALKTGI
FT                   FMAAVLMPLQILVGDLHGLNTFEHQPQKVSAMEGVWHTEQGAPLLLFAIPDEEAQKNHW
FT                   EIGIPHMASLILTHTFNGEITGLTEFEAHPPVKPLFFGFRVMVGVGLLMLATAWFTSLL
FT                   LLKNKTLPYWLLRHLEVMTFSGWVATLAGWYVTEIGRQPWLVTGVLRTADAVTSLPTGN
FT                   VGTSLVLYLLVYAGLLTAYVHTVRLLARKSVEVEEFEVDDHATHDRPLIEEGASS"
FT   gene            complement(337884..338438)
FT                   /locus_tag="TERTU_0323"
FT   CDS_pept        complement(337884..338438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0323"
FT                   /product="helix-turn-helix, type 11"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12249"
FT                   /db_xref="GOA:C5BM66"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR026282"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM66"
FT                   /protein_id="ACR12249.1"
FT                   /translation="MKLNPTAENFVVHFGEMGSRWGFNRTVGQMLALLVIHSEPLNAED
FT                   IAETLHVSRGNVSMGLKELQSWRLVRVQRVHGDRKDYFTVSGSIWELAQTVFEERRKRE
FT                   IEPTLSVLRSNLLDEPKSDEEAFAQQQMSDLLTLLEQLTNWAQQLNNLSPGQLQGLLKL
FT                   GSGVGKVLDLKDRIIGQSKPD"
FT   gene            complement(338674..340302)
FT                   /locus_tag="TERTU_0324"
FT   CDS_pept        complement(338674..340302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0324"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12700"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM67"
FT                   /protein_id="ACR12700.1"
FT                   /translation="MNIKHAFRTLKASVVLACLTLSFTPITQAQATYDVSFEFSEADSI
FT                   ATWHPFQVDYSAGDFALSYEQETLGITPAWQNGDAVFAITGLESPLDFTQAKIIADIKF
FT                   DDSYFHETDAGYETSLARATVVLVDVQGRYALGEIQSPSIENKSTFTTVTLLQGAITLN
FT                   YADAEFDITNVASVGVGLISVNYGPIATGLAQFDNIGIDLDGAAGEPTNLLDFPVMHSG
FT                   WDHNWITSSTRSTSQGVKGKSTLIFRNSETQGKDVEIYHHLPWNLNLAQGRVSFNLSLP
FT                   PQFETLTEGVKVLLVDAQGKTAQVYGISASELNFNSPVSVIIDSVAQRDFITMDDGFDL
FT                   TQVESLTVTIELPAENTLLSGILVVDSFYLQLSPKFAKNFYNPVKPQNFSAAELYPWVI
FT                   ETSNTPDYESLHNFSASDSEMVATLNWQPEESEIWLVHSWATPVNLSTGYITQRFYIPA
FT                   RETASGMSINLEIADSFGNRKNKTLLTMDGTITGGWVVIKIPTVEFADSIDLNFPSYLN
FT                   IVITRGSALGHSGVLKFNAPSFSAN"
FT   gene            complement(340626..342260)
FT                   /locus_tag="TERTU_0325"
FT   CDS_pept        complement(340626..342260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0325"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14434"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM68"
FT                   /protein_id="ACR14434.1"
FT                   /translation="MMKTSTLRSVLKAASFCFSILWSIYSLAQTDPSSDLVYDFSEPSS
FT                   VESWEFLSSGYPDSNVQISHENGSLGLTPSWRANDYVFTTTPLNATYDFSQAKVHGAVK
FT                   FDEKFFTLVYDDFESSLARATVVLVDTDGRWALGEFHSPVPENKSEFSTFTFLQGEDSL
FT                   VYADPGFDMTNVNAFGMGLLSINYDIVAAGLAQFDDITIDFDGAAEESTALIDFPVYVS
FT                   GWEHNHIARLWSTSKKGNKGKFSIFYNDDNTYGQNLEIYQNLPRTVNFTKGQISFDLLL
FT                   PSTFGTIVNAIGVVLVDSKGNRAETYTLNAPNMLFGTTMNIAIDDLSRNKFISMDPDFD
FT                   LAKVRSILVELRLPSENLTISGQVVFDYFHLQVHPKFEKNFFNPLRPSPIPADVLYPQV
FT                   LLDDVPPNYESLHEFSVNNNDVVANLNWQDAEAEIHLSHFWERPVNLSSLEVTQRFYVP
FT                   PREAESGMSLYLKLVDINMDEVEIPLATLDGGNTRGWTVVKFSSADLPDDLNLNYINEY
FT                   IIIIKRNATYGHAGAFRFNPPVFSITR"
FT   gene            343220..343474
FT                   /locus_tag="TERTU_0328"
FT   CDS_pept        343220..343474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0328"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13352"
FT                   /db_xref="GOA:C5BM69"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM69"
FT                   /protein_id="ACR13352.1"
FT                   /translation="MHTEAAFAGGGQISLGYLTVMPFLLLCVMGEKKGADFDFFDFINA
FT                   VKMMFAAPDVWVFYFVLMLGMSSPTLIELKTQIDKSKQI"
FT   gene            343572..344354
FT                   /locus_tag="TERTU_0329"
FT   CDS_pept        343572..344354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0329"
FT                   /product="protein RhsD"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACR10846"
FT                   /db_xref="InterPro:IPR001826"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM70"
FT                   /protein_id="ACR10846.1"
FT                   /translation="MNINTYDEYGVPDPTNAGLYGYTGQVYLQELGLYYYKSRMYDPLL
FT                   GRFLQTDPIGYEDQMNLYAYVYNDPMSNTDPSGECPWCIVGAVAGAIIGGGGSAVSQMM
FT                   SGDGSVDMGKVGRSALAGALVGGTGGLASTGAAAIGLGAAETFGSVSVTSDTVAYVTAG
FT                   VNQIVDNVLNEAPMAGVHQAAALSATATVVGGAAGDKAVSAITNSSKLGPSGFIAGGKI
FT                   TENAVTGVIQETMSQAGGAASSALQSGQSCDSNGSSCP"
FT   gene            344852..345928
FT                   /locus_tag="TERTU_0330"
FT   CDS_pept        344852..345928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0330"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07605"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14570"
FT                   /db_xref="GOA:C5BM71"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM71"
FT                   /protein_id="ACR14570.1"
FT                   /translation="MTTSRETQVFLDETPFYHCCVRCVRCVRRAYLCGEDFSTGESYDH
FT                   RKQWVVSRLKFLSYIYAIDICAYAVMSNHYHVVLHVDKSRAESWSRSEVVERWMQLYKG
FT                   DMLVSRWLKAPATLDEAQRDAVYLKIEAWRERLFDIGWFMRGVNETIARMANAEENCKG
FT                   RFWEGRYKSQALLDEAALLSCMVYVDLNPVRAGMEESLDASDFTSIQQRLAEFASKKRQ
FT                   LKKHPELAERTEKQVRLKADLKLDKQPEAPLMVFDGSSHTDIHVALPFTEQDYLRLVDE
FT                   TGRVLRADKRGAIPDAIKPIIERFGIDPKNWLEHVKNFSRRYGRCAGHVVRMRAYVERY
FT                   GLRAAKGVGISKAMYRAA"
FT   gene            346650..348683
FT                   /locus_tag="TERTU_0331"
FT   CDS_pept        346650..348683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0331"
FT                   /product="carbohydrate binding module family 2 domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00553"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11434"
FT                   /db_xref="GOA:C5BM72"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM72"
FT                   /protein_id="ACR11434.1"
FT                   /translation="MTSRYLPRINSIFKWFTLPTLLLTSFAQAVECEWQYISQWNGGAT
FT                   AEIQATNNSDAVVDLDHFTAEFPGGVTVQHVWNASVSGSNPYTFIPSDWNAQLQPGAGM
FT                   VVGMQVSTPSGVPASENIPVLGGDCSDQPVPEGSLSIAAKDKVLAGSADDITVTLVTPS
FT                   LPSSQPLLSVSPYAEYSYMSSTGGSNDARYIMGYYYRVSYDNPGTYLWRAEYEQSELVA
FT                   EHSVEVFPVTARPTVSYQMPELIYAGQPFSLTIIGEDTELLESLTLTPPSGAEFSLQSS
FT                   DHQSDTLWRDVYVGELPEGEHLIFIEAKDPDGFFQKKQVTVNVLPFGGDNTPPVADIYF
FT                   FADFTANDTVSFRAAITDAENNIANARMMIFQIVDGARVNPQEIINRDYDDTGDEILFA
FT                   SWATSMAGAYELEVIVTDADGERGVDTASFTVAEDEGGSISFSGSEKVIVDTRQSVGVF
FT                   AYHPTRIPYEHSLSIEPYARANRTSSSSSGGGGEGYTRIYFYEIAYDYPGTYLLTATSA
FT                   GLDPVEKRVEVFPVSARPTARIEVPENIYENQEFTLTVIAEDTEALESVFLSYPSDIEF
FT                   TLQSKDYSSDTYWVETYTGALNVGTYNFSVRVEDSDSFTWWVNRSVEVKPVVDEPPEVL
FT                   WCDWFGYDVPVCEDHSLTDFQWINDALCIGYQTCGESRNFSR"
FT   gene            349401..351158
FT                   /locus_tag="TERTU_0332"
FT   CDS_pept        349401..351158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0332"
FT                   /product="Ser/Thr protein phosphatase family protein"
FT                   /note="identified by match to protein family HMM PF00149"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14259"
FT                   /db_xref="GOA:C5BM73"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM73"
FT                   /protein_id="ACR14259.1"
FT                   /translation="MHPMAEVLKQQSDAGVDMVIALGDLTDNGSSLEFAEWRSVAEPYA
FT                   QAGIEFLPVMGNHETSYAYTVEWIRNMRDFIPEDAVHMPGYEWVNYYVVRENVLIIGLA
FT                   YYNLPVAFEWIKQVYAENENRVDHVVIASHDGLIGAKYGETLEHIVDGAKDDNWVYDVQ
FT                   PQIRDFLADIDAIYVQGHEHQYQRSVISAKTMLTTYPSGSTPSGGNYRMDVYTQIMAGN
FT                   ASYKGYEFRYGERDLVQAIIAQKNATMSNGSAGFDVNSSILRFDDARVDYWSWFAPHTA
FT                   TSNAADQAFAADWKLLDTFSRTTNRCEALIYPDSIPEGTRPVMVLQTEYISDDCIADDG
FT                   TLARLVGGTNATFNRTNTRTRDLEYTPGISRAESLNDLLRLAYQWLFQVHESWSPNLNS
FT                   AARVIPDVGEDLILIPETSIDLKEHVSLSWLPAEGTLSDSLVISGLQNQTGMFQGAYGT
FT                   PMDLELDAGLAMSSPTGDAKAPVTLPATASKHWDISDAVADTYAVEFIQPDSLTGVATL
FT                   AKRVGDSWVPLASAACVISAAWDSSVLSSAPARDGDCSTMPLVGYDQATGAWWAVLDHD
FT                   IELALITAQ"
FT   gene            351472..351648
FT                   /locus_tag="TERTU_0334"
FT   CDS_pept        351472..351648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0334"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11007"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM74"
FT                   /protein_id="ACR11007.1"
FT                   /translation="MKAYMSESVKAMMGDREASRKLRDAFRASKKDGNPHTINFNGKDI
FT                   AVSSRPISQVSGH"
FT   gene            351683..352423
FT                   /locus_tag="TERTU_0335"
FT   CDS_pept        351683..352423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0335"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14751"
FT                   /db_xref="GOA:C5BM75"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM75"
FT                   /protein_id="ACR14751.1"
FT                   /translation="MNIAFPAVVIFLLLFPGVVFRNAFLQSEDKSASTATPLTTAAALA
FT                   FIYALMLHFVWVFFATLFGFKIDYFSLLVILTSDRDNLAAAIKVVAASINWIALYFATL
FT                   LAASWLLGFAFRFVVSTFNLDHGENWLAKRLKNDTPWYYYFSDFESDTKDMPAAVYISA
FT                   LTEVGGLIFIYEGFLRSYKLNSSGQLDRIVLQNVDRRLICEDKNSGTDIFEGNSHEISG
FT                   DNMVIPMSEIKNFNIQYLYTEDAD"
FT   gene            352811..353965
FT                   /locus_tag="TERTU_0337"
FT   CDS_pept        352811..353965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0337"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11222"
FT                   /db_xref="GOA:C5BM76"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM76"
FT                   /protein_id="ACR11222.1"
FT                   /translation="MLLTVCAQKLKKYRARTTCSSHIWLVILLCSTLICCSVCNTAAES
FT                   FSTELKPDKAKLTDYPIYARGWKAPLTSWAMEVEAGDLGGGTWIFNAYNNKSSSTDRGI
FT                   ATLVHQFPQPLNLINATVDFGVSFDATLERQVATFSLSMVDSKGRRYRLETTTGTDKTQ
FT                   FQLGPFTATTFTQGRVAFDISQVHSIELTIVGRNTTAVVSGTLFIDDFHLQVDRRFSEN
FT                   FENSIRPQTMNPENIRVLLYTDDDTSQYDVLHRHSVSGRALAITPVWQYQESALVSSSL
FT                   WDKPTNFTGVKITQEFSLPLLALGSSMALALEIIDIRGDYAIVQLANLADEKVAGWKSL
FT                   TVDTDKLAKQVDLKHVQEVRIWLKRNSADGYLGEFKLLPAVFSY"
FT   gene            complement(353977..355515)
FT                   /locus_tag="TERTU_0338"
FT   CDS_pept        complement(353977..355515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0338"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACR10717"
FT                   /db_xref="GOA:C5BM77"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR022055"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM77"
FT                   /protein_id="ACR10717.1"
FT                   /translation="MKDTKSLMRKAHFLGTKIRNLRKRNNLTIEDLSSRCVKVDAESAP
FT                   SVSYLSMIERGKRVPSESMLEVIARVFEKPPEWFLDEAPEDDDLTPVKSSSAGGITGIP
FT                   LEPNFLFSNEILQIAIPELLSQTGTTGRQFAHLLIRAHQEHYQNHFPDLERAAENIGKK
FT                   QLPLNHDALHDIIKQMGLKLAWFDTPGDDVREEIWHNENCIVTSYYDPRGTVFINRILE
FT                   AWPMRYKYDLAVHIGHCVLHDKDAYKTVLVAGHGQSSTLMEDDAFSHQSSSVNSQDILH
FT                   AWRDFECSFFAGALLCPKVPFRQMLDRYSYEVDVSKLVDVSESVAMRRMTAVSPYPHWH
FT                   YFDAYPPGKLKAVYRGNGIPLPWGNMRSVKDPCQHWSVFRMINTPVKGTASQLSILNVN
FT                   GSPRIYCCESKYVEDLAGQNHVLCAGIDLNPAIEAQGKDAHTLAQELKAICVSNGGSAP
FT                   VPAAIKRDLTTVARILNIAWVSRGIEGDARLICPRGTECPRVPSCYDGCEHTAP"
FT   gene            355679..357853
FT                   /locus_tag="TERTU_0339"
FT   CDS_pept        355679..357853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0339"
FT                   /product="putative malate synthase G"
FT                   /note="identified by match to protein family HMM PF01274;
FT                   match to protein family HMM TIGR01345"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12824"
FT                   /db_xref="GOA:C5BM78"
FT                   /db_xref="InterPro:IPR001465"
FT                   /db_xref="InterPro:IPR006253"
FT                   /db_xref="InterPro:IPR011076"
FT                   /db_xref="InterPro:IPR023310"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM78"
FT                   /protein_id="ACR12824.1"
FT                   /translation="MKLSLKNSSYMDANFYNFINEDVLPLAGVSRADFWRELEVLVDRF
FT                   SPENQQLLFQRDALQAQIDEWHKSHQGELFDAALYTAFLTEIGYLEPEADDFQVTTENV
FT                   DAEIAQLAGPQLVVPLKNARFALNAANARWGSLYDALYGTDVIPYDAGLKPGKRYNPAR
FT                   GQQVIQSGRDFLDEIFPLETGSHHNVSSYVVYYQHLLAFFADGSETGLQDPGQFVALNG
FT                   HKENPESILLKNNGLHVELVFDRHGEVGKNDLANLQDIQIEAALTTIMDCEDSVAAVDA
FT                   EDKLEVYRNWLGLVRGDLTAVFDKGGVAHTRRMNCDRVYTAGDGEEYRLPGRSLMLVRN
FT                   VGLAMNCDIMQTSQGEFVPEGIIDAVVTGLIGAIDIRDSARKKRNSRTGSVYIVKPKLH
FT                   GSREVAFTCALFSAVEELVGLTPNTLKIGIMDEERRTTLNLKACIREARERVVFINTGF
FT                   LDRTGDEIHTSMHAGAFMPKAWLKEQPWITAYENNNVDVGLACGLPGHGQIGKGMWPMP
FT                   DEMEKMMASKIAHPRAGANTAWVPSPTAAVLHALHYHRVDVGEVQDGLRERAPAARAEI
FT                   MQIPLLSAEDTLSSADIERELENNIQGILGYVVRWVELGIGCSKVPDINDIGLMEDRAT
FT                   LRISSQHIANWLLHGLCSLDQLDTLLLRMAAVVDAQNAATDGYQPMATDPATNLALQAA
FT                   RDLIVLGAEQPNGYTEHLLQKYRLQQKQRA"
FT   gene            357921..359519
FT                   /locus_tag="TERTU_0340"
FT   CDS_pept        357921..359519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0340"
FT                   /product="putative isocitrate lyase"
FT                   /note="identified by match to protein family HMM PF00463"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12489"
FT                   /db_xref="GOA:C5BM79"
FT                   /db_xref="InterPro:IPR006254"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM79"
FT                   /protein_id="ACR12489.1"
FT                   /translation="MNTYTNEIKNINRTLEQQGASWSAINAESVARMRLQNRFATGLDI
FT                   ARYTAKIMREDMAAYDRDPANYTQSLGCWHGFVGQQKMISIKKHFGETKGRYLYLSGWM
FT                   VAAMRSEFGPLPDQSMHEKTAVPDLIAELYTFLKQADARELHHLFKELDKARAGRDHVR
FT                   ERYVQKAVDGFQTHVVPIIADIDAGFGNEEATYLLAKKMIEAGACCIQIENQVSDAKQC
FT                   GHQDGKVTVPHEDFLAKIHAVRYAFMELGVEDGVIVARTDSLGAGLTQKIPVSTSAGDL
FT                   AQQYNAYIDGEAISDLREIAPGDLVLAQGDGCIKVKRLANGLVKFKPNTGEDRVVLDCI
FT                   TSLQHGADLLWIETEKPHIGQIAGMVNRIRAQVPNAKLVYNNSPSFNWTLNFRQQVFDA
FT                   WQQEGRDLTEYHRENLMSVEYDTTPLAQEADERIRTFQRDAAQQAGIFHHLITLPTYHT
FT                   AALSTDNLAKSYFGDQGMLAYVETVQRQEIRQSLACVKHQDMSGSNIGDDHKEYFSGGQ
FT                   ALKAAGEANTMNQFS"
FT   gene            359753..360451
FT                   /locus_tag="TERTU_0341"
FT   CDS_pept        359753..360451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0341"
FT                   /product="pirin domain protein"
FT                   /note="identified by match to protein family HMM PF02678;
FT                   match to protein family HMM PF07883"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13571"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR041602"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM80"
FT                   /protein_id="ACR13571.1"
FT                   /translation="MIVKRAAEERGPSDLGWLQSQHTFSFGGYQDPAHMGFGPLRVINE
FT                   DRVVPGAGFGTHPHKNMEIISYVLSGELAHKDSMGNGSRIVAGDVQVMSAGAGVTHSEF
FT                   NASDSEPVHFLQIWIQPNAVDTEPGYQQLSFAPEDLRNKLIQVVGGDARAPLQIKQDAS
FT                   LAIGRLEPGVELGETLVPTRKYWLQVASGELRVNGELAKAGDGLAIAGEAALAMAAITQ
FT                   TEILLFDLPA"
FT   gene            360561..361148
FT                   /locus_tag="TERTU_0342"
FT   CDS_pept        360561..361148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0342"
FT                   /product="NADPH-dependent fmn reductase domain protein"
FT                   /note="identified by match to protein family HMM PF03358"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13438"
FT                   /db_xref="GOA:C5BM81"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM81"
FT                   /protein_id="ACR13438.1"
FT                   /translation="MKVLFMAGSSRKESLNKKLAHAASDLARCAGADVTFIDLADFPMP
FT                   IYNGDLEDDSGLPENALALKKIFTEQDALFIATPEYNGSFPALLKNTLDWLSRSHYEGE
FT                   PRMSAYTNKVVALAAASPGGFGGMRSLMALRLQMAHLNTLVISQQMALAKAGDAFDEEG
FT                   SFKDDKKRAQLDALVKTLMATTRALAQDDTRA"
FT   gene            complement(361156..361977)
FT                   /locus_tag="TERTU_0343"
FT   CDS_pept        complement(361156..361977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0343"
FT                   /product="NAD(+)--dinitrogen-reductase
FT                   ADP-D-ribosyltransferase"
FT                   /EC_number="2.4.2.37"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11514"
FT                   /db_xref="GOA:C5BM82"
FT                   /db_xref="InterPro:IPR009953"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM82"
FT                   /protein_id="ACR11514.1"
FT                   /translation="MNKHSCDTLPAYARSALNRCNLPAIILGGITFQLHPKALRLDSMA
FT                   YLHQPFFRSIAEIHNPQKRSDCFHDYMSSCFLLDNKDEAGFNDNSRVKRAKADYLRLLR
FT                   GWLFNADGIEAAVLKYWVASRFGLLCQNHNGCLRDPHGRAFAQYQADFMRGLYNANALE
FT                   SQLDLLYSFCQYELVRRFPRRQHWHLYRGINHLTEFDVLAYGDDHEKVLLNNLNSFSAS
FT                   VDTAGIFGDRVLSVAVPSSKILYFPGLLPGVLQGEEEFLVLGGVYQVKHHR"
FT   gene            362014..362937
FT                   /locus_tag="TERTU_0344"
FT   CDS_pept        362014..362937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0344"
FT                   /product="ADP-ribosylation/Crystallin J1"
FT                   /note="identified by match to protein family HMM PF03747"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12003"
FT                   /db_xref="InterPro:IPR005502"
FT                   /db_xref="InterPro:IPR036705"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM83"
FT                   /protein_id="ACR12003.1"
FT                   /translation="MMTTQPQTQLDRKQRYRGSLLGLATGDALGTTVEFQPRGSFELIT
FT                   DMVGGGPFHLRPGQWTDDTSMALCLGHSLLEKRGFDADDQMQRYCAWRTHGYMSSNGRC
FT                   FDIGMTVSGALSRYQRKGDPFAGSTNPSAAGNGSIMRLAPVAMFFSPDLTQVRHFAALS
FT                   SRTTHGAEECVDACALFGEMLHLALCGASKEAILQPTFVPGAERLSAIQQGAYLGKSSH
FT                   QLKGSGYVVESLEAALWCFATTDSYANAVLTAVNLGDDADTTAAVCGQLAGAFYGEVAI
FT                   PDAWLGKLSHRSQITELADGLLQNNA"
FT   gene            complement(362972..365371)
FT                   /locus_tag="TERTU_0345"
FT   CDS_pept        complement(362972..365371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0345"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14300"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR025883"
FT                   /db_xref="InterPro:IPR035992"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM84"
FT                   /protein_id="ACR14300.1"
FT                   /translation="MTTKGHLAVAFFCLITLIGCNGSPEKTTPDIPDLSLQSLTINGNS
FT                   VALEKGKTATYEVDLTADTQTIDIKVGVTSEVESAFYTFSNGDRAISSTEFIPGDAITL
FT                   TVGDGTNRLTITLVDGTAETSLTYAVHLFRLSRDASLTGYVFYDNDDNSIVLSPTFSST
FT                   HYDYTANVDYDTCFYYGQFYTGYADNTVTLNGDDIDNAEIFARYLEPGENIFDTHVKAA
FT                   VGEREVIYSVGITREQPTETQLQANARLAQLTIDDTDMDFLCAQNVYSIAVNSDQPSLE
FT                   ITAKPEVDGIDMVIGDQDLTANEPITIPLADGDTLVQLVSTALNGSQTQTYSIYVYRRT
FT                   TNMVSVSSAAELQQALQNAQPNDQIVVAPGTYAGEIATSGNSEAHFYSGRSGTPLNPIY
FT                   LMAEDSDEDTVLRGNVIGTGTVLKLTGDNWRISGLEISQGATGVHLASASNNRLSDVDI
FT                   HDVTQALRINQGSTKNEISRCEFSAINGSNAPLVQVADAETSSAGSTRLKRNEFYTQGE
FT                   QPALYLAAGADSTLIEANRLQDLSTATSDDPVPLLLVHGNNTQLRFNSFYPVDTADARA
FT                   PLRVENPGNGWGNNTWVYGNWLVSTQTDLLLEAETATHLYATENLARAPIALEEDYRTA
FT                   TYSGGSVEVDTFTPPQFQIVLADETGSCLDLEEVNEVNIVIINPCSDAQTQRWTWEMAA
FT                   DTFMYLRNLSEDEYAYMMPTTSFTESCTSIASATSIAYLSTKRYGYAQQWAPIQGANDE
FT                   DYYLANRQNLNYGLTVAGGTYTPGTAAVVCPLSDSKRQTFLLREIE"
FT   gene            365579..367600
FT                   /locus_tag="TERTU_0346"
FT   CDS_pept        365579..367600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0346"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11089"
FT                   /db_xref="InterPro:IPR011043"
FT                   /db_xref="InterPro:IPR013517"
FT                   /db_xref="InterPro:IPR013519"
FT                   /db_xref="InterPro:IPR028994"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM85"
FT                   /protein_id="ACR11089.1"
FT                   /translation="MKTKNTLGSSLLLVVLPVLLSACGGSSGSKDDTSPDAFAFTDEED
FT                   VGLAQYVISDAIEIEGINTETPISIEGGEYSIDGGEYTDEEGEIVNGQIVRVRVMSSDE
FT                   LSTETEAVLTVGDEEDTFTVETVDIALSAHAGFKNIIFSWPTVTGAVSYSLLEKADENA
FT                   DFIQKGRTFSSAAVGYTMDVPIHKHDWLGAEYMLQACTNASCSTTEEISLYNYMRRSIG
FT                   YFKAPNTDEGDQFSVLDISADGRTIAVGAPAEDSGSRGVNQDDGNNSVSGSGAVYVYVK
FT                   DEDSWRIQAYIKADYPDEGDGFGSSVSLSSDGDTLVVGAPFEDGGDFAVDGEQADNTAR
FT                   DSGAVYVYQRFGDTWFEQNYLKASAGHEGAQFGSRVSISDFGATLAISAIGDEMPAGAN
FT                   AGAVFVYALTGDNWQAVQKVQPDDAQEGAQFGSALSISANGDRLLVGAEYFTTGATPAA
FT                   KTGKAYVFDLLGGTWEQTQALNASNPHDGMRFGAAVTLAADGARLAVGAPGEKSSGFGV
FT                   NGEQSDLAAADSGAAYIFADTAAGFVQTTYVKSDNSDPSDRFGSAVAMNATGDTLVVGA
FT                   IGESSVAQAIHGNVYDNSVTDAGAAYVFTRDADAWQQWRYVKSPNTDAGDRFGATLALD
FT                   ASGDSLIVGAPYEQSDATGLSGSQSNNTANKSGAVYLY"
FT   gene            367800..368657
FT                   /locus_tag="TERTU_0347"
FT   CDS_pept        367800..368657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0347"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12006"
FT                   /db_xref="GOA:C5BM86"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM86"
FT                   /protein_id="ACR12006.1"
FT                   /translation="MLWDILGILIAFASVMLFFSLMVTTLAQGVQQIAQQRYRVLRQQL
FT                   TDFAGQIGQEFPHTQAFLAQAIGQMLDESSFNGRLVKEVAHVGKEEIRSRILRICDGSA
FT                   EDQALPEGATTSLQLLDELFPKLETAMRHQFKAWMDRMALVLALILALVFHLNAFDLLR
FT                   SISANPEVAAAYSQYGAEQVAAGDIDTAKAGEPAVQEFNTVTKVVAQEFAIFQFTPFPQ
FT                   DCDCYLVTDGPNPVLRTLGNLLGILISTLLISLGAPFWFRTLHNLFRIRDQVVGADSGS
FT                   RSAG"
FT   gene            368748..369014
FT                   /locus_tag="TERTU_0348"
FT   CDS_pept        368748..369014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0348"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12985"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM87"
FT                   /protein_id="ACR12985.1"
FT                   /translation="MVRLILLGVALVICTAASAESVQEYCNNLYPADSYDASDRAVYVQ
FT                   ECVEMYAEDFAAPGPDSAVEEPSEPEDSGVDDMADGERETSYE"
FT   gene            complement(369034..369147)
FT                   /locus_tag="TERTU_0349"
FT   CDS_pept        complement(369034..369147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0349"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11107"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM88"
FT                   /protein_id="ACR11107.1"
FT                   /translation="MKKGGVHEKSRGAKRASQKRATRKLVSDQLGRSPLAA"
FT   gene            369766..371112
FT                   /locus_tag="TERTU_0350"
FT   CDS_pept        369766..371112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0350"
FT                   /product="putative Na+-driven multidrug efflux pump"
FT                   /note="identified by match to protein family HMM PF01554;
FT                   match to protein family HMM TIGR00797"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11585"
FT                   /db_xref="GOA:C5BM89"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM89"
FT                   /protein_id="ACR11585.1"
FT                   /translation="MKAKKPLNVWTTAIPLYFEMVAINSIGLVDVFFMSLVADKAVAAL
FT                   GACTQIILVFTLLSRTLCGGAGSIAGQSIGAKNRVRATLAFMYAMLIAIVFGAVFAAML
FT                   FVGRSLIPTWMGLQGEALGYASTYLAILGPAFFLLSLRLGYSTIVAVKGKSRVNLICAL
FT                   ISNAVNLVLNAIFVLGLFGAPKLGVVGVALATAVSHLVYLLAIAWVAHKYLHVRFIFVK
FT                   RVVDRLHELTRPVLGIAIPNCGDLLSYTMFQVVMVSIVIRIDELAAAAYTYVHQAMMFS
FT                   VLWSFSVSQGQAIWTAHLVGARQYEKVESEVKRSILRCLMFAMPITLVLYSISGQLFPL
FT                   FSDNPAIVSMATTAMLAYLGIEIGRAFNATLSFSLAAAGDARYPAILGFIFNWLVGVPV
FT                   AWFMGVHLGWGLIGALAGVAADELVRSPLNYYRLVSRRWIKYPDNQAKR"
FT   gene            371142..371738
FT                   /locus_tag="TERTU_0351"
FT   CDS_pept        371142..371738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0351"
FT                   /product="modulator of drug activity B"
FT                   /note="identified by match to protein family HMM PF02525"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13871"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM90"
FT                   /protein_id="ACR13871.1"
FT                   /translation="MKNIYIINGHEPYESSPGNLNRELVDRAQQQLQALGYSVKTTKPA
FT                   ENLDLEHEVNMHLWADAIIIQAPVNWMSVPWSMKRYIDLVASASFGQLWNGDGRSRENP
FT                   AAQYGSGGLASDKKYMLSLTFNAPEDAFNNSSQHFFAGQSVDDLFGHIHLVYKFMAMSA
FT                   LPTFVCYDVLKNPQIDSDFVRFGEHLNAAFPARNA"
FT   gene            complement(371808..372725)
FT                   /locus_tag="TERTU_0352"
FT   CDS_pept        complement(371808..372725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0352"
FT                   /product="putative L-lactate dehydrogenase"
FT                   /note="identified by similarity to SP:P13714; match to
FT                   protein family HMM PF00056; match to protein family HMM
FT                   PF02866"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13927"
FT                   /db_xref="GOA:C5BM91"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR018177"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM91"
FT                   /protein_id="ACR13927.1"
FT                   /translation="MKISIIGLGKVGSSLAFVLSQRNIAKELMLVGRRKESVMGDVLDL
FT                   RHGQLFVDAPTRITAGELADTANSDIIAICASVPTTPDMTDRLQQAPANVALLKAMFPI
FT                   LSDASPNAKIVMVSNPVDVLVHFALEFSGFAPHQIMGTGTLVDSARFRQLLADEIHIHM
FT                   EDIRAYILGEHGDSQFPAMSCADAGGEPIDDTPHRRELFKRASNAGFEVFKYKGYTNYA
FT                   IALAAADIIQSIASDTKNTMPISLKVNGFLGVDDVCLSLPAVVGARGVERVLHPKLDDK
FT                   EKQEFLHSAGVIREVINQVNAGLP"
FT   gene            complement(372780..373616)
FT                   /locus_tag="TERTU_0353"
FT   CDS_pept        complement(372780..373616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0353"
FT                   /product="glycoside hydrolase family 12 domain protein"
FT                   /note="identified by similarity to GB:CAA93274.1"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14297"
FT                   /db_xref="GOA:C5BM92"
FT                   /db_xref="InterPro:IPR002594"
FT                   /db_xref="InterPro:IPR013319"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM92"
FT                   /protein_id="ACR14297.1"
FT                   /translation="MNRIVSLLVALFLPIMLPIHAIAANTVLSCDAFASHPTPIGTLVN
FT                   NVWNQQAAGKARWEQCLLQRDGPNGPEYGWRWRWPATPRVVFAQPQITHGNTPWTSHPT
FT                   PQSGFPIPLTGLDHLTISYAVTTTGDADFNLATTFWLTDLDQVPPQADINSIRAEFMVW
FT                   SYASDNFFSTPAGRKRATVEINGIEWEVWVERRWHDTSGTNDNRWIYIAFRSTKNYLDI
FT                   TYNAAELVHYALQRGFLDSEWSIADIELGNEVMRGTGETWVHKFRVSTPALNTDNI"
FT   gene            complement(373644..373910)
FT                   /locus_tag="TERTU_0354"
FT   CDS_pept        complement(373644..373910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0354"
FT                   /product="Fe-S cluster protector protein"
FT                   /note="identified by match to protein family HMM PF04362"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12807"
FT                   /db_xref="GOA:C5BM93"
FT                   /db_xref="InterPro:IPR007457"
FT                   /db_xref="InterPro:IPR036766"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BM93"
FT                   /protein_id="ACR12807.1"
FT                   /translation="MTRTVHCRKYNKEMEGLAVPPLPGAKGTELFNSVSKQAWQEWLQH
FT                   QTMLINEKQLNLMDLTARAYLTEQMEKFLSGADYDQADGYVPK"
FT   gene            complement(373907..374965)
FT                   /gene="mutY"
FT                   /locus_tag="TERTU_0355"
FT   CDS_pept        complement(373907..374965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutY"
FT                   /locus_tag="TERTU_0355"
FT                   /product="A/G-specific adenine glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /note="identified by match to protein family HMM PF00633;
FT                   match to protein family HMM PF00730; match to protein
FT                   family HMM TIGR01084"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13439"
FT                   /db_xref="GOA:C5BM94"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM94"
FT                   /protein_id="ACR13439.1"
FT                   /translation="MSSFADRLLAWFDDHGRKNLPWQHPITPYRVWLSEIMLQQTQVET
FT                   VIPYFERFVAKFSGFASLAEAPLDEVLHLWTGLGYYARARNLHRCAQQVVAQHGGDMPS
FT                   DMAELEQLPGIGRSTAAAIASIAFEQPCAILDGNVKRVLARYHAVEGWPGKSSVHDTLW
FT                   QFAEKHMPRERCRDYTQAIMDLGATLCTRANPQCEVCPMRRGCKAKKTGQPQSFPGKKP
FT                   RKILPVKTVQMLIMRNPQGQVLLLQRPPTGIWGGLWSFPEIETGSDCENHIAAQFGRVQ
FT                   HLTRWPVMRHTFSHYHLDIAPVVADLLPRPQNIAEADSRVWYNLKSPPALGLAAPVKKL
FT                   LTLLDEFNLEAQ"
FT   gene            375138..376229
FT                   /gene="gcvT"
FT                   /locus_tag="TERTU_0356"
FT   CDS_pept        375138..376229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvT"
FT                   /locus_tag="TERTU_0356"
FT                   /product="glycine cleavage system T protein"
FT                   /EC_number="2.1.2.10"
FT                   /note="identified by match to protein family HMM PF01571;
FT                   match to protein family HMM PF08669; match to protein
FT                   family HMM TIGR00528"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12644"
FT                   /db_xref="GOA:C5BM95"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR022903"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BM95"
FT                   /protein_id="ACR12644.1"
FT                   /translation="MLKQTPLFDLHRDMGGKLVDFGGWNMPVNYGSQIEEHHAVRNGAG
FT                   MFDVSHMTVVDIQGTGARDFLRYLLANDVDRLKLPGKALYTGMLNESGGVIDDLIVYLM
FT                   VNGYRLVVNCATREKDLAWINSQAEAYDVTVIERPELAMIAVQGPLARGKVHDLIGAAV
FT                   LEELKIFQGVPLSGEGYADWFVARTGYTGEDGYEIILPAEAAVQLWQDLARIGVTPCGL
FT                   GARDTLRLEAGMNLYGHEMDDDTSPLVANMAWTVAWEPAERNFIGREALTAEKSAGISH
FT                   KLVGLVYTGKGVLRAEQEVTAPGVDGVGVITSGTFSPTLGYSIALARVPVGFTDQAVVN
FT                   VRNRQLEVKIISPCFVRSGNKVF"
FT   gene            376271..376663
FT                   /gene="gcvH"
FT                   /locus_tag="TERTU_0357"
FT   CDS_pept        376271..376663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvH"
FT                   /locus_tag="TERTU_0357"
FT                   /product="glycine cleavage system H protein"
FT                   /note="identified by match to protein family HMM PF01597;
FT                   match to protein family HMM TIGR00527"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11908"
FT                   /db_xref="GOA:C5BM96"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BM96"
FT                   /protein_id="ACR11908.1"
FT                   /translation="MSEIRSELKYLSSHEWARVEEDGTVTIGITDHAQEALGDVVFVET
FT                   PEVGSQVSAGEEAGVVESVKAASDIYSPVTGEVIAVNELLEEAPETVNESPYDEGWFFK
FT                   VKPSDVSELDGAMDSEAYVKSVEDDS"
FT   gene            complement(376819..377694)
FT                   /locus_tag="TERTU_0358"
FT   CDS_pept        complement(376819..377694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0358"
FT                   /product="HDOD domain protein"
FT                   /note="identified by match to protein family HMM PF08668"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11454"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM97"
FT                   /protein_id="ACR11454.1"
FT                   /translation="MSTELTPEQIQKVLQGIAIPPQPQVLVDLQMEQLKPDWSIQEIAR
FT                   LICQDVGLSGSILKTVNSPFYKHSNTITSIDQAVNLLGVNSVVNLVNALSIKGALSDDD
FT                   IIALGRFWDTAMDIAITSSVIAKQIGVPNPEEAYTLGLFHNCGVPLLMSRFANYNQVMI
FT                   AAYADAGERIVEVENRLINTNHAVVGYYVAKSWNLPDYLCEAIHEHHRIMKTFAEESAS
FT                   ARKKTLLAVLKMAEHICGNYRILGQQNEDYEWARIQEIVWMYTGLTEYEFASLKLQIEE
FT                   MGLGSLTYYD"
FT   gene            complement(377784..378779)
FT                   /locus_tag="TERTU_0359"
FT   CDS_pept        complement(377784..378779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0359"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF09375"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACR10691"
FT                   /db_xref="InterPro:IPR018976"
FT                   /db_xref="InterPro:IPR038352"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM98"
FT                   /protein_id="ACR10691.1"
FT                   /translation="MSEQNKTYWDTGSHALASSLNAAQKLQALIRAFLANPSGDSLAAA
FT                   QEQWIHTESAWQSFFFYSQWPVTLTDVYAPLSPLLFNIGARPIQPGYLDYVGPYPYAGL
FT                   VHDISVPLSAESLEEQHGMMDAEAAALGIYAIEFMLFGEQNTRPSSDYQPATTLTSAQR
FT                   EQGFQQAIELPANRRRELLNLQTDLLVAHLTALQTLWNDDSKNSIRSHWQRMSNDAQQV
FT                   AMLSNLERTTTHLLLEIARATPNAQPAEPIDGKPLSPSALAQAVSSLKIASAWLVDPEP
FT                   IDARACFDNVATQLRNATTVEAWSDIYQLFRTCANSDASATLPSLQEQDG"
FT   gene            complement(378934..379587)
FT                   /locus_tag="TERTU_0360"
FT   CDS_pept        complement(378934..379587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0360"
FT                   /product="HAD-superfamily subfamily IB hydrolase"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01488; match to protein
FT                   family HMM TIGR01490"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14436"
FT                   /db_xref="GOA:C5BM99"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C5BM99"
FT                   /protein_id="ACR14436.1"
FT                   /translation="MSLAIFDLDNTLIGGDSDHAWGEFLVAEKIVDADTHSRTNDRFYE
FT                   DYKRGTLDIHAYLRFALAPLKQYNMTELDELHQRFFAACIRPLWLPKAEALIASHRQQG
FT                   HRLLVITATNRFITAPIVAALGIDDLLASDAEIVDNRYTGEPSGIPCFQQGKVARLKNW
FT                   LAETGETLANSYFYSDSANDLPLLQVVDQPVAVDPDERLRAFAEQHQWPILSLR"
FT   gene            379713..380228
FT                   /locus_tag="TERTU_0362"
FT   CDS_pept        379713..380228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0362"
FT                   /product="nudix hydroxylase"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11271"
FT                   /db_xref="GOA:C5BMA0"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR022927"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BMA0"
FT                   /protein_id="ACR11271.1"
FT                   /translation="MIDTDGFRPNVGIILADGSGRVLWARRVGGQDAWQFPQGGIKESE
FT                   SAEQALYRELQEEVGLKAEDVEILAVTQGWLRYRLPQKLVRQKEPRCVGQKQKWFLLKM
FT                   LAEDSAVDLIGGGPPEFDEWRWVSYWYPLSKVVSFKREVYRRALKELVAPHNSLLSGLP
FT                   LVDGESLC"
FT   gene            380222..382483
FT                   /gene="ptsP"
FT                   /locus_tag="TERTU_0363"
FT   CDS_pept        380222..382483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsP"
FT                   /locus_tag="TERTU_0363"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase"
FT                   /EC_number="2.7.3.9"
FT                   /note="identified by match to protein family HMM PF00391;
FT                   match to protein family HMM PF01590; match to protein
FT                   family HMM PF02896; match to protein family HMM PF05524;
FT                   match to protein family HMM TIGR01417"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACR10946"
FT                   /db_xref="GOA:C5BMA1"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMA1"
FT                   /protein_id="ACR10946.1"
FT                   /translation="MLNSLRSIVQEVNAAADLNSVLEIIVTRVKQAMKTEVCSVYLRDN
FT                   ERQFVLMATEGLHKSAVRRVKLSEKEGLVGHVASREEPLNLDDAESHPRYQYFPETGEE
FT                   RFSSFLGVPIIHHRQILGVLVIQQREKRKFDEGEEAFLVTMSAQLAAVIAHAEATGALR
FT                   GMGKKTEVRFNGVPGASGVAIGVCVVASPVADLNSVPCQTCESVDAELEFFQQGLSLVR
FT                   ADVRRLASELESRLNREERVLFDAYIGMLEDTSLAQEVTEKISQGFAAPYAWSSVILEH
FT                   VKTFSSMHDPYLRERASDVRDLGCRVLACLQESSRKERVYPDNTILVGEDLSASVLAEV
FT                   PPGKLAGIVSTRGSSNSHIAILARSIGIPTVMGAVDLPFTHLDGRELIVDGYRGSVYSD
FT                   PSDGLRAQYQVIVDEDVQLVAGLEALKDLPCETVDHHRVALWVNTGLMADAMISLERGA
FT                   EGVGLYRTEIPFMLRDRFPSEEEQRQTYRDQLQAFAPHTVTMRTLDVGGDKSLPYFPIE
FT                   EENPFLGWRGIRVTLDHPEIFLVQIRAMLKASEGLNNLRIMVPMVSNVAELEIAQMLLY
FT                   RAYDELLEEGFQIEMPPFGVMIEVPGAVYQAKDFAARVDFLSVGSNDLTQYLLAVDRNN
FT                   PRVADLYHSLHPAVLRALRAIVVDSHSQGVPVSICGELAGDPAAALLLMAMGYDVLSMS
FT                   ATNLLKVKSVVRSVTLEQAERLLSEVMRLPDTESINRVIDATFRNTGLTRIVRPLGDDT
FT                   "
FT   gene            382563..383423
FT                   /gene="lgt"
FT                   /locus_tag="TERTU_0364"
FT   CDS_pept        382563..383423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lgt"
FT                   /locus_tag="TERTU_0364"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /EC_number="2.4.99.-"
FT                   /note="identified by match to protein family HMM PF01790;
FT                   match to protein family HMM TIGR00544"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12474"
FT                   /db_xref="GOA:C5BMA2"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BMA2"
FT                   /protein_id="ACR12474.1"
FT                   /translation="MLKYPEIDPVALSLGSVTVFGKTINLPDIHWYGLMYLFGFILCWA
FT                   VGTYRAGKPHNVVHKSWLEDLVFYVAMGVVLGGRCGYVFFYNFGAFLDDPLWLFRVWEG
FT                   GMSFHGGLLGVILAMMLYARKMQVRFLDLMDFVAPLVPIGLGLGRIGNFIGQELWGRVT
FT                   TLPIGMVFPKDPGVARHPSQLYQAALEGLVLFAVLFWFSSKPRPRAAVASLFLILYGCF
FT                   RFAVEFVREPDAHIGFDMFGWLTRGQELSLPMIIIGALIFFYAYRHPAYAEKAPDPRAN
FT                   GSKKG"
FT   gene            383427..384260
FT                   /gene="thyA"
FT                   /locus_tag="TERTU_0365"
FT   CDS_pept        383427..384260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thyA"
FT                   /locus_tag="TERTU_0365"
FT                   /product="thymidylate synthase"
FT                   /EC_number="2.1.1.45"
FT                   /note="identified by match to protein family HMM PF00303;
FT                   match to protein family HMM TIGR03284"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13608"
FT                   /db_xref="GOA:C5BMA3"
FT                   /db_xref="InterPro:IPR000398"
FT                   /db_xref="InterPro:IPR023451"
FT                   /db_xref="InterPro:IPR036926"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BMA3"
FT                   /protein_id="ACR13608.1"
FT                   /translation="MKQYLELMRHVRDNGVRKEDRTGTGTVSVFGYQMRFDLSQGFPLV
FT                   TTKKCHLKSIIHELLWFLNGETNIAYLNNNGVKIWDAWATESGDLGPIYGAQWRSWPAQ
FT                   NGETLDQISQLIEQIKHKPDSRRLIISAWNPALLPDESISPQDNVRNGKMALPPCHTLF
FT                   QFYVLEGRLSCQLYQRSADIFLGVPFNIASYALLTMMIAQVTGLAPGDFVHTFGDAHLY
FT                   LNHLEQVDTQLQRQPLPLPTMAINPAVKDIFGFCFDDFELQNYQAHPHIAAPISV"
FT   gene            384265..384786
FT                   /gene="folA"
FT                   /locus_tag="TERTU_0366"
FT   CDS_pept        384265..384786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folA"
FT                   /locus_tag="TERTU_0366"
FT                   /product="dihydrofolate reductase"
FT                   /EC_number="1.5.1.3"
FT                   /note="identified by match to protein family HMM PF00186"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13123"
FT                   /db_xref="GOA:C5BMA4"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR017925"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMA4"
FT                   /protein_id="ACR13123.1"
FT                   /translation="MTVSDEISIALVVGVAANGVIGRDNGLPWRLPKDLAYFKRVTMGH
FT                   PIVMGRKTFDSIGRPLPGRTNIVVTRNPTWQAEGVDVCHSLEDALVLARDVATQTQVKQ
FT                   IMVIGGAEFYRQMLPQADRLYLTEVHADVVGDAYFPEFDRSRWQQLSAERHEADSGNPY
FT                   AYSFLVLERR"
FT   gene            385108..385893
FT                   /locus_tag="TERTU_0368"
FT   CDS_pept        385108..385893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0368"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14237"
FT                   /db_xref="InterPro:IPR016866"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMA5"
FT                   /protein_id="ACR14237.1"
FT                   /translation="MKKQRIKAVALTTVLSAGALLVGTAHADKTLDAIMQVGQAKTTAG
FT                   VQSQKKIDKLAEETSDLLQKYKTVNKEIEGLRVYNSQLEKQLASQLKVLEDLNTSIDQV
FT                   TVIERQIQPLILRMLEGLEQFVNLDVPFHMEERLKRVETLRDNQDRADISVAEKFRQVL
FT                   EAYNIEAEYGRKIDTYVDTLEVGGQERQVNILAVGRIALMYQTTDTKLSGAWDQRQRAW
FT                   VELDAGAYRAAILKGIRIAKKQASIDVMELPILAPEAAQ"
FT   gene            385890..387266
FT                   /locus_tag="TERTU_0369"
FT   CDS_pept        385890..387266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0369"
FT                   /product="transporter, proton channel domain containing
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01618"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11274"
FT                   /db_xref="GOA:C5BMA6"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR017270"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMA6"
FT                   /protein_id="ACR11274.1"
FT                   /translation="MKMNLKKAIVAVAAAGAIALSGSVMAQDKAASLDELLQMVKNSQI
FT                   AENKENRQREAQFRKQRANQANMLAQAEATKKAEEDRSARLEQQHKEREQDVQAARQQL
FT                   DDRLGSLKELFGHLTSTAGDLRAALDSSIVSVQYPGRTQFISELIEKMNSETKLPSIEE
FT                   IERLWYELQRETVEGGKVVKFNSVVSDPAGNKAEREVVRIGNYNLLSDGKYLTYDVKSG
FT                   SLNELPRQPGDHMKGAAAIQQATSGFTKVGIDPTGPAGGTLLSALINSPSIVERWHQGK
FT                   LVGYIITGVGVFAILLALFRFVVLSAMGAKVSRQLKSNTASTDNPLGRVLKVAEENKGA
FT                   DTETLELKLEEATLKELPRIESGLNLLKIISMVAPLLGLLGTVTGMIVTFQAITIYGAG
FT                   DPKAMAGGISGALVTTVLGLCVAIPTVLLHTFLNGKAKRIVHVLEEESAGLIAEKSESK
FT                   "
FT   gene            387329..387856
FT                   /locus_tag="TERTU_0370"
FT   CDS_pept        387329..387856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0370"
FT                   /product="lipid A export ATP-binding/permease protein MsbA"
FT                   /note="identified by match to protein family HMM PF01618"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACR10729"
FT                   /db_xref="GOA:C5BMA7"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMA7"
FT                   /protein_id="ACR10729.1"
FT                   /translation="MLAMMEALAAIKAFVASGGPILYWIAALAFAMWTLIFERLWFYKG
FT                   SLGKIKAQTVELWEARGERKSWNSRQIRKALISRAASKINQNLDLLGTMVTLCPLLGLL
FT                   GTVTGMIEVFNVLAVTGGGDAKSMASGVSRATIPTMAGMVAALSGVFGTTLINRIAERE
FT                   NHMLEDQLTMDH"
FT   gene            387895..388296
FT                   /locus_tag="TERTU_0371"
FT   CDS_pept        387895..388296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0371"
FT                   /product="transport energizing protein, ExbD/TolR family"
FT                   /note="identified by similarity to SP:Q9ZHV9; match to
FT                   protein family HMM PF02472"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12506"
FT                   /db_xref="GOA:C5BMA8"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMA8"
FT                   /protein_id="ACR12506.1"
FT                   /translation="MSRKIKAEEETGAIDLTPMLDVVFIMLIFFIVTASFIKEPGIQVN
FT                   RPDATTAALKKNANILIAINDQNEIWINKNEVDIRQVKTQIQLLLAENPKGAVVIQADK
FT                   DSNIKTLTEVTQKAREAGVGDVSVSAENR"
FT   gene            388304..388912
FT                   /locus_tag="TERTU_0372"
FT   CDS_pept        388304..388912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0372"
FT                   /product="TonB domain protein"
FT                   /note="identified by match to protein family HMM PF03544;
FT                   match to protein family HMM TIGR01352"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12525"
FT                   /db_xref="GOA:C5BMA9"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMA9"
FT                   /protein_id="ACR12525.1"
FT                   /translation="MSIVRLLSSLAPAALVTLGLLLLMHVLILRNMTEPEESKEFKIPE
FT                   ILMPEREITTEYDTSRPEKPQEPEEPPPELPEPEFDNPDVQMDISFAPQINTGGVQISG
FT                   IGGFSSDGDYLPIVKVAPKYPARAANRGLEGYCTVEYTVTKTGETRDISVVDCPDSVFA
FT                   SASVKAAEKFKYKPKVIDGEPIEVPGVRNRFTFQMAKDK"
FT   gene            388929..390302
FT                   /locus_tag="TERTU_0373"
FT   CDS_pept        388929..390302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0373"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="identified by match to protein family HMM PF00515;
FT                   match to protein family HMM PF07719"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13460"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMB0"
FT                   /protein_id="ACR13460.1"
FT                   /translation="MNKFYSKKVSHFGRCLLLATAATLAAPALEKAVNAAGFNVDLGAK
FT                   AFAQDTKKKRALPGISEAFFKKLGKVADLASPPERKDGTQPPGDFNAALKELKDVEKDC
FT                   SKCNAYELAQIYNYYGWIYYSLEDFKNSIKYYRKVIEQSPNIPWGLELQVTYTLVQLMF
FT                   AQEDYADALKMLNTWMGISDTIGDDAYYLKSQICYQMDDKACALENINIAVKMAEKDGN
FT                   VAKEPWLSLQKALYLEKEDYKSSLPIIEKMVRHYPKKSYWQQLAGVYGMLEREKDQYYT
FT                   LDAAYTMGALEKEQQLLNLAYLSMANEYPYKAAKIVEKGMKDKIIAENAKNLETLAIAW
FT                   RQAKDTDKAIPAMQRAAEKSDNGDLYGQLLGLYLYIDDNKKAVEAGKKALAKGDLKRAG
FT                   EINLNLGIAHLELAQYESAIKAFKKAKEDKRVKRTADNWLQHAQREKFRAEQLAAAAG"
FT   gene            complement(390679..392517)
FT                   /gene="ilvD"
FT                   /locus_tag="TERTU_0374"
FT   CDS_pept        complement(390679..392517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvD"
FT                   /locus_tag="TERTU_0374"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="identified by match to protein family HMM PF00920;
FT                   match to protein family HMM TIGR00110"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11853"
FT                   /db_xref="GOA:C5BMB1"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BMB1"
FT                   /protein_id="ACR11853.1"
FT                   /translation="MPEYRSRTTTAGRNMAGARALWRATGMKDDDFQKPIIAVVNSFTQ
FT                   FVPGHVHLKDLGQLVAREIEKAGAVAKEFNTIAVDDGIAMGHDGMLYSLPSRDIIADSV
FT                   EYMVNAHCADAMVCISNCDKITPGMLMAAMRLNIPCIFVSGGPMEAGKTKLAEHNLDLV
FT                   DAMVIAADDTASDETVAEYERSACPTCGSCSGMFTANSMNCLTEVLGLSLPGNGTVLAT
FT                   HADRRKLFEQAGQQIVAITRDYYEQDNVNVLPRSIGSKAAFENAITLDIAMGGSTNTIL
FT                   HLLAIAQEAEVDFDLKDIDRLSRKVPQLCKVAPNTQKYHIEDVHRAGGIYGILGELERG
FT                   KLLDSSVPTVHSTTLSAAIAKWDIQQTSDDQVAHFYRAGPAGIPTQVAFSQDTRWPSLD
FT                   GDRAQGCIRNVANAYSQEGGLAVLYGNIAADGCVVKTAGVDDSILVFEGPAHITESQDE
FT                   AVANILAGKVQAGEVVIVRYEGPKGGPGMQEMLYPTSYLKSKGLGKNCALLTDGRFSGG
FT                   TSGLSIGHVSPEAAAGGAIGLVRNGDIIRIDIPNRSIDVKLSDDELTARREAQNELGWK
FT                   PAELRPRKVSAALKAYAKLATSADKGAVRDLSQLDD"
FT   gene            392518..392637
FT                   /locus_tag="TERTU_0376"
FT   CDS_pept        392518..392637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0376"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12760"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMB2"
FT                   /protein_id="ACR12760.1"
FT                   /translation="MRTPSGGENWLRRIPDSRSDYARGNTSGYVGIMLAELTV"
FT   gene            complement(392596..394269)
FT                   /locus_tag="TERTU_0375"
FT   CDS_pept        complement(392596..394269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0375"
FT                   /product="response regulator receiver protein"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00515; match to protein
FT                   family HMM PF07719"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14379"
FT                   /db_xref="GOA:C5BMB3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMB3"
FT                   /protein_id="ACR14379.1"
FT                   /translation="MNLDLKSENELRQIDIVKIYNNKKCLIVDDFPEIRGSLTRTLRTF
FT                   GVNSVDTAANGEEAIRACSFKKYDIVLCDYNLGAGKDGQQILEEVRYLRVLLMTSLFVM
FT                   ITGESSREMVLGALECQPDDYITKPYTQQSLRVRLNKAIVRHETLLPIKKFISDGDYRA
FT                   ALDTCNQMIADNSRYAGDCLKIKGQLHFLLKQLKEAQKLYESVLGKKPLVWAKLGMGKT
FT                   QLALGNYDSAEEILNSIIEEDERYVEAHDLLAEVHKERKDFAAAQRATENATRVSPKSV
FT                   LRHRQLAELAEQNNDDEIALKSHQNAIRWGFNSCHESEQDYFNYARKVSEVVQGDNSNN
FT                   AKTLTRQGHNFLDRARKRFADRPEIAVQAQLVEIQLHLGSGEQKKAEAAVEKAREMYND
FT                   LATPPVETSLEMARTLHAMNNEDEARELLTQLAARHENDPDILQMIDGITGEPISDKGK
FT                   VVATKLTKAGIEHYETKNFAEAIDVFLEALANYPKHIGLNLNLIQAILADTEANGFSER
FT                   YEKLCRRSLRAVGTVGPEHKQHKRYAFLYRQLGKHYPNVT"
FT   gene            complement(394497..395822)
FT                   /gene="argA"
FT                   /locus_tag="TERTU_0377"
FT   CDS_pept        complement(394497..395822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argA"
FT                   /locus_tag="TERTU_0377"
FT                   /product="amino-acid N-acetyltransferase"
FT                   /EC_number="2.3.1.1"
FT                   /note="identified by match to protein family HMM PF00583;
FT                   match to protein family HMM PF00696; match to protein
FT                   family HMM TIGR01890"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11631"
FT                   /db_xref="GOA:C5BMB4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR010167"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR033719"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMB4"
FT                   /protein_id="ACR11631.1"
FT                   /translation="MSTESNNYIQWFRHTSPYINSHRGKTFVVLLPGDCISQDNFPNII
FT                   NDLTLLSSLGVRLVVVHGARRQIDEQLAVINSETEFHKGVRITTREQMGEVLKAIGHAR
FT                   FTIEAAFSSGLPDSPMYGSKIRVRCGNFVTAMPQGVIDGIDHQLTGKVRSVDASGIRAM
FT                   LDQNSLALVSPLGYSLTGEAFNLSFADVAIAIANALRADKLIAYNDDGPITDSQGEQFR
FT                   ELTLLQCERFLLEKQQHNRSNTYFSLRACYQACDGGVSRAHVVSACDDGALIKELYTRD
FT                   GSGTMVYRDSYETIRRARIEDVVGILNLIEPLEQKGILVKRSREHLETEIGFFTVMEKD
FT                   NLIVGCAALYPIANSEAGELACVAMHNEYRGDGRAAKLLTHIERQAHKLNFTQLFALTT
FT                   QTAHWFLEQGFRECDVEQLPGERKALYNYQRRSKVFVKAVQT"
FT   gene            complement(395881..397047)
FT                   /gene="argE"
FT                   /locus_tag="TERTU_0378"
FT   CDS_pept        complement(395881..397047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argE"
FT                   /locus_tag="TERTU_0378"
FT                   /product="acetylornithine deacetylase"
FT                   /EC_number="3.5.1.16"
FT                   /note="identified by match to protein family HMM PF01546;
FT                   match to protein family HMM PF07687; match to protein
FT                   family HMM TIGR01892"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14168"
FT                   /db_xref="GOA:C5BMB5"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010169"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMB5"
FT                   /protein_id="ACR14168.1"
FT                   /translation="MIDTRLFTRRLADLIAQPSVSCTSPQLDMSNRNVVELLAEWLAAK
FT                   QFQVEFQELPDNKANLIATRGSGPGGLVLSGHTDTVPCNPDRWEQDPFTLSSRDNRFYG
FT                   LGATDMKGFFPVVLAALDRLDEHLDKLQQPVIVLATADEESSMSGARALVKAGLPKARY
FT                   AVIGEPTCMHPIRMHKGIMMEAIRIQGLAGHSSNPALGHNAMESMHAVLGELLKFRSEI
FT                   QAKYSNQGFAIPFPTLNPGYIHGGDNPNRICGHCEMHFDLRPLPGMDIGDLHHQLEQRL
FT                   TPIGDAHNTPLTLENLIGGIDAYEQSADSELVLLAEKLTGFKSESVAFATEAPFLQKLG
FT                   MQTLVMGPGSIDQAHQPNEYMAHEQVAPAVDVIANLITQLCLQTTSAA"
FT   gene            complement(397081..397884)
FT                   /locus_tag="TERTU_0379"
FT   CDS_pept        complement(397081..397884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0379"
FT                   /product="phenazine biosynthesis PhzRF"
FT                   /note="PhzF family, phenazine biosynthesis, isomerase-like;
FT                   identified by match to protein family HMM PF02567; match to
FT                   protein family HMM TIGR00654"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13774"
FT                   /db_xref="GOA:C5BMB6"
FT                   /db_xref="InterPro:IPR003719"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMB6"
FT                   /protein_id="ACR13774.1"
FT                   /translation="MEFTVYQVDSFSNRPFAGNPAAVLVLERSLDEETMRNIAAEMNLS
FT                   ETAFAVRDGDRFGLRWFTPTTEVALCGHATLATAHVLFNHLGYSADTLYFDTLSGELRT
FT                   RKADTGLIEMDFPTATLTPVSATNEIIDAISARPLALMTDGTKLLVELDSARKVCNLNP
FT                   DMDRLRKLPYMGVCCCALANDYVADPQPDFVSRFFAPASGIPEDPVTGSAHTLLMPHFG
FT                   NKLGRKTLQARQISARGGDLHLEQKGDRVLIAGTAVTVMKASLYL"
FT   gene            398015..399793
FT                   /locus_tag="TERTU_0380"
FT   CDS_pept        398015..399793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0380"
FT                   /product="ATPase, PulE/Tfp pilus assembly"
FT                   /note="identified by similarity to SP:P37093; match to
FT                   protein family HMM PF00437; match to protein family HMM
FT                   PF05157"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12049"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMB7"
FT                   /protein_id="ACR12049.1"
FT                   /translation="MKSDFLAERALDLRSLLLDLVDEGFVQQEEANMVMGAHRTREQTL
FT                   MHPLTYLASQELENLRVPGKKMDELTLTEWLAEKAGLPLFHIDPMKIPVAKVAEVMSYQ
FT                   FAKRHGLLCVGVTAEIVTIAVSQPFITEWEMQLAQTVRQQIKRVFARPSDLNRYRVEFY
FT                   SLARSVSGAEDGGGNTRSGAANFEQLLELGRLKDPEANDQHVVNIVDWLLQYAFDQRAS
FT                   DIHLEPRREICRMRFRIDGVLHNIYEFPANVATAIVSRLKILGRMNVAEKRKPQDGRIK
FT                   TKRPNGMEAELRLSTLPTAFGEKLVMRIFDPDVLFRTFEQLGLMGDDFKRWNSMTGKPH
FT                   GILLVTGPTGSGKTTTLYSSLRQLATEQVNVSTIEDPIEMVEEAFNQTQVQHNIEFDFA
FT                   AGIRTLMRQDPDIIMVGEIRDRETAQMAVQAALTGHLVLSTLHTNDAASAITRLLDLGV
FT                   PSYLLRSTVLGVMAQRLIRTLCPHCKSESTISSSDWENLVRPWKVARPPKVYAPEGCLE
FT                   CRNTGYLGRQGIYEILTLTDSVQQHISDTLDLQAMRQQAMRDGMRTLRLSGAQKIAQGR
FT                   TTLAEVLRVAPPPESS"
FT   gene            399765..399983
FT                   /locus_tag="TERTU_0381"
FT   CDS_pept        399765..399983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0381"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12869"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMB8"
FT                   /protein_id="ACR12869.1"
FT                   /translation="MLHRHQRVASPANLARVSTNIIFSESAIHPKNGGFFYYVCAIRNT
FT                   LFERLFPSPRVKLARIALYQIEFSGAA"
FT   gene            400094..402379
FT                   /gene="pflB"
FT                   /locus_tag="TERTU_0382"
FT   CDS_pept        400094..402379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pflB"
FT                   /locus_tag="TERTU_0382"
FT                   /product="formate acetyltransferase"
FT                   /EC_number="2.3.1.54"
FT                   /note="identified by match to protein family HMM PF01228;
FT                   match to protein family HMM PF02901; match to protein
FT                   family HMM TIGR01255"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13134"
FT                   /db_xref="GOA:C5BMB9"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR004184"
FT                   /db_xref="InterPro:IPR005949"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMB9"
FT                   /protein_id="ACR13134.1"
FT                   /translation="MNIKAEISEKASEVASGPVCDPWAGFAAGPWQESVDVRDFLQRNY
FT                   TPFDGDDAFLAGPTHRTETLWKEVLELLKAEQAAGGPLDFDADTPATVTSHKPGYINLA
FT                   LEKIVGLQTDAPLKRAIVPFGGIRMVQTSCETYGKELNPAVLEVFSKYRKTHNQGVFDA
FT                   YTPEILRCRKAGVITGLPDAYGRGRIIGDYRRVALYGIDFLIKAKKAEKAETESWDMVE
FT                   DTIRLREELSEQITALQDIKAMAASYGSDISHPAKTAREAIQWTYFAYLAAVKSQNGAA
FT                   MSIGRVSSFLDIYIERDMRNGLLTEAEAQELIDDLVIKLRLVRFLRTPEYDELFSGDPT
FT                   WVTESIAGMGCDGRSLVTKNSYRVLQTLYNLGPAPEPNLTVLWSNKLPKGFKDFCAKVS
FT                   IDTSSIQYESDDLMRDRFGDDYGIACCVSAMPIGKQMQFFGARANLAKTLLYAINGGVD
FT                   EKIGLQVGPAAEVMVDDVLEYDKVMERFDTYMAWLARTYVAALNAIHYMHDKYAYETPL
FT                   MALHDRDVKRTLACGIAGLSIVADSLSAIKYAKVTPVIGEDGLVKDYVTEGDYPKYGNN
FT                   DDRVDQIACDVVSRFMNHVRANKTYRNAEPTQSVLTITSNVVYGKKTGNTPDGRRAGEP
FT                   FAPGANPMHGRDTNGALASLLSVAKLPYGDSEDGISYTMSMVPNALGTDDQAKTSNLVG
FT                   LLDGYFGSAGHHVNVNVLARELLVDAMEHPEKYPQLTIRVSGYAVNFNKLTKEQQQDVI
FT                   SRTFHGCC"
FT   gene            402519..403073
FT                   /locus_tag="TERTU_0383"
FT   CDS_pept        402519..403073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0383"
FT                   /product="putative nicotinate-nucleotide
FT                   adenylyltransferase"
FT                   /note="identified by match to protein family HMM PF01467;
FT                   match to protein family HMM TIGR00125"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14689"
FT                   /db_xref="GOA:C5BMC0"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMC0"
FT                   /protein_id="ACR14689.1"
FT                   /translation="MAAASIGVLGSAFNPPHNGHADVVAQALAEFDRVLLVPSYRHAFG
FT                   KNMLPYHWRLQMVAALVEAIADDRVALFDIEKSLAEMQDDPMRPVYTYDVLAETERRFP
FT                   NAKIAFIVGPDNAATSTWQKFYRGDEIVARWSLWPAAERIPVRSSDIRAQVELGIYPSS
FT                   AQCPPEVARLLRACLTDSSHK"
FT   gene            403178..404881
FT                   /locus_tag="TERTU_0384"
FT   CDS_pept        403178..404881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0384"
FT                   /product="transporter, small conductance mechanosensitive
FT                   ion channel family protein"
FT                   /note="identified by match to protein family HMM PF00924"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14091"
FT                   /db_xref="GOA:C5BMC1"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMC1"
FT                   /protein_id="ACR14091.1"
FT                   /translation="MLFPRLRRLVRALPMLCVFVCLCVYAQSENPPTTSLEPNYSEEEL
FT                   RILAAAERVESNKAKLEALDAAYKKSSGETSESIVLQRLDTYDSLIKELREFTSLVGDY
FT                   KNGGGTPDHLLGDFNEEMLNTGRSLRADIRTYLSRYNENSIERDTATADGLRSYIFDNR
FT                   LLDMGFRLLSEYVAVIEQLEFSAAPSRRFLMSEVPLRADSLSGQIRLNTERLNEAKALL
FT                   SIKKDDADVLEKQRLATEKQESDTHSLLLIIDIAEKLELDVSRYRQLLLRTTGEISADL
FT                   IGSNVLSGLFYDWWISVKQSVGTTLANFMIKAGVFLGILLVFHGIATLVSRVLLRSLTS
FT                   GSVNLSVLMQDMLTSMTARLIMLLGLLVALAQVGVSLGPVLAGLGVVGFVIGFALQDTL
FT                   GNFAAGVMILVYRPYDVDDFVEAAGVFGKVRSMNIVSTTVLTIDNQTLIIPNSKIWGDV
FT                   IKNVTAQKVRRVDMTFGIGYSDDVEHAERILADIVEENEKVLQSPEPMIKLNALGESSV
FT                   DFIVRPWAKTEHYWDVYWEVTREVKMRFDREGITIPFPQRDVHIYQQSKD"
FT   gene            405020..405211
FT                   /locus_tag="TERTU_0385"
FT   CDS_pept        405020..405211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0385"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACR10856"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMC2"
FT                   /protein_id="ACR10856.1"
FT                   /translation="MVSGGYSAIANDLISPPEGYACWGRSDVFCHRTSSGSQPHLDRCT
FT                   MFPAALTCPDYHNNYKLK"
FT   gene            405226..406641
FT                   /locus_tag="TERTU_0386"
FT   CDS_pept        405226..406641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0386"
FT                   /product="MFS transporter, SP family"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690; match to protein
FT                   family HMM TIGR00879"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14439"
FT                   /db_xref="GOA:C5BMC3"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMC3"
FT                   /protein_id="ACR14439.1"
FT                   /translation="MNQATSGNTENFAFILLISGVATIGGFLFGFDSGVINGTVDGLKV
FT                   AFNSDDVASGFNVASMLLGCAVGAFFAGRLADLYGRRFMLIIAAIFFIVSAWGSGIAGS
FT                   SGEFIIYRVIGGLAVGAASVMAPAYIAEVAPARYRGALATVQQVAIITGLFMAFLSNYF
FT                   LADASGSAMNPLWMNFETWRWMFWIELIPAFVFLFALLLIPESPRFLVVKQHKEKALGI
FT                   LQRLYGNVAGQQKLDDIDASLEGDHHRPKLGDLIDKASGKLRPIVWVGIGLATFQQLVG
FT                   INVVFYYGAVLWQAVGFGENDALLINVVSGALSIGAVILALVLVDKIGRKPILLIGSIG
FT                   MTVTLGITAFAFTTASQNAAGEVSLGDGMGVVALISANIYVMFFNFSWGPVMWVLLGEM
FT                   FPNQIRGSGLAVAGLAQWGSNFLVSWTFPMLLGSLGLAFAYSLYTLGALISIFFVAKFV
FT                   YETKGMELENMKG"
FT   gene            complement(406668..407393)
FT                   /locus_tag="TERTU_0387"
FT   CDS_pept        complement(406668..407393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0387"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11789"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMC4"
FT                   /protein_id="ACR11789.1"
FT                   /translation="MQSMAGRMTLAEFLTRRGTIAAAASIGLHSILLLLPETAEPPEFA
FT                   RSERKTFAVTLRKASPDISPEPQSNALASKPLPLSETTPVSHSETNTETSDSNSATDNQ
FT                   QTTEQNMRRQQLPAIPTHPPAPAASQTNSKYTASQKSEQSSDSLRVFDPRLRNKFKRDT
FT                   GPSRSEQIDAFKHKHTFTDVHGRTVRKNGRYCSVYTPPKSLTETGLWSLPFVCDTSQDE
FT                   GEKIKRGIAEALRDYRQQP"
FT   gene            complement(407503..408813)
FT                   /locus_tag="TERTU_0388"
FT   CDS_pept        complement(407503..408813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0388"
FT                   /product="transporter, major facilitator family"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11586"
FT                   /db_xref="GOA:C5BMC5"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMC5"
FT                   /protein_id="ACR11586.1"
FT                   /translation="MTQSTTMKHPLLWVPSGYFTMALTYNMLTAASVVMFSNLGMDNAR
FT                   AAAYASALGLAYTIKPLFAAFLEMYKTKKFFVLLSQLILGIGFVGVALVMNLPSYITIM
FT                   MGMFWVLSFIGSSQDITTDGVYVTSLDAKQQALYCGWQSLSWNLGKLAMMSVMVVLSGV
FT                   FHQYLFNHDPHVSGPEWSKSWQIVFGIMGILMLAMAAWHWRVMPEGSRAENTPTSPMEA
FT                   MKTLADAFVTFFQKRGIWLMIGFALLFRISFGFLNAPSMLFMKDAFDNGGLSLTNQEFG
FT                   IIYGTFGLCALLVGSLVGGAYVAKKGLEKALFPLCFCVNIPNITFLILAIYQPHSHVLI
FT                   TLGVVVEQFFFGIGSVGFMIYLMQQLAPGKYATTHYAFGTALMGLCMMLTGMVSGALQE
FT                   LMGYIGYFAFVMAATIPSFIICWFAPFYVKHDDSPST"
FT   gene            complement(409106..410398)
FT                   /locus_tag="TERTU_0390"
FT   CDS_pept        complement(409106..410398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0390"
FT                   /product="glycerophosphoryl diester phosphodiesterase
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF03009"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13407"
FT                   /db_xref="GOA:C5BMC6"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMC6"
FT                   /protein_id="ACR13407.1"
FT                   /translation="MFLTAVLSVLAISQFSNAAPAAKSQAAINEARPVPTQLGPRPYFL
FT                   VEDMDDSELKQKLQGCSDIRPHKTSFSIGHRGAPLQFPEHTKESYTAAARMGAGIIECD
FT                   VTFTKDKELVCRHSQCDLHTTTNILATDLADQCTQPFVPAQYDEQGNMISPASAQCCTS
FT                   DITLAEFKTLKGKMDAANNRATNVADYMNATADWRTDLYATRGTLMTHKESIALFTSLG
FT                   VKMTPELKSPSVAMPFNGFSQEDYAQKMIDEYREARVPASRVYPQSFNLSDIQYWIEHT
FT                   PAFGQQAAFLDGRDSSSSFNYRDPATWEPSMAELAAQGVQIIAPPLWMLVDVADGKIVP
FT                   SLYANEAKAAGLDIIAWTFERSGPLATGGGWYYQSINGQNADSSNPQPSVINNDGDAYD
FT                   LLDVLARDVGIIGIFSDWAAPVTYYANCMGL"
FT   gene            complement(410571..412085)
FT                   /gene="ilvA"
FT                   /locus_tag="TERTU_0391"
FT   CDS_pept        complement(410571..412085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvA"
FT                   /locus_tag="TERTU_0391"
FT                   /product="threonine ammonia-lyase, biosynthetic"
FT                   /EC_number="4.3.1.19"
FT                   /note="identified by match to protein family HMM PF00291;
FT                   match to protein family HMM PF00585; match to protein
FT                   family HMM TIGR01124"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACR10835"
FT                   /db_xref="GOA:C5BMC7"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005787"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMC7"
FT                   /protein_id="ACR10835.1"
FT                   /translation="MPQSYLKRILDARIYDLAVETPLDMMPNISLRTGNTILLKREDLQ
FT                   PVFSFKIRGAYNKLLQLSDEQRKGGVVAASAGNHAQGLALAAKHMGISATIVMPQTTPY
FT                   IKVNGVKRHGAKVVQIGDTYDEASAYAKTLVAEKGMTYIPPYDDPDVIAGQGTVALELL
FT                   RQWTGNIDAVFIPVGGGGLCAGMASYIKYVRPDIKVFAVEADESACLKAAMDAQRRVKL
FT                   PQVGIFADGVAVAQIGKETFRVIRECIDGVITVSTDEICSAIKDIFEDTRSIAEPAGAL
FT                   SLAGLKKYIEQNQCSEHTLVAVDSGANTNFDRLRYISERTEIGEKREAILAVTIPEKPG
FT                   SYRGFCRLLGKRLITEFNYRFADSTDAHIFVGLQVSGEQSDHDELIENLRSKDYKVVDM
FT                   TDNEVAKLHIRYMVGGHAPQVEDEIVYRFEFPERPGALLNFLNKLAGRWNISLFHYRNH
FT                   GSASGRVLVGMQVPKTERKQLRELLDDLGYPYSDETENEAYKYFLS"
FT   gene            412303..412980
FT                   /gene="rpiA"
FT                   /locus_tag="TERTU_0392"
FT   CDS_pept        412303..412980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpiA"
FT                   /locus_tag="TERTU_0392"
FT                   /product="ribose 5-phosphate isomerase A"
FT                   /EC_number="5.3.1.6"
FT                   /note="identified by match to protein family HMM PF06026;
FT                   match to protein family HMM TIGR00021"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13312"
FT                   /db_xref="GOA:C5BMC8"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR020672"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BMC8"
FT                   /protein_id="ACR13312.1"
FT                   /translation="MNQQELKQAVAQAAVDYILPKLESDTILGIGTGSTAALFIDALAQ
FT                   HKGLFQGAVSSSEASARQLEGHGIPVYDLNEVDRLVAYVDGADEANARLQLIKGGGAAL
FT                   TREKIVTACADEFVCIADESKWVPVLGKFPLPVEVIPMARSFVARELVKMGGSPEHRHG
FT                   CTTDNGNHILDVHGLEIHQPAELESAINQIPGVVTNGLFALRPADVLLLGTNDGVKTLY
FT                   PHS"
FT   gene            412995..414230
FT                   /locus_tag="TERTU_0393"
FT   CDS_pept        412995..414230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0393"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /EC_number="1.1.1.95"
FT                   /note="identified by match to protein family HMM PF00389;
FT                   match to protein family HMM PF01842; match to protein
FT                   family HMM PF02826"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14024"
FT                   /db_xref="GOA:C5BMC9"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMC9"
FT                   /protein_id="ACR14024.1"
FT                   /translation="MANAQTSLDKAKIKFLLLEGVHQSAVESLNRAGYTNVDYVKTALA
FT                   EEELIERIKDAHFVGLRSRTQLTRRVIEHAPKLVAAGCFCIGTNQVDLDAAQEHGVAVF
FT                   NAPFSNTRSVAELVIAEAILLLRGIPAKNAGCHRGEWDKSAVGSYEIRGKTMGIVGYGS
FT                   IGSQVSVMAEAMGMQVVFFDVVTKLPLGNAVQSKSLTELLQVADVVSLHVPELEATKNL
FT                   IGENELAAMKPQSFLLNASRGTVVDIDALAAALESKHLAGAAIDVFPVEPKGNNEEFVS
FT                   PLRRFDNVILTPHIGGSTMEAQENIGYEVAEKLIKYSDNGTTTSSVNFPEVALPAHREV
FT                   HRLLHVHQNVPGVMTAINRIFSENNINIAGQYLQTKESVGYVVIDVDSAYSDLALKQLR
FT                   EVEGTVRCRVLF"
FT   gene            complement(414310..416358)
FT                   /gene="feoB"
FT                   /locus_tag="TERTU_0394"
FT   CDS_pept        complement(414310..416358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="feoB"
FT                   /locus_tag="TERTU_0394"
FT                   /product="ferrous iron transport protein B"
FT                   /note="identified by match to protein family HMM PF01926;
FT                   match to protein family HMM PF02421; match to protein
FT                   family HMM PF07664; match to protein family HMM PF07670;
FT                   match to protein family HMM TIGR00231; match to protein
FT                   family HMM TIGR00437; match to protein family HMM
FT                   TIGR00650"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14464"
FT                   /db_xref="GOA:C5BMD0"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMD0"
FT                   /protein_id="ACR14464.1"
FT                   /translation="MKEIALIGSPNCGKTTLFNRLTGTRQRTGNWPGVTVERKDGVLSI
FT                   QKQQSLLVDLPGIYTFHDDIQGVESRVAHSYMSSGRAALALFVLDATRLPQQLELLPDL
FT                   LATGTPVILVVNMLDSAAAEGMKVDLAALHESTGLPVAGVVGSTGEGIAGLKDVIANSL
FT                   VSYPLVDADKIDIQAAAAASYRSEGDSSRTEKIDRWLLHPKLALPFFLLVMYLLFTISV
FT                   NLGAVFIDFFDILLGSWFVDGTRWLLASIGTPEWLIAILADGVGGGIQLVGTFIPVIGF
FT                   LYLCMSVLEDSGYLSRAAFVIDRLMAKIGLPGQAFIPLIIGFGCNVPSVMASRALGQAS
FT                   ARLTTIFIAPFMSCGARLSVYVFVGTAFFPTQAQNAIFALYLLGIIVAVLSAWVLRRKL
FT                   FSHMVGANISEMPAYHRPLVRNVLTQTWHRLYSFIWRAGRRIVAVVLLLSVFSSLGTDG
FT                   SWGNQDTEKSALSATGKILTPIFTPMGVGEDNWPATVGLFTGLFAKEVVVGTLDTLYSP
FT                   SDSDADQGGMPDFGGDAKAALQSVVDGLAGLAGTFTDPLGIGSAQEDVAGDQPGSYTAM
FT                   QQLFPSAWGAFCYLVFILLYAPCVATIGVMHKEAGHMWLAFSVVWSLLLSYWLASVMWH
FT                   LSLIASSPVFAIGWIVISTALLYGSYIWILHRMKRGMSDRIPVVNLS"
FT   gene            complement(416397..416633)
FT                   /locus_tag="TERTU_0395"
FT   CDS_pept        complement(416397..416633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0395"
FT                   /product="FeoA domain protein"
FT                   /note="identified by match to protein family HMM PF04023"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12179"
FT                   /db_xref="GOA:C5BMD1"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMD1"
FT                   /protein_id="ACR12179.1"
FT                   /translation="MSTTLNQLTTGKIATINFLHGDNQALIRQCGALGLKPGEQVKVLH
FT                   RSGGKGPMQIKCRGTLFAIRSDEAANIGVTLEA"
FT   gene            417231..417377
FT                   /locus_tag="TERTU_0396"
FT   CDS_pept        417231..417377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0396"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12649"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMD2"
FT                   /protein_id="ACR12649.1"
FT                   /translation="MKTDVLTLAAVIFVVGLIASGLGIIGGSEAEAEDLPPADLHQGIV
FT                   VER"
FT   gene            complement(417615..418172)
FT                   /locus_tag="TERTU_0397"
FT   CDS_pept        complement(417615..418172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0397"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /EC_number="6.3.3.2"
FT                   /note="identified by match to protein family HMM PF01812;
FT                   match to protein family HMM TIGR02727"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12853"
FT                   /db_xref="GOA:C5BMD3"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMD3"
FT                   /protein_id="ACR12853.1"
FT                   /translation="MNKHLLRSQLRKARRALTSSQQQQAAVAIYSQILHQHTFRSAKNI
FT                   AVYIANDGEISPHLIARTARKLGKQVYLPVVQRDRLRFRIAPAGAKMWRNRFQIPEPLP
FT                   KYADVPGDCLDLVLMPLVGFDKWGNRLGMGGGFYDRTFACNHLRPKLVGLAHHLQEVDS
FT                   LLVDNWDIPLDAVATDRQWLSV"
FT   gene            complement(418178..418357)
FT                   /locus_tag="TERTU_4743"
FT   misc_RNA        complement(418178..418357)
FT                   /locus_tag="TERTU_4743"
FT                   /product="6S / SsrS RNA"
FT   gene            complement(418434..418721)
FT                   /locus_tag="TERTU_0398"
FT   CDS_pept        complement(418434..418721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0398"
FT                   /product="ZapA domain containing protein"
FT                   /note="identified by similarity to PDB:1W2E_A; match to
FT                   protein family HMM PF05164"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13318"
FT                   /db_xref="GOA:C5BMD4"
FT                   /db_xref="InterPro:IPR007838"
FT                   /db_xref="InterPro:IPR036192"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMD4"
FT                   /protein_id="ACR13318.1"
FT                   /translation="MSSEPQSVTVTILDKNYQIACPPSERESLQRAAKELDARMRVIRS
FT                   TGNVIGLERIAIMAALNLCYDLNKIGEQADQKQSVALERLLGKLDSALDG"
FT   gene            complement(418758..418961)
FT                   /locus_tag="TERTU_0399"
FT   CDS_pept        complement(418758..418961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0399"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM TIGR02449"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13462"
FT                   /db_xref="InterPro:IPR012662"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMD5"
FT                   /protein_id="ACR13462.1"
FT                   /translation="MTDKLINEVEHKLDKLINLCTRLQQENASLRAEKSEWQQERSRLI
FT                   EKNQLARTRVEAMIERLRNMEA"
FT   gene            419271..419876
FT                   /locus_tag="TERTU_0401"
FT   CDS_pept        419271..419876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0401"
FT                   /product="YecA family protein"
FT                   /note="identified by match to protein family HMM PF03695;
FT                   match to protein family HMM TIGR02292"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACR10982"
FT                   /db_xref="InterPro:IPR011978"
FT                   /db_xref="InterPro:IPR036255"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMD6"
FT                   /protein_id="ACR10982.1"
FT                   /translation="MTELYEFHFLNDQLFNLGSVNSVAELQGMLCGRLCAGERLEAAQW
FT                   NTLALEFMDLEHLALAEEHSALLALILERTQALLDDQQLGFTPLLPADETSLDNRAREL
FT                   GAWCEGFLHGLGQAIGQSGLSADTGLSDDVKDSLRDLAHISQAEAISEGESETEQDEVY
FT                   WVELVEYVKVAVLNIYNDIVLAKAAKAPPADEDPNTLH"
FT   gene            419886..421217
FT                   /gene="pepP"
FT                   /locus_tag="TERTU_0402"
FT   CDS_pept        419886..421217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepP"
FT                   /locus_tag="TERTU_0402"
FT                   /product="Xaa-Pro aminopeptidase"
FT                   /EC_number="3.4.11.9"
FT                   /note="identified by similarity to SP:P15034; match to
FT                   protein family HMM PF00557; match to protein family HMM
FT                   PF05195"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13054"
FT                   /db_xref="GOA:C5BMD7"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR007865"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMD7"
FT                   /protein_id="ACR13054.1"
FT                   /translation="MSITKQEFARRRKTLMAQMEPNSIAIVPAAKEKNRSRDTDFPFRQ
FT                   DNDFFYLTGFSEPAAVLVLVPEREHGEFVLFCREKDIEKEIWDGYRAGPEGACKDFGAD
FT                   DAFPIDDIDDILPGLIEGRERVYYAMGKDADFDRRVMGWVNQIRAQVRAGAIPPGEFLD
FT                   LDHHLHDMRLFKSAAELRLMEKAAEISAAAHTQAMKTCAAGRFEYELEAEIKYVCALNG
FT                   GREQAYNSIVGGGRNACVLHYVENNQKLKSGDLVLIDAGCEYENYASDITRTFPVSGKF
FT                   SAEQKAIYEIVLAAQLAAIDKVKPGNHWNEPHDASVKTIVEGLLDLGLLKGKLKTNIEK
FT                   ETYKMFYMHRIGHWLGMDVHDVGDYKVGDEWRVLEPGMVMTVEPGIYVPPDNKKIPEKW
FT                   RGIGVRIEDDVAVTKEGNKILTAGVPKTVAEIEKLMRGRKAKAA"
FT   gene            421466..422749
FT                   /gene="ubiH"
FT                   /locus_tag="TERTU_0403"
FT   CDS_pept        421466..422749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiH"
FT                   /locus_tag="TERTU_0403"
FT                   /product="2-polyprenyl-6-methoxyphenol 4-hydroxylase"
FT                   /EC_number="1.14.13.-"
FT                   /note="identified by match to protein family HMM PF01494;
FT                   match to protein family HMM TIGR01984; match to protein
FT                   family HMM TIGR01988"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11915"
FT                   /db_xref="GOA:C5BMD8"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR011295"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMD8"
FT                   /protein_id="ACR11915.1"
FT                   /translation="MTEVAATRKLQDIVVVGGGMVGLTQALLLAHQIPDAEITLVESLP
FT                   VNMQDVRQPSFDARATALSPATVDVLQKLALWPFLESSAQPITRVHVSDRGHVGQTEYR
FT                   QDENSGRALGYVIENRRFGAELTAACLRTSNISILAPAEVLRVTPVRAGVELVVRQASE
FT                   HTVLAAQLVIIADGANSPLREKLGIGIDQHDYRQAAVIANLSFSEPHHGAAFERFTEEG
FT                   PLAILPMVSADGRSQSHRAALVWTRPAAQLEETLGLDDAAFIDQLQARFGYRLGRCSRV
FT                   GERSSYPLKMVFAREQVRRGIVFMGNAAHFLHPVAGQGFNLALRDCAQLAALLVQAWSR
FT                   KQPLGDLTLLQEYLSQQAVDQKITAQLSHNFIQVFASHHPLLQLARNAGLLGISLLPGL
FT                   KQEFFKQMMGQALPRAEFQPIEKQEMVG"
FT   gene            422746..424005
FT                   /gene="ubiF"
FT                   /locus_tag="TERTU_0404"
FT   CDS_pept        422746..424005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiF"
FT                   /locus_tag="TERTU_0404"
FT                   /product="2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol
FT                   hydroxylase"
FT                   /EC_number="1.14.13.-"
FT                   /note="identified by match to protein family HMM PF01266;
FT                   match to protein family HMM PF01494; match to protein
FT                   family HMM TIGR01988"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11407"
FT                   /db_xref="GOA:C5BMD9"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR018168"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMD9"
FT                   /protein_id="ACR11407.1"
FT                   /translation="MKEPDLTTQIAIVGGGMVGLTLALSLVRNEATQHVSVMLIEAGTP
FT                   VEEFHGAQFDPRVVALSEASIQQLQKLDVWPMVVGKRACPYSSMSVWDGEGTGNIQFHA
FT                   RDLHRDTLGYIVENSVLVRSLAERVRSSGRVRVLDRTTVVGIEVQGSVHEPAVVLSLRD
FT                   SSDSTLTLNADLVIAADGARSQLRELAGFATREWDYGHAAIVTTVEVAASHEHTCWQRF
FT                   TQDGPIALLPLQKMPGFNRADSHYCSLVWSAKTSLAQELMALEDGAFCQALARAFEYRL
FT                   GEIKSVQHRVSIPLRQRHAKTYTKPGIALVGDAAHTIHPLAGQGVNLGYYDVAALTAEI
FT                   ARASERQIPLTDGSILRRYQRARQTHNLAAMASMEGFKRLFGADNLPLRWLRNQGMTFV
FT                   NNQFLLKKQLAKIAAGQLSG"
FT   gene            423998..425275
FT                   /locus_tag="TERTU_0405"
FT   CDS_pept        423998..425275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0405"
FT                   /product="paraquat-inducible protein A"
FT                   /note="identified by match to protein family HMM PF04403;
FT                   match to protein family HMM TIGR00155"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14762"
FT                   /db_xref="GOA:C5BME0"
FT                   /db_xref="InterPro:IPR005219"
FT                   /db_xref="InterPro:IPR007498"
FT                   /db_xref="UniProtKB/TrEMBL:C5BME0"
FT                   /protein_id="ACR14762.1"
FT                   /translation="MAEQQFSDVQDAQPHAQQRDWLLCHSCGELQKVVSISPRHQMVCC
FT                   NCDEVLHSAEPRRLELASALSVTALILFICANTLPFLTLDVGSQSQTVTILDGFFALLE
FT                   RQQWILAGVVITTIFLFPLIEIFAFLYLLIPYSYNRHLPGQCIVLRWLVIAESWSMLEV
FT                   FMLAMVVGSVKMADMAVLHLDEGAYTFFALVAVLILTFVKLNRRHLWSWINTNNYFSMG
FT                   PDEIVYDCRICHAMVGESIIDRTHECPRCHSEIHRRIPHSLQKSTALVIAAAVLYVPAN
FT                   VLPIMTYSTLGETETDTIFSGVVELIQQELWGVAIIVFTASILVPMAKLIILSYLIWSV
FT                   KAGVKRGAKQRAFLFKLTEIVGRWSMVDVYVVTIFVSLVQFGFVYTVEPEAAIIAFGAV
FT                   VILTMVAAEAFDPRLIWDVLDDKNSR"
FT   gene            425256..426866
FT                   /locus_tag="TERTU_0406"
FT   CDS_pept        425256..426866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0406"
FT                   /product="paraquat-inducible protein B"
FT                   /note="identified by match to protein family HMM PF02470"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14186"
FT                   /db_xref="GOA:C5BME1"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:C5BME1"
FT                   /protein_id="ACR14186.1"
FT                   /translation="MTRILDKAVVRKVSTISPVWIVPVVAVLIALWLAVQARLERGAEV
FT                   EITFENASDIIAGQTQIKLKEVNVGEVTKVRLSPDLKHVVVTAQLDRDMTPHLSENTRF
FT                   WVVTPRVSATGVSNLGTLISGVYIIMDPGAAGEYQTRFQGLDEAPGFESDEPGTQYVLQ
FT                   AEELGSLDIGSPIYFRQIRVGEVTGYKLSGTMEHVDIHMFIRAPYDSMVQTRSRFWNVS
FT                   GFGVSINADGMKARMESLASLISGGIAFDNAAGFENVQVAPDGHRFYLYPDRESVLEGR
FT                   FNIKYYYQLKFSGSVRGLTVGAPVEFRGIKVGEVVDVVLASAENVSDSLLVYIAMEPER
FT                   LEPDDSPTREEVDERMETMVNQGLRAQMSTASLITGSRFIDLVFVDDAEPVEFVRSENY
FT                   SEIPTVPDSMEQLSSQATDILAKINKIPFDKIGTELAGSLESLNNLLTTLDKQNTAGKL
FT                   DTTMDNLQQTMASANEALQQMTQVMDSVDQMVAPDSEFKYEFTEMAKSVSDAARSLQLF
FT                   MDELNRHPTSLISGKEKDE"
FT   gene            426859..427482
FT                   /locus_tag="TERTU_0407"
FT   CDS_pept        426859..427482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0407"
FT                   /product="putative lipoprotein"
FT                   /note="identified by match to protein family HMM PF03886"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13633"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:C5BME2"
FT                   /protein_id="ACR13633.1"
FT                   /translation="MSNLLRCGLVAGLLMSFAGCGVSGPKTQYYSLFPGVEANQETRLE
FT                   GDDLSFGVGPIILPEYLQQTSIVSRNAGQQLTVSGVNAWGGDLNATLSRVLATNLSTLW
FT                   QQDDVWAFPWDTRARPNYQIRIVFEDFSGVRGGKVTLKARWLLLGNKGKQQLAVGSQEL
FT                   SESTSSNSAEAYVSVLNNLLKRFSISLSKEVKKELIAHEENEGH"
FT   gene            427460..427996
FT                   /locus_tag="TERTU_0408"
FT   CDS_pept        427460..427996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0408"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13043"
FT                   /db_xref="UniProtKB/TrEMBL:C5BME3"
FT                   /protein_id="ACR13043.1"
FT                   /translation="MRRMKATRVAVLCWLLALLSCSIKPCFADISEFPIQITPEAPYKT
FT                   KIKKIKNSFTINLKTKIPENTDVNPWFSLSFLSSKGKKTHSVISVVGYDDNCSGEYHFR
FT                   VGYYDDRSTIATHYFSTTAKWGEAVDIIFSKLGRRTYNVSLNGETKNISAYEKLKQVEL
FT                   ESDTPLELLSLGNQN"
FT   gene            427996..429408
FT                   /locus_tag="TERTU_0409"
FT   CDS_pept        427996..429408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0409"
FT                   /product="Sel1 domain containing protein"
FT                   /note="identified by match to protein family HMM PF08238;
FT                   match to protein family HMM TIGR01352"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12441"
FT                   /db_xref="GOA:C5BME4"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:C5BME4"
FT                   /protein_id="ACR12441.1"
FT                   /translation="MFNIRNFLFGLCLLGPVISCSVFAVTFEQAMTYYVNKQYEQAYGA
FT                   FEELAALGNERAQLNLGVMYARGEFFERDFIESAAWLKLSNATLRNDSATKILKIISAK
FT                   LSEEDQSTANARYKELSVKYGREAVNQRLFPESAIDEVSEFAEAVPLKKRRPKFPRMEL
FT                   YVPGIVDIQYSIATDGTVRNITVLNATENVFARSSIEAIRHNLFKPATINGKPVPESGR
FT                   RARFNYTLSGDKLNAKGLRTVVDPLREKAEQGGGLDKYLYAYTLSILKSAVGVLDDSEG
FT                   ASLDPSADWFKKAAQDGNRLAKFELGLDLSYGKQCRADSKKSYFWLEQAADEGVMDAQV
FT                   FLGSELLHGGRFEKDVDKGLEMLTRAADDGYDDAILKLAWIMATHPDANIRDPQKALAY
FT                   LNSFNNDDYIDELTVFETQAVVYALTGKNAEAKKALKKAMKYRKKYELPDGITGDIAKA
FT                   FDAGKPYLQDIL"
FT   gene            complement(429457..430182)
FT                   /locus_tag="TERTU_0410"
FT   CDS_pept        complement(429457..430182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0410"
FT                   /product="acetyltransferase"
FT                   /note="identified by match to protein family HMM PF00132"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11712"
FT                   /db_xref="GOA:C5BME5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:C5BME5"
FT                   /protein_id="ACR11712.1"
FT                   /translation="MRRNHQPWAVKFILNALNHFYVERILRPQFDRLGKCPAMLKPRSI
FT                   KLTGHQIYAGDYLHIISSAEQPVTLTCWRSKQHDGKIELGNYCLISPGVKIAAAEQISI
FT                   GDNCMLAAEVSISDCDWHGLYNRVRPFRCSAPVTLENNVWIGLRAIIGKGVTIGENSVV
FT                   GAGAVVTGNVPPNVVVAGNPATVVKHLSPGKRYLKRDYLFQQAGDDFWNKQQALEKAFN
FT                   RSNRWWYWLKTWVAPGDND"
FT   gene            430195..430815
FT                   /locus_tag="TERTU_0412"
FT   CDS_pept        430195..430815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0412"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14681"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5BME6"
FT                   /protein_id="ACR14681.1"
FT                   /translation="MTFFNDFFHANRIKGFLAAEEGLALYEHALTVATTGPCLEIGSYC
FT                   GKSAVYLGRACQQTENTLYAVDHHRGSEEHQPGEEYHDQDLYDARTRQMDSFPAFRRTL
FT                   RLARLDDCVVPVVASSELSLRHWATPLGLVFIDGGHSPAMAMADVTGWATKLAAGGLLC
FT                   IHDIYPTPEDGGQGPRLAMQAVLDSGGFTLVNRVASLAVLQRS"
FT   gene            complement(430766..431851)
FT                   /locus_tag="TERTU_0411"
FT   CDS_pept        complement(430766..431851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0411"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12047"
FT                   /db_xref="GOA:C5BME7"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:C5BME7"
FT                   /protein_id="ACR12047.1"
FT                   /translation="MFAHIEHPLLPQFQRAASYIASCQQADGAIRWFDQGKLDPWDHTE
FT                   AAMALGIAGREDLAINAFRWLAQQQQANGSWQANYFLAPCDQDIDDTKVETNFVAYPAT
FT                   GLWHHYLIFSNTQTLRDFYPMVRAAIDYVVSQQTAHGDIQWAQSQREPLPRDALVTACS
FT                   SVLRSLECAVNIAITLGEPNAHWQLAHRRLADALRNKPWRFDRTWESKRRFSMDWFYPI
FT                   LAGIYSEQEAQLRLEQRWHEFVVSDLGCRCVSDEPWVTAAESSELVLACVAAGWRDRAE
FT                   SIHRWLSQWQDTDGGFWTGYSFRDKVIWPQEKTSWTGAAYLLAADALFQFTPAHDLLTR
FT                   PHRIRASCAVTPPETPPDSPA"
FT   gene            complement(431854..432594)
FT                   /locus_tag="TERTU_0413"
FT   CDS_pept        complement(431854..432594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0413"
FT                   /product="SAM-dependent methyltransferase, UbiE family"
FT                   /note="identified by match to protein family HMM PF01209;
FT                   match to protein family HMM PF08241; match to protein
FT                   family HMM PF08242"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12849"
FT                   /db_xref="GOA:C5BME8"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5BME8"
FT                   /protein_id="ACR12849.1"
FT                   /translation="MLTIRPEKLPLKPGDCVLDLGCGEGRHTLGLYFSAPLGELSGQLS
FT                   LIGIDISAIDLATANKRKTDFPLPESQRAGIQFVRGDGLKLPLPDASVDHLICSEVLEH
FT                   IPDYHAMLREINRVLKPGGTLCVSVPRAWPERICWWLEPRYHQVAGGHIRIFNRASLKR
FT                   DLRSHGIQLFFEHGAHALHAPYWWLKCLFWDRGDRFWPVQVYHRFLVWDLFRAPWLTRS
FT                   LDKLLNPLLGKSIVIYGVKGPGAQ"
FT   gene            complement(432588..433880)
FT                   /locus_tag="TERTU_0414"
FT   CDS_pept        complement(432588..433880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0414"
FT                   /product="glycosyltransferase family 4 domain protein"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13502"
FT                   /db_xref="GOA:C5BME9"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:C5BME9"
FT                   /protein_id="ACR13502.1"
FT                   /translation="MTIAHPHPELPREPTSVFEAPTKSLKIALLGYRSAPHVGGQGIYI
FT                   KYLAAALVRAGHQVDVYSGPPYPELEVGARLIKVPSLDLYACDNHVTALRWQHLRSFSD
FT                   TYEWWTMLTGGFAEPYTFGRRLEKYLSPGDYDIIHDNQSLCYGLLNLQNRGAKVVATIH
FT                   HPIHRDRELALAEQNDWGMRLLVKRWYSFLRMQERVVRGLEHIVTVSQCSQRDIATHFQ
FT                   LRGEVSVITNGIDINTFKPLAAIRKQPLRLITTASSDQPLKGLRYLLLALNRLRQQWPA
FT                   IELRIIGKLSDNSPNRKLIDELELATHVSFVSGISSEDLAAEYNRASVAVCPSLYEGFG
FT                   LPAGEAMACELPVVSTNGGALPEVVGDAGVIVPAGDAEALAAAIHNLLDSPDHAKALGV
FT                   RARQRIETHFCWDAVARQLTQYYQRVITSTC"
FT   gene            complement(433961..434434)
FT                   /locus_tag="TERTU_0415"
FT   CDS_pept        complement(433961..434434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0415"
FT                   /product="response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12318"
FT                   /db_xref="GOA:C5BMF0"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR022910"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMF0"
FT                   /protein_id="ACR12318.1"
FT                   /translation="MEKSSAATPARHSAQSTWRTLLVYGILALIIYFGHQYLQTALGER
FT                   ALAAVPLEKLTLEEALSASRASDKPVLLDLAAIWCPSCRKLDQQVLSDPAVVEVIRNKY
FT                   VFTRVEFESATGETVQQKYQVKGFPTLLVVDGNGNLIRQLPLSFEPQEFIRSL"
FT   gene            complement(434690..434821)
FT                   /locus_tag="TERTU_0416"
FT   CDS_pept        complement(434690..434821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0416"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12714"
FT                   /db_xref="GOA:C5BMF1"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMF1"
FT                   /protein_id="ACR12714.1"
FT                   /translation="MNEAVTIGGLAMFASTALIIVLGLSAAGILTFCEKRAGHIGNH"
FT   gene            435039..435632
FT                   /gene="hisB"
FT                   /locus_tag="TERTU_0417"
FT   CDS_pept        435039..435632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisB"
FT                   /locus_tag="TERTU_0417"
FT                   /product="imidazoleglycerol-phosphate dehydratase"
FT                   /EC_number="4.2.1.19"
FT                   /note="identified by match to protein family HMM PF00475"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACR10903"
FT                   /db_xref="GOA:C5BMF2"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BMF2"
FT                   /protein_id="ACR10903.1"
FT                   /translation="MQERKAAVNRDTLETQISVALNLDGTGAAAFATGVPFLEHMMDQI
FT                   ARHGMIDLDVRCQGDTHIDDHHSVEDIGITIGQAMHQAVGDKRGIRRYGHAYVPLDEAL
FT                   SRVVIDFSGRPGLEMHIPFTQKRIGSFDTELFWEFFQGFVNHAGVTLHIDCLRGHNAHH
FT                   QIETVFKAFGRALRMALEVDPRMGNAMPSTKGTL"
FT   gene            435668..436345
FT                   /gene="hisH_1"
FT                   /locus_tag="TERTU_0418"
FT   CDS_pept        435668..436345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisH_1"
FT                   /locus_tag="TERTU_0418"
FT                   /product="imidazole glycerol phosphate synthase, glutamine
FT                   amidotransferase subunit"
FT                   /EC_number="2.4.2.-"
FT                   /note="identified by match to protein family HMM PF00117;
FT                   match to protein family HMM PF07685; match to protein
FT                   family HMM TIGR01855"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11496"
FT                   /db_xref="GOA:C5BMF3"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMF3"
FT                   /protein_id="ACR11496.1"
FT                   /translation="MNRKQVAVIDYGMGNLHSVASALKHVDRRIDVAVTGDKEVIANAD
FT                   HVIFPGVGAMRDCMGEIRRQQVDQAVDKVVASGKPLLAICVGLQALMDSSEENNGVECL
FT                   GMFPGEVKFFAGNEQFNAASDEGSASGERLKVPHMGWNQVSQTLAHPLWEGIEDNSRFY
FT                   FVHGYYVDSHNPSVVAGKSHYGIDFTANIARDNVFAAQFHPEKSHHNGLQLLKNFLNWD
FT                   GKC"
FT   gene            436339..437076
FT                   /gene="hisA"
FT                   /locus_tag="TERTU_0419"
FT   CDS_pept        436339..437076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisA"
FT                   /locus_tag="TERTU_0419"
FT                   /product="1-(5-phosphoribosyl)-5-((5'-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide
FT                   isomerase"
FT                   /EC_number="5.3.1.16"
FT                   /note="identified by match to protein family HMM PF00977;
FT                   match to protein family HMM TIGR00007"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11449"
FT                   /db_xref="GOA:C5BMF4"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BMF4"
FT                   /protein_id="ACR11449.1"
FT                   /translation="MLIIPAIDLKDGNCVRLRQGLMDDSTVFGEDPVAFARQWVDKGAR
FT                   RLHLVDLNGAFAGKPVNGDVVTAIAKAFPELPIQIGGGIRSAETIEHYLQAGVNYVIIG
FT                   TKAVKEPEFVTEMCKQFAGHIIVGLDAKNGFVATDGWAEVSEVKATDLAARFASDGVTE
FT                   IVYTDIARDGMMQGVNVEATVDMAKASPIPVIASGGITDMNDIRALAKVASAGISGAIT
FT                   GRAIYEGTLDIVEAQAYCDIVSD"
FT   gene            437079..437852
FT                   /gene="hisF_1"
FT                   /locus_tag="TERTU_0420"
FT   CDS_pept        437079..437852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisF_1"
FT                   /locus_tag="TERTU_0420"
FT                   /product="imidazoleglycerol phosphate synthase, cyclase
FT                   subunit"
FT                   /note="identified by match to protein family HMM PF00977;
FT                   match to protein family HMM TIGR00735"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12165"
FT                   /db_xref="GOA:C5BMF5"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BMF5"
FT                   /protein_id="ACR12165.1"
FT                   /translation="MPLAKRIIPCLDVDKGRVVKGVQFVDIRDAGDPVEVAKKYNEQGA
FT                   DEITFLDITASHEARETTINTVEKIAAEVFIPLTVGGGIRTLDDIRNMLNAGADKVSIN
FT                   SAAVKDPDFVRIAAEKFGSQCIVVAIDAKRVSADGEPGRWEIFTHGGRNPTGIDAVEWA
FT                   VRMTEYGAGEILLTSMDRDGTKDGFDLGVTRAISEAVRVPVIASGGVGNLQHLVDGVIK
FT                   GGADAVLAASIFHFGEYTVPEAKAYMEQHGIEVRL"
FT   gene            complement(437940..439217)
FT                   /locus_tag="TERTU_0421"
FT   CDS_pept        complement(437940..439217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0421"
FT                   /product="phosphate transporter family protein"
FT                   /note="identified by match to protein family HMM PF01384"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14696"
FT                   /db_xref="GOA:C5BMF6"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMF6"
FT                   /protein_id="ACR14696.1"
FT                   /translation="MSILADYGTILLVLGCIFCVFMAWGVGANDVANAMGTSVGSGALT
FT                   IRQAIIIAMVFEFLGAYLAGGEVTATVRKGIIDPAIMAGHPELLVYGMLSALLAAGTWL
FT                   VIASMLGWPVSTTHSIVGAIVGFAAVGISTSAIAWGKVGTIVASWVVSPVLAGTFSFLL
FT                   FKSVQWLIFNNEHPEAAARRFIPVYMFLVGFLIAMVTLLKGLKHVFKDSGLKLSYLENT
FT                   GIAVLIGLIAAAVGFYFLRRVNTQAPQGDNRYANVEKVFAVLMIFTACSMAFAHGSNDV
FT                   ANAVGPLAAIVTVVSSGGAIAAKSAMPGWVLLLGGLGIVVGLATYGYKVIATIGRKITE
FT                   LTPSRGFAAELGAASTVVVASGLGLPISTTHTLVGAVLGVGMARGIGALNLGVIGSIFL
FT                   SWLVTLPAGAGLAIVFFFMFKSIFGA"
FT   gene            complement(439260..439940)
FT                   /locus_tag="TERTU_0422"
FT   CDS_pept        complement(439260..439940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0422"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01865;
FT                   match to protein family HMM TIGR00153"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13830"
FT                   /db_xref="InterPro:IPR002727"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMF7"
FT                   /protein_id="ACR13830.1"
FT                   /translation="MKLKNPLTEMFGRSPIKPMEEHMTVALQTARELLGFYRASVNEDW
FT                   TAAEASYNAISKLEQQADELKKQIRLHLPKNLFLPVPRADLLELITRQDKIPNRCKDIS
FT                   GLMLGRKMVFPKQLHEPVEAYLNTAFSTVEQAHTAIAELDQLLETGFGGREMDLVESMV
FT                   SELNRLEQQTDHQQIALRAELFKLEPELPPVDVIFFYRIIEEMGDLADRAQRTGQRLLQ
FT                   LLAR"
FT   gene            complement(440149..440922)
FT                   /locus_tag="TERTU_0424"
FT   CDS_pept        complement(440149..440922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0424"
FT                   /product="putative methyltransferase"
FT                   /note="probable secreted protein, N-terminal signal
FT                   sequence"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14784"
FT                   /db_xref="GOA:C5BMU0"
FT                   /db_xref="InterPro:IPR016980"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMU0"
FT                   /protein_id="ACR14784.1"
FT                   /translation="MSISACLKPFALAAGLLALSVTAGATTDNATVKALNKAMAAKSRP
FT                   EKDTARDANRLPVETLTFFGFNRDMTVVELIPGGGWYTRLLAPTLRDKGKLYVAYGTGY
FT                   LEKQDVLKQKGFDKVSLIAPESKVYRPENAPRYVLENADLGITDADMVLTFRNYHNFGP
FT                   EGRKAMNDAAFKALKSGGIYGVVDHTRRHMEPNSDANRRRIDPVLAIKEIEAAGFEFVD
FT                   YSPLHYRPQDDTTLEVGDASVTGHTDRWTLKFRKP"
FT   gene            441861..443960
FT                   /locus_tag="TERTU_0427"
FT   CDS_pept        441861..443960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0427"
FT                   /product="glycoside hydrolase family 5 domain protein"
FT                   /note="identified by match to protein family HMM PF00150;
FT                   match to protein family HMM PF02013; match to protein
FT                   family HMM PF02839"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13327"
FT                   /db_xref="GOA:C5BMU1"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR002883"
FT                   /db_xref="InterPro:IPR003610"
FT                   /db_xref="InterPro:IPR009031"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032798"
FT                   /db_xref="InterPro:IPR036573"
FT                   /db_xref="InterPro:IPR036601"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMU1"
FT                   /protein_id="ACR13327.1"
FT                   /translation="MIIKNIRTLMSVAIATAIMAPTAYAANCSNVNVYPDWTARDWSGG
FT                   PFNHANAGDQMVYQNTLYSANWYTTAVPGSDPSWTSVGACDGGSSTSSTSSSSSSSSSS
FT                   SSSSSNSSSNSSSSSSSSSSSSSSSSSSGGQCEEVCSWYGQGVYPLCQNTSGWGWENNQ
FT                   SCIGRQTCESQNGGNGGVVSNCGTGSSSSSSSSSSSSSSSSSSSSSSSSGSTSTSSSSS
FT                   SSSSSSSSSSSTSTSSSGGMFRVDASGNITKNGEVFPVHCGSWFGLEGRHEPSDDPTNP
FT                   GGAPMELYIGNVFWANEHSRTMEQTMEEITARGINVIRFPIVPQTLDASDPQGRDPYLK
FT                   NYEPLRQTNARQAMEDFIVMADQYGLEVMLDIHSCSNYVGWRAGRFDARPPYADADRDL
FT                   YDYFREDYSCAASGNPSSVDHVQAYDKAAWLDDLRELAGLADELGVDNIIGVDIFNEPW
FT                   DYTWAEWKTNIEDAYQAIDEVNSDLLIFAQGISASAGNQDGNPDDAVEVPHGDEFSNPN
FT                   WGENLYEAGADLPNVPQSRLVFSPHTYGPSVFVQSMFMDPAEPECEGLSGDEAGDLGCN
FT                   IVINPELLRPGWEEHFGYLRDMGYAIVVGEFGGHYNWPQGSSERDLARWGYITDNVDEQ
FT                   WQNAFVDYMDEKNIEACYWSINPESGDTGGLYSHAYDPISNTGGWGTWTGFEEGKWSML
FT                   NRLWD"
FT   gene            444562..447246
FT                   /locus_tag="TERTU_0428"
FT   CDS_pept        444562..447246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0428"
FT                   /product="glycoside hydrolase family 11 and family 5 domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00150;
FT                   match to protein family HMM PF00457; match to protein
FT                   family HMM PF02013; match to protein family HMM PF02839"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12792"
FT                   /db_xref="GOA:C5BMU2"
FT                   /db_xref="InterPro:IPR001137"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR002883"
FT                   /db_xref="InterPro:IPR003610"
FT                   /db_xref="InterPro:IPR009031"
FT                   /db_xref="InterPro:IPR013319"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018208"
FT                   /db_xref="InterPro:IPR032798"
FT                   /db_xref="InterPro:IPR033119"
FT                   /db_xref="InterPro:IPR033123"
FT                   /db_xref="InterPro:IPR036573"
FT                   /db_xref="InterPro:IPR036601"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMU2"
FT                   /protein_id="ACR12792.1"
FT                   /translation="MKLLKTHRRAIAAAALAVATVPIAHAQTLSSNATGTQNGYYYSFW
FT                   KDSGNATMTLGAGGNYSSSWNSSTNNWVGGKGWMPGTRRTVTYSGSYSASGTSYLALYG
FT                   WTRNPLIEYYIVENWVNYNPASGATNYGTVNIDGSTYQLGRSQRVNQPSIEGTATFYQY
FT                   WSVRQNKRTSGTINIGAHFDAWAAVGLNLGTHDYQIMATEGYQSSGQSNITVSEGSSGS
FT                   TTSSTSSSSSSTSSSSSSSSSSGGGTGSCAGVNVYPNWTARDWSGGAYNHANAGDQMVY
FT                   QNNLYRANWYTNSTPGSDASWTSLGSCSGGGSTSSTTSSSSSSSTSASSSSNSSSSSSS
FT                   SSSSGGCREMCNWYGQGMYPLCQNTSGWGWENNQNCIGRQTCQSQNGGSGGVVNSCGTS
FT                   SSSSSSTSSSSSSSSSSGTTSSSSSSSSSTSTSSGGGTFRVDASGNITKNGQIFPMHCG
FT                   SWFGLEGRHEPSDDPDNPSGAPMELYIGNVFWANEHSRTIEQTMDEITARGINVIRFPI
FT                   VPQTLDPNNAQGRAPYLKNYEPLRQTNARQAMEDFIVLADQHGLEVMLDIHSCSNYVGW
FT                   RAGRFDARPPYADADRDLYDFPREDWSCSASGNPGTVQNIQAYDKAAWLDDLRELAGLA
FT                   DQLGVDNIIGVDIFNEPWDYTWAEWKTHIEDAYAAINSVNSDLLIFAQGISASANNQDG
FT                   TPDDNVEVPHGDEFSNPNWGENLYEAGSDLPNVPQSRLVFSPHTYGPSVFVQRMFMDPA
FT                   QPACEGLEGDEAGDNDCNIVINPDILRPGWEEHFGYLRDMGYAVVVGEFGGHYGWPQGS
FT                   SERDINRWSHITTNVDEQWQNAFVDYMDEKNIEACYWSINPESGDTGGLYSHAYDPISN
FT                   TSGWGTWTGFEEGKWSMLNRLWD"
FT   gene            complement(447349..447768)
FT                   /locus_tag="TERTU_0429"
FT   CDS_pept        complement(447349..447768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0429"
FT                   /product="hemerythrin metal-binding domain protein"
FT                   /note="identified by match to protein family HMM TIGR02481"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12553"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMU3"
FT                   /protein_id="ACR12553.1"
FT                   /translation="MTDLLTTRPESLHLGHPIIDRTHDEFHGLVAKLNAAGLVDFILHF
FT                   AALASHAEEHFAKEQQLMRQSHYPADQMETHLRDHLMVLQEINRLNAMVARGSVAAARV
FT                   YVSDLLPVWFEQHNLAHDGPLVSHLKRANLASSLG"
FT   gene            complement(448087..448344)
FT                   /locus_tag="TERTU_0430"
FT   CDS_pept        complement(448087..448344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0430"
FT                   /product="YebG"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12195"
FT                   /db_xref="InterPro:IPR009813"
FT                   /db_xref="InterPro:IPR038627"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMU4"
FT                   /protein_id="ACR12195.1"
FT                   /translation="MFDDKKAAEAHDNMLELAANITQLIESRISGISDENLEAIGLLLA
FT                   KNSDALAKACKGKPSVLLELEEADTETTEDSSSKVTAING"
FT   gene            448523..449107
FT                   /locus_tag="TERTU_0431"
FT   CDS_pept        448523..449107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0431"
FT                   /product="putative thiol-disulfide isomerase and
FT                   thioredoxin"
FT                   /note="identified by match to protein family HMM PF00578;
FT                   match to protein family HMM PF08534"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13340"
FT                   /db_xref="GOA:C5BMU5"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMU5"
FT                   /protein_id="ACR13340.1"
FT                   /translation="MSLTESTMMALGTSAPDFSLPSTEGITVSLSDFNSSKLLVVVFMC
FT                   NHCPYVIHISSALAELAEETMPMGVSFVGINSNDTQAYPADSFEKMREEKAFRGYPFAY
FT                   LWDETQEVARAYDAACTPDIFVFDADRTLVYRGEFDGSRPDRISSGNYDSAKNPSTGET
FT                   LRQVLQDLLNGKGAPTKQYPSMGCNIKWRDS"
FT   gene            449315..449560
FT                   /locus_tag="TERTU_0432"
FT   CDS_pept        449315..449560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0432"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11801"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMU6"
FT                   /protein_id="ACR11801.1"
FT                   /translation="MIYRKGEGERTWYRTDRCFRVGEDWYIATREGKDIGPFKSRVTAE
FT                   RSAERLIAILREDRKDVDNYTRKLVLEGIWADTNFA"
FT   gene            complement(449606..449950)
FT                   /locus_tag="TERTU_0433"
FT   CDS_pept        complement(449606..449950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0433"
FT                   /product="transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13665"
FT                   /db_xref="InterPro:IPR021732"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMU7"
FT                   /protein_id="ACR13665.1"
FT                   /translation="MILQDVVIGVCVAGLLGLVWQHLSISQHAYRLVARQTRDRGVNLL
FT                   DQSIVLRRISLRPSASSLFAVRRVYSFEFATLGDERYPGTIELLGKRQINITLAPFKTE
FT                   TLQGENQLDG"
FT   gene            450187..450813
FT                   /locus_tag="TERTU_0434"
FT   CDS_pept        450187..450813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0434"
FT                   /product="Hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04337"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13197"
FT                   /db_xref="InterPro:IPR007432"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMU8"
FT                   /protein_id="ACR13197.1"
FT                   /translation="MKLTDIETRVLGVLMEKAVTTPDQYPLSLNALTTGCNQKTNREPV
FT                   MQVSESDVLDAVTQLIEKSVVSEVRIGTRVSKYQHRFSGTEFAQYKFNKAQQAILCMLF
FT                   LRGPQTPGELRSRSQRLFEFDNVQQAEASLAELEQKEYVVQLAREPGRREARYAHLFGD
FT                   AEPQVSAFSAEAGVASEATPALEQRVTELEQRVADLEAMLNELMA"
FT   gene            450860..451480
FT                   /locus_tag="TERTU_0435"
FT   CDS_pept        450860..451480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0435"
FT                   /product="SAM-dependent methyltransferase"
FT                   /note="identified by match to protein family HMM PF08241;
FT                   match to protein family HMM PF08242"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13667"
FT                   /db_xref="GOA:C5BMU9"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMU9"
FT                   /protein_id="ACR13667.1"
FT                   /translation="MTRNPYFWDRIAEQYAALPIRFPDDYHHKLEQTRGRLTSHMRVLE
FT                   FGCGTGSMAVRHAPLVADYVAIDVSFKMLEIAEKKRSAAGLANLQFMRDAIESRSLGRA
FT                   HFDLVMGFSILHLVRDLDAVLHKLHTALKPGGLFISSTFCFADFDPLLRWMLPVTQRLG
FT                   VTPAINQLAANGLRDTVQTAGFTIEEDWQPAPDRALFLIARKT"
FT   gene            451561..453369
FT                   /locus_tag="TERTU_0436"
FT   CDS_pept        451561..453369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0436"
FT                   /product="ABC transporter, ATP-binding protein domain
FT                   containing protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664; match to protein
FT                   family HMM TIGR02204"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13041"
FT                   /db_xref="GOA:C5BMV0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR011918"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMV0"
FT                   /protein_id="ACR13041.1"
FT                   /translation="MPSTPSLLSARQTLLPMLRFITPYRGRIVIAITALVVVAGISLSL
FT                   GQSVKLVINNLFVVQSQRELAVALGILAGLITMIAVGTFVRFYTMSWLGERVSADIRRA
FT                   VFDHLLLLEPSYFEENQSGELMSRLTTDTTLLQTIVGSSFSMALRNALTLVGGIAMLLV
FT                   TNLKLTALVLVGIPLALVPVLILGRRVRKLSRHSQDTIADVGSYAGEIIQNIKAVQSYT
FT                   REAEERHAFGVEVEQAFAVARTRIRERAMLFGSVMLLMFLGICAMLWVGGSDVLAGTIS
FT                   PGDLGAFVFYALMVAMSLATLAEVYGEVQRAAGAAERLMELLQVAPDICDPPEPANMQN
FT                   RAPANGQMAANASNAIELENVSFAYPSRPKKLALNNLSLTIKQGETVALVGPSGAGKST
FT                   LFELLERFYDPQQGEIRQFNHPYRALALADLRGRVGLVPQNPVLFSADVWRNIRYGNPQ
FT                   ASDAAVMEAARKAHAHDFIAALPEGYDSFLGERGVRLSGGQKQRIAIARAILKDPPILL
FT                   LDEATSALDAESEHYVQAALNDLMRERTTLIIAHRLATVVHADRILVMQDGEIIDSGTH
FT                   TSLQTSSALYRRLCELQFATDELAKG"
FT   gene            453462..454310
FT                   /locus_tag="TERTU_0437"
FT   CDS_pept        453462..454310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0437"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14647"
FT                   /db_xref="GOA:C5BMV1"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMV1"
FT                   /protein_id="ACR14647.1"
FT                   /translation="MSPSFLREPLLHFLLLGGVLFGLECWLTPTAAPTQNIVLAPETLN
FT                   ELAGNFTQARGRSPTQEELSELAVRWVTDEVLVREARELKLAQGDDVIRNRLASQMRAV
FT                   VQHQSPLGEPSRDELERFFQAHHNAYDTPAHYDLEQRFVAGGLSEAKELAAQWREQIAP
FT                   AEWPQATTSLRHRPQSNVVAIYGELASAALLREPYNWQAVATQRGAQVARVTRVYPAQS
FT                   AEFEAVRPRVARDWQRAEQQRRIAAEVARMAQGYQITAPPELPQTVADAIAHAVKSEDA
FT                   R"
FT   gene            454312..455280
FT                   /locus_tag="TERTU_0438"
FT   CDS_pept        454312..455280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0438"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14083"
FT                   /db_xref="GOA:C5BMV2"
FT                   /db_xref="InterPro:IPR032809"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMV2"
FT                   /protein_id="ACR14083.1"
FT                   /translation="MQRVRLWLTGLLAGLLLLVSIGIRAHDTPVVSLTLTEIDAGRYSL
FT                   SWSPADIDAALHVAFPGHCELQVQVLACGRKGLVGRLKVDGLGRRYAAVVLLVRALPGE
FT                   AAAQTYTLTAAQQEIMLEPAAGNRLRHTAAVYLPLGIEHIVLGVDHLLFVLGLLLLTRG
FT                   LADLVKTITAFTLAHSVSLAVAVFGWITVNEVLVNALIALSIAVLAVEVVHRQRGRTGW
FT                   SQRAPWVVAFGFGLLHGLGFAGGLVSLGLDQHTLVGALVFFNLGVEAGQLLFVGLVLGM
FT                   FASYRSLGVILSERICTGAIYGVGAIASYWFVARVSMMFSG"
FT   gene            455285..455887
FT                   /locus_tag="TERTU_0439"
FT   CDS_pept        455285..455887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0439"
FT                   /product="HupE/UreJ protein"
FT                   /note="identified by match to protein family HMM PF04955"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11894"
FT                   /db_xref="GOA:C5BMV3"
FT                   /db_xref="InterPro:IPR007038"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMV3"
FT                   /protein_id="ACR11894.1"
FT                   /translation="MRLSSRLRLFWFLLTLISFPALGHTDVGVAGGLLSGLIHPVKGLD
FT                   HLVAMIAVGLWGAQLRQPAIWLLPITFPLVMALGGLAGLAGLPLPGLEIGIAVSAIALG
FT                   LAVGFAWRAPLWLAGLLVALFALFHGYAHGRELPQAADPLAYGAGFVVATGLLHLCGIG
FT                   LGALAHWPRGAQWVRALGAGIAVCGGYFLLAAAGGAG"
FT   gene            455884..456477
FT                   /locus_tag="TERTU_0441"
FT   CDS_pept        455884..456477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0441"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13188"
FT                   /db_xref="GOA:C5BMV4"
FT                   /db_xref="InterPro:IPR007038"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMV4"
FT                   /protein_id="ACR13188.1"
FT                   /translation="MNRARYLCLFVGFCLPSLAHAHLVSDRFGDFYSGLLHPLTSVIHL
FT                   VPWLALALGNGVQALPQARCMLWLFPLVVGLGVVCGLFMPPGQSLEFGLIATFGVALVA
FT                   VAGRALPAWVWVILVSSIGVLHGMAHAEPALEGRALVLYAAGVTLASHWVMLSMTAIIY
FT                   WLCRRWAWCVIGVRALGSWILAIGVLFGGYRLLV"
FT   gene            complement(456474..456884)
FT                   /locus_tag="TERTU_0440"
FT   CDS_pept        complement(456474..456884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0440"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11298"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMV5"
FT                   /protein_id="ACR11298.1"
FT                   /translation="MLPWLWFWAPQLHFPLSGNVEQDINTITRKWFAGIPASAGDGDIE
FT                   RQAVKVASYGRQLGLLTELILELAQKAPEKSPRAIEVCERLADIQHSIAQLKQPNAKNT
FT                   DMAEQLLALQQQDPARFRTLCASLCETGISET"
FT   gene            457052..457441
FT                   /locus_tag="TERTU_0442"
FT   CDS_pept        457052..457441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0442"
FT                   /product="transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14012"
FT                   /db_xref="GOA:C5BMV6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR024467"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMV6"
FT                   /protein_id="ACR14012.1"
FT                   /translation="MKPSIVQSDSAIVANALLDACPSLGITQDQLAQVLGVSRATVARI
FT                   KKKASTHQADEAIAPSSKPFELALLVIRVYRSLYAIVGGNVDAMKHWMNTPNHHLNLQK
FT                   PIDLIQTALGLSEVIWYLDAMRGKI"
FT   gene            457442..458206
FT                   /locus_tag="TERTU_0443"
FT   CDS_pept        457442..458206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0443"
FT                   /product="RES"
FT                   /note="identified by match to protein family HMM PF08808"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13259"
FT                   /db_xref="InterPro:IPR014914"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMV7"
FT                   /protein_id="ACR13259.1"
FT                   /translation="MQIAESVSQLPIALVPLVGLAWRVVETQGTAATRAITRNADEQLR
FT                   LEQLLEGCKPPVPDACEKLSYLLATPFRYPPLRHGSRYGTRWERGIFYAAQEQETALAE
FT                   TAVYLWLFQQGAVEMGPLAEITDARTVFSVRLRTGRGCDLAANHFQHIQAKLTEPGNWG
FT                   YTQALGTRLREMGADFFWFPSARLAGGTNVAVVNPESFASPTPDTQQLWNLRLTPELCW
FT                   FGRADAGRDTSGYFEFSREVFAEAGALAHPCL"
FT   gene            458197..458316
FT                   /locus_tag="TERTU_0444"
FT   CDS_pept        458197..458316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0444"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13689"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMV8"
FT                   /protein_id="ACR13689.1"
FT                   /translation="MPVTRVTVNHEQRATHRKRAGALFLNVPVLSHIAQQPKL"
FT   gene            458327..458872
FT                   /locus_tag="TERTU_0445"
FT   CDS_pept        458327..458872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0445"
FT                   /product="glutathione peroxidase subfamily protein"
FT                   /note="identified by match to protein family HMM PF00255"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12211"
FT                   /db_xref="GOA:C5BMV9"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR029759"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMV9"
FT                   /protein_id="ACR12211.1"
FT                   /translation="MSAVQNIPVNRIDGEQQTLADYQGKVLLVVNVASKCGLTPQYEGL
FT                   QKLYADKQGDGLEILGFPANNFMGQEPGSNEEIQEFCSLNFNVSFPMFEKISVLGDDKH
FT                   PLYDALTDAQPSAEGDGPFREKLKGHGVERDNPADILWNFEKFVVGRSGEVVARFAPDV
FT                   TADDPRLVACIEAELAKS"
FT   gene            complement(458934..460130)
FT                   /locus_tag="TERTU_0446"
FT   CDS_pept        complement(458934..460130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0446"
FT                   /product="esterase, PHB depolymerase family"
FT                   /EC_number="3.1.1.-"
FT                   /note="identified by match to protein family HMM TIGR01840"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13660"
FT                   /db_xref="GOA:C5BMW0"
FT                   /db_xref="InterPro:IPR010126"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMW0"
FT                   /protein_id="ACR13660.1"
FT                   /translation="MSIYTLKKFTATIAVAGSILLSPLWANAQVAAGVLTEITNFGDNP
FT                   TELGMHLYVPENLENNAPVLLAMHYCGGSGPAFFNGTQFDELADQYGYIVIYPSEPDTA
FT                   ARNNTNCFDASSDASLNGTGSDPIGLMSMVNYVRSHYNVDDSRIFAVGLSSGGMMTNVM
FT                   LALHPDVFAAGAAFAGLPFTCFAASQPAGWNSACANGTLDKTAQQWGDAVRNVNPGYNG
FT                   PWPRMQLWHGTKDGTLDYANFGEAIEQWTNVHGLSQTPLSTTTDGINTRTRYGNDSEKP
FT                   LVEANSLADADHDFLFSNGAFYAKEAIRFFGLDVPADTSSSSSSSSSSSSSSSSSSSSS
FT                   SSSSSSSSSSSSSSSSSSSSSSSSSSSGGSSGGGASSPWLLLVGAALVLMGRRKRKLA"
FT   gene            460416..461477
FT                   /locus_tag="TERTU_0447"
FT   CDS_pept        460416..461477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0447"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM TIGR03304"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12337"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMW1"
FT                   /protein_id="ACR12337.1"
FT                   /translation="MEKEMMIKQLLALVLAWGCAIPGFAALSTDKEKPTEIDLAKNYPV
FT                   ILRDSDVEGTFYVRVINIPPGVKDYFSVEITAEKIEVEALKDPRSKSTDDSETAMETAA
FT                   EGTNTKGAADPCSDLKTATKKLQDETNPAMVGFHLTQVKTLLDDEQCRTSEITYAAKSA
FT                   IESTQSAVFKVSVAHGERVTLLIKTQDKDKKLTRSFYEHVISGAQEKFYTHVGFTFLKN
FT                   QGTEWYSKPTVADDGKTTYTVARQESQDDILYVPTALFTMPMGSRGKTVEYGITAGLGV
FT                   NNSDVVVVLGGSLIIKQNVLVSLLVGVQEQSSLNGGYANGQALGETAVDSDALNGKEFR
FT                   GTVGLSVGYRFGK"
FT   gene            complement(461614..462894)
FT                   /locus_tag="TERTU_0448"
FT   CDS_pept        complement(461614..462894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0448"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11760"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMW2"
FT                   /protein_id="ACR11760.1"
FT                   /translation="MIRKLVLMSMMCSAVVLTGCGGSDDTDSVPVPGNGSTTSSSSSSS
FT                   SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSGSGATLEYTF
FT                   DDAAEVDDWDSSAQGNAVAPALSHSATEGAMVIEPTWASEDDSFYVFYEDADPAVITGA
FT                   DISLDVYVPQEYVTDKKTAFMLFFHDVNGEYANVGYRTAEGLTGDAYNTFTITNLGATN
FT                   GTAFGHKNDNFDLTKVDTFGLQVNANKKPTTVTGDLMIDNVVLTLAEDKTPTTPTYNSD
FT                   FAMDSGWTASYGALTMDYSDVDGVKSVWFEPGSGDATYRNLLYVTDAYTDLSNATVSFT
FT                   VQADQAFIDSGATLQAMVQQAGSPYDGVYCNVAATTTDVMTVDCLVNKALLPADGKYQI
FT                   GVQVTGDVTFAGKVTIYSVEVEPAPAS"
FT   gene            complement(463297..464703)
FT                   /locus_tag="TERTU_0450"
FT   CDS_pept        complement(463297..464703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0450"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11289"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR014010"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMW3"
FT                   /protein_id="ACR11289.1"
FT                   /translation="MIREVLLVGLMCSAVALTGCGGSDDNDKDPSDNSSSTSSSSSSSS
FT                   SSSSSSSSSSGSVPGGSTSSSSSSSSSSSSSSSSSSGAAASSSSSSSSSSSSSSSSSSS
FT                   SSSSSSSSSSSSSSSSSSSSSSSSSSGTAAPREIRYEFSGSDEIDDWNTTTWGSSTADP
FT                   IILYSAEKQALELDTAWNSDDDIAAILFGVDPPINLKNGSLSMDFIVPDAYITDGRPVF
FT                   RFFAIDSDGNFNYILWGDMFKQTPDDDNRFTLTKPNMNVSTQNFDQTTVTSVGVVIQTG
FT                   VTEAKPAPRVSTSEHVFVDNVILRNHAANKIATDPNFESDFPLELSTAWSSSVPLAISF
FT                   GAIGGVKSVSYKPGSTATQFRNLVYKSSDFLDLSNATITMNLSVNQSFLDSGASLQVMA
FT                   QRAGDDYAGVYCNAVPADTEWFRVECPVEGALTLGNATEFQYGVQTLGGDGNADAKVSI
FT                   YNIQVTPQSN"
FT   gene            465193..466800
FT                   /locus_tag="TERTU_0451"
FT   CDS_pept        465193..466800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0451"
FT                   /product="phosphate transporter family protein"
FT                   /note="identified by match to protein family HMM PF01384"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13083"
FT                   /db_xref="GOA:C5BMW4"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMW4"
FT                   /protein_id="ACR13083.1"
FT                   /translation="MSVQISDPVRTGASSLLPFSNTSLLFGVLLVAMTTYFLFWGFGYV
FT                   NGNQGFIFVLATLFGVFMAFNIGGNDVANSFGTSVGAGTLTIKQALAVAAIFEVSGAVI
FT                   AGGEVTSTIRKGIVDLSTVAIAPMQFVYIMMSALLAAALWLLFASKKGWPVSTTHSIIG
FT                   GIVGSSITLGILVAGSQGAVNLVHWDKIGTIAISWVLSPVLGGAVSYVLYAQIKKHILQ
FT                   YNDKAAAQLAAMREEKRQHRAEHKKAFETLSELQRISYNSAMARDASVIAEPDYNPEDL
FT                   ESDYYQRLHAINQKTHDIDSHRALEVWVPVIAAAGGMIISSMLLFKGLKNMHLGLSTLH
FT                   NYLIMGMVGATIWMATFIFAKNLKGVTLERSTFLMFSWMQVFTASGFAFSHGSNDIANA
FT                   IGPFAAILDVLRTGALNSKAAVPSIAMITFGVALIAGLWFIGKEVIQTVGHNLTKMHPA
FT                   SGFSAELAAAAVVMMASLMGLPVSSTHILIGAVLGIGLVNRQTNWNLMKPIGMAWVITL
FT                   PAAGLLSALAFLFFNSVM"
FT   gene            466819..467748
FT                   /locus_tag="TERTU_0452"
FT   CDS_pept        466819..467748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0452"
FT                   /product="polyphosphate kinase"
FT                   /note="identified by match to protein family HMM PF03976"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACS93533"
FT                   /db_xref="GOA:C6AQZ1"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022486"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6AQZ1"
FT                   /protein_id="ACS93533.1"
FT                   /translation="MNDYFDDLDDNVDLSWLQAELEDAIDEDYELEFSEPTLSMELREL
FT                   YKKEHPQSIPRRTYFKQLLMLQTELIKLQDWVVASGEKIAILFEGRDAAGKGGVIKRIT
FT                   QRLNPRVVRVVALPKPTEREQTQWYFQRYVKHLPAGGEIVLFDRSWYNRSGVERVMGFA
FT                   TENEVESFFQQVPEFEKMLVNSGIRLLKYWFSITDEEQQLRFLMRIYDPLKQWKLSPMD
FT                   LESRVRWEAYTKAKEETFARTNIPDAPWFIVEGNDKKRARLNCIDHLLTQIPYQEVESE
FT                   RIELPQRIFHPEYERRDLPPEMFVPNKY"
FT   gene            complement(468127..468969)
FT                   /gene="fghA_1"
FT                   /locus_tag="TERTU_0453"
FT   CDS_pept        complement(468127..468969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fghA_1"
FT                   /locus_tag="TERTU_0453"
FT                   /product="S-formylglutathione hydrolase"
FT                   /EC_number="3.1.2.12"
FT                   /note="identified by match to protein family HMM PF00756;
FT                   match to protein family HMM TIGR02821"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13512"
FT                   /db_xref="GOA:C5BMW5"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR014186"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMW5"
FT                   /protein_id="ACR13512.1"
FT                   /translation="MEKLSAIQCCGGEQLRFKHRSHSLNCDMTFSVFLPQDAQKTPVPV
FT                   IYWLSGLTCTDENFVTKAGAQRFAAEYGVAIVAPDTSPRGDDVPDDPNGAWDFGKGAGF
FT                   YVNATEQPWAAHYRMYDYVVTELPALISQHLPVDTARQSIFGHSMGGHGALTIALKNPG
FT                   KYRSVSAFSPICSPLNCPWGEKALGQYLGDDRSAWEDYDTCTLLGKAQSHLPVLVDQGS
FT                   ADSFLVEQLKTDRLLRASTEHQYPMTIRMQAGYDHSYFFIASFIDEHIAFHANHLLWS"
FT   gene            complement(468969..470075)
FT                   /locus_tag="TERTU_0454"
FT   CDS_pept        complement(468969..470075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0454"
FT                   /product="S-(hydroxymethyl)glutathione dehydrogenase/class
FT                   III alcohol dehydrogenase"
FT                   /EC_number="1.1.1.284"
FT                   /EC_number="1.1.1.1"
FT                   /note="identified by match to protein family HMM PF00107;
FT                   match to protein family HMM PF08240; match to protein
FT                   family HMM TIGR02818"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11241"
FT                   /db_xref="GOA:C5BMW6"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014183"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMW6"
FT                   /protein_id="ACR11241.1"
FT                   /translation="MKTRAAVAFAAGQPLQVMDVDLEGPKAGEVLVEIKASGVCHTDAF
FT                   TLSGDDPEGAFPAILGHEGAGVVVDVGPGVKGLKPGDHVIPLYTPECRECDYCLNPKTN
FT                   LCQAIRSTQGQGVMPDGSSRFSIDGKPILHYMGCSTFSNYTVLPEIALAKIREDAPFDK
FT                   VCYIGCGVTTGIGAVAFTMKVEAGATVAVFGLGGIGLNVIQGAKMVGATRIIGVDTNPA
FT                   KAELAKQFGMTDFVNPKDYDSVVDHLVQMTGGGVDYSFECIGNVNVMRQALECCHKGWG
FT                   RSCIIGVAGAGQEISTRPFQLVTGRSWHGSAFGGARGRTDVPRIVDWYMEGKINIDDLI
FT                   THTMPLDEINNAFDLMHKGESIRSVVVY"
FT   gene            complement(470315..472090)
FT                   /locus_tag="TERTU_0455"
FT   CDS_pept        complement(470315..472090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0455"
FT                   /product="TrkA-C domain protein"
FT                   /note="identified by match to protein family HMM PF02080;
FT                   match to protein family HMM PF03600"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACR10671"
FT                   /db_xref="GOA:C5BMW7"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR031312"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMW7"
FT                   /protein_id="ACR10671.1"
FT                   /translation="MDWQGWFTLLLTGTSLLLLVLTRIKPHLVMMAVLTALSSLGILTG
FT                   SEALSGFSNPGLITVAAMFIIACGVHHSGGVDMLVNNVLGTPTTTRGALARIFAPIVLL
FT                   SGFLNNTPVVATMIPAVHAWARKIKIPASKLMIPLSYTAILGGTLTLIGTSTNLVVNGQ
FT                   YQALTGEPGFSLFAITPVGLPVALLGLAFMWLFFPHWLPDRSKKQAFANLREFTLEVAV
FT                   APNGPLVGKTVAEAGLRNLQRIYLVEIERQGTIVTAVPSQEILQSNDRLVFAGDTQAIS
FT                   DLLRINGIVPSRENGHSAPLEVDRAERRLVEAVVSPHCAAVGKAIRDARFRDRYGAAVL
FT                   AVARGGERVKGNLGTIKLAAGDTLLLEARPAFVSRQRYAKDFLLINDLNEDAPRHERAY
FT                   IAWAILVGVVAAAGLGLLSMLDASLIGAGLMIVTRCCSVNQAERSLDLPVIVTIAASFS
FT                   LGAALQKTGVATYIAEAIVTFSFGHAWLMLVLTYFVVALLTETITNNAAAVIMLPIVLE
FT                   MTEKAGLNNEPFILALMIAASASFVTPLGYQTNLMVFGPGGYRFSDFTRVGLPMMLFVA
FT                   TATLSLLLLGYPLYP"
FT   gene            472540..472653
FT                   /locus_tag="TERTU_0457"
FT   CDS_pept        472540..472653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0457"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11576"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMW8"
FT                   /protein_id="ACR11576.1"
FT                   /translation="MLNRDLFLANPLTFSHLEPRNLAEGSPFARGPSSFLG"
FT   gene            472764..474461
FT                   /locus_tag="TERTU_0458"
FT   CDS_pept        472764..474461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0458"
FT                   /product="glycine betaine transporter OpuD"
FT                   /note="identified by match to protein family HMM PF02028;
FT                   match to protein family HMM TIGR00842"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13638"
FT                   /db_xref="GOA:C5BMW9"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMW9"
FT                   /protein_id="ACR13638.1"
FT                   /translation="MLYTLSRVNGVFTHQFKTEIIMSKTELQALRDQYDTDFEVGQDNI
FT                   QAMGMDLHNPVFFISAILIIGFVLATLLFPTQSADFLGGAKSWTINTFDWLFMASGNIF
FT                   VVFCLALIVLPVGKLRLGGKDATPDFSTPSWFAMLFAAGMGIGLMFWSVAEPIAYYTDW
FT                   YGTPFNTEPETQAAARMAMGATMFHWGLHPWSIYAVVALSLAFFSFSKGMPFTIRSVFY
FT                   PIFGERVWGWVGHFIDILAVLATIFGLATSLGLGAKQAAGGLHFLFGIGNDVSTQIAIV
FT                   IGVTLVAIFSVVRGVDGGVKLLSNINIGMALLLFAFVFIAGPTLHLLGWIGTTLWSYAA
FT                   NILPLSNWLGRDDQSWLHGWTVFYWAWWISWSPFVGMFIARISRGRTVREFLVAVLLVP
FT                   CLVTVIWMGVFGGAALEQSINGVGELADGISRVSLSMFQMLEQLPLTEISSFLGIVLVL
FT                   TFFVTSSDSGSLVIDSITAGGKLDAPVPQRIFWASMEGLIAGTLLFGGGKQALDALQAG
FT                   AISTGLPFTLVLLLMCVSLYKGLHHELALTRLEKKVRHAERRNADQSG"
FT   gene            474519..475670
FT                   /locus_tag="TERTU_0459"
FT   CDS_pept        474519..475670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0459"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13168"
FT                   /db_xref="GOA:C5BMX0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMX0"
FT                   /protein_id="ACR13168.1"
FT                   /translation="MGDISAVIYFLGAPLVALALVLAGLRSAFANATLGRAQLWLAGIL
FT                   VVQLCLEVLVNAERAPAKALWLGLLLASAHLLGPLLLLAFKRADVLRRWDIWLAVAGMV
FT                   AVLPLVYTTQLQSTYSGSRIFSSGYWLWVNCLDGASLLLFLCHWPTCVYRIRCDLAAPT
FT                   SVQSWLRSGAQDASAFNQVLVALLCVQWLLALVKLLHCLTLGPPTLVSMLMSWGQVAML
FT                   LGLLLLLLAKPQVGIKPVAKSKKYGRYQKYKKSGLVDADKQRIAERIQQVMADPRWVAS
FT                   PTRKLDHLATAARASEHYCSQVINELFDCSFFELLNRARVKLASERLVASPECTILDVA
FT                   LASGFNSKSTFNAAFKRYLGCTPSEYRRANTVKSSLQAYEPTR"
FT   gene            475763..476821
FT                   /locus_tag="TERTU_0460"
FT   CDS_pept        475763..476821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0460"
FT                   /product="peptide-methionine-S-oxide reductase"
FT                   /note="identified by match to protein family HMM PF00756"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12493"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMX1"
FT                   /protein_id="ACR12493.1"
FT                   /translation="MRKAYLGLFLCFIFCLLSGAASAGEIIDRTLRSRILGGEHLGYDP
FT                   QRHIKLYLPSGYATSGKRYPVLYHFHGLFWSNTQAFADGNLQRTLDFAMAQGIIPEFIW
FT                   VAGDFTTAGAGAFFENSAQAGRWLDHVVEELVPYVDSHFRTLATREARGLLGEFTGAYG
FT                   ALKIAMYHPELAASVYAMHPVGTGLGWVPMSQRDFWSRLLTARDPAGVPDGFESVFLAM
FT                   AQAYLPRPDKPPFYADFIVRNSDGEIVVDSKNFHTLRTRFLLDTQIPAAAENLKQLQGI
FT                   KLDWGRYDSNQDHVLANQNFVRLLEDYGIEHEAEEYRGNGHDHWTNGRVLRDVLPFFAR
FT                   MFAAGGKGSSAG"
FT   gene            complement(477019..477810)
FT                   /locus_tag="TERTU_0461"
FT   CDS_pept        complement(477019..477810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0461"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02582"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12042"
FT                   /db_xref="GOA:C5BMX2"
FT                   /db_xref="InterPro:IPR003734"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMX2"
FT                   /protein_id="ACR12042.1"
FT                   /translation="MSTQSSSAIKRITIALLGRSIDTERREEVLIEKLGAVRYRDAYAI
FT                   RTVAGEAWLFDYGVLVGWDLPEDLRQQLVNDLEDIIEDPSANSLTEHYSYTVDSGQPFS
FT                   VQHDMLSIPDQEQLTRLGLSHAFAQSAKLGFFEDAAQQVIQRNAHISKQLAATGKVPLS
FT                   RRELAKLRGVLFDTSSDITLHFNLLDTPEFFWDYPELEAGYLRLAKYLDLAPRIEIMNK
FT                   KLGTIHELLDMLAAEQHHKHSAFLEWIIIVLIAVDIVVYFL"
FT   gene            complement(477821..478930)
FT                   /locus_tag="TERTU_0462"
FT   CDS_pept        complement(477821..478930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0462"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14735"
FT                   /db_xref="GOA:C5BMX3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR021770"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMX3"
FT                   /protein_id="ACR14735.1"
FT                   /translation="MDTTDIRRAQLGDLNALLALEQACFSNDRLSKRSFRHFIQASQST
FT                   LLVAEHSGVILAYGLVWHHKGTRLARLYSLAVSPEARGAGLASRLLARLEQNAAERGRL
FT                   YMRLEVAKNNTRAIALYQARDYRIFGEYSDYYDDHTDALRMQKQIRTLSQEGAQHSTPW
FT                   YQQTTEFSCGPASLMMAMASFAKGVECSQTMELDIWREATTIFMTSGHGGCHPLGLALA
FT                   ARRREFEVQAWINNDQPLFLDGVRSDHKKSIMAVVHNHFVTQCAAEGVAVNYAEVSQDT
FT                   VEDWLQNGFAVVVLISTYRLDGKKAPHWVVVTGVDDQCFYLHDPDLDTKTQLAIDCQHV
FT                   PIAREDFARMTAFGSNRLRTAVAIRPATH"
FT   gene            complement(478934..480382)
FT                   /locus_tag="TERTU_0463"
FT   CDS_pept        complement(478934..480382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0463"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF08443"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13120"
FT                   /db_xref="GOA:C5BMX4"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR025839"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMX4"
FT                   /protein_id="ACR13120.1"
FT                   /translation="MITSLFVVEDTASLALVPENAVTFDTYLKDYPKLNEPRLRVINLC
FT                   DTSRYLSQGYYCSLLAEARQHDVLPSVKVINNLRASGVGGLWFNDKVLGKDVSADEITG
FT                   AHLVCMGEVADVRLKKLAQRAFEEFSAPLLRMVLSREASGLKAHVTRVSLASLSEAEQR
FT                   FAQDVLASYARQSWRKRGASKKYRWEMAMLVDENEAVPPSDKGALSRFISAGKKLGIRI
FT                   QQVTAADIGSLNQYDGLFIRETTAIDHHTYRLAREAEESGLVVMDDPESILRCCNKVYL
FT                   HDAFNYKKVPSLRTEFVSDANRETLEGLQARFGFPLVLKMPEGSFSRGVFKVSSPEELE
FT                   QVCRKLLAESALVLAQEFLFTEFDWRIGVLNGRALYACRYYMARNHWQIYNHGNKRHFS
FT                   GGFDALATFEVPRKVLTAALKAAAVVGQGLYGIDIKEVDGKAYVLEVNDNPSLDHGVED
FT                   KYLGDELYMQIMSEFSRRLELRGR"
FT   gene            480721..481905
FT                   /locus_tag="TERTU_0465"
FT   CDS_pept        480721..481905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0465"
FT                   /product="putative glycosyl hydrolase"
FT                   /note="identified by match to protein family HMM PF02012"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12207"
FT                   /db_xref="GOA:C5BMX5"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMX5"
FT                   /protein_id="ACR12207.1"
FT                   /translation="MSNLLILGTRKGTVIIDRQAQGWVVRPIEHAGIPICYAARDPRDG
FT                   TLWASQDNGHWGAKLSRSKDNGASWEDLSSLKYPEGARHITQRPPLPDDSETDSQVELA
FT                   YQGASVYKIWNITFGTAEQPNRIYAGTIPGGLFVSDDGGDTWALNRPLWNHESRGGDLF
FT                   AGDATSQNHWMGTPASMDYGIFEPGIHSIVADPSDSAHLYVAVSTAGVLESRDGGQTWQ
FT                   GRNKGMVMDYLPDGEADWGHDPHFVTACKGAPQYLWQQNHCGVFFSDDGAASWRKVSDT
FT                   DSGVHFGFPVAVDDTDGRTAWVVPARADSHRMAIDGGIYVARTTDGGETWQSLRTGLPQ
FT                   QHAHDIVLRHALDVSGDMLCFGSTTGNVYLSENRGDSWECLGHNFPPVYSVRFG"
FT   gene            481926..482189
FT                   /locus_tag="TERTU_0466"
FT   CDS_pept        481926..482189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0466"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACR10794"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMX6"
FT                   /protein_id="ACR10794.1"
FT                   /translation="MTSHLYRFFPALEGLEIRVSAGSVADALAELNQLAPNFSDYILDD
FT                   TGALRRHVNLCINNELIVDRKKLSDQLGDEDTLYIFQALTGG"
FT   gene            482309..482479
FT                   /locus_tag="TERTU_0467"
FT   CDS_pept        482309..482479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0467"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11251"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMX7"
FT                   /protein_id="ACR11251.1"
FT                   /translation="MRQNLSPSFHLLFVLRNQRTFYFHPNFYFFLRRMVNVKTRKKFKK
FT                   NRETLLSILSH"
FT   gene            482577..485678
FT                   /locus_tag="TERTU_0468"
FT   CDS_pept        482577..485678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0468"
FT                   /product="carbohydrate binding module family 32 domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00754;
FT                   match to protein family HMM PF06537"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14110"
FT                   /db_xref="GOA:C5BMX8"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR010538"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMX8"
FT                   /protein_id="ACR14110.1"
FT                   /translation="MDNFLIRMSTRKRSLVQTCVAVPLLTFLLASCGGAGSDLDSSPNT
FT                   PPAVGNGNNNDGNNNNGGTVDDNIGNDEADSSGDEADSSGDETEAPVDETSEPDENDNG
FT                   QSAGGVDELPEPEFEAPPTRDEVSLPSNDAPVNPAPGSELRLPGDYQFNGPGQIISGVT
FT                   ATSSATRNNNATAAKAVDGDMSTRWESEWEDDAWIQFDFGEKTAVGSMKLSWENAHADQ
FT                   YAITISDDGENWYQIRYVNNSPGGTEQFFNLSMNARYLRLNGVERSSQYGYSLYEAEFK
FT                   TPGTDNAMPVLNTSYASLPMSGEGREPLPAPENPIEMVRFTLADGTLVTRFGMVGRSRH
FT                   ARERGEDWGEIGYGENETVDAAGNPVDKAPGAHLNFVANYFKNRTWGVELIDNTNVAGV
FT                   TKPKIIVNQYFQQRQKGGGHAFVRRFDDPNVTGFGWMSPGDLLDDSTYLTDGAPCPVMP
FT                   KPPEGALLNPNSGYNGVIGANDGCSVVFDTYPGHRAIAANSDGVMVPTNQPVQARKLVA
FT                   GDVIEFTSSFFSTRAAMDEVGDSGAFRYYTNELTYVMGEGLRPWYGVQPRLMNEPLPMA
FT                   TLQGGLGSVSYDYADNSEFIFQQPHNNIGMQNMQRFVEGRRWIHTNLWTGEHNENGNDR
FT                   NDDGMGLQGPHFNQSSCFGCHINNGRSFAPTAINQRLDTMAVRVGSVAANGQYLPHPVY
FT                   GHALQMNSRSPVTGKSENWGNGVWVSGFETKNVSLADGTVVELRKPQVSFEGPTPEVYS
FT                   LRSAQPMIGMGLLEAISDEEILSRARRTPDEDGVMGRANYNYDPETGDVRLGRYGWKAS
FT                   KVSLRHQVANAALLDMSVTSPMYPNRDCLAGPERCNTQSGTDAGLSEDALELMTNYLNL
FT                   LAVPAQRSVVSGFPNGVAPLSYLDVNPAKIAAGETVFEEIRCSACHVSSIKTSKRSQFD
FT                   EVREQFIKPYTDMLLHDMGDDLADNFEEGLAKGSMWRTSALWGIGYTKDVAGDVPVGYL
FT                   HDSRARTLTEAIVWHGGEAETSKQRFVNLSREDREALLAFLGSL"
FT   gene            complement(485823..486821)
FT                   /locus_tag="TERTU_0469"
FT   CDS_pept        complement(485823..486821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0469"
FT                   /product="putative homoserine dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00742;
FT                   match to protein family HMM PF03447"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14608"
FT                   /db_xref="GOA:C5BMX9"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR022697"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMX9"
FT                   /protein_id="ACR14608.1"
FT                   /translation="MKTIKIAIAGAGNIGRALLDAIYEQADAFEQKHGVRLRVTGVCNS
FT                   RGGLLDTAGLSPKKIAEQSAFTPDLAGRNFVQQVDADILVEAGPSDYITGEPGLSYADA
FT                   AIARGLHVIFISKGAMLLHGTQLLEKARKQGVAIKYRCATASGLPAIDLLERAFANATI
FT                   EKIEGVLTGTTSFILDKMQSQRCSLTEALTEAQALGMTEPDPTNDLNGKDTACKLLIIA
FT                   NTAFRTQLTLADMSVSGIESVSPEDIATACAEGKTPRLIGSVARTTSGINAAVQLQYLN
FT                   NTDTLARLNARDKALRIFTREFGETILAGGSSSRDATIAAAMEDLAQIVRL"
FT   gene            complement(486988..488526)
FT                   /locus_tag="TERTU_0470"
FT   CDS_pept        complement(486988..488526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0470"
FT                   /product="transcription regulator"
FT                   /note="identified by match to protein family HMM PF00158;
FT                   match to protein family HMM PF01590; match to protein
FT                   family HMM PF02954; match to protein family HMM PF07728"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13210"
FT                   /db_xref="GOA:C5BMY0"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMY0"
FT                   /protein_id="ACR13210.1"
FT                   /translation="MPLEHYLSVIEDLSRDLPAEARYRRLLHAIRQTIPCDAIGLLRLV
FT                   NDSLQPVAFLGLREEVRGRRFTIEHHPRLKSILYSEQLVRFPADSELPDPYDGLLLATS
FT                   EHVHIHDCMGMSIYIDDKPWGVITLDAVQADQFESVDPQRQTLAISLTRAVVTAAERIH
FT                   QLQQQVNRGHAATAQLNKELALSEITGTSAGMQKILADVDMVAPTPLAVLIAGETGVGK
FT                   ELIARRLHLNSDRFNQPLVKLNCAALPENLAEAELFGHTRGAFSGANGERAGRFELADG
FT                   GTLFLDEVGELPLNLQAKLLRAIQEGEVQRIGSDHPVQVNVRIIAATNRDLEAEVEQGR
FT                   FRADLFHRLSVFPITVPPLRDRQRDVLHLAEYFLERDQQRLKIQKLVLSAAARTALMQH
FT                   SWPGNVRELEHVLSRAALRASRKSLPGAIVVIDAIDLSLDDSTATSNSELSNNAAIAGV
FT                   QVQDSLARQMQQFQRNLITQALVETGGNIAAAARSLAVDRSNLLRLMKRLGIRS"
FT   gene            488780..489967
FT                   /locus_tag="TERTU_0471"
FT   CDS_pept        488780..489967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0471"
FT                   /product="globin domain protein"
FT                   /note="identified by match to protein family HMM PF00042;
FT                   match to protein family HMM PF00175; match to protein
FT                   family HMM PF00970"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13645"
FT                   /db_xref="GOA:C5BMY1"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023950"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMY1"
FT                   /protein_id="ACR13645.1"
FT                   /translation="MLTPSQMAIVKATAPLVGEKAGDITAHFYPMMFARYPQVIQLFNQ
FT                   THQRKGSQPQALAKALVAYATHIDQLAALGDAVAMIANKHCSLNIQPEHYPIVGECLLE
FT                   SIAAVLGESVTAEVADAWSAAYKQLADILMSAEEHLYQNNSLRQGGWRGERAFRIARID
FT                   TESAVIKSFYLVPAAGEQVIDFSAGQYIGLVITVNGESVRRNYSLSEAPGKVGLRISVK
FT                   REEGGLVSDYLHQQAKVGDTLMLTPPAGTFTLGHSAVSQERPLLFVTGGVGITPAISML
FT                   NDCVHNGRPITFIHAAVNSDHHAFDVHLKALAKTHRNLNYYVIYEKPLEEDTPDAMGFI
FT                   DREILSRFVPASGDVDLYFLGPKPFMRCVKGLAAELGIPHEQCFFEFFGPVEELA"
FT   gene            490247..490873
FT                   /locus_tag="TERTU_0472"
FT   CDS_pept        490247..490873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0472"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13074"
FT                   /db_xref="GOA:C5BMY2"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMY2"
FT                   /protein_id="ACR13074.1"
FT                   /translation="MHLNFSELSPLQRYLTIVQTVTPRPIAWILSDSGEGRFNLAPYSF
FT                   FTAICADPPLLLVSVGKKLAGKEAGQVKDTSINIRERKEFVVHIASTAQAEALNQSAAT
FT                   LDHAISEVDTLGLATAELPGFRLPRIADCSVAFGCTLYRLDEVGNAPQSVIYGEITHAY
FT                   IAPDVISNADTVPPGIDPQKLDPLAKLGGPLYTGLGDILNLPRPE"
FT   gene            complement(490968..491939)
FT                   /locus_tag="TERTU_0473"
FT   CDS_pept        complement(490968..491939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0473"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13523"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMY3"
FT                   /protein_id="ACR13523.1"
FT                   /translation="MKNFLSHKRLLQCAAGILASLGVATASAATNIIYIIDTTGSTQPL
FT                   IDDWKAEITSAETLNELTAVYPGARFGLASHLDFPMNGHAAAGEYAYKLEQQLTTNTAV
FT                   FSAAVNGLVSGYGGDTPESQLEAIYQACSGAGYDLNNNGSYLDNGDIPPSNMGFVKPLP
FT                   ATEMTLIFHFTSPLVYHNYPEDLSYPDPGVVNRPATLAEVVDTIENECNTRFFTFVPAN
FT                   EPLPGMLASTFGFAAMPFSYDMQTGDALNYSLMAVGSSASENPAEILAEATDGDIKYVG
FT                   PNLEGLDVAIREVMRAAADPESPCDAGEKLIILPFGSYCVPI"
FT   gene            493219..494124
FT                   /locus_tag="TERTU_0476"
FT   CDS_pept        493219..494124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0476"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14296"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMY4"
FT                   /protein_id="ACR14296.1"
FT                   /translation="MREQAKSVSAFAANPLRARILIRELERKCLEVKPAASGEKFDRYE
FT                   HLNRFIACHRNSKKRFDLPRRPFFRWRNGEALPNLTNRRLIDGLFDVDLGSKRGGRSIN
FT                   GPEQTLLVALDLISRSNAPNNQETLTEAEEILAVVNSAVCDLIPRIPNLKRPKFTSYRG
FT                   GKALTSSANQKSSRYAVWSKKRPVAYPFIVERINPYDSVSPLCAALLYLVKPNIQTYLP
FT                   DGLAQALLLDVISGVIAAYIVMLHWNPSEFQTGGLLVDLYRMVYRIFLSGEAKVSQKGT
FT                   ELVREVFIIVCQNVLKSLTN"
FT   gene            complement(494288..495571)
FT                   /locus_tag="TERTU_0477"
FT   CDS_pept        complement(494288..495571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0477"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14753"
FT                   /db_xref="InterPro:IPR031009"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMY5"
FT                   /protein_id="ACR14753.1"
FT                   /translation="MGKKSKKYEWEIGQALPSLDEHSQTKHHIISDYLKRYVEVVMAHY
FT                   AMEKLSMTIVDGFAGGGKYVDALSKTPVDGSPFLILRAIKEAEATINIGSKKNRCIDAE
FT                   YHFIEKEPTHLDFLRYEIQQSNFSGLLQNNAFLHNTSFAEAATGIIERIKKRNPRTQRA
FT                   IFILDQYSYKDVPFSIARKVLTELSNGEIILTFNFDAAQSYISDTPSNRKAFSNIQLDE
FT                   YISWKRLAEFKEAGNWHAAIQEQLANAIFKASGAKHITLFFIHPKKGRAYWLVHLSNVY
FT                   RARDVMMDIHWKHANNQPYFSHHLGAGIYGLGYQAFQIPGQNSLELCDEKVLNEETEKR
FT                   CVKALSEELPRHIFETKGPISFSQLTDQLGSFTVASESHIKDALQSAIETKELVIRTNK
FT                   GGIRRSATQIASTDLIEYSQLPLIFSLG"
FT   gene            complement(495586..496329)
FT                   /locus_tag="TERTU_0478"
FT   CDS_pept        complement(495586..496329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0478"
FT                   /product="phage protein Gp37/Gp68"
FT                   /note="identified by match to protein family HMM PF07505"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13687"
FT                   /db_xref="InterPro:IPR011101"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMY6"
FT                   /protein_id="ACR13687.1"
FT                   /translation="MASMSKIEWTEQTWNPVTGCTKVSPGCKHCYAETLSKRLRAMGTP
FT                   GYEKEFSEINLLPERLTQPLERKKSTMYFVNSMSDLFHEEVPFEYIDKVFGVITQTPHH
FT                   IYQILTKRSERMRDYFKNRKVPKNAWIGVSVEDRKYGLARIPHLQEIDAETRFLSIEPL
FT                   LEGLGRIRLKGIHWVIVGGESGAKARPMNEQWVLSIRNQCNKAGVDFFFKQWGAWGADG
FT                   VKRSKSANGRKLEGKTWDMIPTIAV"
FT   gene            complement(496729..496807)
FT                   /locus_tag="TERTU_0479"
FT   tRNA            complement(496729..496807)
FT                   /locus_tag="TERTU_0479"
FT                   /product="tRNA-Met"
FT   gene            complement(497222..499081)
FT                   /locus_tag="TERTU_0480"
FT   CDS_pept        complement(497222..499081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0480"
FT                   /product="RNA polymerase sigma factor RpoD"
FT                   /note="identified by match to protein family HMM PF00140;
FT                   match to protein family HMM PF03979; match to protein
FT                   family HMM PF04539; match to protein family HMM PF04542;
FT                   match to protein family HMM PF04545; match to protein
FT                   family HMM PF04546; match to protein family HMM TIGR02393;
FT                   match to protein family HMM TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14128"
FT                   /db_xref="GOA:C5BMY7"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007127"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR007631"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR042189"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMY7"
FT                   /protein_id="ACR14128.1"
FT                   /translation="MSEQQQSRIKELINRGREQGYLTYDEVNDHLPDDISDPDQVEDII
FT                   QMINDMGIRVYEVAPDADELLMTDGEASPDEIAAAEAAAALAAVETEAGRTTDPVRMYM
FT                   REMGTVELLTREGEIAIAKRIEEGLRELMHALAFWPNAVQQIMDEYDLVEKEERRLNDV
FT                   ISGWLDPAEEVEAATPVDSTDNNTKNDADDEDDSDDDEDEDDDSSSDEDENNSGIDPEY
FT                   ARERFDELRVQLVAANDAIAKHGLDSKETGVALEALGEVFKFFKLAPRQFDPIYNYVRD
FT                   VLARIRAEEKEIMRLCVRMAGMPRKTFVKEFPGNEINEDWIPEIIRKKRDYSDSLRPVE
FT                   GDILRSQRKLQQIEEETGLELTAIKEINRRMSIGEARARRAKKEMVEANLRLVISIAKK
FT                   YTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRI
FT                   PVHMIETINKLNRISRQMLQEMGREPTPEELGERMEMPEDKVRKVLKIAKEPISMETPI
FT                   GDDEDSHLGDFIEDTTITSPVESATSQGLMEATKAVLAGLTAREAKVLRMRFGIEMNTD
FT                   HTLEEVGKQFDVTRERIRQIEAKALRKLRHPSRSDHLRGFLDD"
FT   gene            complement(499224..501146)
FT                   /gene="dnaG"
FT                   /locus_tag="TERTU_0481"
FT   CDS_pept        complement(499224..501146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaG"
FT                   /locus_tag="TERTU_0481"
FT                   /product="DNA primase"
FT                   /EC_number="2.7.7.-"
FT                   /note="identified by match to protein family HMM PF01751;
FT                   match to protein family HMM PF01807; match to protein
FT                   family HMM PF08275; match to protein family HMM PF08278;
FT                   match to protein family HMM TIGR01391"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11905"
FT                   /db_xref="GOA:C5BMY8"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013173"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR019475"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMY8"
FT                   /protein_id="ACR11905.1"
FT                   /translation="MARIPQSFIDDLLNRLDIVEVVDHRVKLKKNGKNYAACCPFHEEK
FT                   TPSFTVSPDKQFYYCFGCGASGNAIGFLMEYERQSFVESVETLAKSAGLEVPREETPFH
FT                   REQYARQKNLYDVLEKASSYYQLQLKENRGRDKAVRYLQNRGLSGHIARDFGLGFAPGG
FT                   WDNLLTKYGLSEQDIDLLVGSGLVIRRAEDDKLYDRFRNRIMFPILDNRGRVIGFGGRV
FT                   LDDSKPKYLNSPETDVFHKGEELYGLYQARMANRNLEQILVVEGYMDVIALAQYGLTNA
FT                   VATLGTACGEEHLKLAFKHTQEIVFCFDGDAAGRTAAKRALMNSLTSMEDGRQIKFLFL
FT                   PEGQDPDTLVRQIGAERFAQQIKNGTPLEDFLFDVAAEGLNIQSMDGRARFSKICAPLL
FT                   AQLPAGVYRELMFTNLAKRTGLSSAALMELTHEKPQLPDAAPALPAVVDVEPPPVDVPE
FT                   HSAATIYEHLEGTRFQGAPLPDEQEKQAFRKRTNVALNPVKAATLLLLDNPQLIQQVVL
FT                   RPDADAAGNEELLRLQNLIDYLQNRPNATFSTLLGFWGGAYGIDSQQELARMLATHELT
FT                   RDSHLASFESAKVLSHAFAKINHQYHRLTHRQELEQLKSKGLANLNSEEKDRFRQLVQL
FT                   IQKPV"
FT   gene            complement(501260..501865)
FT                   /locus_tag="TERTU_0482"
FT   CDS_pept        complement(501260..501865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0482"
FT                   /product="glutathione S-transferase family protein"
FT                   /note="identified by match to protein family HMM PF02798"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12373"
FT                   /db_xref="GOA:C5BMY9"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR034343"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMY9"
FT                   /protein_id="ACR12373.1"
FT                   /translation="MKLYMSHTSPFARKVRMTTRLIGLADQVEEICTTFESAELRERNP
FT                   LGKIPALEAPDITLFDSALICEYLDEQYVEAGGDSLYHGDRDDYYPLLSALALANGITE
FT                   AAVSTMMETKRTTEHSTYWLERWNTAMETGIRNLDVAVLGTPADMNMAGIAMAACLGYL
FT                   DFRLGDRNWRAWNPALADWFHEIAQQRWFTDTAPPEGA"
FT   gene            complement(502023..503477)
FT                   /gene="gnd"
FT                   /locus_tag="TERTU_0484"
FT   CDS_pept        complement(502023..503477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gnd"
FT                   /locus_tag="TERTU_0484"
FT                   /product="6-phosphogluconate dehydrogenase,
FT                   decarboxylating"
FT                   /EC_number="1.1.1.44"
FT                   /note="identified by similarity to SP:P43774; match to
FT                   protein family HMM PF00393; match to protein family HMM
FT                   PF03446; match to protein family HMM TIGR00873"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACR10820"
FT                   /db_xref="GOA:C5BMZ0"
FT                   /db_xref="InterPro:IPR006113"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMZ0"
FT                   /protein_id="ACR10820.1"
FT                   /translation="MKELSDIGLVGLAVMGENLILNMANNGYTVTAYNRSTEKVDAFLA
FT                   GRAKGKSIRGAHSVEELVASLAKPRKIMLMVKAGAPVDAFIEQILPHLEEGDILIDGGN
FT                   THFPDTNRRVDYCASKGILFVGAGVSGGEEGALTGPSIMPGGAKDAWHHVKPIFQSIAA
FT                   KVEDGTPCCDWVGENGAGHFVKMVHNGIEYGDMQLICEAYQIMKDLLGMSADEMHEVFA
FT                   EWNEGELDSYLTEITRDILKTKDEDGEPLVDKILDTAGQKGTGKWTGVAALEMGVPLTL
FT                   IGEAVFARCLSAQKEERVEAAKIISGPTPKFEGDKKAFIEDLRNALFAAKIVSYAQGYV
FT                   LMREAAKEFGWELNNGGIALMWRGGCIIRSVFLGNIKEAFDTNPALTNLLLDPYFQQRV
FT                   DAAQAGWRNVVASATLNGIPAPTLTSALSYFDGYRTARLPANLLQAQRDFFGAHTYERT
FT                   DKPRGEFFHTNWTGRGGDTASSTYNA"
FT   gene            503696..504091
FT                   /locus_tag="TERTU_0485"
FT   CDS_pept        503696..504091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0485"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04237"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13747"
FT                   /db_xref="InterPro:IPR007351"
FT                   /db_xref="InterPro:IPR038056"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMZ1"
FT                   /protein_id="ACR13747.1"
FT                   /translation="MDYSAVREHALGLPETREDFPFGPEARVFKVANKMFGLLSFTEWN
FT                   GHTGVGRLNLKCNPTEALMLRDLFAAVIPGYHMNKTHWNSVMLDGTVPAPEIARMIDRS
FT                   YGLVVKSLPRATRRGMELRWGEAALYR"
FT   gene            complement(504103..505080)
FT                   /locus_tag="TERTU_0486"
FT   CDS_pept        complement(504103..505080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0486"
FT                   /product="phosphotransferase family protein"
FT                   /note="identified by match to protein family HMM PF01636"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13150"
FT                   /db_xref="GOA:C5BMZ2"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR032882"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMZ2"
FT                   /protein_id="ACR13150.1"
FT                   /translation="MTDTPFHTLNPDKVIDAVESLGYLSDLRVFPLNSYENRVYQFGLE
FT                   DGEPIIAKFYRPARWSDEQILEEHEFSRALADLEIPIVAPLERDGKTLFEFDDFRFALY
FT                   PRRGGHAPELTDLDTLYRLGQQLGRLHELGKAQPFSHRPSLNLQTFGIDSRDFLLAEDF
FT                   IPGSLTEAYATLSQHLIEAMEPILAATPFETIRLHGDCHPGNILLRPDSLYLVDLDDAR
FT                   NGPAVQDIWMLLSGERPQKQQQLGEIIAGYEEFCEFDNRELALVETLRTLRLMHYAAWL
FT                   ARRWQDPAFPMAFPWFNTERYWAEHILELREQLAALSEPPLEIL"
FT   gene            complement(505123..506787)
FT                   /locus_tag="TERTU_0487"
FT   CDS_pept        complement(505123..506787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0487"
FT                   /product="diguanylate cyclase domain containing protein"
FT                   /note="identified by match to protein family HMM PF00989;
FT                   match to protein family HMM PF00990; match to protein
FT                   family HMM PF08448; match to protein family HMM TIGR00229;
FT                   match to protein family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11804"
FT                   /db_xref="GOA:C5BMZ3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMZ3"
FT                   /protein_id="ACR11804.1"
FT                   /translation="MGWLANIDILRNFAFFAFYPAMPLVNAVGMMVLAIAVGALRRGLS
FT                   QIIWLSAITSLLLSIGNFTELFGDTSLGLHHLFITHSESHSSISSAVGFALAAITLPLS
FT                   QQPAFTQRKTFIGLLLLNALLPLSALLAYTSNAYAAARASLFDGYSLPEALSHLLLVVG
FT                   IGLTTPNRLHASLFADHPDAAALRKYALALLMVVLAATLLTTHLSIQLRFGSVLVFALY
FT                   AATLLLSLVAFLAVTYSRATPPARSAADLDGAHAHQEQLLAFVEESGDGILMVDNTGTI
FT                   RYANSTCSKMFGYPQDEFVGMRLNELIPKRFRAKHLEHFAHFFAAHPAEKKYVKRGRLT
FT                   GISKEGIEKALAISLFRREENSLVIATLRELNGLERDIAERMKHIQHDLVTGVPDRQEF
FT                   GRFCQNHWDQVVRKSERHFCIFVIDLDGLRLINSKYGREFGNAVLQNVAANIKSRQRGG
FT                   DRLFRYTSDEFIMICSDITPDACELLAERIRTSIKVVPTRLGDNNIYITASVGFTHCDQ
FT                   LPANLMDTVAHITNVLHKQQPDYKDQVVPVAQLPEFK"
FT   gene            506851..506982
FT                   /locus_tag="TERTU_0488"
FT   CDS_pept        506851..506982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0488"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13288"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMZ4"
FT                   /protein_id="ACR13288.1"
FT                   /translation="MIVGMDGGRICHRTGLGFWFALSIDATGRMRNLPAANPNKAFC"
FT   gene            complement(506993..507697)
FT                   /locus_tag="TERTU_0489"
FT   CDS_pept        complement(506993..507697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0489"
FT                   /product="competence protein ComF"
FT                   /note="identified by match to protein family HMM PF00156"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACR10993"
FT                   /db_xref="GOA:C5BMZ5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMZ5"
FT                   /protein_id="ACR10993.1"
FT                   /translation="MHQVRRFLTQVATRVDEAVPSSCILCNNPALKPICAQCENELPRL
FT                   GKRCQCCALPTTTDTALCGECLQTTPAFDRTYSAFIYQGYVPWLINRFKHQHALIVGQQ
FT                   LSEHLLAVLPQTNVFDLIVPVPLHWSGLVQRGFNQAEVIARPLAHHLKLPVDHCLKKTA
FT                   FRRHQQTLNRAQRQRAVRNSYAITRDVRHRHILLVDDVMTTGATVGAIAQLLRDAGANR
FT                   VDIACLARTPKT"
FT   gene            507824..508879
FT                   /gene="bioB"
FT                   /locus_tag="TERTU_0490"
FT   CDS_pept        507824..508879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioB"
FT                   /locus_tag="TERTU_0490"
FT                   /product="biotin synthase"
FT                   /EC_number="2.8.1.6"
FT                   /note="identified by match to protein family HMM PF04055;
FT                   match to protein family HMM PF06968; match to protein
FT                   family HMM TIGR00433"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14030"
FT                   /db_xref="GOA:C5BMZ6"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMZ6"
FT                   /protein_id="ACR14030.1"
FT                   /translation="MTAEQNLLRHNWTRAEVEALFDLPFNDLMFRAQSVHRQFFDPNEV
FT                   QVSTLCSIKTGACPEDCAYCPQSSRYDTGLEREKLMAVEKVLEEARAAKDSGATRFCMG
FT                   AAWRSPHQRDMKYVLDMVKGVKSMGMETCMTLGMLTADQALELKGAGLDYYNHNLDTSP
FT                   EYYDCIITTRTYQDRLDTLENVRAAGMKVCAGGIVGMGEEQKDRAGLLTQLANMDQHPE
FT                   SVPINMLVRVAGTPLAEQADLDPFDFIRTIAVARIMMPASHVRLSAGREEMNDQMQSLA
FT                   FLAGANSIFYGEKLLTTPNPEANEDMQLFKRLGIRPESYHAEEPEEVLEEQLHEKIVQA
FT                   QNDQFFYNAAN"
FT   gene            508950..510137
FT                   /gene="bioF"
FT                   /locus_tag="TERTU_0491"
FT   CDS_pept        508950..510137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioF"
FT                   /locus_tag="TERTU_0491"
FT                   /product="8-amino-7-oxononanoate synthase"
FT                   /EC_number="2.3.1.47"
FT                   /note="identified by match to protein family HMM PF00155;
FT                   match to protein family HMM TIGR00858"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14479"
FT                   /db_xref="GOA:C5BMZ7"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004723"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022834"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMZ7"
FT                   /protein_id="ACR14479.1"
FT                   /translation="MNLENRLRAKLAERQMAHRYRTRRIVGSPQGAILQEGGRPLLNFC
FT                   SNDYLGLANHPLVVAALHQGAADWGAGSGASHLVNGHSAEHHALEEELAEFTGRERALL
FT                   FSTGYMANIGVINALVGRGDRVLQDKLNHASLLDGGLLSGADFQRYRHNDMAHLRARLE
FT                   NSGADQQLVVVDGVFSMDGDMADLPAIVEASRANNAWLMVDDAHGFGTLGTHGRGTTDY
FT                   FGLNQTQVPVLIGTLGKAFGTFGAFVAGSETLIESLIQFSRTYIYTTALPPAVAAATRA
FT                   SLRLLRDAEEGRQHLQQLITQFRQGCDSLGMALMDSMSPIQPLIVGSDAKAMRMSARLA
FT                   ELGCWVSAIRPPTVPEGTARLRVTLTAAHNSEQVDKLLEALNDAASQAGDEEVLP"
FT   gene            510134..511846
FT                   /locus_tag="TERTU_0492"
FT   CDS_pept        510134..511846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0492"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /note="identified by match to protein family HMM PF00561;
FT                   match to protein family HMM PF01209; match to protein
FT                   family HMM PF08241; match to protein family HMM PF08242;
FT                   match to protein family HMM TIGR02072"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11632"
FT                   /db_xref="GOA:C5BMZ8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR011814"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BMZ8"
FT                   /protein_id="ACR11632.1"
FT                   /translation="MTEVNVRAAATPEEKPFLNRTRHEPANPQPNRSVLVFLHGWGSDK
FT                   RQWQSFVPTLLEALGDEREMVFIDLPGFGDNSDFRCDDLEHMLKQLARIIPGNATLIGW
FT                   SLGGMIATQLASRHPEKIGRLITIATNPLFVKNDAEIAAGKAPWKHAMERETFSDFVNG
FT                   FADDPEATLKRFIALQSMGDSERRQVTDTLKNLLSFSAHSQQTCWANALSYLDQLDNRT
FT                   ALRNLTQPALHIYGKSDALVPVRAGRALQGLAPSHWVESITAAGHAPHISHPREVATMI
FT                   NSFLRQQAPRLSQRKRRIANSFSSAAQEYDTLARLQKRVVDSLVEFSLGTGGSVGQTLL
FT                   DLGCGTGYCIERLLQQFPEITQPEGRIHALDIAEGMLDRAQQKFDELGVAEQINWHLGD
FT                   MESLPFVDESFDGCISSLTVQWSENPLQLFSEMYRALKPGGWFALSTLGPETLFELRSA
FT                   WRMVDEFAHVNKFLSLESVKSVAEQAGLQMVAYKSETPVLYYHSVVHLMRELKGIGAHT
FT                   INEGRQNGLMGRATFRRLEEAYDNWLDPDRGLPARYEVYYIYLRKPLDESASA"
FT   gene            511907..512608
FT                   /gene="bioD"
FT                   /locus_tag="TERTU_0493"
FT   CDS_pept        511907..512608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioD"
FT                   /locus_tag="TERTU_0493"
FT                   /product="dethiobiotin synthase"
FT                   /EC_number="6.3.3.3"
FT                   /note="identified by match to protein family HMM TIGR00347"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11137"
FT                   /db_xref="GOA:C5BMZ9"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5BMZ9"
FT                   /protein_id="ACR11137.1"
FT                   /translation="MKSYFVTGTDTDAGKTLIASALLLKAQQHGLATLGLKPVAAGGAM
FT                   DGEQFCNEDALLLTAQSSVKLPYELVNPVLLREPMAPHIAAQREGKRLSADKIVGFYRG
FT                   AVMGLRGEKKPDLCLVEGAGGWRVPLNNSVTMAEVAKLLQLPVVLVVGLKLGCLNHAIL
FT                   TAEAIARDGLVLAGWVASQTDPQMTVVDENLTTLARYINAPCLGFVPPLADPSPEAAAD
FT                   FLNIDPLGLAG"
FT   gene            512830..513138
FT                   /locus_tag="TERTU_0494"
FT   CDS_pept        512830..513138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0494"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13127"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN00"
FT                   /protein_id="ACR13127.1"
FT                   /translation="MINSVMSEGLKGMQHSQREMQKSAQEIAEANIREQPSETVEVQSV
FT                   TRTNPVAPVEEPVRSDSGGDIVEPLIELRRQEQLFDASANVVSVADKTLGSLIDVKS"
FT   gene            513125..513253
FT                   /locus_tag="TERTU_0495"
FT   CDS_pept        513125..513253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0495"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12662"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN01"
FT                   /protein_id="ACR12662.1"
FT                   /translation="MLNHDVIAAFFRWLLGMPEQPQMIRIPVEEDKRVPPRRRDTY"
FT   gene            513299..514144
FT                   /locus_tag="TERTU_0496"
FT   CDS_pept        513299..514144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0496"
FT                   /product="putative SrpA-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13941"
FT                   /db_xref="InterPro:IPR021973"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN02"
FT                   /protein_id="ACR13941.1"
FT                   /translation="MISSNLPFPSAANIAAYPSPAARRSEGLSSLVPASPAPSPELSSR
FT                   DRTPASSADLSATQRVQSANGSAEAGAEAPDDQARLEKRLEEKQLQAEQQEIRELSARD
FT                   REVRAHEQAHAAVGGQYAGAASFDYQRGPDGVRYAVGGEVPIDVGREPTPEATIEKMQV
FT                   VKRAALAPAEPSAQDRRVAAEASRQEAEARQELRSEQAKNADNDADGDMREVSGDESDD
FT                   TLTTRPTDLNETINPNRERVANASIFPSSTQQLTSRLSAEFANASGYEQRRGSILDQIV
FT                   "
FT   gene            514177..514308
FT                   /locus_tag="TERTU_0497"
FT   CDS_pept        514177..514308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0497"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13573"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN03"
FT                   /protein_id="ACR13573.1"
FT                   /translation="MICHLRVSLKFFLAQSEKLFQLCLAEIVERKWTLTFHRSLGCG"
FT   gene            514360..516135
FT                   /locus_tag="TERTU_0498"
FT   CDS_pept        514360..516135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0498"
FT                   /product="acyl-CoA dehydrogenase family protein"
FT                   /note="identified by match to protein family HMM PF00441;
FT                   match to protein family HMM PF02770"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11697"
FT                   /db_xref="GOA:C5BN04"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN04"
FT                   /protein_id="ACR11697.1"
FT                   /translation="MPDYKAPLDDIRFVIERQLATYELWHSLRNFEDLDKNTVEAILSE
FT                   CGKIAGDAIAPCSREADEQGCQLQEGNVAVPQGFADAYQLLCDGGWCSLSGNPEYGGMG
FT                   LPKSLVAAVDEMVQGACMSFGLLPMLTAGACLAIDAHGSDALKSTYLEKMYSGAWSGAM
FT                   DLTEPHAGTDLGLIRTRAEPLADDSYAVTGTKIFITWGEHQLAENIIHLVLAKLPDAPA
FT                   GSRGISMFLVPKYIPDAQGEPGERNRFSCGGLEKKMGIKASPTCVMNFDGARGWLVGEP
FT                   HKGLQAMFTMMNYERLVVGIQGVGAAEASYQNAVSYARERLQGRSPVGAHSPEKEADNL
FT                   LVHPDVRRMLLTMRALNEAGRAFYIYVSQWLDIAKFSDDQQRKTQAEALVALLTPVAKG
FT                   FMTDRAFEVAVLGQQVYGGHGFIREWGQEQLVRDTRITQIYEGTNGVQAMDLVGRKTVA
FT                   THGQLLDVFVGDVDAFVAGLANKRELSSLITPLQQAIVLLQTTTHSIVQQSADNRFLPG
FT                   AVAVDYQDMVGYVCYAYMWLRAAAAVRGDDSDFASAKRATAEFYMLKLLPQVDTLARRV
FT                   VAGSAPVMAMQDDWF"
FT   gene            516193..516369
FT                   /locus_tag="TERTU_0499"
FT   CDS_pept        516193..516369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0499"
FT                   /product="Hypothetic protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11367"
FT                   /db_xref="GOA:C5BN05"
FT                   /db_xref="InterPro:IPR021444"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN05"
FT                   /protein_id="ACR11367.1"
FT                   /translation="MAKLSLEDQQRVDDYLQASLHQVPRRDFKPGLLLIVLIGVLLLLT
FT                   GVSYLVAFDAGVV"
FT   gene            complement(516517..516984)
FT                   /locus_tag="TERTU_0500"
FT   CDS_pept        complement(516517..516984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0500"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01878"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13265"
FT                   /db_xref="InterPro:IPR002740"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN06"
FT                   /protein_id="ACR13265.1"
FT                   /translation="MTMSYWLFKSEPNEYGIDHLAKDKKARWDGIRNYQARNILRDDVS
FT                   VGDQVLFYHSSCKPTAIVGLAEVVAEGYPDPAQFNADSPYFDAKSKIDAPRWVCVDIAF
FT                   QAKFKNPLTLAALKKMPELSEMVLLQQSRLSIQPVTKAEFEFILRTGAGKS"
FT   gene            complement(517071..517388)
FT                   /locus_tag="TERTU_0501"
FT   CDS_pept        complement(517071..517388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0501"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12297"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN07"
FT                   /protein_id="ACR12297.1"
FT                   /translation="MKPIKTKAEIRNEIEEQIAQYIAGGGAVEKIPTGQSGNVTNANLF
FT                   ANATTFEPKKDRTLVTDVIKSVDERRKQKPTTPQKKSSQPRKKLITDDFGEPVRWVWVE
FT                   N"
FT   gene            517736..518422
FT                   /locus_tag="TERTU_0503"
FT   CDS_pept        517736..518422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0503"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07729"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14808"
FT                   /db_xref="GOA:C5BN08"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN08"
FT                   /protein_id="ACR14808.1"
FT                   /translation="MSEIYEAEGSGLSRVELAYRQLKTNILSNEYPPGFQALEPEIAKK
FT                   LGVSRTPVREALIRLEAEKLIELIPRRGMRVLPLVPDDIIEINQVLTGLECLAVELLAK
FT                   KSCGSDVLRPMTDAVQEMELALENDAIEDWAKAEEKFHRLLISLAGNKRLSMLVENVRA
FT                   QAYRARIITLKLRPKPFSSTSAYRDVFEFIARGDWQAAKSRHYDHRIEIGNILTEVLDR
FT                   YQLPHL"
FT   gene            complement(518382..518495)
FT                   /locus_tag="TERTU_0502"
FT   CDS_pept        complement(518382..518495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0502"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14154"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN09"
FT                   /protein_id="ACR14154.1"
FT                   /translation="MQQAKEPAADLYRGDKERVVSPALATGEGAGIDPILQ"
FT   gene            518671..519093
FT                   /gene="fkpA_1"
FT                   /locus_tag="TERTU_0504"
FT   CDS_pept        518671..519093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fkpA_1"
FT                   /locus_tag="TERTU_0504"
FT                   /product="peptidyl-prolyl cis-trans isomerase fkpA domain
FT                   protein"
FT                   /EC_number="5.2.1.8"
FT                   /note="identified by match to protein family HMM PF00254"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13898"
FT                   /db_xref="GOA:C5BN10"
FT                   /db_xref="InterPro:IPR000774"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN10"
FT                   /protein_id="ACR13898.1"
FT                   /translation="MSRKLNKGSAGQNRKAGQGFMEKYRLKDGVQESSSGLLFRVLEES
FT                   DGMRPTEQDVVVVNQRILNADGSVIADTYKAGIPDTFTMKEAIPGLREGLLLMPVGARY
FT                   ELVIPPELAWGRRGATNKIGPNAVLIIDVRLLEIKF"
FT   gene            complement(519390..520367)
FT                   /locus_tag="TERTU_0505"
FT   CDS_pept        complement(519390..520367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0505"
FT                   /product="putative acetaldehyde dehydrogenase"
FT                   /note="identified by similarity to SP:P77580; match to
FT                   protein family HMM PF01118"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14327"
FT                   /db_xref="GOA:C5BN11"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR003361"
FT                   /db_xref="InterPro:IPR015426"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN11"
FT                   /protein_id="ACR14327.1"
FT                   /translation="MASSAKLNVGIIGSGKIGTDLLIKIMRSRFLKCGLFVGRDYSSQG
FT                   LQKAKSLGVQISDQSIDAFSHSGQKFDVVFDATSAAFHKKHAEIFRIAGIKAIDLTPAK
FT                   VGRFCVPSIDSDVVATEDNINMVTCGGQASVPIINTLSKVYPEISHIEVHSHLAEDSVG
FT                   PGTLANIDEYYSSTSSAIANYSGVSSVEVHLQVEHSSWKPDMLTVVRAHTTDANLEKLY
FT                   GPLHARLQQVRAHVPGYHIIGTPRYLNGAIEILISIRGQGDWVPSHAGNLDIINCAAIA
FT                   IAEKYAQYKGIQESPATGPQRVASVDKTRLDVFHSSKQPVAESA"
FT   gene            520475..520672
FT                   /locus_tag="TERTU_0506"
FT   CDS_pept        520475..520672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0506"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12968"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN12"
FT                   /protein_id="ACR12968.1"
FT                   /translation="MKKDDANNKTRAPKNFNLLMFFKITINFCLIQRNWYNEKKYDVLC
FT                   CVKSIVPNVNFIIHRIFAMI"
FT   gene            520919..522169
FT                   /locus_tag="TERTU_0507"
FT   CDS_pept        520919..522169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0507"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13409"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN13"
FT                   /protein_id="ACR13409.1"
FT                   /translation="MEKNDLRDLEVALGIASPWSIKSIKVNEKDHAFDVFLEVADQKRL
FT                   FGFLDSYKRSQDVELVSGSWQYMSLGTFTTIIHADIPRLGNDNENVVGPENIIQPAFLG
FT                   HPSRQYSNFVRQRVALGQIKGLDSSVIAETINIDESLVSLVLSDIAKSNADIRTLSCLP
FT                   TEVDPVWERILRDQVLLRTTMLPLKFLLSKLKLTATKITDSRKILPLVCDLRDFFVEHV
FT                   AAMDSEVDQVCGITTERQQQYARAAKSRHRLVLPSVKSPVWLDVLSGRITLNSQSVPLN
FT                   LLISRQRSNFVQGRTKEEKIAAIEMLREYFRKNYRTLKTELLLLNRAMNIRQKSGVELP
FT                   DPEHAVWQQILNDDTLVPSSHIAYKLLLAKLRAQVTTKPDPVVKLEAARRIREFLSQNQ
FT                   KSMREELNLLLKQTAVV"
FT   gene            522195..523211
FT                   /locus_tag="TERTU_0508"
FT   CDS_pept        522195..523211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0508"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11258"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN14"
FT                   /protein_id="ACR11258.1"
FT                   /translation="MAGEGSISVASLAVDRATVESMISRGDYLVIAGDESVLESLPSGN
FT                   WIAGTIPYFMTDEGGKVDQEKLYVNVIEGLSSNNMPRLTLYDTNTISRVAQEAPEHGFT
FT                   ILILPANSDVHLNYAQNAPDFPKMYFAPIIGWISGMHLDNMGTQSAKVGFGPAGGMLSE
FT                   SQAAAMHITLPEDQVAEIKTVNLFEQGEGDAIAFSQSGFVVSDCKAGDADWKLSDYVRE
FT                   KGIDTRLPLVANYSGMMVNVSIQEVCDDSVKLYAPVFADVEYRFAKPVEDYVTQFNEQI
FT                   SSSNGSKVAFSCNCILNFLYSELEGKKTGKFTGPITFGEVAYQLLNQTMVYLTLSKI"
FT   gene            523890..526991
FT                   /locus_tag="TERTU_0509"
FT   CDS_pept        523890..526991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0509"
FT                   /product="TonB-dependent receptor"
FT                   /note="identified by match to protein family HMM PF00593;
FT                   match to protein family HMM PF07715; match to protein
FT                   family HMM TIGR01782"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12157"
FT                   /db_xref="GOA:C5BN15"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010104"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN15"
FT                   /protein_id="ACR12157.1"
FT                   /translation="MFKKNKLSTAVVGVLATSAIAAPTFAQDQAIEEVFVTGIRASMEA
FT                   AMDVKRNSAGVVDAISAEDIGKFPDTNLAESLQRITGVSIKRTNGEGSEITVRGFGPDF
FT                   NMVTLNGRTMPGAIAYGGGSGADGTTRGGSARAFDFSNLASEAVRGVEVFKTGKASIAT
FT                   GGIGATVNIKTSRPLDDPGLSASVGVKAVHDTTNRVGDDITPELSGVVSWADDDAMFGA
FT                   SLSASYQKRDSGYTGATVNQWNIGVWGQDDLYQRDISPDDPGTHVNDPIFENTPELGQL
FT                   YARPNDIRYAFSDTSRERTNAQLTLQFAPNEKITGTLDYTFAENGIEENRGEVTNWVQN
FT                   GGNVARVVFDDSDVATPLIITEDYADGWRDQGYEQQYRKQKNSLDSVGINIEYQMLDNL
FT                   SFVLDAHDSTMESLPDGPGGIGELSVALGAPVKTGKTLYFGGDLPYWTHQIDDCRHADA
FT                   NPGKEFVTNCNGVLDAGDISSTVLRNWAAEQTSDITQVKLDGTLEFDNGRFDFGVESRD
FT                   MSSNSSAYNSNNNQVLGGWGADNPGEFPAGMIEPFDVVGEFDDFDTGDAPHVGFRADAR
FT                   ELAEFLVSSPTYAEYDPFIGLNNDGRNTRNVNNTVEEETTAIYFQFAQSGTLGDFETNT
FT                   LLGLRYETTDMTSTSNVQPVGYLNWASDDDFGPVNVGVATPETETASYDNLLPSLDFDI
FT                   SFLDNLIGRFSFSKTIARPGFSDLAVAAGNFGLSGATSAGAVPSASRSNPNLLPLESTN
FT                   YDLSLEWYFADSSYLSGGFWEKRVINFVGTAQEDRNYFGIRDQTAGPRAQAAAEALASQ
FT                   GFLVDNANLHTMMVILADPATFPNGAADFTGMQSQISALGEGCAECDIQPNDDDPLMIF
FT                   RTSYPVNNREAKIHGFELAVQHFFGETGFGVMANYTFVDGDVEFDNLAPPTEQQFALLG
FT                   LSDTANLVLMYENYGVQARLAYNWRDEYLNRTNYQSSNNPTYIEAYSQIDMNVSYDITD
FT                   SISVFFEGINLTGADNREFARNEKQMYYLEDLGPRYALGARYSF"
FT   gene            527243..528721
FT                   /locus_tag="TERTU_0510"
FT   CDS_pept        527243..528721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0510"
FT                   /product="tryptophan halogenase PrnA"
FT                   /note="identified by match to protein family HMM PF01266;
FT                   match to protein family HMM PF04820"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14565"
FT                   /db_xref="GOA:C5BN16"
FT                   /db_xref="InterPro:IPR006905"
FT                   /db_xref="InterPro:IPR033856"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN16"
FT                   /protein_id="ACR14565.1"
FT                   /translation="MSEQKTKVVIAGGGTAGWLAAAALSQQLGSAVEVALVESAEIGTV
FT                   GVGEATIPPMKTFHRLLRIDEQEFMRTTHATFKLGIQFENWRVEGEKYFHSFGTTGRDT
FT                   LVSEFIHFWLRGRDMGIAKDFGDYCVEFKAALENKCSTQGDTKVNHAFHLDAGLYAKYL
FT                   RTFAESHGATQVEGNIAEVLQDNNSGYITGLRMASGDIVSGDLFVDCTGFRGLLIEQTL
FT                   HAGYESWEHWLPCNRAVAVQTASVRDPVPYTRSIAHHAGWRWQIPLQHRVGNGTVFCNR
FT                   YMSEDEAIAKLLADIQGDVITEPRVIQFQTGRRRKNWVKNCVAMGLSSGFLEPLESTSI
FT                   HLIMTSIMRLLQLFPGKDIQQATIDEYNMQAAIEFELIRDFIILHYKATEREDSKFWRY
FT                   CKRMDIPESLAHRIDLFRETGKSYQKEGELFRLDSWTQVMLGQGIYPKRYHPMVDSMQA
FT                   QELERFLHATAANVAAVVDSMPPHEKFLAEYCAI"
FT   gene            528998..530527
FT                   /locus_tag="TERTU_0511"
FT   CDS_pept        528998..530527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0511"
FT                   /product="FG-GAP repeat domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11121"
FT                   /db_xref="GOA:C5BN17"
FT                   /db_xref="InterPro:IPR013517"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN17"
FT                   /protein_id="ACR11121.1"
FT                   /translation="MRSFLIKRVSMLTFFCCVAFGVHAEKSVEQVAQLAKQVCGACHYQ
FT                   PSPDLLPKRSWPYVIKSMAEIAAERAGAAVLTEEQISDITAFYYGFAPEELPRLPYVDD
FT                   LSHSLKPKQIQQIGRAAKLPLVVKLKSVALTESKAHQFLLCDGETDTVSLFELRGSQWQ
FT                   EKILANVPVPSNATVADMDGDGDLDVVVSALGLFFPPTGVFAGKVFILEQVSPGKFEKR
FT                   LVEDKLGRVTDAQPLDMDGDGDMDIVLAVFGGDVPGEIAWLENKGKKSAFEKHTLLPIG
FT                   GALNITPIDINGDGRLDLVSFFTQEFEHILALINKGGGEYERAVLFQAATPIGGPTSIN
FT                   FPDMDNDGDPDILFTNGDAHDYQHDPKPYHGVQWLENKGNLAFEYHEVGRFYGASYAQA
FT                   GDVDGDGDMDVVASSWNNYWDDPKRQTLVWYENTGKFAFTSHGLMSRPKSMVTFELVNL
FT                   DKDKSLELVGGMFDIDLLKDYINALVESKDAADKLVAGQEDKPRLLKLDLH"
FT   gene            complement(530694..531533)
FT                   /locus_tag="TERTU_0512"
FT   CDS_pept        complement(530694..531533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0512"
FT                   /product="polysaccharide deacetylase family protein"
FT                   /note="identified by match to protein family HMM PF01522"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12798"
FT                   /db_xref="GOA:C5BN18"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN18"
FT                   /protein_id="ACR12798.1"
FT                   /translation="MKPSQSRSMGKIKPCFYRRIFVLLLILFSAGSYGADSPWNGKSAA
FT                   VSLTYDDALGVHIDNVAPVLAQNDLLATFYVTSNSWPLRSRLDDWRAIATSGHELGNHT
FT                   LFHPCAGDKPGREWLNKELYLNEWSEQRYIGNLNINNTLLQALDGKTERSFAYPCGDTE
FT                   VAGKSYVETITPMFTAARMVGGTPPTIDKVDLMRIPSHMVMGDSAEKLISLVEAGIKNH
FT                   TWVVFLFHGVGGEHGLNVSKEAHAELVNYLGKHKKDVWIAPVTDIANYVKDKQKAKK"
FT   gene            531777..535226
FT                   /locus_tag="TERTU_0513"
FT   CDS_pept        531777..535226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0513"
FT                   /product="xylanase"
FT                   /EC_number="3.2.1.-"
FT                   /note="identified by match to protein family HMM PF00331;
FT                   match to protein family HMM PF02018"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13391"
FT                   /db_xref="GOA:C5BN19"
FT                   /db_xref="InterPro:IPR001000"
FT                   /db_xref="InterPro:IPR003305"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR031158"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN19"
FT                   /protein_id="ACR13391.1"
FT                   /translation="MRFRTKRLGLAMLALGVFPSAAMATSDFSLELLFPGLSRPAPGQV
FT                   ETLADAAEQSRRLVGVAAGYGLVTNDEQFVDIVTGEFNYMTPENSGKWGPLQPAPGVWN
FT                   FDTHDQMVEFAGQSELAYKGHALVWHSQAPGFVTDDLSADELQSLIDDHITTVMSRYSG
FT                   EIRAYDVVNEAMGDDAEYRDSVLYRTLGADFIANAFRTAHSVDRRAVLFYNDYNIAGLN
FT                   AKSDAVYEMVKGLVHNRVPIDGVGFQMHLTAATAPSYDELVANLSRFANLGLRVNISEL
FT                   DVRVADLPWDYQTNIAIQRQVYHRVVSACMAVRRCEAVTTWGVSDKNSWINYTFGEDAA
FT                   LAWDDDNQRKPAYYGMLDGFMGVEPDESPLPNLVANSEFEGGVQGWTGENADVHRIRAV
FT                   GKPQANSMLVIGRGSREAGASYDFSDVALAGQSYDISSQVKIPQLSLVPLLSRLFGLAR
FT                   GDTVEMNVRTLCSDGTEELTNLETAFATFGRWQTIGGTVTLPNCEIEAVDLLVNGPRAG
FT                   TSIQVDSVVARPQVLVPTAEGFSENLVTNPYFEDGAYDWFGFGSAVVETTTDNVKSGAQ
FT                   SGYVTGRTDSWQGPATNVTAGVQAGDIYDMFAWVQAEGADSRIGATLKVSCAGEDDSYL
FT                   NIGNVNVTAGEWALLRGSVLVPDCELLDATLYFEGPAADVNMLIDEVYLRRDNKASDAL
FT                   DIVDDGNLHLNGGFELGTESWTTWGGALGTSDEYVHSGSAAGVLSSRTASWQGPVFDLL
FT                   SVASAGGEYEITAWGMVQGVSQDTLNITVKTTCGGESAYHQLASTLVNNTDWTELSGAV
FT                   TLPSDCDLTEATLYFDGPAVGVDTYLDDVFISGEAPSVPNLVINGDFEAGINDWQVWGG
FT                   VLSVSDDAHTGAQSALHSGRTADWQGPVYPLSVVADTDYNVSAFIKIDGAATATANITL
FT                   KTTCADGSEEYLWGGQAEVNSSGWTELSGVVTTTSCEPMDAVVYFSGPAVGIDILLDDV
FT                   VVWQEGAVVEPPAGNLVANSSFEESLDGWISWGGTLERSADQAYDGSYSAYLTTRTGDW
FT                   EGPVYSLLSSVTAGASYDIAAFARVDAGSAEAMNITVKVACDDGSEEYIWAGSAEVNES
FT                   DWTEVAGSVTLPACNLTEVSMYFGGPAQAAGIYLDQVSVVAL"
FT   gene            complement(535412..536746)
FT                   /locus_tag="TERTU_0514"
FT   CDS_pept        complement(535412..536746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0514"
FT                   /product="GGDEF domain protein"
FT                   /note="identified by match to protein family HMM PF00990;
FT                   match to protein family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12935"
FT                   /db_xref="GOA:C5BN20"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN20"
FT                   /protein_id="ACR12935.1"
FT                   /translation="MTEHSSNKSTLLPAISRTEALLGMIACVSIILIFAPKDWIQRSLE
FT                   IYPQDYEAVLTDDTYSNGNSEAIWLDADKQIWQCRMGNKFRSPYCSMRLSLFDDSWSGL
FT                   NLSDYDTMTIWASYSGPSDSLRFYLRNRHPDYYQVGDDTSTKYNMVEIPVEQLDTGFTL
FT                   SMADFNVADWWLVTKKIPLEKSHPEFNDVVFLEVQTGSQATFGDHTIRLRKVLWHGHLF
FT                   SDETLYKGMVIAWCVLIFFLLLYRMIHLKLELRRNVKHQQELVAINKLLNLQNKQFEDL
FT                   AKTDQLTGLLNRIGIRDVLYDGLNNWKERRTPFSFVLIDIDHFKQVNDSFGHDVGDQIL
FT                   KLTAKLLAENIRRSDFLARWGGEEFILVCPDTDLYQAQVLAELLRKKLEDAPLHPERQI
FT                   TASFGVSALSTPNLDDLFKRADAALYEAKTQGRNKVCAVADTDAD"
FT   gene            complement(536752..538062)
FT                   /locus_tag="TERTU_0515"
FT   CDS_pept        complement(536752..538062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0515"
FT                   /product="GGDEF domain protein"
FT                   /note="identified by match to protein family HMM PF00990;
FT                   match to protein family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13501"
FT                   /db_xref="GOA:C5BN21"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN21"
FT                   /protein_id="ACR13501.1"
FT                   /translation="MPATRLKNLHALSRFDATLGLLALLSIICVLTPKDIVTRKLEIRP
FT                   SEYQANIAGDSYSGGKSEASWVDEKARRWRCILSDAIYAPYCSFQISTINENWRGLDLR
FT                   AFNKMTIVGEYLGEANYIRVYLRNRHPRYYVLGDETTTKYNQAEVPIANLRNGVGVRLQ
FT                   DFEVADWWLVQKKIPLKESHPEFNDVIYIEFQTSSALHSGTHEIQIEKIIWQGNYISNE
FT                   TLYRGIALVWAATIFLLLLLRLTRLKAELQSTRNYQNELESINKLLNLQNKQFEDLAKT
FT                   DQLTGLLNRIGIREPLLAGLNAWKHTQTPMAFVLIDLDYFKMVNDRYGHDVGDQVLRKS
FT                   AELVRSNVRESDYVARWGGEEFLLMLPDTSLTQAEQIAEMLRSKLETAQIHTATTITAS
FT                   FGVAALKEDNLDNLFKAADDALYKAKQNGRNCVYTNG"
FT   gene            538200..538334
FT                   /locus_tag="TERTU_0516"
FT   CDS_pept        538200..538334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0516"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12080"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN22"
FT                   /protein_id="ACR12080.1"
FT                   /translation="MWRYNHYYYPNLGLPIAYSMRGFWHENTRKNSQLYALAQISIRF"
FT   gene            complement(538341..539696)
FT                   /locus_tag="TERTU_0517"
FT   CDS_pept        complement(538341..539696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0517"
FT                   /product="carbohydrate esterase family 15 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12575"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="PDB:6HSW"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN23"
FT                   /protein_id="ACR12575.1"
FT                   /translation="MRNPLRYTLLAFLLGHLGIAQSAPLTADQDHAQLLHVLGIENLRR
FT                   GADGNTDSPFAANTDEAKANTALDSLPPLLTSVSGQAIASATDWEANRPALLNTFSQEI
FT                   YGYVPGGAPELHWKAGSTTPIDDSGTSAIRQHFTSTLVHPENAALNLSLNFTLVLPKSN
FT                   KPVPVVVVMSFDPGIWERFRDRMPAERYAQIQADNARWREQVVNAGWGYAEIIPTEFQA
FT                   DSGDGLSQGIIGFVNNGKPRNPTDWGALRAWAWSASQVLTYLQTDSRVAADRISVHGHS
FT                   RFGKAALVAMAFDNRFAAGFISSSGEGGAKLWRRNFGEQVGNLAGAGEYHWMAGNFVKY
FT                   AGPKKVNDIPVDAHQLLALCAPRPVLVSVGSQGESWVDPKGMLLAAYHATPAYALFGEQ
FT                   GVTQNELPAVGNGLLAGKLAFRQHEGGHTPAPNWETFITFATRQWASPNRLK"
FT   gene            540020..540442
FT                   /locus_tag="TERTU_0520"
FT   CDS_pept        540020..540442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0520"
FT                   /product="CBS domain-containing protein"
FT                   /note="identified by match to protein family HMM PF00571"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13527"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN24"
FT                   /protein_id="ACR13527.1"
FT                   /translation="MLNSVDADDYMTANPVIFSPETDIYEAIQVLVERRVTGGTVLNAQ
FT                   GEVVGIVSELDCLKAVIQTGYYGEGGGTVADFMFAGNIQFMDDHANIVDAAQKLLASGR
FT                   RRMPVRKDGKFLGQVSARSLLMAFVAAVNRTGDPGS"
FT   gene            complement(540508..541479)
FT                   /locus_tag="TERTU_0521"
FT   CDS_pept        complement(540508..541479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0521"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14007"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN25"
FT                   /protein_id="ACR14007.1"
FT                   /translation="MLNSPLSHANQEFSSPVIEGNCSFQIVDNTLYLNVDKVLNNRPVG
FT                   DVSGTLAVELWGLRQPYSGGEFDGVALAGAYVGEIFGQHFLGSNMFEVPFSEPPVGTWH
FT                   LTLMLREWTHSGFVTRDYINFPVPYVVNWVPELVHKSQGKIINLPVDREAKSANVEKEI
FT                   TLRENAQEEKIISPTPADEEALTPKTTAGEKTEKLEPAETASIKIPTADATQAKTAPAE
FT                   KSPSDTAPAKTTSTETKPASQVKSSPIGAPKKLKKVAKAKAIELVNVNSASLAEVQNLK
FT                   GVSTALAKEIIARRPYKETGDLLKVKGMGAKLLEKLRTSITI"
FT   gene            541478..541624
FT                   /locus_tag="TERTU_0522"
FT   CDS_pept        541478..541624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0522"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12008"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN26"
FT                   /protein_id="ACR12008.1"
FT                   /translation="MAHFLVIKIAAILIHLRHNFFIWHNHFKKNGAKYFYIFLVLKPYT
FT                   KTP"
FT   gene            complement(541648..542847)
FT                   /locus_tag="TERTU_0523"
FT   CDS_pept        complement(541648..542847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0523"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12615"
FT                   /db_xref="GOA:C5BN27"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN27"
FT                   /protein_id="ACR12615.1"
FT                   /translation="MQNMRYHEFDWLRVGAFALLIFYHTGMYYVADWGWHYKSLHQSES
FT                   LQFLMLWSNQWRMSLLFIISGFAVATMLQRKKPSRFFIQQPTRLIVPLIFGMLVVVVPQ
FT                   VYIEAVHIGLIERGYSYLSFWGAYLDQDSPLFEGHKTIDDLHITWNHLWYLPYLLTYSL
FT                   AAGAAYYAMGSRLRAWLRLVLSQFPAWITVVLLPVILLSLNSRWLYEDYPPTNALFGDY
FT                   FNHGRYGIAFLFGILIYSQPRCWQWIKHLRHATLPMAILTYGFIAFSFSGGELGEGALV
FT                   EWLTTGLWALNKWLWLLTILGWAQVIFCRENRAVQYLNRGVYCYYILHQTCILVFAFWL
FT                   RPYDLPPGIEATALILLTLASCAFAYELLRRIPGAAFVFGIPRKKNESSNRLLTPQTTV
FT                   "
FT   gene            542996..543880
FT                   /locus_tag="TERTU_0524"
FT   CDS_pept        542996..543880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0524"
FT                   /product="response regulator receiver domain protein"
FT                   /note="identified by match to protein family HMM PF04397"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12825"
FT                   /db_xref="GOA:C5BN28"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR012379"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN28"
FT                   /protein_id="ACR12825.1"
FT                   /translation="MTEVQRADKFKQHFLMHQRLWCTVLLLLWGALNVLVLTTTVLMDA
FT                   ASFGRPLPIWEPLCWELTSTTAILLLIWAMTIVLPRWIENKPWYQQALLHLLLTIPFSL
FT                   VHVLTMMALRKLWYWLAGSLYQPFDAGWWYVLFYEFRKDFMSYFLILFVISGYRLMVLR
FT                   LRGEATYVPTGEKSVPVEESPPQQLLVKKLGKEFLIHTADIEWVEAAGNYANLHVGAAV
FT                   YPMRITMARLAELLPAPGFIRIHRSTIVSSRAVAHIEPLDTGDHRVTLKDGKVLSLSRR
FT                   YREHFRDSLAVGS"
FT   gene            complement(544086..544982)
FT                   /locus_tag="TERTU_0525"
FT   CDS_pept        complement(544086..544982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0525"
FT                   /product="Gluconolaconase domain protein"
FT                   /note="identified by match to protein family HMM PF08450"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13338"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN29"
FT                   /protein_id="ACR13338.1"
FT                   /translation="MLRSASLLLLTSLLLGCAPELRKGPSGANPFRVEQLNLPAFELAE
FT                   GPTWDGEDLLFFTDIFASKLYKYNLRTGELATEQEATHAANGMAMDDTGKLWICTQELG
FT                   RITLYDPKTATLRPLLRGFQGKRFNHPNDITLDDHGGAYFTDPAWDPVKHRHQPVNGIY
FT                   YVGHDGEAHLLDANLDKPNGILLSKNGKFLYVVDMGTNAFLRYPVVQPGVVAEPEAFAT
FT                   LNTEGVSAAAPDGLEEDADGNIYVATENGIQVFTPTGQFLYRVALPQRPTNLEFIDRAQ
FT                   KEMIVTSANYLFRLRRE"
FT   gene            545330..546073
FT                   /locus_tag="TERTU_0527"
FT   CDS_pept        545330..546073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0527"
FT                   /product="DNA/RNA non-specific endonuclease"
FT                   /note="identified by match to protein family HMM PF01223"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14277"
FT                   /db_xref="GOA:C5BN30"
FT                   /db_xref="InterPro:IPR001604"
FT                   /db_xref="InterPro:IPR020821"
FT                   /db_xref="InterPro:IPR040255"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN30"
FT                   /protein_id="ACR14277.1"
FT                   /translation="MNKQALLICGFILTFVATLPAKAAVVSHNYSYFKLWIDCNKRSAV
FT                   KFDYLLWSDSGNQSRPSAFTTDPYISASCQQKSTKSYESVHSGYDRGHMVASNHMDFSA
FT                   TAIKRANYMTNILPQVSQMNQGAWLKTEEITECYREYTDIRVLGGPVWSAGVKNNYFLS
FT                   SHGTPTPKKYWKVLIKQDYYGNVIDAIGWIINNDTAATKSKLDNYLKSINAIESATGES
FT                   IPVPSSFKYMVPSKSWSLPSGCDLS"
FT   gene            546545..548542
FT                   /locus_tag="TERTU_0528"
FT   CDS_pept        546545..548542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0528"
FT                   /product="peptidase, S9 family"
FT                   /note="identified by match to protein family HMM PF00326;
FT                   match to protein family HMM PF01738"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14016"
FT                   /db_xref="GOA:C5BN31"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN31"
FT                   /protein_id="ACR14016.1"
FT                   /translation="MQVRKQAFSIISLFTYLFILFLIPKAIAQEYSPIPAGVLFNPNQA
FT                   HMHALSPQGKQLAYLTLSGETVYLNIVDVDKLEIKARFNLGSDVVTQFYWIDEFRLIYN
FT                   MAGRIKSVNTAGTENVVLMDHIYDMEGIDSWYDVMRHWRGWSIASMLPNDAENILLRGE
FT                   DIKGYASISKFNIFTGEKTDIANGGKHKIHEWSTDMQGNVRLAYRYKKGQVEVFQVEGS
FT                   DETKLLLKPMMIEGNSLAYDGRSFVNQRVFFNAFSFDGKSMYLTENIEKDKFRYVEYNL
FT                   EKQKIVKVLAENKRFDIANPQSHEIFYNGFIFDSNKKQLAGIRYSAERPVTIWLDEDVK
FT                   AIQATIDGFYPNTSNLIMDWTDDRNSYVVFSFSEQVPGKTSIFIKNKKRFTVVSDDTEI
FT                   YVDHTLATTSFVSYKSKDGTDIYAYLTSPIVSSDAPPPLVVMPHGGPWARDYYGYDPEV
FT                   QFFATRGYAVLQPQFRGSAGLGRGYMLAAKQSLNGVMLDDIADGAQWLIDKGDVDRNRV
FT                   YIYGYSYGGYAAIMSAIKYKDLYKAAVSMASPLDLNAQLKFYKKEDYDFAYEYWNTLVG
FT                   DAKSNKKELAAASPSENMANIKIPLLIAHGDKDPIVPVDQFDKFKKALDRKKNPNIRTQ
FT                   RFKNVGHGFKNPSNNIYFVEQALKMFEEAK"
FT   gene            548539..550488
FT                   /locus_tag="TERTU_0529"
FT   CDS_pept        548539..550488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0529"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11502"
FT                   /db_xref="GOA:C5BN32"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN32"
FT                   /protein_id="ACR11502.1"
FT                   /translation="MRALGLLLVVSLLTMFTQASDDRLREPVPSSVLFSGFKFGEFKLS
FT                   PSGKYLLIKHWKMDGSSISVYDIPNKKIKYNFKVDKEYKYRDITWLSDEVIAYEKNGYI
FT                   VKMESSGSNLEVMVNRVIDKKGSYEDRRYKYWNLGGLIPGDKGEVLLEASSDDKSLLYA
FT                   YNFRTGEKRVLADGRALGVSDWYVDSLGVPRVGLKETKKERQYFWFDSESGELNPVLSP
FT                   SKKPLVFNKKEREKHRYQIIGYAPKSNNIYIAENRSTGYYRLVELDPKTGDIVRVIKEK
FT                   AGVDIGWASDVVIEVRPELGVLAGIRYRDDLGWQQEWFDKDYERIQKILDKKQPELKNL
FT                   ITSCDRGLNFCNVEALNTTDTYIEQVLDVANGQLISVAKFAKERTGYVLNQPEAYQFKT
FT                   PETTLYGITTNTTAANDNPPVILIPCPGLESNYAVAYNSYAQFFATRGFTVHQTNNRGC
FT                   SGRGVDYLYGKQGELPQYMADDLVATVEWVHSQPRYQDSKIFLFSYTWYSSFTAGLALK
FT                   RKPELFSGAALFSAPLNPKAYYKYLKKNDYWYARNFWDSLAADGKLKGADFERLSVYDE
FT                   LAKTKIPVLLTYGRDDATPIAENLEKLSELSKANGNLDVRALKDTSLKIGLDAMEIYYA
FT                   ESAERTFRKALGGG"
FT   gene            complement(551923..552093)
FT                   /locus_tag="TERTU_0532"
FT   CDS_pept        complement(551923..552093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0532"
FT                   /product="OmpA domain protein transmembrane
FT                   region-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14336"
FT                   /db_xref="GOA:C5BN33"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN33"
FT                   /protein_id="ACR14336.1"
FT                   /translation="MDYNISSTDTESDQLYGLGFSFEIKKKNQLYIEYASYIHDSEIEF
FT                   DGVSIGYKYKI"
FT   gene            complement(552365..552799)
FT                   /locus_tag="TERTU_0533"
FT   CDS_pept        complement(552365..552799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0533"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13887"
FT                   /db_xref="GOA:C5BN34"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN34"
FT                   /protein_id="ACR13887.1"
FT                   /translation="MNVEISENSDDPEPTDNKWFLLVEEFRARHTEILHYQNETKQIVF
FT                   WSVASTGALWAWVVQNKSNADAQIFMSFVIFLPLIIVLYCGLRWRLLEHFIETNSKYIR
FT                   SDIEHFFQKNYWGGRHTYNAKRKIVKMRFFHLEKRRGFKI"
FT   gene            complement(552891..553076)
FT                   /locus_tag="TERTU_0534"
FT   CDS_pept        complement(552891..553076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0534"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11465"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN35"
FT                   /protein_id="ACR11465.1"
FT                   /translation="MVEAIDLVDGCEPGVWIDGKTLSASLDLPDFVLNSIFKIYEAKGY
FT                   GLVSKTINECKYLGKT"
FT   gene            complement(553498..554073)
FT                   /locus_tag="TERTU_0535"
FT   CDS_pept        complement(553498..554073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0535"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11423"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN36"
FT                   /protein_id="ACR11423.1"
FT                   /translation="MSIESAKKELESAKRAVEAMKNAESFDIFDEEWRDFLNCLEKVWV
FT                   KTERGCQHIKNSFQPWQGRYSALRRKDMLLRYLKQARDADNHSIQPVAEYKAANRTLDF
FT                   INAKGGQIKNLVIEGGQIVHYEGDPLVVRNNPASIQAIRVKNSGNWYNPPTSHLNKKVS
FT                   SLHPVHLAELGVQFYEAFINDTESTFFS"
FT   gene            complement(554083..554205)
FT                   /locus_tag="TERTU_0536"
FT   CDS_pept        complement(554083..554205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0536"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12715"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN37"
FT                   /protein_id="ACR12715.1"
FT                   /translation="MNYHQQGMHHEAFNKATKNRAFSAGLATSRSPFMAALGQL"
FT   gene            complement(554174..554758)
FT                   /locus_tag="TERTU_0537"
FT   CDS_pept        complement(554174..554758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0537"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12125"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN38"
FT                   /protein_id="ACR12125.1"
FT                   /translation="MEISSSAVTGAMRIGVQVVSSDRLAVLEIYHQVRNRFGTEFESEI
FT                   PKKASSEETIKQKTRLQDILIEVSLVNIGGSRAENINLAISGDLRRNLPRESSGDLFDV
FT                   IIPQLAPGQSRFLFKFDEFDLNEYPEGGGTPTGIKNESFTIHIEYDSGIGIINWLISRW
FT                   SKLRGRRRFHDEYAFFPKLVTGELPPAGYAP"
FT   gene            complement(554868..557024)
FT                   /locus_tag="TERTU_0538"
FT   CDS_pept        complement(554868..557024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0538"
FT                   /product="KAP family P-loop domain protein"
FT                   /note="identified by match to protein family HMM PF07693"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13305"
FT                   /db_xref="InterPro:IPR011646"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN39"
FT                   /protein_id="ACR13305.1"
FT                   /translation="MNWIRTMFSRKKGDSVVQKIENPPVPEGGQKTAKITADNPITSSE
FT                   EDALGRLKPASSFAEQVLTLDSSEGVVVGVLGPWGSGKTSFVNLSQSFLKESGVTVLEF
FT                   NPWMFSGADQLVQSFFIELSAQLKLRPGLSEIGELIEDYGDTFSGLGWLPLVGPWIERG
FT                   RVVTDLVAKALQRKKEGVKSSQNRVRQSLKKIDKPIVVILDDIDRLSTQEIRDVFKLVR
FT                   LTANFPNIIYLLAFDRYRVEQALGEQGIPGRDYLEKILQIAIDLPAVPEHVLNTQIFNA
FT                   INGALADVENPGNFDSDLWPDVFMEVIRPLIRNMRDVRRYAAAIHGTARDIGGQVALVD
FT                   VLALEAVRVFLPDVFHSLHTSVDGLTTTSGGYGYREDPPELKNQIDNLVAKGGEHEESI
FT                   RNLIRRLFPGGERHLGGSHYGGDWTNRWLKERRVAHVEVLRYYLERVAGEKLQAFSDAE
FT                   IAWSLITYKAEFETYLKLLPLDRLQDVISSLEAYEDDFADQHVIPGTVVLLNLLPQLPD
FT                   RQRGMFDLDTRLVVGRVVYRLVRALKEPEAIEAAVKEILPQIKSLSSRQELITDVGYQG
FT                   SGHKLVSEEAAKAFEVEWRAQVRSASPEELASETDLLRTMLLVKREADPDEPDLMVPDN
FT                   TDITYALLKSARSDVRIQSMGSRAVRLKPRLAWDILIDLYGDENVLRDRIDQLKASPPD
FT                   EIGDLFELADKYLSGWRPKDFGDE"
FT   gene            complement(557050..557937)
FT                   /locus_tag="TERTU_0539"
FT   CDS_pept        complement(557050..557937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0539"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12941"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN40"
FT                   /protein_id="ACR12941.1"
FT                   /translation="MFDTRPKPFVFVLMPFSEEFRDIYELGIKSACELAGAYCERVDEQ
FT                   IFEERMLDRIYNQIAKADVIISDMTGKNPNVFYETGYAHALGKRVLLLTRQANDIPFDL
FT                   KHFQHVIYQGKITYLKNELVRRIEWAINHPKENSEIFSTSIRYMVQGVEVIDGAQSYIV
FT                   EHFDKESRSLERTLQLDLFNLSDGTINSDQVRLSLDIDCYSGASASLMPDGKYLHRLPI
FT                   KEDIYPGSHISIRLDLHVPQGIDHDALISEGVKATLHESTKFGKMSRNLILKLVTQERL
FT                   EVITHNKELQRTSR"
FT   gene            complement(557948..558166)
FT                   /locus_tag="TERTU_0540"
FT   CDS_pept        complement(557948..558166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0540"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14205"
FT                   /db_xref="GOA:C5BN41"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN41"
FT                   /protein_id="ACR14205.1"
FT                   /translation="MVVLKEKYSIYYAVLIGWSGVLAWWKGIHPNKWVNLMPHATLRFG
FT                   VASPLYPKTTLHMQHRLPKRYVRYFMG"
FT   gene            complement(559198..559443)
FT                   /locus_tag="TERTU_0543"
FT   CDS_pept        complement(559198..559443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0543"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12077"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN42"
FT                   /protein_id="ACR12077.1"
FT                   /translation="MEFYWSTTADDLPLTGFYQSTTTNHQSLIKFSRSPTINDRSLTEF
FT                   YWSTTPDDQPLAGFYQSKNTNHKPLIEFSRSPTVAD"
FT   gene            complement(559852..559938)
FT                   /locus_tag="TERTU_0544"
FT   tRNA            complement(559852..559938)
FT                   /locus_tag="TERTU_0544"
FT                   /product="tRNA-Leu"
FT   gene            560122..562704
FT                   /gene="rnr"
FT                   /locus_tag="TERTU_0545"
FT   CDS_pept        560122..562704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnr"
FT                   /locus_tag="TERTU_0545"
FT                   /product="ribonuclease R"
FT                   /EC_number="3.1.-.-"
FT                   /note="identified by match to protein family HMM PF00575;
FT                   match to protein family HMM PF00773; match to protein
FT                   family HMM PF08206; match to protein family HMM PF08461;
FT                   match to protein family HMM TIGR00358; match to protein
FT                   family HMM TIGR02063"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14606"
FT                   /db_xref="GOA:C5BN43"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR013668"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR040476"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN43"
FT                   /protein_id="ACR14606.1"
FT                   /translation="MSRRKTLKLQDPHAAREAQKYDNPIPSREFILDVLDNASGPMSHR
FT                   ALCGELKLTDEDAIEALRRRLIAMERDGQVMSNRKGAYGRVDRMALVRGRVQGHRDGYG
FT                   FVIPTEGGEDIYLTNRQMRKVFDGDEVLVRPEPDGFRGRTEGVIVEVLARNTQHLVGRF
FT                   TTERGIFYVRPDNPRIGRDILVPPDQTGGAVNGQIVVVEVLQQPDRQNMPAGRIAEVLG
FT                   DHLAPGMEIDVAIRSHGIPHQWPDAVEEQVRDFSNQVAEADKAHRVDLRQLPLVTIDGE
FT                   DARDFDDAVYCEAKRSGGWRLYVAIADVSHYVTPGSALDIEAQKRGNSVYFPDYVVPML
FT                   PKILSNGLCSLNPQVDRLCMVCEMTISAAGKVSGYKFYEAVMHSHARLTYTQVGQVLAE
FT                   RDKPRSGIRQQFHHVVKQLDGLHDLYMQLRARREERGAIDFETRETRILFDEGRKIREI
FT                   VPTERNDAHKLIEECMLAANVCAAKFIEFHKLPGLFRVHEPPKAEKIDMLYQFLAELGI
FT                   RIPWSEQVTPADYQQVMEAIAGRSDAHIIQMVLLRSMNQAVYQPENRGHFGLAYDAYAH
FT                   FTSPIRRYPDLLVHRAIRSVIRSNLDTKKVVRVEGATPLTAAQIYPYTAGDMASFGDEC
FT                   SFTERRADDATRDVISWLKCEFVKDRVGEVFDGVVASVTGFGLFVELKDVYVEGLVHIT
FT                   SLPEDYYRFDPAHHRLVGDRTRRVFGLGDELSVQVVRVNLDERKIDFELNQIKPRKKVR
FT                   VKVSEQAKSLAQDYEAETARKSGGRVPRKRAAAPAGDSAEKAADKAASPAKRSAKKPVD
FT                   ATAEPAKKRKPAKSAKPAKPAKKVKKKKHAKREEASGKKKKKAPKTRK"
FT   gene            562970..563713
FT                   /gene="rlmB"
FT                   /locus_tag="TERTU_0546"
FT   CDS_pept        562970..563713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rlmB"
FT                   /locus_tag="TERTU_0546"
FT                   /product="23S rRNA-methyltransferase RlmB"
FT                   /note="identified by match to protein family HMM PF00588;
FT                   match to protein family HMM PF08032; match to protein
FT                   family HMM TIGR00186"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14158"
FT                   /db_xref="GOA:C5BN44"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR024915"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN44"
FT                   /protein_id="ACR14158.1"
FT                   /translation="MKTDVIFGIHAVQSLLKTAPQRISELQVVKDRQDQRIKKLLAMAE
FT                   AHGVRVSLVNRQQLESAAGDGNHQGVIAYAKPGKALDEKGLLDLIAQMEEDPLILVLDG
FT                   VTDPHNLGACMRSADAAGVHAVVIPKDNSAGLNETARKVACGAAETVPLVVVTNLARAL
FT                   NKLQDAGLWVAGAAGEADADIYSADLTGPRVIVMGAEGDGMRRLTKETCDLLIKIPMMG
FT                   SVSSLNVSVATGVVLFEVLRQRNAR"
FT   gene            563877..564332
FT                   /gene="rpsF"
FT                   /locus_tag="TERTU_0547"
FT   CDS_pept        563877..564332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsF"
FT                   /locus_tag="TERTU_0547"
FT                   /product="ribosomal protein S6"
FT                   /note="identified by similarity to SP:P02358; match to
FT                   protein family HMM PF01250; match to protein family HMM
FT                   TIGR00166"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11329"
FT                   /db_xref="GOA:C5BN45"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BN45"
FT                   /protein_id="ACR11329.1"
FT                   /translation="MRHYEIVFLVHPDQSEQVPGMIERYTSAVKDSGGSVHRLEDWGRR
FT                   QMAYSINKIHKAHYVLMNIECGDQALEELTTNFRYNDAILRNMVIRCDEAVTEESPIQK
FT                   AEKENRERKNRAERRAAEAAAATETEKSESEESAEEETSTDTTGEEE"
FT   gene            564335..564562
FT                   /gene="rpsR"
FT                   /locus_tag="TERTU_0548"
FT   CDS_pept        564335..564562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsR"
FT                   /locus_tag="TERTU_0548"
FT                   /product="ribosomal protein S18"
FT                   /note="identified by similarity to SP:P10806; match to
FT                   protein family HMM PF01084; match to protein family HMM
FT                   TIGR00165"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACR10830"
FT                   /db_xref="GOA:C5BN46"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BN46"
FT                   /protein_id="ACR10830.1"
FT                   /translation="MSRFFRRRKFCRFTAEGVKQIDYKDLETLKAYISETGKIVPSRIT
FT                   GTKAKYQRQLATAVKRARYLALLPYTDSHE"
FT   gene            564592..565458
FT                   /locus_tag="TERTU_0549"
FT   CDS_pept        564592..565458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0549"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11058"
FT                   /db_xref="GOA:C5BN47"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN47"
FT                   /protein_id="ACR11058.1"
FT                   /translation="MRALANFIMRGRVQAVIMALLGSWVPLLSQGALGLVTLRKGWKEG
FT                   LIITLWASLPAVAALWAGDVAKVMAVAGIEVMVVAYLSSVMLRYTVSWSAALAAIVALS
FT                   SFAALVAVLLVEDISSQLVAFFQTMLESQAQNPPSAETALLTNWSTARAAGVIAMWISL
FT                   TTFAGLALARWWQAMLFNPGGFRTEFHSLRLNASLATAALGGVVIAEFNGLEYGFWGLV
FT                   FGMPLLVAGIGLIHCFVAAKKLGIWPLVAFYFGLVLIAPLGLLVSLLGFTDVWIDYRKR
FT                   FNLVQPK"
FT   gene            565485..565934
FT                   /gene="rplI"
FT                   /locus_tag="TERTU_0550"
FT   CDS_pept        565485..565934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplI"
FT                   /locus_tag="TERTU_0550"
FT                   /product="ribosomal protein L9"
FT                   /note="identified by match to protein family HMM PF01281;
FT                   match to protein family HMM PF03948; match to protein
FT                   family HMM TIGR00158"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11719"
FT                   /db_xref="GOA:C5BN48"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BN48"
FT                   /protein_id="ACR11719.1"
FT                   /translation="MEVILLEKVGKLGTVGDKVKVKAGFGRNYLVPQGKAIAATESNIA
FT                   EFEARRAELEAAASDRRTAAEGRAKLLAEKETFTIVAKTGDEGKLFGSVGTRDIADAIT
FT                   ADGIKVSKAEVKLPQGTLREVGEYEVDIQLHVDVTQAIKLVIAAE"
FT   gene            566113..567441
FT                   /gene="dnaB"
FT                   /locus_tag="TERTU_0552"
FT   CDS_pept        566113..567441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaB"
FT                   /locus_tag="TERTU_0552"
FT                   /product="replicative DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by similarity to SP:P0ACB0; match to
FT                   protein family HMM PF00772; match to protein family HMM
FT                   PF03796; match to protein family HMM TIGR00665"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13690"
FT                   /db_xref="GOA:C5BN49"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN49"
FT                   /protein_id="ACR13690.1"
FT                   /translation="MPHSVEAEQSVLGGLMQDASNFDGVSEQIAEGDFYKSGHRKIYAA
FT                   MFQLIERDQPIDVITVSEYLTQTDELEAVGGLDYLVDLATNVPSSANVAAYARIVRERA
FT                   TFRQLISAATEISRASFNPAGLGSDDLLQLAEKRVLEIAEERPKEGGFAAINELLKKTA
FT                   DKIDELFQSDSDITGLSTGLSDLDQRTSGWQSGELIILAARPSMGKTALALNFVEAALF
FT                   TQPKPVLVFSLEMPADSLIMRMLSSVGRIDQGNLRNGALADEDWPKLQSAFAKLKDKKL
FT                   FIDDTAGLSPAEVRARIRRLAREHGEPGMIMIDYLQLMQIPGNSEGRTQEISEISRSLK
FT                   ALAKEYECPVIALSQLNRGVEQRPNKRPMNSDLRESGAIEQDADVILFIYRDEYYNEDS
FT                   NEKGVAELIIGKQRNGEIGTCRAAFLGKFTRFDNLAPEYMARD"
FT   gene            567539..567706
FT                   /locus_tag="TERTU_0554"
FT   CDS_pept        567539..567706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0554"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14708"
FT                   /db_xref="GOA:C5BN50"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN50"
FT                   /protein_id="ACR14708.1"
FT                   /translation="MLTAGAFALLTLGTLALLAAGNARFGSLLGMFGLLTAGGACFSAR
FT                   AKQSAVSAQK"
FT   gene            567866..568723
FT                   /gene="panC"
FT                   /locus_tag="TERTU_0555"
FT   CDS_pept        567866..568723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panC"
FT                   /locus_tag="TERTU_0555"
FT                   /product="pantoate--beta-alanine ligase"
FT                   /EC_number="6.3.2.1"
FT                   /note="identified by match to protein family HMM PF02569;
FT                   match to protein family HMM TIGR00018"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12885"
FT                   /db_xref="GOA:C5BN51"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BN51"
FT                   /protein_id="ACR12885.1"
FT                   /translation="MKTFHHIQSVREALKQARLEGKTVGFVPTMGNLHDAHIALVRQAQ
FT                   SLVDVVIVSVFVNRLQFGLNEDWDKYPRTIEADSQKLAAVNCDFLFYPDEKEMYPNGMD
FT                   AQTRVIVPSMADVLCGASRPGHFEGVTTVVSKLFNIVQPDIAVFGIKDYQQLAIIRRMV
FT                   EDLCIPVDIVAGDIVREADGLAMSSRNSFITPQERPNANQLHRSLSWLREQILAGERNY
FT                   PALETAAKARIKEAGFRPDYVSICNSKTLAPAASDDLNITLLGAMYTEGARLIDNLSLN
FT                   LAGE"
FT   gene            568746..569126
FT                   /gene="panD"
FT                   /locus_tag="TERTU_0556"
FT   CDS_pept        568746..569126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panD"
FT                   /locus_tag="TERTU_0556"
FT                   /product="aspartate 1-decarboxylase"
FT                   /EC_number="4.1.1.11"
FT                   /note="identified by match to protein family HMM PF02261;
FT                   match to protein family HMM TIGR00223"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13465"
FT                   /db_xref="GOA:C5BN52"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BN52"
FT                   /protein_id="ACR13465.1"
FT                   /translation="MQITLLKGKLHMACVTQAELWYDGSCAIDADLVKLAGLREFEQID
FT                   IYNVDNGERFSTYVILAEPGSKTISMNGAAARKVQVGDRIIIAAYAGMEEAEADRHKPK
FT                   LVYLNSDNSVNRTSNTIPVQVA"
FT   gene            569471..571411
FT                   /gene="acsA"
FT                   /locus_tag="TERTU_0557"
FT   CDS_pept        569471..571411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acsA"
FT                   /locus_tag="TERTU_0557"
FT                   /product="acetate--CoA ligase"
FT                   /EC_number="6.2.1.1"
FT                   /note="identified by match to protein family HMM PF00501;
FT                   match to protein family HMM TIGR02188"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11752"
FT                   /db_xref="GOA:C5BN53"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN53"
FT                   /protein_id="ACR11752.1"
FT                   /translation="MADTNLYPVSEAIAASAHITKDEYETLYQESISSPETFWAAKAEE
FT                   FLTWDKKWDKVREFDFVKGEARWFDGGKLNVSANCIDRHLAERGDQVAIIWEGDDPSDD
FT                   LKVTYKEVHEQVCKLANVLKTRGVKKGDRVCIYMPMIPEAAYAMLACARVGAIHSIVFG
FT                   GFSPEALKDRIQDSDCQVVITADEGVRGGRKIPLKANADTAVAQCPGVSTVLVVKRTGG
FT                   DVAWDESHDVWYHDAMAEASADCAPEPMDAEDPLFILYTSGSTGKPKGVLHTTGGYLLQ
FT                   AAMTHKYVFDYQDGEVYWCTADVGWVTGHSYIVYGPMANGAITLMFEGVPTYPTAARCW
FT                   EVVDKHDVSIFYTAPTAIRALMGQGDEFVTQTSRKTLRILGTVGEPINPEAWDWYYKVV
FT                   GDSRCPIMDTWWQTETGAHMLTPLPGAIALKPGSATLPFFGVEPVLLDGDGKEVVGAGE
FT                   GSLAIKSSWPSQIRTVFGDHNRLVQTYFSTYPGYYFTGDGARRDEDGYFWITGRVDDVI
FT                   NVSGHRMGTAEVESALVLHEKVSEAAVVGYPHDIKGQGIYAYITLMVGEEPSDELKKEL
FT                   VALCVKEIGPIAKPDVIQWAPGLPKTRSGKIMRRILRKIAANEVDALGDTSTLADPTVV
FT                   DDLIDNRENKG"
FT   gene            571560..572024
FT                   /gene="slyD"
FT                   /locus_tag="TERTU_0558"
FT   CDS_pept        571560..572024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="slyD"
FT                   /locus_tag="TERTU_0558"
FT                   /product="fkbp-type peptidyl-prolyl cis-trans isomerase
FT                   slyd"
FT                   /EC_number="5.2.1.8"
FT                   /note="identified by match to protein family HMM PF00254"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12349"
FT                   /db_xref="GOA:C5BN54"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN54"
FT                   /protein_id="ACR12349.1"
FT                   /translation="MKIQDNCVVSIHYTLTDEEGAVIDSSSGGEPLNYLAGAGNIIPGL
FT                   EKELEGCVVGDSKLVTVQPADGYGEYQPELVQTLPADMFTGIEKVEVGMEFQAQGPSGE
FT                   VQFVVVKDVAEDGITIDGNHELAGKVLNFDVTVEAVREATAEEIDHGHVH"
FT   gene            572053..573444
FT                   /locus_tag="TERTU_0559"
FT   CDS_pept        572053..573444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0559"
FT                   /product="decarboxylase family protein"
FT                   /note="identified by match to protein family HMM PF03641"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12645"
FT                   /db_xref="InterPro:IPR021826"
FT                   /db_xref="InterPro:IPR027820"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="InterPro:IPR037153"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN55"
FT                   /protein_id="ACR12645.1"
FT                   /translation="MLDSVSIGAAGKKISALITPDNTLNVLSQLEVARLVEKSNAAVYE
FT                   TFRRCALAALNTGAETDNTKQVLEQFRDFEIDVVQQERGIKLHLKNAPGNAFVDGEMVQ
FT                   GIKEHLFSALRDIIYVNNELLENSAADFHSSEGITNGVFQILRNSSVLKVHRSPSIIVC
FT                   WGGHSINEVEYDYSKEVGYQMGLRGLDICTGCGPGAMKGPMKGATFGHAKQRIQGRYIG
FT                   ITEPGIIAAESPNPIVSELVIMPDIEKRLEAFVRLGHGIVVFPGGVGTAEEILYLLGIL
FT                   LHPDNRGLPFPLIFSGPASAAEYFGQIDEFIGLTLGKEAQGLYEIILDDPVLVAQKMRA
FT                   GMDVVRNYRKQTHDAYYYNWVLKIDQDLQSPFNPTHQSMSQLSLRPGLAPNLLAANLRK
FT                   AFSGIVDGNVKEHGIHAVAEKGPYQICGDPQIMKPLDALLRSFVAQKRMKIPTEEYIPC
FT                   YQVVV"
FT   gene            573452..574027
FT                   /locus_tag="TERTU_0560"
FT   CDS_pept        573452..574027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0560"
FT                   /product="Smr domain protein"
FT                   /note="identified by match to protein family HMM PF01713"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11117"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN56"
FT                   /protein_id="ACR11117.1"
FT                   /translation="MQDDDFSKLLGDDEVLPIKTERRVNLVVPKDVGVDKEARRLAAQE
FT                   LAAAKDDPLSVPQDLLDPYDVLSYQKPGVQNGVFRNLRLGKYDIDARLDLHQLKIEEAR
FT                   KSVYQFIKDCVESDVRCALITHGKGAGRETPALLKSCVNHWLPQFEEVLAFHTAQRHHG
FT                   SYGATYVLLRKSDKKKQETKDRHQRKRS"
FT   gene            574127..574540
FT                   /locus_tag="TERTU_0561"
FT   CDS_pept        574127..574540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0561"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF06561"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11488"
FT                   /db_xref="GOA:C5BN57"
FT                   /db_xref="InterPro:IPR001129"
FT                   /db_xref="InterPro:IPR023352"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN57"
FT                   /protein_id="ACR11488.1"
FT                   /translation="MLYPMFALVMCTFVFIFVQLYLRVHAVKSRAVRMRYFKLYQTNAD
FT                   MQPVPAYLVAGQNHFANLFETPLLFYVAGVLAIVMKVEPTAMVVCGWSYVVTRVVHAFI
FT                   HCTYNHVLHRAITYWVSLMLLLAMWILLVVNAN"
FT   gene            complement(574581..577004)
FT                   /locus_tag="TERTU_0562"
FT   CDS_pept        complement(574581..577004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0562"
FT                   /product="Predicted signal transduction protein, with PAS,
FT                   HAMP, GGDEF and EAL domainsl"
FT                   /note="identified by match to protein family HMM PF00563;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF00990; match to protein family HMM TIGR00229;
FT                   match to protein family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13922"
FT                   /db_xref="GOA:C5BN58"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033417"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN58"
FT                   /protein_id="ACR13922.1"
FT                   /translation="MTDETLAQRSTIKRRLMRSIGSTLIVAVIMVAGILTWVGNRDAKA
FT                   NLINDLTVIGQIIANRSSTAMFFADFTDKDVIEKNLASAGFHSAIDLICVFDKEGKLYH
FT                   TFAKPEAHSQCQRQQSSINELNFTEDNNVIRVRVPILHEGEHFGLVEIYSNNHGVNQAF
FT                   LRFSITLAFALTIALFVAYFVGGRLVGSSLVPLRDLFNTSQEVAASPYANIRANKKSND
FT                   EIGDLVDVFNQILDTLETDNAALMESESRFRVLAEHAPIGIFLRNRKLIMEYTNDRWCE
FT                   ITGLTPSQANAFTNNIDPKDAALYESVQDKARSQHTPQVIEYTYTTPQGSRRTLMEHLA
FT                   PLNNLQGFQGFVGSLLDVTELKTAQMELEKLAFYDPLTDLPNRRFFRGHLELTIAAAKK
FT                   YDKRLAVMMTDLDDFKKINDTFGHDAGDQLLMQIGKRLKAASASIDVVSRMGGDEFMLL
FT                   VKNIDSSSQLDHKANNILRALREKMEINGQQVEVGGSIGIAVFPNDAITYEELIRYADI
FT                   ALYNAKSMGGNTVSYYSSDLDKRIKDKMRLEQKLRVALDKRLLEVYIQPIYDAATREMI
FT                   KGEALVRWMDPEEGFISPEVFVSLAEESGLIYDLGSLVLEKVCAYLHEHEGKLHLLGMR
FT                   TIAVNLSARQFFASQLVTYIEATFKQYQIDPKQIEFELTESMVMDDVDQAIDIMRAIRN
FT                   LGCSLSIDDFGTGYSSLSYLKQFPINTLKIDRSFIKDIPEDKNDVEIAYTIIAMAHNLG
FT                   LTVVAEGVETKEQWQLLRDKNCDYLQGYYFARPMPMSDVLMLDNVINLLGDGSR"
FT   gene            complement(576997..577446)
FT                   /locus_tag="TERTU_0563"
FT   CDS_pept        complement(576997..577446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0563"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14218"
FT                   /db_xref="InterPro:IPR025293"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN59"
FT                   /protein_id="ACR14218.1"
FT                   /translation="MSAKEAQVRALIIARTLTFITWPPAMGSDINICRLGESQAFDELH
FT                   RTPQIQDILKPFNANFVADLSPLTDCHVQIVGQSDAPFPDSIKDNALLTICDDCVDGEE
FT                   FATIRLLKIHDRIKFTVNLPLAQRQNLKISSSLLELAHRVTKRND"
FT   gene            complement(577850..579691)
FT                   /gene="pdxS"
FT                   /locus_tag="TERTU_0564"
FT   CDS_pept        complement(577850..579691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxS"
FT                   /locus_tag="TERTU_0564"
FT                   /product="1-deoxy-D-xylulose-5-phosphate synthase"
FT                   /EC_number="2.2.1.7"
FT                   /note="identified by match to protein family HMM PF02779;
FT                   match to protein family HMM PF02780; match to protein
FT                   family HMM TIGR00204"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14422"
FT                   /db_xref="GOA:C5BN60"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN60"
FT                   /protein_id="ACR14422.1"
FT                   /translation="MFYQIPNQRPATPLLDSIDTPADLRRLSAERLAQVAQELRAFLLY
FT                   SVGHTGGHFGAGLGVVELTIALHYLLHTPEDRLIWDVGHQAYPHKILTGRREQLLTIRQ
FT                   QGGISGFPKRAESVFDSFGVGHSSTSLSAALGMALASAQQGIPRQCVAVIGDGAMTAGM
FT                   AFEALNHAVHTQADLLVVLNDNTMSISPNVGGLASYFAGVLENSAEQAGAHAKAQVQSA
FT                   PPASASSSASALFTELGFSYSGPIDGHDFDQLLPAISSVLNTSGPRLLHVVTRKGKGFA
FT                   PAEKDPVGYHALNKIERESASVTPDKRRRYQQVFGDWLCDTAARDERLIGITPAMSEGS
FT                   GMVSFAQTFSDRFHDVAIAEQHAITLAAGLACEGMKPVVAIYSTFLQRAYDQLIHDVAL
FT                   QDLDVLFAVDRAGLVGEDGASHAGSFDISFLRCIPNMVIATPSDERECYQLLDAAYQYP
FT                   GPAAVRYPRGKGPGAELTDTLTPLEVGKAHQVREGEQLAILNFGALLPEALAVGDTLHA
FT                   TVCDMRWAKPLDHALLREIANSHRAIVTLEENAVAGGTGAGVLEWLQAEGITVPVLNLG
FT                   LQDVFYEHGSRVQVLARAGLNTEEIEARIRNWLKRHD"
FT   gene            complement(579755..582391)
FT                   /gene="ppc"
FT                   /locus_tag="TERTU_0565"
FT   CDS_pept        complement(579755..582391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppc"
FT                   /locus_tag="TERTU_0565"
FT                   /product="phosphoenolpyruvate carboxykinase (GTP)"
FT                   /EC_number="4.1.1.31"
FT                   /note="identified by match to protein family HMM PF00311"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12937"
FT                   /db_xref="GOA:C5BN61"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018129"
FT                   /db_xref="InterPro:IPR021135"
FT                   /db_xref="InterPro:IPR022805"
FT                   /db_xref="InterPro:IPR033129"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN61"
FT                   /protein_id="ACR12937.1"
FT                   /translation="MQKLPETLRENVRMLGDLLGENLLEHQGPKLFRKVEEIRAFSKQL
FT                   AKSDRSSDAHKEAVESLLESLSQVEDADILPIARAFNQFLNLANIADQHYFYSSEAREE
FT                   DALDEILENLADAKGKDDLYKLVNELNIELVLTAHPTEVTRRTLIRKYEQVAKALSDLR
FT                   RNDLLDYEVAQIKESLQRYIEEIWHTNEIRTTRPTAVDEAKWGFAVIENSLWHAVPDFI
FT                   RHLDSVCRRRLGKPLPLGITPFRFYSWMGGDRDGNPNVTHKVTEQVLLMGRWRAADLYI
FT                   KDINEVAGDLSMHAASHELLELVGEDSATPYRDLLHGLRNRLQATLNWAEARMNDPMLP
FT                   EPANIIHSRNELLQPLMLCYESLHELGLSQIANGSLTDLIRRIHAFGINLVPLDIRQDG
FT                   DRHVELLDELTIYLELGSYRSWDEEKRQAFLLEQLESKRPLLPEEWPVSEDSREVINTC
FT                   RVIAAQPRETLAHYVISMAQQPSDVLAVALLLKECGVRWKMPIDPLFETLDDLDRAPRV
FT                   MNALWQMHWYQRYIDGQQTVMIGYSDSAKDAGKFAATWAQYKAQEKLVSLADQHDVKLN
FT                   LFHGRGGTVGRGGGPVEKAMASQPPGSVKARIRVTEQGEMIRYKFGMPRVAFASLSNYV
FT                   LATLRATETPAPNPKPEWRELMENMAQASLTAYRGVVRGHESFVPYFRSLTPEQELSKL
FT                   ALGSRPPKRKASGGVESLRAIPWVFAWTQVRLNLPGWLGTRQALEYGLQNEQDTLKDMQ
FT                   QNWPFFNSFIDLLEMVLGKADTSICAHYEEQLVDKDLRPLGEQLRGDLEALAGLINTMK
FT                   EQPELLENTPLLQQSINIRKPYMDPLNYLQAELLKRERKAGEISPDLERALKVTMTGIA
FT                   AGMRNTG"
FT   gene            582573..583535
FT                   /locus_tag="TERTU_0566"
FT   CDS_pept        582573..583535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0566"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13480"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN62"
FT                   /protein_id="ACR13480.1"
FT                   /translation="MRITRLWCEKKSLQKIVLWLAILPAVGLTGCMPKIIEETESQADA
FT                   LYRQQVIQSDHIMVERARLHYTVREQLEFSAGALTANEVTELLVFVHGTPGDWRSFGQQ
FT                   LADRRLAARAVLVAIDRPSWGGSFFEEERVETSLGEQAGLIAPLLLRLREDYPNARLTL
FT                   AGHSFGASLVPMIAMVYPQAVDSVVVIAGDLSAEYLEEKWYNTVLAWPWVRPLLPREIC
FT                   YANDEVLALDENIAAMSDYWSHLSVPMMVIQGTEDTLVDPRNADFAAALKTPAGVRVER
FT                   IDGGSHLIHMAQSQRVDGLLLDWLASNFKTTNSAINSSD"
FT   gene            complement(583557..584375)
FT                   /gene="panB"
FT                   /locus_tag="TERTU_0567"
FT   CDS_pept        complement(583557..584375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panB"
FT                   /locus_tag="TERTU_0567"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /EC_number="2.1.2.11"
FT                   /note="identified by match to protein family HMM PF02548;
FT                   match to protein family HMM TIGR00222"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12606"
FT                   /db_xref="GOA:C5BN63"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN63"
FT                   /protein_id="ACR12606.1"
FT                   /translation="MAYANTEALEKSVSIKTLQAMKDRCEKFTTVALYDAPMAAMAQNC
FT                   GVESVLVGDSLGMTVLGYDSTLPVTMEHMIYHVEAVARGNKKSHIMGDLPFMTYATPEL
FT                   AMHNATRIMQAGAHAVKIEGGAWLASTVSMLSERGIPVCAHLGLTPQSVNKFGGFRVQG
FT                   REREQAETILADAMLLADAGADLLVLECVPAELAARITKAIPIPTIGIGAGRDTDAQVL
FT                   VINDILGLTETPPKFSKNFLSEAGDIPKALKKYVADVKAGVFPEDSHIFS"
FT   gene            complement(584390..585076)
FT                   /locus_tag="TERTU_0568"
FT   CDS_pept        complement(584390..585076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0568"
FT                   /product="deoxynucleoside kinase family protein"
FT                   /EC_number="2.7.1.-"
FT                   /note="identified by match to protein family HMM PF01712"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11062"
FT                   /db_xref="GOA:C5BN64"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN64"
FT                   /protein_id="ACR11062.1"
FT                   /translation="MSEHDIQQVDLQGQTIPRYIAVEGPIGVGKTSLARRLALTFNYET
FT                   LLERAEDNPFLEKFYANEKNAALPTQLFFLFQRMQQLNALQQHDMFEPVRVADFLLEKD
FT                   RLFAQVVLDEDALRIYHQVYDHLTIDAPKPDLVIYLQAPVQVLTERIQRRGVAFEQTIS
FT                   AAYLEELNQAYTRFFHYYDAAPLLIVNAADIDWVNNPDDYRNLVQYMLTIKSGRHYYNP
FT                   QPTMLR"
FT   gene            complement(585089..585571)
FT                   /gene="folK_1"
FT                   /locus_tag="TERTU_0569"
FT   CDS_pept        complement(585089..585571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK_1"
FT                   /locus_tag="TERTU_0569"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /note="identified by match to protein family HMM PF01288;
FT                   match to protein family HMM TIGR01498"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11688"
FT                   /db_xref="GOA:C5BN65"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN65"
FT                   /protein_id="ACR11688.1"
FT                   /translation="MQVFIGLGSNLDNPAAQLKSALAAIRAHSEIALICCSPFYRSIAV
FT                   GPPQPDYVNAVAELQTNLKPEPLLDALQAIENDHGRVRTEHWGARTLDLDLLLYGDTTL
FT                   NTVRLTVPHPWMTARNFVLRPLCDIAPELVIPGGDAVESYLAGVGDQGLIRLDEDN"
FT   gene            complement(585578..586969)
FT                   /locus_tag="TERTU_0570"
FT   CDS_pept        complement(585578..586969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0570"
FT                   /product="putative poly(A) polymerase"
FT                   /note="identified by match to protein family HMM PF01743;
FT                   match to protein family HMM TIGR01942"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13823"
FT                   /db_xref="GOA:C5BN66"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR010206"
FT                   /db_xref="InterPro:IPR025866"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN66"
FT                   /protein_id="ACR13823.1"
FT                   /translation="MLKQLLQFNKSRNEKRFGNARGPLGATVIPEKAHNIPRELISRNA
FT                   IRVIDQLLDAGYEAYLVGGGVRDLLLGGKPKDFDVATSATPEQLRGIFRNARIIGKRFQ
FT                   IVHVRFGREIIEVTTFRDNHAVADDNQQAKQSEHGVLLRDNVYGNLKTDAERRDFTVNA
FT                   LYYNPRSRELLEFSTGLEDLNDRVIRIVGDPQTRYREDPVRLLRAVRFAAKLGFTIEPV
FT                   TEAPIREHADYLTHIPPARLFEEVLKLFMSGSATATVNLLREYHLFKYLFPDTDFCMEN
FT                   GREPDRAMVMNAAANTDKRIRQGKKVTPAFIYAAFLWPALRASMRHLAKEQNLPTQEAM
FT                   QRAAQGIISQQLAYTSIPKRFLIPMREIWTLQLRLPRRQGQRAFAMLEHPRFRAAYDFL
FT                   LLREESGENCQGLGDWWTRFQADSQARDQMVEELSQPEAATPAAVRRPKRRRPRRSGSN
FT                   PPSTD"
FT   gene            complement(587601..589043)
FT                   /locus_tag="TERTU_0571"
FT   CDS_pept        complement(587601..589043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0571"
FT                   /product="transcriptional regulatory protein ZraR"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00158; match to protein
FT                   family HMM PF07728"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14398"
FT                   /db_xref="GOA:C5BN67"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN67"
FT                   /protein_id="ACR14398.1"
FT                   /translation="MRTFFGAATNKEIMSKILIVEDEDIIRTALRKLLNRNKYDVEEAG
FT                   SVSEATNKYKLGNFDLIISDLRLPGAPGTDLIQMAGEIPVLIMTSYASLRSAVDSMRMG
FT                   AVDYIAKPFDHDEMLAAVKRVIGKSSARKQQSQEQHTDGDNQAAIEGMIGSSAVMKSLY
FT                   AKIHKVAPTNATVLVHGETGTGKELVAHALHDESPRRSRPLISVNCAAIPETLIEAELF
FT                   GHEKGAFTGAASTREGLVAAADGGTLFLDEIGELPLEAQARLLRVLQEGEVRPIGSVES
FT                   RKVDVRLIAATHRDLGKLSREAKFREDLYYRINVVQLKLPPLRERGKDILALAEAFVKR
FT                   FCLEMDKPALSLTPEAIQAITTYTWPGNIRELENAIQRAVILCENQTEIDHEQLAIDLD
FT                   LVRLDDDPHEFAQASRASNSTKPRNEPTEDLSLEDYFQRFVLEHQDTMSETELARKLGV
FT                   SRKCLWERRQRLGIPRSKPTQK"
FT   gene            complement(589063..592047)
FT                   /gene="cbrA"
FT                   /locus_tag="TERTU_0572"
FT   CDS_pept        complement(589063..592047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbrA"
FT                   /locus_tag="TERTU_0572"
FT                   /product="Two component sensor signal transduction
FT                   Histidine kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF02518; match to protein
FT                   family HMM PF08448; match to protein family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12925"
FT                   /db_xref="GOA:C5BN68"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN68"
FT                   /protein_id="ACR12925.1"
FT                   /translation="MNFSVIQVGLICLTYLSVLFTIAYCTERGLISSRLVHHPVTYIFS
FT                   LGIFASAWAFYGVIDLAGKFGYGALAYYLGTGTLFLLAPAALKPLMELARRFQINSTAD
FT                   LLTFRYHSHGVGGLATLCMLLAMAPLLALQIQAVAETIHIVTRDNGGTVAMPGSNFDSR
FT                   QLLALAYCLVVASFAVTFGSNREHHKGLITSMAFESLVKVFGLCAIGLFSLYQVFGGPD
FT                   GLEQWLVDNPVHLQNLNSPQTGESAHTLLLVFIATAVSMPHIFHMTVVENPVKNVSRTI
FT                   SWAFPLFLLVMALPIFPILWAGLKLGSVFPTEYFPLAVPIAANSKAFTVISFVAGLSAA
FT                   TGAIVAISLSIATMILNHWILPASPLRTHKGIYGQVIWMRRILIAAVVLGGYSFYLLLS
FT                   HRFNLTDLALTAFIATLQFLPGIIAVAHWSPGNRNGLVAGLLVGTGVWLVGLFIPMVMG
FT                   QHALPLTLFNWDIVVGIDSWERVTLWSLGLNTCAFVILSLLTRQSNDENYSAELCAEDE
FT                   MSHPIRMALDIRAPEEIVERLTHRIGETTARAEVNRALEQLGFNVGESRPYALRRLRDE
FT                   VEANLSGLMGISMATEIMDSELPYKIPEVDGVADINLMESRVNEYRDHLTGLAAELNDL
FT                   RLYHRRTLEELPMAICSVGKDMEVLMWNSAMEQMTGITADHVTGSRLPQVLEPWGELLS
FT                   RFANSSAPHFYKQEVELAGKTHWITLHQAAIHSSLAHKASGLVIMLEDVTEMQLLEQEL
FT                   LHSERLASVGRLAAGVAHEIGNPVTGIACIAQNMKYETEDADLLESVDQILSQTDRVSR
FT                   IVHSLVNFSHSGQQQQEDNAQLPIDLRDCAQEAIDLIKLQQKGDITFENTVDSGLTAMG
FT                   DTQRMIQVLVNLLSNARDASPDGGHIVVNGDLRKNWVHLSVTDEGTGISPELRDQIFEP
FT                   FFTTKEPGEGTGLGLAMVYSIVEEHGGLLEIISPVDEVLQKGTKFVIKLPKPLETAATT
FT                   GNTRR"
FT   gene            complement(592079..592261)
FT                   /locus_tag="TERTU_0573"
FT   CDS_pept        complement(592079..592261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0573"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11336"
FT                   /db_xref="GOA:C5BN69"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN69"
FT                   /protein_id="ACR11336.1"
FT                   /translation="MKKQGPLLLLVLVIYIFSPTLLDWVIHPGLAWYRPYIVWFLVVIV
FT                   AFILQFRGTSDKTVL"
FT   gene            complement(592338..593273)
FT                   /locus_tag="TERTU_0574"
FT   CDS_pept        complement(592338..593273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0574"
FT                   /product="glutamyl-Q tRNA(Asp) synthetase"
FT                   /EC_number="6.1.1.-"
FT                   /note="identified by match to protein family HMM PF00749"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACR10870"
FT                   /db_xref="GOA:C5BN70"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR022380"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN70"
FT                   /protein_id="ACR10870.1"
FT                   /translation="MYHDLPNPAKVYRGRFAPSPSGLLHLGSLLCALASFLDARANKGA
FT                   WLIRIEDIDPPREQPGASSAILSTLAAHGMHWDEPPLFQSRCHARYRSRLDELSTAKLS
FT                   YRCACTRARLKSLGTSYDGHCRNSPPAENVPAAIRLDVSRCCSQLAAEDAMLFGELEDF
FT                   VVHRKDGLFAYQLAVVADDIAQDITHVVRGRDLAPMTSAQQLLFNVFGAEPPRYVHTPL
FT                   VVDNLGNKLSKQNRAKAVADTQPVHNLLACCSLLGLIDGEVTETNLAISSLDDILAWAI
FT                   SQWQVNRLPKEDRMAPPEYQGKFPEPPENL"
FT   gene            complement(593315..593755)
FT                   /gene="dksA"
FT                   /locus_tag="TERTU_0575"
FT   CDS_pept        complement(593315..593755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dksA"
FT                   /locus_tag="TERTU_0575"
FT                   /product="RNA polymerase-binding protein DksA"
FT                   /note="identified by similarity to SP:P0ABS1; match to
FT                   protein family HMM PF01258; match to protein family HMM
FT                   TIGR02420"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12271"
FT                   /db_xref="GOA:C5BN71"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR012784"
FT                   /db_xref="InterPro:IPR020458"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN71"
FT                   /protein_id="ACR12271.1"
FT                   /translation="MPESQAKTNFALRDIPAYQEQEGEEYMNDKQKAHFRELLLAWKRE
FT                   LMEEVDRTVSHMKDEAANFPDPADRASQEEEFSLELRTRDRERKLIKKIDSTLELLDTD
FT                   DYGYCDGCGVEIGVRRLEARPTATLCVDCKTIDEIKEKQTSL"
FT   gene            complement(593935..594093)
FT                   /locus_tag="TERTU_0576"
FT   CDS_pept        complement(593935..594093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0576"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11814"
FT                   /db_xref="UniProtKB/TrEMBL:C5BN72"
FT                   /protein_id="ACR11814.1"
FT                   /translation="MAVRKASRVLIKSYKRPMFYWKQKGICHKSGAWHKAQHFNQFTLL
FT                   KRLKLLA"
FT   gene            594075..594776
FT                   /gene="sfsA"
FT                   /locus_tag="TERTU_0577"
FT   CDS_pept        594075..594776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfsA"
FT                   /locus_tag="TERTU_0577"
FT                   /product="sugar fermentation stimulation protein"
FT                   /note="identified by match to protein family HMM PF03749;
FT                   match to protein family HMM TIGR00230"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12239"
FT                   /db_xref="GOA:C5BN73"
FT                   /db_xref="InterPro:IPR005224"
FT                   /db_xref="InterPro:IPR040452"
FT                   /db_xref="InterPro:IPR041465"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BN73"
FT                   /protein_id="ACR12239.1"
FT                   /translation="MLFEPPLISATLVRRYKRFLADVVLASGEEITVHCPNTGSMKNCV
FT                   VPHSPCYLSDSNNPKRKYRYTLELVTTPDGDLAGVNTGRANALVEEAIRAGVVPELAGY
FT                   QIQREQKYGEEGSRIDLLLSRGEERCFVEVKNVTLAEPGGQGLFPDAVSVRGAKHLREL
FT                   MYVRAQGHRAVLFFCVQHTGVNLVSPADDIDAVYGQLLREAAGAGVEIFAVRATLGSCE
FT                   IKLRELLPVVL"
FT   gene            complement(594803..595120)
FT                   /locus_tag="TERTU_0578"
FT   CDS_pept        complement(594803..595120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0578"
FT                   /product="iron-sulfur cluster-binding protein, Rieske
FT                   domain family"
FT                   /note="similar to feredoxin subunit; identified by match to
FT                   protein family HMM PF00355"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11785"
FT                   /db_xref="GOA:C5BNK8"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNK8"
FT                   /protein_id="ACR11785.1"
FT                   /translation="MSIKLFSLSALPEGGAVSFPYKNQPAFAVKRDGEIFAYVNSCPHL
FT                   GIPLEWQENNFLDDDGELIQCATHGALFLIETGECISGPCNGEHLQPININIIAQDVFA
FT                   E"
FT   gene            complement(595166..595453)
FT                   /locus_tag="TERTU_0579"
FT   CDS_pept        complement(595166..595453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0579"
FT                   /product="TfoX domain protein"
FT                   /note="identified by match to protein family HMM PF04994"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13714"
FT                   /db_xref="InterPro:IPR007077"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNK9"
FT                   /protein_id="ACR13714.1"
FT                   /translation="MNTTNGRSPHGELLGLKNLGMASVNILHAIGVNNYEDLSKMGAVE
FT                   AYKRIKSRGIHVSKVMLYALQGALMDVHWNDLSPDLKKQLVEEAESTESA"
FT   gene            595706..596383
FT                   /locus_tag="TERTU_0580"
FT   CDS_pept        595706..596383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0580"
FT                   /product="serine-type D-Ala-D-Ala carboxypeptidase"
FT                   /note="identified by match to protein family HMM PF02557"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13253"
FT                   /db_xref="GOA:C5BNL0"
FT                   /db_xref="InterPro:IPR003709"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNL0"
FT                   /protein_id="ACR13253.1"
FT                   /translation="MNTSLFAQLTGQTDTHIVSNATDCPVHKALVEPWCLLAERAAARG
FT                   IQMRVASGFRSFSRQLMLWNAKANGTRPVLNDRSEAIDVATVDDETLVFAILRWSALPG
FT                   ASRHHWGCDVDVYDAAAVPRDYALRLVPEEYLPGGPFQLLSRWLDESGLMDDGFFRPYA
FT                   EDRGGVAPELWHLSYRPLADEFASAMNQAQLQSLIENTDIALKDAILDNFHSIYSKFVV
FT                   LPC"
FT   gene            596377..597027
FT                   /locus_tag="TERTU_0581"
FT   CDS_pept        596377..597027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0581"
FT                   /product="haloacid dehalogenase-like hydrolase"
FT                   /note="Name was change to haloacid dehylogenase-like
FT                   hydrolase instead of isochorismate synthase; identified by
FT                   match to protein family HMM PF00702; match to protein
FT                   family HMM TIGR01509"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACR10857"
FT                   /db_xref="GOA:C5BNL1"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNL1"
FT                   /protein_id="ACR10857.1"
FT                   /translation="MLVIFDCDGVLVDSEPLAAAVFSAELARLGLSMSADACYREFHGH
FT                   SLAYCFDWIERKFDCRLPDAFAAQLSVATDSTFSQQLQAVPGVKAVVEELERRHISYCV
FT                   ASNGGHKKIANSLAITGLARYFSRDKGNCFSVDDVATGKPAPDLFLYAAESMGVPPAFT
FT                   TVVEDSAAGVRAATSAGMHLFVYDPMENFAAQPDLRKFARMQDLLALLLPRGC"
FT   gene            complement(597121..597381)
FT                   /locus_tag="TERTU_0582"
FT   CDS_pept        complement(597121..597381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0582"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14149"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNL2"
FT                   /protein_id="ACR14149.1"
FT                   /translation="MEPKSDKILAIGQQRIHVTAITTKIHEDIAFLESKIERMKKMRSP
FT                   SRTVLATYESMLASRLSVLKWLENHDMISNQHAAQHSDASG"
FT   gene            597591..598406
FT                   /locus_tag="TERTU_0584"
FT   CDS_pept        597591..598406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0584"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12229"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNL3"
FT                   /protein_id="ACR12229.1"
FT                   /translation="MMVIALYRREPLTQVQGIMTQDKYDLVFKGQLVKGVELAVAKNNI
FT                   ASLFKINAAKVDAMFSGKPLVLKRGLDADAANKYRVAIKKAGALVDIVLVREAKVSGKA
FT                   TFAVPDSDTPVPEKPVGAIPGTIPGTSPSSSSPATGQRNPAPDASAATESAGLSLAPLG
FT                   AEMLPATARQPDPVISVDTSALSLRAVGGDLLDAKERQSSAPEVPVPVTDFGLADVGAP
FT                   VLRAEERKPVRAVDVDISGLAMDLSESNLAPPQPAPPAAPDVSGLQLES"
FT   gene            complement(598403..598951)
FT                   /gene="ppa"
FT                   /locus_tag="TERTU_0583"
FT   CDS_pept        complement(598403..598951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppa"
FT                   /locus_tag="TERTU_0583"
FT                   /product="inorganic diphosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="identified by match to protein family HMM PF00719"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACR10811"
FT                   /db_xref="GOA:C5BNL4"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNL4"
FT                   /protein_id="ACR10811.1"
FT                   /translation="MSLHLVPTGDDAPDIVNVIIEIPMGGEPIKYEVDKESGALFVDRV
FT                   LGTAMHYPCNYGYIPHTLCGDGDPADVMVYMNRPLLPGSVIPCRPLGVLKMTDESGEDA
FT                   KILAVPASSVTKFYDHVHSIEGLSQIKVDRVAHFFEHYKDLEEGKWVKIDGWGDVDAAK
FT                   QEILDAIANYKNQPDAPRF"
FT   gene            599527..602454
FT                   /locus_tag="TERTU_0585"
FT   CDS_pept        599527..602454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0585"
FT                   /product="putative two-component hybrid sensor and
FT                   regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00512; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11309"
FT                   /db_xref="GOA:C5BNL5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR033425"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNL5"
FT                   /protein_id="ACR11309.1"
FT                   /translation="MTNPGVARSPGRTGLAPHVPINFVLGITALCALPLLCDLAGFSFV
FT                   VTNPPVLPSSATSQITPAILAHALLEGVAIIMALLSGALALSHYRISRKIIAPILGLSL
FT                   LCAASMDLFHTLVSLRLVDTQTASNAMISFSWAVARIVSAVVLLVGLTLLMLTGRGHLS
FT                   ARMANLPYVLGLIFFLLGIGLIITLVRWPELPNTLFPERLLKHPLDVVPLLLNLAVGGL
FT                   LLVRLLRRQGDVLAEALLVSLLPMLAAEIYMIFGSSALYDHYDFAAHGLKILSYSVPFV
FT                   GLLLDHHYTYHLDTLKTNQLHQTYRELQERTHELLKSHRSLEESNRFKTEFLASVTHEL
FT                   RTPLNSVIGFSRVLLKSRSNEQSSKEHRAVEAIFRNSTHLLGVINDILDLSKIETGSIT
FT                   LEKSEFLLSDVIQEVFEMLEPLADKKQLTFQLLNYARNLRLVSDMAKLRQVLINLCSNA
FT                   VKYTERGSVVICIERADHEELGEVVKISVRDTGIGIEESEKNKLFVEFSRTEAAINSGA
FT                   EGTGLGLMISAKLVQVLGGAIDFDSEFGVGSEFRVCFPTALSATEQWTAQVEGDVLASG
FT                   IRVVCGEPDPDTARYLEIAFDQEGVQAVSAPTPKALISLAEEHMPDVIFFDTGRGTFDQ
FT                   QLLLAQLAAHNLLKDIPKIAMSDNHDDERNALRNGADLFLAKPFNSEDLVERVRRLVYR
FT                   DISSVVLIGVEDEHQERLAQCFDDMSVHTFFVADHRLAQEKLSQFLPDMVVVNLGNPRV
FT                   ESARLVVALTNDEHHARLPVILYNGLETDVLTRHDSLTRWEVREVEPTCFTLVDAFLGV
FT                   RRRIRQRLMHIEDVNRRLQIEDVPDSGARTIQTPAKLPATNVLVVDAASDSSAIIGWLL
FT                   QDMQLGHDLASGGRDALKRVLEKNYKLIFVALDLPDLRGREVVRRLRATNTYRNTPIVA
FT                   INSDNETVSEKELQEIGFNNVIRKPIDGDRLLDVLSMYIELRVTS"
FT   gene            complement(602460..602597)
FT                   /locus_tag="TERTU_0586"
FT   CDS_pept        complement(602460..602597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0586"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACR10814"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNL6"
FT                   /protein_id="ACR10814.1"
FT                   /translation="MGPYPSRSSAANGLKLYIRYMQVNPMQGALYASARRRAGERFFFH
FT                   "
FT   gene            602857..604290
FT                   /gene="mpl"
FT                   /locus_tag="TERTU_0587"
FT   CDS_pept        602857..604290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mpl"
FT                   /locus_tag="TERTU_0587"
FT                   /product="UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate
FT                   ligase"
FT                   /note="identified by match to protein family HMM PF01225;
FT                   match to protein family HMM PF02875; match to protein
FT                   family HMM PF08245; match to protein family HMM TIGR01081"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14589"
FT                   /db_xref="GOA:C5BNL7"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005757"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNL7"
FT                   /protein_id="ACR14589.1"
FT                   /translation="MSLYYHWNARERRAELMHIHILGICGTFMGSLAQLARAKGYRVTG
FT                   ADHNVYPPMSTQLEQAGIELIDGFGLEQLNLKPDVFVVGNVVSRGNPLMEAILDAGLPY
FT                   VSGPQWLAENLLRGKWVLGVSGTHGKTTTATMLTWILEYAHMAPGYLIGGVPGNFATSA
FT                   RLGESDFFVIEADEYDTAFFDKRSKFVHYQPRTLVINNLEYDHADIFPDLAAIQTQFHH
FT                   LLRTVPNNGLVISPAGDTAVEQVITRGCWTPRQTTALAANADWLIAERDAAGTRFTVAF
FT                   GGQVVGEISWSLTGSHNMRNALSAMAAARHVGVVPELACAALCEFNGVKRRMEVRVDLP
FT                   SVTVYDDFAHHPTAIATTLEGLRAQVGDEPILAVIEPRSNTMRLGVHQASLAAATEPAD
FT                   AVIWFQPPGMNWSLESVVAAEHRVMQGTAEIIEAVRAYLAQAPAKTHVVIMSNGGFEGL
FT                   HQRLCNQLERDAGGESRDA"
FT   gene            604283..604912
FT                   /locus_tag="TERTU_0589"
FT   CDS_pept        604283..604912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0589"
FT                   /product="aromatic acid decarboxylase"
FT                   /EC_number="4.1.1.28"
FT                   /note="identified by match to protein family HMM PF02441;
FT                   match to protein family HMM TIGR00421"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12295"
FT                   /db_xref="GOA:C5BNL8"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNL8"
FT                   /protein_id="ACR12295.1"
FT                   /translation="MPDQYAKTVTLALTGASGAQYGIKLLQSLVAANCRVYLLLSEAAQ
FT                   VVLRVEAGIDVPQALAEQQVFMATLCGATEGQLQVFGAKDWFSPVASGSSSVSSVVVCP
FT                   CSGGTLSAIANGASNNLIERAADVALKERRQLILVPREAPYSEIHLTNMLALTRMGAVI
FT                   IPASPGFYHAPSTIEDLIDFVVARILSQLGLEQSLIPPWGEAPSEQ"
FT   gene            complement(604901..605812)
FT                   /locus_tag="TERTU_0588"
FT   CDS_pept        complement(604901..605812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0588"
FT                   /product="FHA domain protein"
FT                   /note="identified by match to protein family HMM PF00498"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14054"
FT                   /db_xref="GOA:C5BNL9"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNL9"
FT                   /protein_id="ACR14054.1"
FT                   /translation="MVNYVSLPDLAAGIILTRIHHTYFNMLKIRSLNFDRAPFWVTERN
FT                   FTIGRSDTNNLTLEDPSVDNNHARIQREKDAIVLRDLNSATGTYVNGERVNARPISCGD
FT                   SFRLGNLEFEVMDPIAETLADGNEYWSLIGDSSWLAGQEFPLDFSTSSSLLLGRGKQCD
FT                   IVFAGTHLSREHARITRVSGTELILEDLKSANSTFLNDKKVERAPLKAGDQIRLDVYSF
FT                   RLFGRGIRLHKSATRPQQTPLPGDHTDKPRTPAEQKRWKTAPTSPGNREEPAAQTSSWV
FT                   TWFIAFLLVLLLAAVLARVLLL"
FT   gene            605899..608487
FT                   /locus_tag="TERTU_0591"
FT   CDS_pept        605899..608487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0591"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11387"
FT                   /db_xref="GOA:C5BNM0"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNM0"
FT                   /protein_id="ACR11387.1"
FT                   /translation="MFSRFFDFYLRGVTRFPKLTLGVLAIVLIAALTGLPNFKLDASSD
FT                   SLTLEHDKDLDFYREVIKQYQSGDFLVVTYRPEASLFTQASLQTLQALRDELAQIDGVV
FT                   SINSILDVPLLYSPVQPLREMVKNPRTLLTPGMDYDMAKKEFLSSPVYKDLILAPNGQT
FT                   TALQLNLAVDDKAIDLYRTRDALSLKQDKGDISAEEVSELEKVRAELRAHTTEEAQQSR
FT                   ERVAQIRAVVEKYRDHAQIYVGGLTMITADMIRFIQNDLVIFGSAVLLFMIAVLAVIFR
FT                   SIRFVVIPMVTCITAVLLVLGYVSWVDWRLTVISSNFAALLLIISLAIIIHLIVRYREF
FT                   AQEQPEWTQRELVMATAKFMVLPCLYTVLTSIVAFVSLVVSNIRPVIDFGWLMTIGLGL
FT                   AFVLAFTVLPASLVLLRKQNSDSQGQATDATKPKKPATYYFARAVEKHGNVILAVSLVI
FT                   GLASAWGVSRLQVENRFIDYFHKSTEIYKGLSVIDKDLGGTTSLDIVINNGDQDTVSSA
FT                   TYADEADPFAEADAFDEADPFETLQPITEADPFAEADPFSEHGDDASSSYWMTVAGLRK
FT                   VEQVHDYLESLPEVGKVQSLATLYKVGKDINGSLNDFELAIMQKSLPEEVSAALVAPYL
FT                   AAKEDQTRITMRIHDGYPGLQRAELVERMRDHINSMELFEPEKVRFTGLLVLYNNMLQS
FT                   LFSSQIATLGTVLLGIFIMFIVLFRSLKVALVAIVPTILAAVSILGFMGIFGLPLDMMT
FT                   ITVAAITVGIGVDNTIHYVHRFRRELMEKGDYTACMYIAHGSIGRAMFYTSVIIIFGFS
FT                   IMVLSAFIPTIYFGLLTGLAMFMSLLGALLLLPRLLLLFKPFNVPQPALQ"
FT   gene            complement(608440..608853)
FT                   /locus_tag="TERTU_0590"
FT   CDS_pept        complement(608440..608853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0590"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF04892"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11699"
FT                   /db_xref="GOA:C5BNM1"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNM1"
FT                   /protein_id="ACR11699.1"
FT                   /translation="MNHPLNNGAYALFYTSPWQWLRIGQLAAALLIFAYYALKPPGAPG
FT                   NGPFSDEVLHFSGNVLLALSCWVAFFGRWNLRYLVLAAFIYSMAIEIAQGLTPARTPDM
FT                   ADALMNTAGLSAGTAIAFLLQRWLRHVKRLKEQ"
FT   gene            complement(608850..610190)
FT                   /locus_tag="TERTU_0592"
FT   CDS_pept        complement(608850..610190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0592"
FT                   /product="His Kinase A domain protein"
FT                   /note="identified by similarity to SP:P23837; match to
FT                   protein family HMM PF00512; match to protein family HMM
FT                   PF00672; match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACR10824"
FT                   /db_xref="GOA:C5BNM2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNM2"
FT                   /protein_id="ACR10824.1"
FT                   /translation="MSLAARLAVSSLLVLPVILGFSAFALDRAFTDSLRKAELEALRAQ
FT                   LYSLLGAAEPSDQNRVLQLPEVLAEPRFNRPLSGLYGRVLNTESQVLWQSESTPPSPPV
FT                   GKPAPAWQAGTEQFGELEVNGAPYFVLRFDSLWEIAGTDTLFRFEIFHSQDNLRTELAS
FT                   YRHLLWQWLGGLALLFVLAQLLITRWGLEPLRHLAQELKIFQQGGQKQLAGQYPPEIAP
FT                   VITNLNSLLEAEQAQRKRYKNTLADLAHSLKTPLAIIRADLEQRSDHLETIDEQLTRMA
FT                   NIIQHQLQRATLTTTTSLREKTLLAPIFERLTGALSKVYREKGFTIELQVDKALYFPGD
FT                   ESDALEVFGNLLENAFKYGERLVLVEASTRDKALVIDISDDGPGVAADMKQTILARGAR
FT                   ADSSIQGQGIGLAITTDILSSYSGQLDVTDAVHPRAKGARFRVTIPL"
FT   gene            complement(610198..610875)
FT                   /locus_tag="TERTU_0593"
FT   CDS_pept        complement(610198..610875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0593"
FT                   /product="transcriptional regulatory protein PhoP"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14073"
FT                   /db_xref="GOA:C5BNM3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNM3"
FT                   /protein_id="ACR14073.1"
FT                   /translation="MKMLIVEDEAAIRQQLTDYFSSQNFVIDAVADGEEGAWQAVEYDY
FT                   DFAVIDLGLPKLDGMEIIRRLRAAGKKYPVLILTARGHWQDKVEGLEAGADDYLVKPFH
FT                   NEELRARANALIRRAAGSATPQLQFGPIAIDTAQKRVLVSNVAIELTSYEYNTLEYLAL
FT                   HAGKPVSKTELTEHLYHQDFERDSNVIEVFIGRLRKKLDPDNQLKPISTIRGQGYRFTV
FT                   EAS"
FT   gene            complement(610892..611182)
FT                   /locus_tag="TERTU_0594"
FT   CDS_pept        complement(610892..611182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0594"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14668"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNM4"
FT                   /protein_id="ACR14668.1"
FT                   /translation="MILPQTHTADAPMKYLLACLLLALPVTSAIATPVHAAEPLQLAQG
FT                   GGELSKSEAAAIAQRKHGGKVLNVSRSGSVYRVKLLLDSGRVKIVTVPASR"
FT   gene            complement(611211..611756)
FT                   /locus_tag="TERTU_0595"
FT   CDS_pept        complement(611211..611756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0595"
FT                   /product="histidine kinase"
FT                   /note="identified by match to protein family HMM PF05433"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13169"
FT                   /db_xref="GOA:C5BNM5"
FT                   /db_xref="InterPro:IPR008816"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNM5"
FT                   /protein_id="ACR13169.1"
FT                   /translation="MKALSGTILSLSLLIAPLTWAAKPQTIDYAQVTHVTPVYKVVEHR
FT                   QPVQNCWNERVRESAPRRGYQTSADARAVGTLVGGIVGGSIGHAVGRGDDNKRIGTVVG
FT                   AVMGAAIGNEVAHTAHMQQVRYRNVERCEVQQQVQKQRVIDGYDVTYRYHGQQYHTRTR
FT                   NHPGKRIKVALTVRPLEH"
FT   gene            complement(611868..612524)
FT                   /locus_tag="TERTU_0596"
FT   CDS_pept        complement(611868..612524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0596"
FT                   /product="enzymatic protein"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01509; match to protein
FT                   family HMM TIGR01549"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13742"
FT                   /db_xref="GOA:C5BNM6"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNM6"
FT                   /protein_id="ACR13742.1"
FT                   /translation="MSLRGIIFDHDGTLVDSEGVHFSIWQEILASMSVSFTKAEYLLHY
FT                   CGVPTRKNAEDLVALHKLPITAEELYQVKQQRLEQRLNAIPFPSMPGARTALAQCQQAG
FT                   LKVGIATGANRFELDTSIAAHQFGDFVQATTTRDDVARSKPAPDTYLRTLDQLQLSASE
FT                   AVAVEDSATGISAAKAAGMRCIAVAYEFAKGQDLSAADYQVDDLTAAAALAISLR"
FT   gene            612705..613397
FT                   /locus_tag="TERTU_0597"
FT   CDS_pept        612705..613397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0597"
FT                   /product="Conserved hypothetic protein, probable
FT                   Zn-dependent protease"
FT                   /note="identified by match to protein family HMM PF05618"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12325"
FT                   /db_xref="GOA:C5BNM7"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNM7"
FT                   /protein_id="ACR12325.1"
FT                   /translation="MLQACTFTNSRESDSSPTQALLEAQSATLENQAQTLAMLSDNQQA
FT                   LLTELRVTQAQIRELQTGSTPVASEPETVGEVKPVAELLAQTEPGRKIRTNSNAKLLLG
FT                   RVEWVWLDILSAHLKARIDTGVANASLVVATVQQFERNGESWVRFTLHDQAEPVEAPLK
FT                   KNARRNRVALMVRMGSLAEYVEFALEQESEAPTYTVTLGRDFLQDIALVDVSRKFTQPK
FT                   VELTLDQN"
FT   gene            613434..614945
FT                   /locus_tag="TERTU_0598"
FT   CDS_pept        613434..614945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0598"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13161"
FT                   /db_xref="GOA:C5BNM8"
FT                   /db_xref="InterPro:IPR025838"
FT                   /db_xref="InterPro:IPR025840"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNM8"
FT                   /protein_id="ACR13161.1"
FT                   /translation="MRQSRAPFYALIALLFVAGLSMTWLRHKTHDVPWLPGEKRQVWSV
FT                   EARVEFEAQGEPVKVSLAVPQTQTRFERLAEYTASPGYGLAFVENGRERRAEWSIRNAD
FT                   GPQTLYYRLDLLVDPSLAVADTAPPLEAPSNLFDDSPHATSALHLLDNAVERSADNFTL
FT                   ARELILEFNLQKQSAGFLEQRQARSRWLKQLLNYAQVPAREVKVLTLEDGRRRQRLQTY
FT                   LQVFQGDHYQLFDPRSGRVGLSPNQVMWEYRSGSVLELIGGSQSDVSFSIINQEIPVSQ
FT                   GLEKEGDHFSLLEFSIHSLPVEEQALFKGILLVPVGVLVVVLMRVLVGLRTSGTFMPVL
FT                   IALSFIQTSLLTGLAGFLLIVGVGLVIRSYLSHLSLLLVARISAVIISVIAMVAVFTVI
FT                   AYELGLNEGMKITLFPMIILSWTIERMSILWEEEGPHEVFVQGGGSLLVALIAYLLMTN
FT                   DIVRHLTFNFIGLQLVFMALVLLLGGYTGYRLLELRRFSVLGKGD"
FT   gene            614947..615894
FT                   /locus_tag="TERTU_0599"
FT   CDS_pept        614947..615894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0599"
FT                   /product="alpha-L-glutamate ligase family protein"
FT                   /note="identified by match to protein family HMM TIGR02291"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11209"
FT                   /db_xref="GOA:C5BNM9"
FT                   /db_xref="InterPro:IPR011758"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR039523"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNM9"
FT                   /protein_id="ACR11209.1"
FT                   /translation="MLNLLRELKDLRKKGVLGMNRRNISYIGRYNERRLYPLVDNKLTS
FT                   KRLAIEAGVSVPALLGVVASQHGIATTELALREQSGFCLKPAKGSGGKGIMVIRRGAEG
FT                   GYLRSNGQVISSEELRRHMSNILAGLFSLGGAPDQVLVEALLECDPSLTGYSHEGVPDL
FT                   RLIVFQGVPVMAMMRLACAASHGKANLHQGAVGVGISIADGRAVLAVQKDAPIKRHPDT
FT                   GMDLRALQVPRWQEMLELGCNCADMTGLGYLGVDLVLDKHLGPALLELNARPGLSIQIA
FT                   NGAGLLPRLREVEALRNPARLSVAERIAFAQDHF"
FT   gene            615982..617238
FT                   /gene="proA"
FT                   /locus_tag="TERTU_0600"
FT   CDS_pept        615982..617238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proA"
FT                   /locus_tag="TERTU_0600"
FT                   /product="glutamate-5-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.41"
FT                   /note="identified by match to protein family HMM PF00171;
FT                   match to protein family HMM TIGR00407"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11946"
FT                   /db_xref="GOA:C5BNN0"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BNN0"
FT                   /protein_id="ACR11946.1"
FT                   /translation="MTVKDYMQQLGRQARAASRDMLAASTDDKNRALVAIADAITANRE
FT                   LIIQENARDLENGRANGLEPAMLDRLELTPARFDGMIEGLRQVAALPDPCGEISDLKYR
FT                   PSGIQVGKMRVPLGVVGIIYESRPNVTIDAASLCLKSGNATILRGGSEAIHSNQAIAKC
FT                   IAAGLESVGLPASAVQVVETTDRAAVGELITMAEYVDVIVPRGGRSLIERISNDAKVSV
FT                   IKHLDGICHVFIDDDADLDKAFNIALNSKTHRYGVCNAMETLLVASSVAEKILPRLATA
FT                   YAEKSVELRGCDRTLAILPNINAAKPEDWDTEYLAPILAIRVVDDMTAAMDHIAAHSSA
FT                   HTESIVTENYTKARKFMALVDSASVMVNASTRFADGFQYGLGAEIGISTDKIHARGPVG
FT                   LEGLTSQKWIVFGDGEILN"
FT   gene            617403..617759
FT                   /locus_tag="TERTU_0601"
FT   CDS_pept        617403..617759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0601"
FT                   /product="polyA polymerase, iojap protein"
FT                   /note="identified by match to protein family HMM PF02410;
FT                   match to protein family HMM TIGR00090"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11887"
FT                   /db_xref="GOA:C5BNN1"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNN1"
FT                   /protein_id="ACR11887.1"
FT                   /translation="MQTELNKVVINALEDLKGKDIVELDVRELSDVTDALVIVTGTSNR
FT                   HVKSLANNVVEDGKEHDFRPIGVEGMESGEWVLVDYGDLVVHVMLETTRAFYELEKLWS
FT                   TEPAGRKNNPTESP"
FT   gene            617779..618255
FT                   /locus_tag="TERTU_0602"
FT   CDS_pept        617779..618255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0602"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02590;
FT                   match to protein family HMM TIGR00246"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12487"
FT                   /db_xref="GOA:C5BNN2"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BNN2"
FT                   /protein_id="ACR12487.1"
FT                   /translation="MKISILAVGGKMPAWVQEGYAEYAKRLPREIEPRMVELALANRSK
FT                   SYSVDAVKQAEGEQILGAYDNAPGHKRLICLDVLGKSLRTEMLAEKMAAWQMDGVNPCL
FT                   VIGGPDGLSQSCLQRADEKWSLSGLTMPHPLVRVLLIEQLYRAWTILQNHPYHK"
FT   gene            618314..620185
FT                   /gene="mrdA"
FT                   /locus_tag="TERTU_0603"
FT   CDS_pept        618314..620185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrdA"
FT                   /locus_tag="TERTU_0603"
FT                   /product="penicillin-binding protein 2"
FT                   /note="identified by match to protein family HMM PF00905;
FT                   match to protein family HMM PF03717; match to protein
FT                   family HMM TIGR03423"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ACR10805"
FT                   /db_xref="GOA:C5BNN3"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNN3"
FT                   /protein_id="ACR10805.1"
FT                   /translation="MMWAGEQLHQFKDHHREARVFAVRAAISFLMVVALFGVLLARYYR
FT                   LQVTDHEVYATRSDRNRIHVRPIPPNRGLIYDAQGQLLADNRPTFTLSVVSERTSNLEQ
FT                   TLDHLANLIEVSERDRENFLKRLRQRRRPFEAVPLRYRLTEEEISRIAVNEFELEGVEI
FT                   EAQLTRAYPKGALFAHTVGYVGRINERELSSFDQATYERYSGTHSIGKIGLERYYESEL
FT                   LGQVGSENIETNAHGRVLRTLEFTDPQPGKDLYLFLDSRLQQVAVDQLAGRRGSVVAID
FT                   VKTGGVLAMVSAPAYDPNLFVNGISYKDYRALNESRDLPLFNRSIQGQYPPGSTIKPML
FT                   GLGGLEAGVVDFDTHIFDPGYYQLENDERLYRDWKKGGHGRRVDLRQAIVESCDTFFYD
FT                   MAFRMGVDSMHPFGDKFGLGERTRLDIPSERPGLWPSREWKERVRGLHWFPGDSLNISI
FT                   GQGDVLTTPLQLAVMTATIASRGTHLRPRLVKQLGDQPTEREVVDQIEVQPQYWDYVHS
FT                   AMEGVVHSARGTAHRISRGIGYKMAGKSGTAQVVGIAQDEEYDADKLDERQWDHALFIG
FT                   FAPVEDPQIAVAIIVENGEHGSSAAGPIAREVFDTYFAMQAEDNAKP"
FT   gene            620182..621330
FT                   /gene="mrdB"
FT                   /locus_tag="TERTU_0604"
FT   CDS_pept        620182..621330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrdB"
FT                   /locus_tag="TERTU_0604"
FT                   /product="rod shape-determining protein RodA"
FT                   /note="identified by match to protein family HMM PF01098;
FT                   match to protein family HMM TIGR02210"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11547"
FT                   /db_xref="GOA:C5BNN4"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNN4"
FT                   /protein_id="ACR11547.1"
FT                   /translation="MKLSQDFVRRLPDSRHHFGRQQGLWQRLHIDPILLLILLALTCFG
FT                   LVVLYSASGQSESMVKRQFVFFSIAYCVMFVVAQLDMQMVRRWSPWLYVGGIILLMLVI
FT                   LVGVGAKGAQRWISLGVVRFQPSEAMKIAVPVMTAAYFSTRSLPPKFTDIVVSMIIIML
FT                   PAVLIFMQPDLGTAILIAASGIIVVFMAGLPWRYIFGSLAMVGISIWPMWHWVMKDYQK
FT                   QRVLTLLDPEADRLGAGWNIIQSKTAIGSGGLHGKGLFNGTQSQLDFLPESHTDFIIAV
FT                   MAEELGLIGVIFLLSLYLLLIARGLHIAWTSQNTFNRLLAGSITLTFFVYVFVNIGMVA
FT                   GMLPVVGVPLPLVSLGGTSIVTLMTSFGLLMAIATEKKKVVA"
FT   gene            621333..622322
FT                   /gene="mltB"
FT                   /locus_tag="TERTU_0605"
FT   CDS_pept        621333..622322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mltB"
FT                   /locus_tag="TERTU_0605"
FT                   /product="lytic murein transglycosylase B"
FT                   /EC_number="2.4.-.-"
FT                   /note="identified by similarity to SP:P41052; match to
FT                   protein family HMM TIGR02282"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13761"
FT                   /db_xref="GOA:C5BNN5"
FT                   /db_xref="InterPro:IPR011757"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031304"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNN5"
FT                   /protein_id="ACR13761.1"
FT                   /translation="MLKKFCSVVVFLMGSTPVLADYSTHPGAQAFVKTLVQEHQFEESY
FT                   VLDMLRQAEKKQSILDAIARPAEKTKPWKDYRKIFLGEPRIQQGIEFWNNNKATLARAA
FT                   EEFGVDEQMIVAILGIETRYGKHTGGYRVLDALATLGFDYTPRGKFFLKELENAFLLAR
FT                   EQKVALPELTGSYAGAMGYGQFIPSSYRAYAVDFDGDGKADIWNNPVDAIGSIANYFRR
FT                   HGWQRGEIVVTRAHIAGNYDKSVLNEKIRPHFTLSELAERGYTPVNAKLKGADKAVPLS
FT                   YDGEYGKEIWLGFNNFYAITRYNRSQLYAMAAYQLSEELRYGFEKQVR"
FT   gene            622404..623273
FT                   /gene="rlpA"
FT                   /locus_tag="TERTU_0606"
FT   CDS_pept        622404..623273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rlpA"
FT                   /locus_tag="TERTU_0606"
FT                   /product="rare lipoprotein A"
FT                   /note="identified by match to protein family HMM PF03330;
FT                   match to protein family HMM PF05036; match to protein
FT                   family HMM TIGR00413"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14200"
FT                   /db_xref="GOA:C5BNN6"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNN6"
FT                   /protein_id="ACR14200.1"
FT                   /translation="MTYSLRAAVVVVISILVFVAGCEAPSRYQQKHDSGPSQPLRVDHI
FT                   PDAVPQVELRTAAGNKSPYTVNGKTYWVATNPTGYREEGMASWYGLKFHGHKTSNGEIY
FT                   DMYGMTAAHKTLPIPSYVRVTNKDNGRVVIVRVNDRGPFHDGRVIDLTYAAAKKLDIVD
FT                   SGTGRVVVEYIDPLTYQPLQNTPAPVLVSGDQQPAAPAPANSNGYQLPENTFLQVGAFS
FT                   QISGAQALQTTIRKLTPYPVTILEPQATAKPALYRVRIGPLRDNFDLQALRAKIAAEGL
FT                   PEPHVVYP"
FT   gene            623395..625137
FT                   /locus_tag="TERTU_0607"
FT   CDS_pept        623395..625137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0607"
FT                   /product="glycoside hydrolase family 9 domain protein"
FT                   /note="identified by match to protein family HMM PF00759;
FT                   match to protein family HMM PF02927"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11786"
FT                   /db_xref="GOA:C5BNN7"
FT                   /db_xref="InterPro:IPR001701"
FT                   /db_xref="InterPro:IPR004197"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR033126"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNN7"
FT                   /protein_id="ACR11786.1"
FT                   /translation="MRHFLASLSFAAISSALVACSSGGGSKSEISDPASASEQAAELGL
FT                   IKVNQVGYLPDGQKFAVVPASAVRQFFLIDGNGEEVYKGKLEKTAGWEPAQERVALADF
FT                   SDYEQPGRYRVKVEGFPLSPAFVIAEDVYSDAHDAAIKAYYFNRASTALPDAFAGAWAR
FT                   PEGHPDDRVKVHWSAASGMRPEGTVLASPKGWYDAGDYNKYIVNSGISTYTLLAAYEHF
FT                   SRFYDDRTWNIPESGDKLPDLLNEILWNLDWMETMQDPADGGVYHKLTTLNFSGDVMPA
FT                   EAIEQRYMVAKGTAATLDFAAVMATASRVFVKWDAAQAIRYREAAVAAWRWAEANPQVV
FT                   FSNPKDVHTGEYGDSDFADERAWAAAELFITTGDQVYYRAFKAVGAGAGVPSWGYVAPL
FT                   AHVSLAFHSKDSLSSKEYEASVDALVSTANGLVDRYRDSAYRVSMTTQDFVWGSNSGAA
FT                   NQAFILLQAYRLTGEDKYRAAALGIVDYLLGKNPMDYSYVTAVGSKPPEHIHHRPSEAD
FT                   SVKAPVPGFLVGGPNAGQQDNCDYRSLAPAKSYVDSWCSYASNEIAINWNAPLVYVLAG
FT                   LMAD"
FT   gene            625280..626452
FT                   /locus_tag="TERTU_0608"
FT   CDS_pept        625280..626452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0608"
FT                   /product="penicillin-binding protein 6"
FT                   /EC_number="3.4.16.4"
FT                   /note="identified by match to protein family HMM PF00144;
FT                   match to protein family HMM PF00768; match to protein
FT                   family HMM PF07943"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12260"
FT                   /db_xref="GOA:C5BNN8"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNN8"
FT                   /protein_id="ACR12260.1"
FT                   /translation="MRFSVARAALVLAHLFILVTPMAANASQVIIPAPPQLAATAYLLI
FT                   DADTGKVIVEHNADEQLPPASLTKMMTSYIVSEEIYAGRLQETDLVRVSDDAWRRGGAK
FT                   SGSSTMFLEARSEVPVIDMLRGVIIQSGNDASIALAQHIAGSEEAFAEIMNQQAQLLGM
FT                   TNSHFRNATGWPAEGHLTTARDLAILAKALINDHPKHYALYSEKHFKHNGISQPNRNKL
FT                   LFTDNTVDGIKTGHTEAAGYCLVASAKRDGMRLISVVMGAKSENARAAESKKLLAYGFR
FT                   YYQTHKLYSAGDELGSARVWGGDPKELVLTIDHDILATIPRGGAKNVKAAIETNANIEA
FT                   PIAKHQPLGKLKISLDDEVIVETDLVAATDIAEAGLVDRAWDAILRLFEE"
FT   gene            626456..626728
FT                   /locus_tag="TERTU_0609"
FT   CDS_pept        626456..626728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0609"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF04359"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11188"
FT                   /db_xref="InterPro:IPR007454"
FT                   /db_xref="InterPro:IPR027471"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNN9"
FT                   /protein_id="ACR11188.1"
FT                   /translation="MSEQQPPKIEFPCPDYVIKCMGTATAGYREAVLNVMERHAPGFDT
FT                   NKVSVRPSRNGTFESVSVFITATGIEQLQAIHEDLKKLPETKMVL"
FT   gene            626729..627343
FT                   /gene="lipB"
FT                   /locus_tag="TERTU_0610"
FT   CDS_pept        626729..627343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipB"
FT                   /locus_tag="TERTU_0610"
FT                   /product="lipoyl-protein ligase"
FT                   /EC_number="2.3.1.181"
FT                   /note="identified by match to protein family HMM PF03099;
FT                   match to protein family HMM TIGR00214"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11248"
FT                   /db_xref="GOA:C5BNP0"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNP0"
FT                   /protein_id="ACR11248.1"
FT                   /translation="MSAVVVKNLGQLEYETCWQAMRDFTDTRTAATDDELWLVEHPPVY
FT                   TQGQAGKPEHLLLPATDIPVVQTDRGGQITYHGPGQLVAYPLLNLKRRKLGVRDLVTLI
FT                   ENSVVRLLGDYGIIGEPRPDAPGVYVDGKKISSLGLRVRKGCSYHGVAINVNMDLQPFA
FT                   NINPCGYAGLAMVQLTDYTAEPPSVAEVADRYSARLLELLK"
FT   gene            627351..628331
FT                   /gene="lipA"
FT                   /locus_tag="TERTU_0611"
FT   CDS_pept        627351..628331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipA"
FT                   /locus_tag="TERTU_0611"
FT                   /product="lipoic acid synthase"
FT                   /EC_number="2.8.1.-"
FT                   /note="identified by similarity to SP:P60716; match to
FT                   protein family HMM PF04055; match to protein family HMM
FT                   TIGR00510"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14713"
FT                   /db_xref="GOA:C5BNP1"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031691"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNP1"
FT                   /protein_id="ACR14713.1"
FT                   /translation="MSEQDLSPVKRTRRIQQGEKLRDADKVERIPVKVITSDSMLRKPD
FT                   WIRIKVSSSPEVDRIKKLLRKNALSTVCEEANCPNLGECFSGGTATFMIMGDICTRRCP
FT                   FCDVGHGKPNPLDANEPRNLAEAIADMSLKYVVITSVDRDDLRDGGAQHFADCIRESRA
FT                   LSPELQVEILTPDFRGRMDIALDILAQEPPDVFNHNLETVPRLYRQSRPGANYKWSLEL
FT                   LQRYKARKPEVLTKSGLMVGLGETKEEIIEVLKDMRAHDIDMLTIGQYLQPSRDHLPVA
FT                   RYVEPAEFDEYSAIAKELGFVHAACGPLVRSSYHADKQAHGEVVK"
FT   gene            628349..628882
FT                   /locus_tag="TERTU_0612"
FT   CDS_pept        628349..628882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0612"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by similarity to SP:Q7PCJ8; match to
FT                   protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ACR10937"
FT                   /db_xref="GOA:C5BNP2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNP2"
FT                   /protein_id="ACR10937.1"
FT                   /translation="MNGTIEISHLREFPQWVKTVAAWHHQEWLRSFRAGGERASREEVG
FT                   ADIREREHNLRAHFDTDPIPATFIAHLPSVAEEARVPVGSVSLVFYQFTKSRKPSEWVT
FT                   NLFVEPEHRCRGVGQQLLNYIETYAEGHGLAQLRLYTRDKAAYYQKRDWTFTHNGLVQG
FT                   NAVSVLEKRVGAER"
FT   gene            628955..630274
FT                   /gene="rimO"
FT                   /locus_tag="TERTU_0613"
FT   CDS_pept        628955..630274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimO"
FT                   /locus_tag="TERTU_0613"
FT                   /product="ribosomal protein S12 methylthiotransferase"
FT                   /note="identified by match to protein family HMM PF00919;
FT                   match to protein family HMM PF04055; match to protein
FT                   family HMM TIGR00089; match to protein family HMM
FT                   TIGR01125"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14011"
FT                   /db_xref="GOA:C5BNP3"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR005840"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="InterPro:IPR041582"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNP3"
FT                   /protein_id="ACR14011.1"
FT                   /translation="MTQKVGFISLGCPKALVDSERILTQLKLDGYSVVPSYDDADLVVV
FT                   NTCGFIDSAKQESLDAISEAMSENGKVIVTGCMGKGKDAEIIRESFPNVLSVTGPAAYE
FT                   EVMGAVHEYIPPVRDHNPHVDLVPPQGVKLTPRHYAYLKISEGCNHRCSFCIIPDMRGD
FT                   LVSRPIGDVLNEAERLVNAGTRELLVISQDTSAYGVDLKYRTGFWQGRPVKTRMQELCE
FT                   ALGEMGVWVRLHYVYPYPHVDNVIPLMAEGKILPYLDIPFQHASPTVLKAMQRPAHQEK
FT                   TLDRIHAWRKMCPDLTLRSTFIVGFPGETDADFELLLDWLEDAQLDRVGCFQYSPVEGA
FT                   AANALPNPVPEEVKQERWERFMAAQQRISAARLQAKIGKTIDVLIDRSEGVNALGRSFA
FT                   DAPEIDGVVIVEDSAHLPAGSLIKARVTAADEYDIWAEPL"
FT   gene            630495..632321
FT                   /locus_tag="TERTU_0614"
FT   CDS_pept        630495..632321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0614"
FT                   /product="GGDEF/EAL domain protein"
FT                   /note="identified by match to protein family HMM PF00563;
FT                   match to protein family HMM PF00990; match to protein
FT                   family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14473"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNP4"
FT                   /protein_id="ACR14473.1"
FT                   /translation="MEKSVTSVSCQVAVTTAEIRTYFGLLLEHIPVLASVVTPTGDVLF
FT                   ASRHHALLFDVSNNINELTEESELYPASARARLQQLQSTSAMECEWELTAKHKDGSTHL
FT                   YKMRRTRIACHRLLPGYAGEPEIQASSDDVIYTVGVDITEDELAESVLRDHKSHLNFAI
FT                   FHDPLTGLANRSLFYDRVNKSIARAKRTKSSLALMLLDLDRFKNVNDSLGHEAGDRYLK
FT                   AVAQHLVDELRDTDTVARLGGDEFVVVLENVTCSESIEAIANKLLGCLQQPVVIQGHPI
FT                   SCTASIGISVFPHDGDSIDQLLKHADTAMYRAKAAGKNRAQFYVSAMSDSAVNYLLLEN
FT                   DLRRALEQNELRVFYQPQVDLNTGRITGLEALVRWQHKDRGLMSPVHFIPLAEETGLIE
FT                   PLGAWVLEQACARFQHWLAAGIDLCKVAVNLSTRQFRQEGFEHTVAQVLRKTGLPAQCL
FT                   ELEITESSAMENAANTINMLNCLSDMGLSLAIDDFGTGYSSLAYLQRFPIQKLKIDRSF
FT                   ITNVDRDDQEAAIAKSIIDLAHNMSLEVIAEGVERASQCQWLGERGCDQVQGYFYSKPL
FT                   SEEALMNLVSDSERVICDASGVRLLSQPLAKH"
FT   gene            632495..632992
FT                   /locus_tag="TERTU_0615"
FT   CDS_pept        632495..632992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0615"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12873"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNP5"
FT                   /protein_id="ACR12873.1"
FT                   /translation="MFRLRLYLCLLSLVSQLMLTGCGGGSDGGNSKNPGTGGGNGGTPP
FT                   SNNARFEFTCDLGGIDATLVMNVEAVSDSGVVFGAGPNPEISGVVSTGSVTYYTSGTVT
FT                   SPAAAYIFTGENNFADFTDLSNSSRFRVQWMADGENLIMLVNPFGPGPSNHNCTLDSAG
FT                   YV"
FT   gene            complement(633010..633213)
FT                   /locus_tag="TERTU_0616"
FT   CDS_pept        complement(633010..633213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0616"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13281"
FT                   /db_xref="InterPro:IPR013619"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNP6"
FT                   /protein_id="ACR13281.1"
FT                   /translation="MKRAEYKIISGPSGLPQLEDRITEFLNKGWKPVGGIAFNAGYPYQ
FT                   AIARVVTVDEDDNLTRNPEPAL"
FT   gene            complement(633436..634722)
FT                   /locus_tag="TERTU_0617"
FT   CDS_pept        complement(633436..634722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0617"
FT                   /product="HD-GYP domain containing protein"
FT                   /note="identified by similarity to GB:ABD79884.1"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12637"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR021812"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNP7"
FT                   /protein_id="ACR12637.1"
FT                   /translation="MLSLEQKEVHVSQLKHGMFVSRLDVPWERTHFPLQGILIRSESDI
FT                   EQIAAYCNFVIVDETRSCKPARIDSPMGKAQNRATSCNTKPAWQRRHCVEKYPVRATVR
FT                   EEVHLSHSLLSTMERQIYLICEHTLRCKRANIEQLVDSSSEVVESVIRNPDALAWLCRV
FT                   RASRRPIYMHTIRLAVWGTIVGRQLGLNRFSLNHMCTALLMTGIGKSSVSDKALAGYSP
FT                   TKPSLEYRQHLQETLYQLEQLRFYSDDITDTIAHYCERIDGSGYPNQVTGSEIPFLAQI
FT                   CGLVETYELLINPYHCTRAISPANAVVYLNKAKNQQFDASLVEEFIKAIGIYPTGTVVE
FT                   LSSGELGVIVSQDSKKRLRASVIPVLSAQGDILKNYRLLDLSYASGRDEDQTMAIRRGV
FT                   PSSVVPRGILEETHSWLFDRRSDRTRACR"
FT   gene            complement(635221..636093)
FT                   /locus_tag="TERTU_0619"
FT   CDS_pept        complement(635221..636093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0619"
FT                   /product="hydrolase, carbon-nitrogen family"
FT                   /note="identified by similarity to SP:P55175; match to
FT                   protein family HMM PF00795"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14055"
FT                   /db_xref="GOA:C5BNP8"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNP8"
FT                   /protein_id="ACR14055.1"
FT                   /translation="MSHLVRIAAAQYPIDEPSTLQAYLDKISQWVAEAAARADLLVFPE
FT                   YAGAEAMAVFGRDINKNLLQATFELQTLVPAIDAHMADLARRYGVYILAPSLPVAAADG
FT                   SLRNVATMYGPQGFVGAQRKRVLTPFDKQEWQLTAGEAYTLFITPFGLIGVAICYDVEF
FT                   PLQVRALCEAGATLILCPSCTDSVAGYWRVRLGAMARALENQCVVVQSPTVGTAEWTTA
FT                   LDVNCGAAGIFAPPDSTLSNDGVLALGEMDKPQWLYSTVNLEDILRLRQHGDVRGFSDW
FT                   HLQLKSGGG"
FT   gene            complement(636094..636693)
FT                   /locus_tag="TERTU_0620"
FT   CDS_pept        complement(636094..636693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0620"
FT                   /product="acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14650"
FT                   /db_xref="GOA:C5BNP9"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNP9"
FT                   /protein_id="ACR14650.1"
FT                   /translation="MADTHFRIERVYGPALRHLVEDLARLRLTVFSEYPYLYAGNQNYE
FT                   SSYLKTFCTAQDAIIVTARDQRGELVGCSTASSLNGHHTDFSQPLVRAGYDLTQMNYFG
FT                   ESVLLEHSRGNGIGHSFFDQREQHARNKGYKLACFCAIERPADHPKKPASYRDHTVFWH
FT                   KRGYRKLNDISTSFAWPETRDGPEISHPMAYWLRKL"
FT   gene            complement(636763..639456)
FT                   /locus_tag="TERTU_0621"
FT   CDS_pept        complement(636763..639456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0621"
FT                   /product="long-chain-fatty-acid--CoA ligase"
FT                   /note="identified by match to protein family HMM PF00583;
FT                   match to protein family HMM PF02629"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14376"
FT                   /db_xref="GOA:C5BNQ0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNQ0"
FT                   /protein_id="ACR14376.1"
FT                   /translation="MSDFIEHYLSDLFAPQSIAVFGASQRPNATGSVVFRNLIAAGFCN
FT                   QLYAINPKYTSVDNHTCYRSLDDIDDHIELAIITTPAHTVKDILKQCGKHKVKAAVIFA
FT                   GGFAQPDEPGKVSEQALVEIARKYGIRFIGPNSLGIAHPSTNINATFGPGEVASGNLAL
FT                   VSQSGAVCTAVMDWAAVQDIGFSSVVSIGACADLDFGDILDFLVSDGKTRSILLYVEGI
FT                   RDARSFMCGLRAVARVKPVIVIKAGRHKAAIEVTQSHNSARVGDDDVFAAALKRAGVVR
FT                   GMHLGDLLAAANILARGTRLRGDKLAIITNGGGPAAMACDRASDLHIPLAPLGEEAHKK
FT                   LDKLLPHYWSHSNPVDILGDADADRYAAALEIMLADTECHGVMVMLTPQATTDPVAIAQ
FT                   RLIDIIKKTSKPVIACWMGENRVLPARRLFASAGIPIFRLPETAVQAFAYLATFFRNQK
FT                   LLLQTPPPLSQTITATIEDAHTVIDTALRSEQFQLSETESKTILAAFGIPIAPTILVHS
FT                   AQEAMEAATEIGLPVAMKIHGSNLSNKSSHGGVQLNIRTLPAVKNTYAGLRRILENLPF
FT                   AVENPGIVIEPMILSPAASELRLAIEQDPVFGPFISLGPGGVAAKRTRVVSLPPLNRLL
FT                   AANLIQESELGDMLSKEGQQPVIALAALENCLMSISDIACELPEVLELEINPLLADSNG
FT                   VTAVDARIRLRPKPPGLPYSHTAIHPYPSHAVQKVTVAGCVPCTIRPVRPEDAELERAF
FT                   IEGLSENSKHFRFMNTFRKLPPEMLAKMTQIDYDREMAFVAVINNNEEEEEIGSARYAI
FT                   NIDGQSCEFAVSVADNWQGKGIATKLMQALIDYAGHRGLTRMQGEILADNVPMQELAKK
FT                   LGFSLQLSREDKTIVIGNRPLRPPAK"
FT   gene            complement(639601..640104)
FT                   /locus_tag="TERTU_0622"
FT   CDS_pept        complement(639601..640104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0622"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12909"
FT                   /db_xref="GOA:C5BNQ1"
FT                   /db_xref="InterPro:IPR007404"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNQ1"
FT                   /protein_id="ACR12909.1"
FT                   /translation="MPFTPFHLGPGLLFKSLLQGSFSLVIFAWAQIVMDIQPLLVLLTG
FT                   KGHLHGFTHTLLGATLLAIFSAVSGKYAIDNLLNRWPNHIKVGLLVSWPTATISALIGC
FT                   YSHVVLDAIMHGDLLPFAPFTTDNPLLHMLNVNDLHWLCVAAGAVGAILYFLVLAWHRQ
FT                   ARSR"
FT   gene            complement(640174..641262)
FT                   /gene="ada_2"
FT                   /locus_tag="TERTU_0623"
FT   CDS_pept        complement(640174..641262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ada_2"
FT                   /locus_tag="TERTU_0623"
FT                   /product="ada protein-regulator of adaptive response and
FT                   methylated-DNA-[protein]-cysteine S-methyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /note="identified by match to protein family HMM PF01035;
FT                   match to protein family HMM PF02805; match to protein
FT                   family HMM PF02870; match to protein family HMM TIGR00589"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12574"
FT                   /db_xref="GOA:C5BNQ2"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR004026"
FT                   /db_xref="InterPro:IPR008332"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR016221"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="InterPro:IPR035451"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNQ2"
FT                   /protein_id="ACR12574.1"
FT                   /translation="MSSAEREQLTAMPIRDAATIDRYYRALVARDPDFLGSFYVGVKTT
FT                   SIFCIATCRARKPKQENVVFYTDLDEVLRDRFRPCKVCRPTENAHQAPPDVATAMRWVL
FT                   AQPKQKVSDTQLRARGLSPEKIRRWFKAHYGMTYQQFQRMYRINMAVEELKLGQSVTAS
FT                   AMDSGYESLSGFGYTYKKLIGHSPASRVNASPILLHRITTPIGPMFVAASSRGICLLEF
FT                   VDRRMLETEFKDLQRLCKAPIIAGTNAHIHQAEQEIAQYFVGERTQFSVPLDTPGTEFQ
FT                   QKVWRGLIDIPYGSTASYQQQACRIAVPSAVRAVARANGHNRVAIIIPCHRVIGADGKL
FT                   VGYGGGLERKRWLLEHENKFCS"
FT   gene            complement(641235..641414)
FT                   /locus_tag="TERTU_0624"
FT   CDS_pept        complement(641235..641414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0624"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11088"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNQ3"
FT                   /protein_id="ACR11088.1"
FT                   /translation="MEAIHKGNNTFPKTLRAHLPPTPKLPVEFSVVAKPASRNTCHSPA
FT                   PHVDAKCHPPKENS"
FT   gene            642058..643521
FT                   /locus_tag="TERTU_0626"
FT   CDS_pept        642058..643521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0626"
FT                   /product="sodium-dependent anion transporter"
FT                   /note="identified by match to protein family HMM PF00939;
FT                   match to protein family HMM PF03600; match to protein
FT                   family HMM TIGR00785"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11531"
FT                   /db_xref="GOA:C5BNQ4"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="InterPro:IPR031312"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNQ4"
FT                   /protein_id="ACR11531.1"
FT                   /translation="MSEVIQSHSDSTNNSAYPLLSLLIGPVCMLIFAWVPPPEGLNDAA
FT                   WATIGLVLWMGIWWITEAVPIPVTSFLPLIVAPLLGIASMKETAAPYAHPLIFLFMGGF
FT                   VLSLAMERWELHKRVALNTLLMIGAKPSAQIGGMMAVTGFLSMWMSNTATAVMMLPIGL
FT                   SVIDMLRSGKLESAGFANALLLGIAYSASIGGLATLIGTPPNALMAAYLNDNFEINIGF
FT                   AEWMYVGVPLSAGLLLFTWYTLTHVTYKVDRVTLDNPKHLFREQLRALGPMKRPEKLVL
FT                   MVFAVTAFAWMFRPLLADLLHLKLNDTVIAMAAACALFIIPVDKQSTRILTWNDTAKMP
FT                   WGVLMLFGGGLSLAVLIKSSGLALAIAEQVELLQGMPTWIMIGAVVCVIVFLTEVTSNT
FT                   ATAAGFLPLLGPVALTLAGTPMMLVVPAAIAASCAFMMPVATPPNAIVFSSGHLKIKDM
FT                   VSAGVMLNVFSIVWVSLITLTLARWLLNF"
FT   gene            complement(643609..644160)
FT                   /locus_tag="TERTU_0627"
FT   CDS_pept        complement(643609..644160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0627"
FT                   /product="signal transduction histidine kinase, nitrogen
FT                   specific"
FT                   /note="identified by match to protein family HMM PF01243"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13930"
FT                   /db_xref="GOA:C5BNQ5"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNQ5"
FT                   /protein_id="ACR13930.1"
FT                   /translation="MGKQFSELKENHIEFIAQQKIFFVGTATDTSKVNISPKGLDSLRV
FT                   INTNQVAWLNVTGSGNETAAHVQTHPRMTIMFAAFEGKPVILRLYGTATAIHHNDDTWQ
FT                   ETYSLFTPQPGARQIFVLDIDMVQTSCGMSVPYFNYVGDRELLNDWAEKQGEQGIKEYW
FT                   GNKNQQSLDGIPTRIAEKNL"
FT   gene            complement(644258..644392)
FT                   /locus_tag="TERTU_0628"
FT   CDS_pept        complement(644258..644392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0628"
FT                   /product="glutathione-dependent formaldehyde-activating,
FT                   GFA"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14508"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNQ6"
FT                   /protein_id="ACR14508.1"
FT                   /translation="MALVPAGSLDEEPPIPAGAKIFFADRADWVDPDAPTFDGFPPQQ"
FT   gene            complement(644676..645143)
FT                   /locus_tag="TERTU_0630"
FT   CDS_pept        complement(644676..645143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0630"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12743"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNQ7"
FT                   /protein_id="ACR12743.1"
FT                   /translation="MNIARKATTILLPLFTSIVLLGCNGDNKDHSTKELDEARAIWSKA
FT                   NLSYYQFTYRRFCFCPQTEALIIEVQNNQVTSAFYTPSGTYLSDEELAYVQNIDELFDT
FT                   IEELIVDQADEVTVIYNSTYGYPEQVDVDLYKNAIDDEFTLNITDFNPIQI"
FT   gene            complement(645203..646108)
FT                   /locus_tag="TERTU_0631"
FT   CDS_pept        complement(645203..646108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0631"
FT                   /product="methyltransferase, TIGR00027 family"
FT                   /note="identified by match to protein family HMM PF02409;
FT                   match to protein family HMM TIGR00027"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11394"
FT                   /db_xref="GOA:C5BNQ8"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR011610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNQ8"
FT                   /protein_id="ACR11394.1"
FT                   /translation="MDTKTINKSKSKTNTKTTVADTAFWVASYRAQETLRPDALFHDPY
FT                   SALLLNERTEQMARSMKPFAKYGYWSVTIRTPIIDDFILRYLQQSCNTVINLGAGLDTR
FT                   PYRLDLPPETRWIEVDFPDVVAFKSEKLRNETPHCQLERVGLDLSNTDARKNLFAELNN
FT                   TYGPAILLTEGVTPYLTETDVIQLAQDLYRQPNFNYWINEYYSKDLYPRYQSPKFQSAL
FT                   GDAVFRFFPTDWFGLFEDNGWIKHDIHFLADFAAKHQRSFPLPWWVNLLKRLFGEDKIT
FT                   GKMREYSAYIVFEKKQDYKK"
FT   gene            complement(646201..646593)
FT                   /locus_tag="TERTU_0632"
FT   CDS_pept        complement(646201..646593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0632"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ACR10718"
FT                   /db_xref="GOA:C5BNQ9"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNQ9"
FT                   /protein_id="ACR10718.1"
FT                   /translation="MEMALYFYVCSLTVLFTLSAAVKIILKMRGRYEQTPRIVQWEEAI
FT                   MFVYFALGFAGLLLHYHQLPVGPALLWQAYAIGLFCYAAATHWFPKMHWIERAASRRAY
FT                   LTTLFAGHFLALPFYFLVARLALLDI"
FT   gene            complement(647002..647154)
FT                   /locus_tag="TERTU_0634"
FT   CDS_pept        complement(647002..647154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0634"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14499"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNR0"
FT                   /protein_id="ACR14499.1"
FT                   /translation="MLLDQTEKSLPRQPGICFVLMRFMLVGGLKIHQPLPEEPWRSFFD
FT                   LLYTS"
FT   gene            647358..648320
FT                   /gene="pfkA"
FT                   /locus_tag="TERTU_0635"
FT   CDS_pept        647358..648320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfkA"
FT                   /locus_tag="TERTU_0635"
FT                   /product="6-phosphofructokinase"
FT                   /EC_number="2.7.1.11"
FT                   /note="identified by match to protein family HMM PF00365;
FT                   match to protein family HMM TIGR02482"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ACR10961"
FT                   /db_xref="GOA:C5BNR1"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012003"
FT                   /db_xref="InterPro:IPR012828"
FT                   /db_xref="InterPro:IPR015912"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BNR1"
FT                   /protein_id="ACR10961.1"
FT                   /translation="MVKNIGVLTSGGDAPGMNAAVRAVVRTALHYDVGVYGIYNGYLGL
FT                   YRNEIQPMTRRSVADTINRGGTFLGSARFPEFKEEAVREEAIKNLRKHEIDALVVVGGD
FT                   GSYMGAKKLTEMGFPCIGLPGTIDNDVAGTDYTIGYFTALNTVLDALDRLRDTSSSHKR
FT                   ISVVEIMGRHCGDLTVWSAIGSGAEYAIVPEMPFDEDKFLEQLRDQVGHGKNHAIVCIT
FT                   EKITDVNRLAKRIEQETGLETRATVLGHIQRGGAPTAFDRILASRMGAYAVELLRQGYG
FT                   GRCVGIQANELVHHDIIDALENMSRPFKDCLLDLAHRLA"
FT   gene            648539..648907
FT                   /locus_tag="TERTU_0636"
FT   CDS_pept        648539..648907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0636"
FT                   /product="MazG nucleotide pyrophosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11442"
FT                   /db_xref="GOA:C5BNR2"
FT                   /db_xref="InterPro:IPR025984"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNR2"
FT                   /protein_id="ACR11442.1"
FT                   /translation="MSTKPRQFASIDELQTYLLSYAKERDWEQFHAPKNLVMALSVEVA
FT                   ELTEHFQWLSEEQSKTLGPDKLAEVTAEMADVFMYLARLAQVLDVDILAACAAKSEDNE
FT                   QRYPPDKVRGSAKKYSEY"
FT   gene            complement(648944..649732)
FT                   /locus_tag="TERTU_0637"
FT   CDS_pept        complement(648944..649732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0637"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:ABG41466.1"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12159"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNR3"
FT                   /protein_id="ACR12159.1"
FT                   /translation="MVVRHPTSNNTYFLQRDRYFLQLLQLALDKSGTSYRLSPVQLPPM
FT                   SENRSEKYLQAKRYDVHWMMTNMRHENSLIPVRIPLYKGLIGWRLLLVHREDETDFATI
FT                   TTLAQLKRKLAVHGLDWPDTGILVANGFRLRTSLDWMSLFRLLDTHDVDYFPRSVAEIW
FT                   QEIDSSPSSNIVVEDSLAVHYYAAYYFFVSKDNAQLAEEIEKGLNAAIADGSFDRLFNA
FT                   SFANAIARANLPQRRVLTVNNPLLPAKTPVQRKELWFQPR"
FT   gene            650346..652181
FT                   /locus_tag="TERTU_0639"
FT   CDS_pept        650346..652181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0639"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13332"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNR4"
FT                   /protein_id="ACR13332.1"
FT                   /translation="MFISKLGMLRSVAFGGFFALLAACGGSSDIGTSSGDGSSTSSSGA
FT                   PGGTPTSQQVVVLMRGLRGELQLSAGGQTFSINTNGYVPLRNLPLGELTGAIGAFPDQQ
FT                   QCLFTETQMLTSPLDSETVAVIECDDLLTLTGKILQPGTETPLPGAVVTVRGYTDSAEP
FT                   VTLVSDTVGDDGIYLLDDILLIGFSRMTLTIEHPDYELFSLPISDSPSELYQDKNYTPT
FT                   DPANSATFSPTEDQALTLGTVEIDLPSNSLRTKSGEIPTGMVTVRTSPLDASFAPELLP
FT                   GAYLNSEDEALESFGAASVRFFLGDEELVFAENAAATIRFPIAVRAQGSAPASEQAYYF
FT                   DRESGYWVAAGMAAISGTADYELTADRSTVWGVFSSYPTVNIKGCVRDMNGNPVKDTLI
FT                   ITQGQSYIGRLLDYTDKYGTYSVRARTNSTVFLYARSDVASQTFSVTTETADVIRSSCL
FT                   VVDPNTTTITLTWGENPADIDSHLYGPNGSGGNFHIYYAAKQTTVNNTTVYLDVDDVTS
FT                   YGPEVITIPRFPSAGTYRFYTHLFSGSSNMFASPTRIALFTGRVEYVYFVTEAPGTTGT
FT                   RCWHVFDIEVDDALTPTVVEQSKYVSDTFCSGNAN"
FT   gene            652228..653193
FT                   /locus_tag="TERTU_0640"
FT   CDS_pept        652228..653193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0640"
FT                   /product="lipid A biosynthesis lauroyl"
FT                   /note="identified by match to protein family HMM PF03279"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11954"
FT                   /db_xref="GOA:C5BNR5"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNR5"
FT                   /protein_id="ACR11954.1"
FT                   /translation="MADTDSKGDPQGRSSAIISLFLQPSPKYWLLGLAILLLSAISHLP
FT                   YRILLSLGRAIGAMIYRSGGRVKHIANVNITRCYPSLAPEAQQRILQQSFRELGISVVE
FT                   TFRVWFGDAEKFYGSRTKLEGEDHWRAALARERGIILLSCHYGSLDLNATLAGLQVRKY
FT                   RKYAFTYRKPSDQLVDRFLVEKRTPYADHFFPVNNLVGIIRLLKKQGVVWYAPDIEVKN
FT                   KNSVFANFMGIPASTTAGLSKLAQAGNAVILPFGHYRNSDNTYTLKFFPPLEGFPSEDA
FT                   VADTRQINRAIEHIIRPFPERYWWTIKRFKNRPAGEPPFY"
FT   gene            complement(653201..654922)
FT                   /locus_tag="TERTU_0641"
FT   CDS_pept        complement(653201..654922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0641"
FT                   /product="signal transduction histidine-protein kinase
FT                   BarA"
FT                   /EC_number="2.7.13.3"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00512; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11408"
FT                   /db_xref="GOA:C5BNR6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNR6"
FT                   /protein_id="ACR11408.1"
FT                   /translation="MKLNLDSKQKIRLGNTLLAAVGGLVLTVLYIYACEVGDCLTSPQE
FT                   VGITLIVFWTVNIGFILTFLTRLNLRFREPSLTLPEMYWAALFCLYIFYQLDELRHLVL
FT                   LFLFLVTIFGTFRLTQSQFITYVAVITLIFTFNQFDYATRKGTPEIRQTDHLIAWLVFT
FT                   FGNITLGVINSAMIRLRTRLREKNVALEKALNAKSTFLANMSHELRTPLNGVIGMVSLL
FT                   EETPLNAEQRKISGIISTSSKNLLEVINNILDFSKIEAGKVALTQAPFDPHKIVNEIYK
FT                   ISTANARDKKLDFRLNIARNLPKRLIGDAFYLKQVLLNLISNAIKFTQMGYVEFAIEVI
FT                   KLEADRTFLRFRISDSGVGIDKKQQAVVFEKFAQEDNSTTRQFGGTGLGLSISSQIVAS
FT                   MGSQINLSSAKGQGSSFWFDLELPVEWQGPENEKVTTSFSRIPNSGSLKQRFQADALVV
FT                   DDDSTNQLVTSQLLRHLGCNVRIAKNGVEAIACSMEEAFDLIFMDCQMPIMDGYTATEK
FT                   IRHVDNPNCRTPIIALTANALIDDGTKCLQAGMDAYLPKPTELNRIAEILEIFLDQ"
FT   gene            complement(655309..657873)
FT                   /gene="hrpB"
FT                   /locus_tag="TERTU_0643"
FT   CDS_pept        complement(655309..657873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrpB"
FT                   /locus_tag="TERTU_0643"
FT                   /product="ATP-dependent helicase HrpB"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00271;
FT                   match to protein family HMM PF04408; match to protein
FT                   family HMM PF08482; match to protein family HMM TIGR01970"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12659"
FT                   /db_xref="GOA:C5BNR7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR010225"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013689"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNR7"
FT                   /protein_id="ACR12659.1"
FT                   /translation="MTTVKTSSARLPQLPIATLLDELALTLQHHHQLVLDAPPGAGKTT
FT                   LVPLALRTAEWLRGRKIVMLEPRRVAAKAAAVRMAELLEEPVGKTIGYTMRLEQKCSRD
FT                   TIIEVVTEGILTRRLQQDPSLDDTALVIFDEFHERSMHSDLGLALCMQSRELLRDDTDP
FT                   LKLLVMSATLDAQAIADLLGGAPKLTSAGRSFPVEVTYAQHTPSRADLVSILATTVVQA
FT                   LNKHSGDCLVFLPGQREIHQLKAALSESLSNEVAVMPLYGSLSLAEQQKAISPLTTDQI
FT                   KTRKVVLATDIAETSLTIDGVHIVVDSGLARKPKFDPRTGMTRLHTGPISIASSIQRAG
FT                   RAGRLAPGNCYRCWTETAQHQRAAQATPEILQSDLAPLAMQLLQWGVNDPQQLQWLDEP
FT                   PKPAFQQACDLLFRLKAIDTPTACVLNEHGQAMAMLPLHPRLAHLLLVATEFGRLPLAA
FT                   SVAAILSEAIPDIGQHTDLMFVVETVEGRRSLPSQHRAWLQRIRQQRGLLLSLLSHNRE
FT                   ANSTDEDLNALGLLIASAYPDRIARKRTQSRNRYLLANGRAAQLSPNDSLAGTEWLAIA
FT                   DIGGVTNQSEDRIFAAASLTKEDLNSGLAAQKTQERVIEWRENRVLAQDQVRIGAILVE
FT                   QRAASNVTAEDRTAATLNYIRLQGLGVLPWNSDINQWRARVALVRENDNSSALWPDLSD
FT                   EALMETIDNWLAPYLIDIDNLQSLKRLDLASIVHAQLPWSQQQLLEQLAPTRIKVPSGN
FT                   HISINYLQSPPQLEVKLQEMFGCEETPSIINGKVALLIHLLSPARRPLQITQDLAGFWR
FT                   NGYEAVKKEMKGRYPKHPWPDDPLSAQATQLTKRRLSADAKK"
FT   gene            complement(657984..658244)
FT                   /locus_tag="TERTU_0644"
FT   CDS_pept        complement(657984..658244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0644"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12189"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNR8"
FT                   /protein_id="ACR12189.1"
FT                   /translation="MKNKDALIIANSLLCEIRLLLNQGKAAQAQRVAEIGQTLPTDEAN
FT                   ITREVVTYEKLFNYMNDFPDRQDLLHFMPLLQVETQQVAQA"
FT   gene            complement(658688..661318)
FT                   /locus_tag="TERTU_0645"
FT   CDS_pept        complement(658688..661318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0645"
FT                   /product="glycoside hydrolase family 9 domain protein"
FT                   /note="identified by match to protein family HMM PF00553;
FT                   match to protein family HMM PF00759; match to protein
FT                   family HMM PF02013; match to protein family HMM PF02927"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14629"
FT                   /db_xref="GOA:C5BNR9"
FT                   /db_xref="InterPro:IPR001701"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR002883"
FT                   /db_xref="InterPro:IPR004197"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR009031"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR018221"
FT                   /db_xref="InterPro:IPR018366"
FT                   /db_xref="InterPro:IPR033126"
FT                   /db_xref="InterPro:IPR036601"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNR9"
FT                   /protein_id="ACR14629.1"
FT                   /translation="MLFKHKKRIFKTASCSLAFAVVSALASVGADAAVGNPRLNQVGYL
FT                   PNSAKVASYHASNNTPQAWELTQNGALIASGMTAPNGVDVASGENVHHIDFSAIANTGS
FT                   NFVLHVGADESYPFDIGEHTFTPVLYDSIRYFYHNRSGIAIETQYTGGGNGSYAANSQW
FT                   SRPAGHINQNSNQGDYAVPCWSGSGCNYALDVTKGWYDAGDHGKYVVNGGISVWKLLNM
FT                   YERALYISNSADKYADGTLNIPESGNGVADILDEARWQMEFLMAMQVPEGETKAGMVHH
FT                   KMHDVGWTGLPLAPHEDNRERALVPPSVTATLNVAATGAQCARLFAAVDSAFADQCLAS
FT                   AERAWDAALANPDDLYPGGYDNGGGGYGDRSAADEFFWAAAELYITTGDSQYLPTINNY
FT                   EITRTDWAWPDTELPGLMSLAIVPTNHTAALSASARQQLIAIADGHVATINSTGYMVPS
FT                   TEEEYYWGSNNVVANKMALIGLAYDFTGNDAYGKAFSKAMDYLFGNNSLSFSFISGHGE
FT                   DALTQPHHRFWAGALSGSYPWVPPGALSGGPNSGLEDETASGQIGGCVSTPAKCFIDNI
FT                   NSWSTNEITINWNSALAWALAFYDDYADDNGGSSSSSSSSSSSSSSSSSSSSSSSSSSS
FT                   SSSSNSSSSNSTSSTSSSSSSSSSSSSSSSSSSSSSSGGACVEMCKWYQDAPRPLCQNQ
FT                   DNGWGWENNQSCIGRNTCASQSGNGGIISVCDGGSSSSSSSSSSSSSSSSSSNSSSNSS
FT                   SSSSSSSSSSSSSSSSSSSSSGSGVSGITCAVTRMNHWGSGYQIDVAVTNSGNSPVNGW
FT                   TIQLDFGEPAQVTNYWNVQLSSSGNYVTANNIAWNGNIGAGQSVSFGLQGNSDGSLATP
FT                   SCRGL"
FT   gene            complement(661877..663682)
FT                   /gene="recQ"
FT                   /locus_tag="TERTU_0647"
FT   CDS_pept        complement(661877..663682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recQ"
FT                   /locus_tag="TERTU_0647"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by similarity to SP:P15043; match to
FT                   protein family HMM PF00270; match to protein family HMM
FT                   PF00271; match to protein family HMM PF00570; match to
FT                   protein family HMM PF09382; match to protein family HMM
FT                   TIGR00614; match to protein family HMM TIGR01389"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12963"
FT                   /db_xref="GOA:C5BNS0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNS0"
FT                   /protein_id="ACR12963.1"
FT                   /translation="MSDSPLDILNHVFGYDSFRASQRDIVNCVTGGQDALVIMPTGGGK
FT                   SLCYQIPALARTGVGVVVSPLIALMEDQVSALKELGVNAGYLNSTLDYDTVWHTENAIR
FT                   SGELDMVYIAPERLIQERTLALLHDAEIALFAIDEAHCVAQWGHDFRADYLKLDVLHNQ
FT                   FPKVPRIALTATADERTRAEIIERLRLENAQQFISGFDRPNIHYRIQQKNKPREQLLRF
FT                   LKDEQQGNCGVIYCLSRAKVEDTATWLCQQGFNALPYHAGLPASVRQQNQSRFLREDNI
FT                   IIVATIAFGMGIDKPDVRFVCHLDMPKSVEAYYQETGRAGRDGQPSTALLLYGLEDIVK
FT                   LRQMTENSDGSEMFKRQEQHRLNAMLGLCEVTGCRRQVLLRYFGDEMPEPCGNCDNCDS
FT                   PPDTWDATEAVRKALSCVYRSGQRFGASHVIAILRGSDNEKIRTCGHNHLSTYGIGKEL
FT                   STDEWRSVFRQLIASGLLAVDTAGYGALQLTEQCRPILRNEQTIAMRRDKPVQTRATQR
FT                   KPTQDIDEAQIPLWNALRRVRKELADEHGVPPYVIFHDATLKDMLEKFPLSEWEMLSVT
FT                   GVGDRKMAQFGEAFLEVFREFEYDQ"
FT   gene            complement(663699..664616)
FT                   /locus_tag="TERTU_0648"
FT   CDS_pept        complement(663699..664616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0648"
FT                   /product="oxidoreductase, aldo/keto reductase family"
FT                   /note="identified by match to protein family HMM PF00248"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14536"
FT                   /db_xref="GOA:C5BNS1"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNS1"
FT                   /protein_id="ACR14536.1"
FT                   /translation="MPTSLTPIAAQGPKVSRFIAGYWRVNQWNKTPQELLRFASECLEL
FT                   GISTVDHAMVYRSEATFGKALALDPGLRSQLQIVTKFGIKPMGFGELGAQAVNHYDSSG
FT                   AALIQSLDASLQGLGTDYIDILLVHRPDYLMDVRELAATMATLRAEGKVRYFGVSNFNT
FT                   HQFEVLQRELRQNVPAGLVTNQIEFSPLHLTPLEDGTLEQCQLNDCRPMLWSCLGGGNL
FT                   LAPASERHQRIHNALRVVADEHAVAALETIVYAWVRALPCAPLPLLGTSNIERVKTALA
FT                   AEKIQLTREQWYRIWEASTGHPVP"
FT   gene            665122..665427
FT                   /locus_tag="TERTU_0650"
FT   CDS_pept        665122..665427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0650"
FT                   /product="carbohydrate binding module family 48 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13677"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR032640"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNS2"
FT                   /protein_id="ACR13677.1"
FT                   /translation="MSLDKRYLKSKPVCKVKFIAPEPLVERSKKIFLAGEFNEWDYENA
FT                   PLRKQKDGTYATTIDLETGKEYEYRYVLDGECWENDYDADKYVPNTCGADNSVVVV"
FT   gene            complement(665678..666163)
FT                   /gene="ilpA"
FT                   /locus_tag="TERTU_0651"
FT   CDS_pept        complement(665678..666163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilpA"
FT                   /locus_tag="TERTU_0651"
FT                   /product="fkbp-type peptidyl-prolyl cis-trans isomerase
FT                   IlpA"
FT                   /EC_number="5.2.1.8"
FT                   /note="identified by match to protein family HMM PF00254"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11153"
FT                   /db_xref="GOA:C5BNS3"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNS3"
FT                   /protein_id="ACR11153.1"
FT                   /translation="MHVEKDRVVSFHYSLREVGGDPIEDNKGAVPMAYLHGHGNLLPAL
FT                   EAEMEGMTEGETRVISLPPEKAYGLRNENALQKVPVKHLIGTYKRLMPKMIVRVNTNKG
FT                   ERNASVIKAGKFMVELDMNHPFAGVALEFTVEVLNIREAQAEEIAHGHAHGDGGHHH"
FT   gene            complement(666228..667694)
FT                   /locus_tag="TERTU_0652"
FT   CDS_pept        complement(666228..667694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0652"
FT                   /product="radical SAM domain protein"
FT                   /note="identified by match to protein family HMM PF04055"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12540"
FT                   /db_xref="GOA:C5BNS4"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNS4"
FT                   /protein_id="ACR12540.1"
FT                   /translation="MKALIVDLNNFSRYPTLSVGYLSAILKAADIEVETLSPLFFGVHG
FT                   FPRRTREPAGLHMLKIANHIGATSSNPLIGKLHTFAKRLGGGTPVDDTAVIVDSFNKML
FT                   KSDIDVVLVSAYTMYFSATKKIAEICAQRNTPLLVGGNMFVVPDIARTWADIPGVTAVF
FT                   AGEPEKILVQLVSDISAGKSVAGCPGITTHDSIAPPAPPLQNLDDVPFPDFSAFPWECY
FT                   PNRIVPIMTGRGCEWARCTFCSDVLTSAGRQYRSRSLANVLAEIRYQREKHNVDLFVFL
FT                   DLKLNSDVELWRGLAREIPRIAPGIKWTASVHVDSRKDNGLSREDLQAAADAGLARITC
FT                   GLESGSQAILNSMKKGVKLDRLSQFIRDAHAANLSVRLTSIIGDPEEEARDIDETTQFL
FT                   NSHANEVERVVVNRFALAPNTPATNQLAATETDFISLLDLDKTSSLIPHTNKRFGEFRH
FT                   IKAVYRLLRIANQINRKPLIAHAAPFEGAF"
FT   gene            complement(667794..668666)
FT                   /locus_tag="TERTU_0653"
FT   CDS_pept        complement(667794..668666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0653"
FT                   /product="response regulator receiver domain protein"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14045"
FT                   /db_xref="GOA:C5BNS5"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNS5"
FT                   /protein_id="ACR14045.1"
FT                   /translation="MEQNWEDRLELGPDCYERFVDQQRVPTLKSLNVAIAGISQLRGDY
FT                   CVARKKPDYHTILFTLEGEGELHTHKGRTLIPANTLTLLPARQPFLITLSREHWATTWF
FT                   CLEDTAHWSHLRQPDASVRYSSEAAALYYLLGHLYYENDPDMQTTPLSHLSHYLHNALG
FT                   NNRQREHLSEPERRLEQLFGDIQQQLHVNWTIERMAERVHYSPSHFHRLCQQHVNRSPI
FT                   QQLIHLRMERAKQLLSDTHWSLNQIASAVGYSDVFNFSNRFKKSTGVSPSQFRTSPGHR
FT                   SSERLMPPL"
FT   gene            668694..670253
FT                   /locus_tag="TERTU_0654"
FT   CDS_pept        668694..670253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0654"
FT                   /product="mate efflux family protein"
FT                   /note="identified by match to protein family HMM PF01554;
FT                   match to protein family HMM TIGR00797"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14637"
FT                   /db_xref="GOA:C5BNS6"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNS6"
FT                   /protein_id="ACR14637.1"
FT                   /translation="MHIEDASLTHIPKGRKHLQCGQFFSVARRRFSTPVRRYNIECGIS
FT                   MATTNSTPTSDSTGLNNRAFWLRVAALALPVAAQMVLQSLLGMADVIMVGGLGPTAIAA
FT                   VGLAAKLQFLLLVLMAGIGAGCSVLVAQYSGADDFRSCQRTLALTLMFGTAVMVPFTLA
FT                   FGFLSHFWVSLINPDPEVVALTATYLRITALVLLSTQIIVIFEAGLRALGNTGVPLVMA
FT                   AIAAVLNVVLNYLLIFGNGGFPALGVAGAAWATLLSRVLQLTGILCWVYLSGHGFGLRI
FT                   THFAEALNRKVFMRYFNFASPIIVNHVVWGVGNATYHILTGYAGTDALAVMGVIVPIES
FT                   LFFALFIGLANASAVMIGRALGGSRNDDAWRLYRFFDRLTLSVALLFSLAVFICRPLIV
FT                   GVFNNMDEATAALLTDTLGIFSLLIWVKVLNMLRILGVLRAGGDNRFCLLMDTVVTWCI
FT                   GLPLFVLGVLWLNLPFLAIYLLMYVEDMAKFMPVRIRIRLRRWMNNLTTEPEPSTASKA
FT                   SG"
FT   gene            670381..670701
FT                   /locus_tag="TERTU_0655"
FT   CDS_pept        670381..670701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0655"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13244"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNS7"
FT                   /protein_id="ACR13244.1"
FT                   /translation="MEKSKVSIYTFELNQGVSEEQLICASAQVDALLLRIDGFMYRSLT
FT                   RIDGGQWQDIMYWNSEAARVRGNRIESSPAFDAFISLIDERTVSFQSNSIVTQVYPQME
FT                   VA"
FT   gene            670735..671472
FT                   /locus_tag="TERTU_0656"
FT   CDS_pept        670735..671472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0656"
FT                   /product="HTH domain protein"
FT                   /note="identified by match to protein family HMM PF08220;
FT                   match to protein family HMM PF08279"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13303"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNS8"
FT                   /protein_id="ACR13303.1"
FT                   /translation="MRKAERLFQILNLLRNRRTVLTARQIAEQLAVSERTVYRDIQALS
FT                   LSGVPIEGEAGVGYRLQRQFDLPPLMFDRDEVEALLLGARMIRAWSDRQLAAAASSALN
FT                   KILAVLPPQLRELEETSAIKVPDYQQQLSVSVHSEQIRAAIRSQQKIAIDYEDAQAQLS
FT                   HRCVLPLGLFFWGATWTLVGWCELRLAYRAFRLDRIRHFELLAENFACHASCSLDHYLA
FT                   LQRQRYDEYMTNANDSLAKNQGD"
FT   gene            671711..672820
FT                   /locus_tag="TERTU_0657"
FT   CDS_pept        671711..672820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0657"
FT                   /product="polysaccharide deacetylase family protein"
FT                   /note="identified by match to protein family HMM PF01522"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12453"
FT                   /db_xref="GOA:C5BNS9"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNS9"
FT                   /protein_id="ACR12453.1"
FT                   /translation="MRAWLQQLDIWKKAGLCLAAAVALGWAQASSALVVLQYHHIADAT
FT                   PPSTSTSPALFEQHLDYLAKHNYRVVSLAELHKLLDAAANGKSLPQKTVVITFDDGYKS
FT                   IYDTAWPLLKKHHWPFAVFVNSEPHDEKNPLFMSWEQLKELHKSGVTIANHTDSHSHLI
FT                   RRRANESPTAFNERRLKEITFAQGRIKKEIGSAPKFFAYPFGEYDSELLSLLKRGGYLA
FT                   FGQQSGPVAADGNRQLIPRFPMGGSYGAMEQFGTKVASVPFVKLKTVVRDSKGRQLHEP
FT                   ELPADEGQPILELSSPILGHIGPIQCFASGQGAISVKGKGGRFSAQAEKPLPVGRSRYN
FT                   CTAHAGGDRFYWFSQLFIRRTASGDWYQE"
FT   gene            complement(672822..673817)
FT                   /gene="hemB"
FT                   /locus_tag="TERTU_0658"
FT   CDS_pept        complement(672822..673817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemB"
FT                   /locus_tag="TERTU_0658"
FT                   /product="porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /note="identified by match to protein family HMM PF00490"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ACR10793"
FT                   /db_xref="GOA:C5BNT0"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNT0"
FT                   /protein_id="ACR10793.1"
FT                   /translation="MQRQFPATRMRRNRFSDFSRRLVRENSLTPNDLIYPVFIVEGEKQ
FT                   RQPIASMPGQYRLSLDELEREVEELLALGIPAIALFPNIDAAHKSLNGEAAYDEKGLVA
FT                   RAVQRLKAAYPEMGIICDGALDPYTTHGQDGIIDDNGYVLNDITVAALQKQAQVCAAAG
FT                   ADIIAPSDMMDGRVGAIRTALDEQGHINTQILAYSAKYASSYYGPFRDAVGSANSLGGG
FT                   NKYTYQMDPANSDEALHEVALDISEGADMVMVKPGMPYLDIVQRVKQEFGVPTLVYQVS
FT                   GEYAMHMFAINAGALSEAVIMESLMCIKRAGADGILTYFAKQAALQLRTP"
FT   gene            674259..675917
FT                   /locus_tag="TERTU_0659"
FT   CDS_pept        674259..675917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0659"
FT                   /product="alkaline phosphatase"
FT                   /EC_number="3.1.3.1"
FT                   /note="identified by match to protein family HMM PF00245"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14162"
FT                   /db_xref="GOA:C5BNT1"
FT                   /db_xref="InterPro:IPR001952"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNT1"
FT                   /protein_id="ACR14162.1"
FT                   /translation="MIRKCYLNAMLLALIGSCTASSVLAAKLSDADFLQYTGDARQWYS
FT                   DGANAIEKKRALMHDRSRGKAKNVILFIGDGMGVSTVTAARIFAGQLQGQSGEEFNLAF
FT                   DEFPYTGLSRTYNTDMQTPDSAGTMTALITGVKSRAGMLSVSDEISRSACSGQYDHSLA
FT                   SAVELAELAGMATGVVSTARITHATPGATYATSSDRDWENDAEMPAAAKAAGCEDIAAQ
FT                   LAGFTPSLNQLAQQLAGKKSKAPAIDGPEIILGGGARNFFPETPVTMDGKQFVGKRKDG
FT                   RNLVAEWRQNNPGGAFVSDAESLQQAVENPQGPVLGLFSNSHMAYESQRLHEEAAAQQP
FT                   SLAQMTDAALEVLSKHKSGYMLVVEAGRIDHAHHASNAYNALQDTVALSDAVALAAERT
FT                   DPNDTLIIVTADHSHVFVMAGYSARGNPILGKSKPKADGDYARDVNKLPYTTVGYLNGR
FT                   GFAFDEGERDADSRYAAPVDAGRKNLEKVNTQDPGFHQESLVPLNAETHGGEDVAIFAR
FT                   GPGAELVSGSNEQNVIFHIMNYSAGLAEKAKKALR"
FT   gene            complement(675984..677717)
FT                   /locus_tag="TERTU_0660"
FT   CDS_pept        complement(675984..677717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0660"
FT                   /product="acyltransferase family protein"
FT                   /note="identified by match to protein family HMM PF01553"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14625"
FT                   /db_xref="GOA:C5BNT2"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNT2"
FT                   /protein_id="ACR14625.1"
FT                   /translation="MINVEQAITNKFPTFASKPALIRKPTLSLLKRLIHENEINQFLTD
FT                   NQSARGIDFIDSVLNYFKFEYTASQRDINQIPSKGRVVIIANHPIGSLDGLAILKLVSE
FT                   VRKDVRIVANDMLMHFENLRDLLIPLDNMTGGSARRSYKRVIESLENEQAIIVFPAGEV
FT                   SRAHATGVKDGAWRPGFLHFARKSHSPILPVHIKAKNSLLFYGASALFKPLGTALLAHE
FT                   MFNKHSRRISFSIGEPIPHAALFTDQIQDRTLVKRLKKHVYSLAHKKNNPFATQKRLAA
FT                   PESPEDLERELASAQQIGMTRDNNTVYLVRYRPHSAVIREIGRLRELTFRAAGEGTGQK
FT                   RDLDEFDTYYEHLVLWNANAREIAGSYRIGNGQHILAEHGIKGFYTSTLYRFDSRFAEY
FT                   FAQGVELGRSFVSPKYWGKACLDYLWQGLGAYLAHNPHLRYLIGPVSMSADYPRDLMDT
FT                   LVFFYRRYYKFEADIVKANHPYLLSTERMAFLDKEFGDRDADAAFDFMQEIFNERGHKL
FT                   PVLFKQYTALYEKGGFKSLVFSRDPDFGDCLDGLCMGDITYLKPSKAKRYIGEPKVPLN
FT                   Q"
FT   gene            complement(678367..679479)
FT                   /locus_tag="TERTU_0662"
FT   CDS_pept        complement(678367..679479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0662"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13183"
FT                   /db_xref="GOA:C5BNT3"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNT3"
FT                   /protein_id="ACR13183.1"
FT                   /translation="MRQKPAEDRPLRIKLDFASLNLGLALGIALIAIATLPHFNRLPER
FT                   YLSVYGQSLATMAAAQAIEPTFKNDLISQQAILREVMGQPKTLLATIHDVEHHLVVQAG
FT                   DSRSLDAHLNEAYTAPILLHNNIAGYLSVHLAVEKTGAETVFVIAVLGSVLLAAFSLWQ
FT                   LQQQGRLLWPALPRARKASPPLDVDNAPQAQEDDTEELESNEPRLVYAIIHIKNLRVLQ
FT                   QQLNADNFRKTLLAVEHTISDVLALYGGDGFEWRQNLVELRFLANDAEDEALFRAVCSA
FT                   WLIVELCSIVNTIPLDLAALVSANHQDLTPSELQISGLVLETQAANDELISRRLQLLEL
FT                   GAEGGRMIVADIVQPYRTLLEKQRSQLAQL"
FT   gene            679597..680805
FT                   /locus_tag="TERTU_0663"
FT   CDS_pept        679597..680805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0663"
FT                   /product="phosphoserine phosphatase"
FT                   /EC_number="3.1.3.3"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM PF01842; match to protein
FT                   family HMM PF06888; match to protein family HMM PF08282;
FT                   match to protein family HMM TIGR00338; match to protein
FT                   family HMM TIGR01488"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ACR10990"
FT                   /db_xref="GOA:C5BNT4"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR023190"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNT4"
FT                   /protein_id="ACR10990.1"
FT                   /translation="MRELILINISGEDRPGVTSSVTAILARNNANILDIGQAVIHDHLS
FT                   LGMLVELPSEEASALAVKDILYRMHDSGMQVRFQPISEQSYSDWVGQQGKQRHIVTLLA
FT                   RHITASHISALAEILAEHGLNIDNISRLTGRVPLDAENKGQACVEFSARGRVADITVLR
FT                   AALADIASDMDVDIAFQEDNMFRRTRRMVCFDMDSTLIEAEVIDELAKAAGVGDQVAAI
FT                   TEAAMRGELDFNESFRARMALLKGLDESVLDGIAQRLPLTEGAARLVSTLNKLGYKTAI
FT                   LSGGFNYFGRYIQQKLGIDYVFANELEIVDGKVTGNVTGQIVNGQRKAELLRSLAEQEG
FT                   ISLEQVVAVGDGANDLPMLSIAGLGIAFRAKPLVRAEAKQAISTLGLDAILYLMGFRDR
FT                   EME"
FT   gene            complement(680843..682939)
FT                   /locus_tag="TERTU_0664"
FT   CDS_pept        complement(680843..682939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0664"
FT                   /product="response regulator receiver modulated diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC sensor"
FT                   /note="identified by match to protein family HMM PF00563;
FT                   match to protein family HMM PF00990; match to protein
FT                   family HMM TIGR00229; match to protein family HMM
FT                   TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11485"
FT                   /db_xref="GOA:C5BNT5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNT5"
FT                   /protein_id="ACR11485.1"
FT                   /translation="MSQTKTIRLLILNDSRAEAERLISMLHNAGRPVRAQHVENDEALN
FT                   KLLQEKVWDLMVGLDTTTNLKPLDAIRIIRRLNKDVPLILQTNDETIRGTVDGLKLGAV
FT                   DVVKVDEDQHLLFVIQREFNNREDRDRRRVAERRYNEIERRNQQLLDSSRDAIAFVQDG
FT                   MFLYTNDSFVELLDYDSRDDLECMPVIDITKDRDQDKVKRFLKDFMLKGSDIESTKLEF
FT                   SVITKDGAERPLAIEVRKSTFEEELCTQFLIRTSTADSQELEAQIQQIKSQDLATGLYN
FT                   RGYLLDTLHLVVENAASGANNSALIHIGVDKFHEIVDGKLGIASADLVIGSIADFAKSQ
FT                   VKADDVLCRYNDNSFMLVIPNIDPETALARAKTLCQKLTSHIVDIDGTTLQFAYAIGIS
FT                   VVNETTADAETPIGQAVKAYELARAESSNNAEDKVRLYEPETREETKRDVSHSVQKALD
FT                   EGRFKLLFQPILSLRGSDREHYEVLLRMIGEDGSEISPQEFLSAAAKIGATTKIDRWVI
FT                   LESIKLLSEHRKNSTNTHLIINLSRESVLDATLPPWIKVAFKAANLPPDALVFQLNEID
FT                   VNDHLNVAATFSEQVTKLGSSCSITRFGCALNPFNALQHVKASHIKIDGSFTQELQENT
FT                   PEAVQALNELVSELHKLDKITIVPFVENASVLSKLWQSGVHYIQGYYLQGPAEEMNYDF
FT                   DTES"
FT   gene            complement(683104..684834)
FT                   /locus_tag="TERTU_0665"
FT   CDS_pept        complement(683104..684834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0665"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12206"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNT6"
FT                   /protein_id="ACR12206.1"
FT                   /translation="MNQPSLPEYINDLQLPTTDLTKLSFCATRPAKVEEWANEFRATQT
FT                   TETSILLYHSLPEAARLKCSYDTRLEILEALRPAAQNAVQGLTRSFLQQPINLPESAQK
FT                   TAIIAQAIQKSMIDGYGRCVSDICAQKRFKPVVMEALAKALHRAITGIGLIFFRNYQLY
FT                   TQLPTGFWHQLHVYFQIAEYFDLLATPVKDPLLLSRPATNIQTAYMRVLLMATARMNQL
FT                   SRNDIAHIYNALESWSQYARLHPSVLQDKDNFYLINLSRDQGPIYKSRFNGSEMDRVLE
FT                   LDFRVLVNQLSKYAPSSDEDPDVPIGGSAAISVPSGFPPPLLDHLMQSWSSIAQRKQER
FT                   RAVQSLAEVSVGMVDTHYLLCGEQPFDEFAAEDVFDEGFEHSVIDMLNTGIGSGDDSVT
FT                   KRKASIVYQVHIQNVSAGGCCLLWKGEIPTKLRAGEIMSIKESGRHSWSLGVVRWVRQY
FT                   RGQSQLGIQTLANHPRPYGIAQGFDMGGYSDYMRAFYLPASKNGRQPESLLTASAPFKE
FT                   LDKVKLFDGDSSVSAKLNKLVFATGAVQQFIFNTLDAPQTQPKRVAGSRTQEQFDDEWD
FT                   "
FT   gene            complement(684934..685941)
FT                   /locus_tag="TERTU_0666"
FT   CDS_pept        complement(684934..685941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0666"
FT                   /product="KamA family protein"
FT                   /note="similar to L-lysine 2,3-aminomutase (KAM) (LAM);
FT                   identified by match to protein family HMM PF04055; match to
FT                   protein family HMM TIGR00238"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11821"
FT                   /db_xref="GOA:C5BNT7"
FT                   /db_xref="InterPro:IPR003739"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022462"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNT7"
FT                   /protein_id="ACR11821.1"
FT                   /translation="MIPHTIPTWQHKSWQEQLTNQITKPADLLSRLSLDNQWLPAAERA
FT                   AALFPLRVSEAFVSRMRPGDPNDPLLLQVLPLGEEFAVTPGYSEDPLEEEKSNPAPGLI
FT                   HKYHGRVLLIAAPHCAINCRYCFRRHFDYRQNTPSRTEWQAALAYIKTRPEIDEVILSG
FT                   GDPLMLGDKQLRWLLTEIDAIPHITRIRIHSRLPVVLPDRFTSTLLELLSATRAQMVVV
FT                   AHCNHSQEIDQSVEAVFEALKQAGITLLNQTVLLKNINDSANILIELSKRLFQSGVLPY
FT                   YLHLLDRVSGTAHYEVDELDARRLREELLAQLPGYLVPTLVKEEPGAPSKTPIR"
FT   gene            685991..686560
FT                   /gene="efp"
FT                   /locus_tag="TERTU_0667"
FT   CDS_pept        685991..686560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="efp"
FT                   /locus_tag="TERTU_0667"
FT                   /product="translation elongation factor P"
FT                   /note="identified by match to protein family HMM PF01132;
FT                   match to protein family HMM PF08207; match to protein
FT                   family HMM PF09285; match to protein family HMM TIGR00038"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12766"
FT                   /db_xref="GOA:C5BNT8"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BNT8"
FT                   /protein_id="ACR12766.1"
FT                   /translation="MATYSTNEFKSGLKVMLDGDPCSIVENEFVKPGKGQAFNRVKMKN
FT                   LKSGRVWERTFKSGESLEGADVVDRDMQYLYNDGEFWHFMEPESFEQFQGDASVVGDSA
FT                   KWLNEQDTVVVTLYNGSPLAVTPPNHVELEIVETDPGLKGDTAQGGTKPATLSTGAVVK
FT                   VPLFLSTGETVRVDTRTGEYLGRANK"
FT   gene            686668..687636
FT                   /locus_tag="TERTU_0668"
FT   CDS_pept        686668..687636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0668"
FT                   /product="putative lysyl-tRNA synthetase"
FT                   /note="identified by match to protein family HMM PF00152"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13483"
FT                   /db_xref="GOA:C5BNT9"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004525"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNT9"
FT                   /protein_id="ACR13483.1"
FT                   /translation="MSWQPTATMDALARRAQMIQQVRAFFAARSVLEVDVPVIGRATVT
FT                   DLNLDSLCVTRAVGSAGSTLSGYLQTSPEFFMKRLLAAGSGDIYYLGKAFRADESGRIH
FT                   NPEFTMLEWYRCGMDDRALSDEVVSLCRAIQPGVAVVVTEYGAVFEQHTGLNPHTCSTE
FT                   TLADYARAHLGVDWFDEPRGLWLDLLFTHCVEPQLGDGLVVIRDFPACQCALARVVPDE
FT                   TGVPVARRFEVYWGGIELANGYWELVDAQEQRARFMQDNKARVAQGKPEMALDNDFLAA
FT                   LDAGLPECAGVALGVDRLLMCASGCAHIGEVMSFHGTSRCD"
FT   gene            complement(687640..688449)
FT                   /locus_tag="TERTU_0669"
FT   CDS_pept        complement(687640..688449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0669"
FT                   /product="serine acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /note="identified by match to protein family HMM PF06426;
FT                   match to protein family HMM TIGR01172"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13924"
FT                   /db_xref="GOA:C5BNU0"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNU0"
FT                   /protein_id="ACR13924.1"
FT                   /translation="MQAKQPRAVVADPVWETIRQETLQEAEQEPALASFLHATILNHST
FT                   LESALSFHLANKLASPALSALQVREIIEDSLENHCDLGDIVRADIKAVFDRDSACDSYL
FT                   LPFLYFKGFHALESFRVSNCLFKQGRKSLAFFLQSHIALTFGVDIHPAAKIGRGIMLDH
FT                   ATGIVIGETTVVDDDVSIMQAVTLGGTGKEAGDRHPKIRRGVLISAGAKILGNIEIGEG
FT                   AKVGAGSVVLKPVEPHTTVVGVPAVTVGKPNTDNPALDMNHQISCDC"
FT   gene            688988..691912
FT                   /locus_tag="TERTU_0671"
FT   CDS_pept        688988..691912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0671"
FT                   /product="TonB-dependent receptor"
FT                   /note="identified by match to protein family HMM PF00593;
FT                   match to protein family HMM PF07715; match to protein
FT                   family HMM TIGR01782"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11039"
FT                   /db_xref="GOA:C5BNU1"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010104"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNU1"
FT                   /protein_id="ACR11039.1"
FT                   /translation="MKIRNRFSISKTGFLSLCVAASMAQAQNSSNLEEEVLVTGYRASL
FT                   LNSTAAKRNSVGFSDEVFSDDIGKMPSQNLAESLSRIPGVRIEREVTGEGQQISVRGLG
FT                   PEFTKVVMNGNSISVASDGSLGSGQKGRQVDLDMFPPELFSSLAVNKTSSAQQVEGGVS
FT                   GYVNMRTIRASDMGDGSHFRVGLEGAYNEMSGETSPKYSFMYGYDTEKFGVLAGIVGKN
FT                   SKSRTDGFESVGNYQDGCVAHWYDAVDDDDQPLGRKSGCIGNTEGREGYYQSTGANTFN
FT                   YTDIATADYAAAHPGVNVGDQLDLNAVSGLTDEQLDNMKLPYIGRPMYTYGDRDSLSMI
FT                   LSAQFRPNENIEASLDILRAEADRSFVRNELVNIYRRNYLQYGLAWIPENIQLNDDGVV
FT                   QSGTFYNNRAWVGSRAYEEELTYTSIMPSLHWQISDVFVMDLSGSRTESDFDRDEPYLL
FT                   YYSAPGVMTHDYNSKMPTVTHSVDVASAGSGWTFGAGPGTEGDAYQAGDFRFQRNARTT
FT                   ETTSFKADFALGEDADISGIKFGVHWDENISDTTGFTGGDDWNNRVRTSDLNDNFANYV
FT                   IDSPITDLTGKGVKGIASVNWGAVKDAVDYDNFVPDSSAGGDQFGSTIGDIEEKIFAVY
FT                   VEGNSESEVAGRPFRTNFGVRLVDTEQTISANGLTKTSDYSRILPSFNAVYDVTESFKV
FT                   RGSASRSLTRANPSSMFPSAAWNGSGVDEVAVGNYQLQPFESTNFDLGGEWYFGDLGYV
FT                   GLNYYQKDITGFVKPRDRQIPLNEVQAAVEALGYDFEVSEDSLTDIQLAAVADCGGIEE
FT                   GTCMTNISDDVNIEGVTTLTGWEAIWVMPLDFIVQGLGFNASMNKIDQDASDPDGEIFG
FT                   ISDTTNFTAYYENFGFQTRVTYTLQEGTETGGGWSPLLADDRAQLDLSASYDLPMFSDY
FT                   NVTVSLDAYNLTNEPMRSVFESDGNTFNLRYPGATYTLGIRASF"
FT   gene            complement(692063..692776)
FT                   /locus_tag="TERTU_0672"
FT   CDS_pept        complement(692063..692776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0672"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07729"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11651"
FT                   /db_xref="GOA:C5BNU2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNU2"
FT                   /protein_id="ACR11651.1"
FT                   /translation="MKKSGLAGVTDKNNYNINFDHPTPDQIFAFIRDEIVGMVLKPGEK
FT                   IPENQMAEKFGVSRTPVREAIVKLANLGFVEVRPQRGTFVTKLSMPLILEARFIREAIE
FT                   IAVVSSLAQMDDPSVLHECENILEQQVVAANAQDAMTFQYLDDEFHRALAGATGYSRVS
FT                   KVIEAEKAHMDRVRNLSLVELTGQYEQVLTQHKAIIKAIKSGSVEDAKAAMGYHMKDVF
FT                   NILQVAPEQHPEYFI"
FT   gene            693048..695222
FT                   /locus_tag="TERTU_0674"
FT   CDS_pept        693048..695222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0674"
FT                   /product="radical SAM"
FT                   /note="identified by match to protein family HMM PF04055;
FT                   match to protein family HMM PF08497"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11934"
FT                   /db_xref="GOA:C5BNU3"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013704"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR022946"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR024560"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNU3"
FT                   /protein_id="ACR11934.1"
FT                   /translation="MPQIQAAPLTRYPKYWAECFGIAPFLPTSRAEMTELGWDSCDVVL
FT                   ISGDAYVDHPSFGMAVIGRLLESQGFRVGIIAQPDWTSAEPFRALGKPNLYFGVTAGNM
FT                   DSLINRYTADLRIRHDDAYTPGGEGGKRPNRAVTVYSQRCKEAWKDVPVVIGGIEASLR
FT                   RIAQYDYWSDEVRRSVLVDSTADILLYGNAERAVVEVTQRLAAGEPVSALTRIRGTTVI
FT                   LPAVPGGFTELDSSRIDWPGRIDAMPSPYEMRSANSCSETSGEVAAQNEQGEVVRIVPM
FT                   PLRKWEQNLATDATCIRLPSFEKVSKDPVLYAHASRVLHQESNPHNARTLVQKHGKREV
FT                   WVNPPAIPLTTEEMDHVFGLSYARVPHPMYQGKKIPAYDMIKTSVNIMRGCFGGCTFCS
FT                   ITEHEGRIIQSRSHASILREIEEIRDKVPGFTGTISDLGGPTSNMYTLNCKDPDIQASC
FT                   RKLSCVYPGICKNLNTDHSPTTELYRKARRVEGVHTVAIASGLRYDLAVEDPEYVKELV
FT                   THHVGGYLKIAPEHSEQGTLSMMMKPGMGTYDRFEKMFYQFSKEAGKKQYLIPYFIAGH
FT                   PGCSDEDMVNLALWLKRHSFEVDQVQTFYPSPMSLATAMYHSDRNPLKHLTYKSKKIFT
FT                   PKIKQQRQLQKALLRYHDPENWPLLREALKAMGRSDLIGDSPQHLVPSENRELRMRSVN
FT                   RRQGSPRAQKARGDKRNQKLPGKSPRRRRD"
FT   gene            695512..696786
FT                   /locus_tag="TERTU_0675"
FT   CDS_pept        695512..696786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0675"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12212"
FT                   /db_xref="GOA:C5BNU4"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNU4"
FT                   /protein_id="ACR12212.1"
FT                   /translation="MEKSEREASSAHPAHMSATAAAACQFRDLRSMPEHRLQLLAKLRS
FT                   PRGSDPSTEVSNRGAAKANSGIAQFGGGDFKGRQSNYKARGRPQIPKRNKPKDEDRRRR
FT                   TIGQQGKAPRPVGRRPRPAPNPANNVQPDAPNQEIFVPPHHQDQDPLINPPLNPLDHDG
FT                   LDEALVPENDVEHPDHFIIDMGEEEPRGIGERIRDKAFGGRTFGDSSNLLGAVANTISD
FT                   TAESSALLTIGSSGVLASGCKLLFDGLNQLGSATASEDKREAGYTVLMGLSNMASGAYG
FT                   IESAILELLKHEASASLAGVLSTATWALTEATNIILQLDILITNITQGKSYTAYLKPIA
FT                   ALLASLLKCIGGVLYVYGTIVSADRQDDEDDPTVNIGVVLMIVGSAMSTLHGIIKLIGM
FT                   CLEKCRDSGVELDDEPDLELGGHQV"
FT   gene            697127..699877
FT                   /locus_tag="TERTU_0676"
FT   CDS_pept        697127..699877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0676"
FT                   /product="glycoside hydrolase family 2 domain protein"
FT                   /note="identified by match to protein family HMM PF00703;
FT                   match to protein family HMM PF02836; match to protein
FT                   family HMM PF02837"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13580"
FT                   /db_xref="GOA:C5BNU5"
FT                   /db_xref="InterPro:IPR006101"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR023232"
FT                   /db_xref="InterPro:IPR032311"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="InterPro:IPR040605"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNU5"
FT                   /protein_id="ACR13580.1"
FT                   /translation="MRTKAAVVGLALAISAGMLSACIWTKPSNESASSPRERILLDDGW
FT                   RFMKYEDAADADGLVYDIRPDHSEHQDDKAADAKPTEAVTVHGGSNVLRPWILPMANPF
FT                   IADPAQHYAAPASMPPHGDFPFIQAEFDDRNWQTVSVPHDWAIQGPFYEGDKAPVGGGM
FT                   GRLPSPGVGWYRKQIMLTEADAGKSLFLDIDGAMSYAMVWFNGHLVGGWPYGYASWRVD
FT                   LTPYAEIGKPNQIAIRVDNPPASSRWYPGGGLYRNVWLEKTQPVHVAQWGTNIVVSAAD
FT                   EQEATVRLSVALNNQSPAAASVQVETDVFELNEQDEPVGAAVAKVGPISTDVEGKGAAT
FT                   VDSRFRVINPKLWGPRPTQTPNRYVAITKVVAQGKVVDEYRTPFGIRTIEIDPNLGVLV
FT                   NGEPIYLQGVNQHHDLGALGAAFNVRAAQRQLELLQEMGTNAIRLAHNPPARELLTLTD
FT                   KMGFLVIDEVFDSWQRKKTPLDFHLIFDDWSEADLRSMIRRDRNHPSVFMWSVGNEVGE
FT                   QYTDTDGAKVGQRLHDIAHSEDPTRPTAASMNYAKAHMPFPETMDTISLNYQGEGIRDA
FT                   EAYAHLNGIRTPPSYPQFHKAFPGKAIFSSENAAAVSSRGEYLFPVARGISAPVADGKG
FT                   GDPTSAQVSAYELYTAPFGSSADKVFRSLAQHPYVAGGFVWSGWDYLGEPTPYYSARSS
FT                   YFGVIDLAGFKKDRFYLYQAHWRPDYPMAHILPHWNWPDRVGKVTPVHVFTSGDEAELF
FT                   VNGKSQGRKQKGDLEYRLRWDDVVYQPGEVSVVAYKNGEEWATDSVVTTGEPAGLTLTV
FT                   DRAGIQADGKDLAFVTATVVDANGRMVPTAKPALTFTVSGAGELVATDNGDATDLVAFP
FT                   SAKRSAFNGLALAIVRAKPGSTGTINVTVAGENLSSAMIDLNSKK"
FT   gene            complement(699913..700146)
FT                   /locus_tag="TERTU_0677"
FT   CDS_pept        complement(699913..700146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0677"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14387"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNU6"
FT                   /protein_id="ACR14387.1"
FT                   /translation="MLRNGDRFGLNRNTPTQSAFFRRCSAFQHTRSNDTRPTIQTNKKN
FT                   REHEDRAGRVFLVQASFDGAINGEEEVAVALL"
FT   gene            700175..701173
FT                   /locus_tag="TERTU_0678"
FT   CDS_pept        700175..701173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0678"
FT                   /product="putative FAD dependent oxidoreductase"
FT                   /note="identified by match to protein family HMM PF01266"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0678"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14271"
FT                   /db_xref="GOA:C5BNU7"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNU7"
FT                   /protein_id="ACR14271.1"
FT                   /translation="MNIAIIGAGLAGLTAANLLQAKGAKVRVFEKSRGVGGRLANKRLP
FT                   WASLDLGAQYFTARDPRFRTKVAEWLRAGVVEPWSFSPYELCETGLRAREDGQTRYVGV
FT                   PAMNSAAHELAENLDVRLNSRVERLLVANGQWHVVTGNDSTGDEARFDRVIVCLPANQS
FT                   KALLHEYEIASRIPTEVHQACWALALATRGHVESDIKGFFGDDFVSWVSRLSSRPMRDS
FT                   SAHWDDLWMLHFAGNWSEIQGKNTALDLVESGSQWLNRALSGYRSRPLTVVEHYSHFWR
FT                   FARVIGQPLAQACIVDSDIGLAVAGDWVAGGRVEGAYLSGLAAAEQILTGL"
FT   gene            701212..702555
FT                   /gene="phrB"
FT                   /locus_tag="TERTU_0679"
FT   CDS_pept        701212..702555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phrB"
FT                   /locus_tag="TERTU_0679"
FT                   /product="deoxyribodipyrimidine photolyase"
FT                   /note="identified by match to protein family HMM PF00875;
FT                   match to protein family HMM PF03441; match to protein
FT                   family HMM TIGR02765"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0679"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11365"
FT                   /db_xref="GOA:C5BNU8"
FT                   /db_xref="InterPro:IPR002081"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014133"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNU8"
FT                   /protein_id="ACR11365.1"
FT                   /translation="MAAILPKSRVGVFWFSNDLRITDNAALNYAAQSCETLICVYILDP
FT                   RLYAPNRYGLRSMGPMRDRFLQESLAQLSVDLNAVGQTLLVLRESPLQAMAQLIGKYDP
FT                   GLVVRSRQAGFYEYKQWAMLQRRYRLISFKDIATHTLFNDEDLLPFPLTDLPKTFSQFR
FT                   KKVEPLADIRNLLPVCDLPPPPRGLKRDHTFRRELLKHQSRSIFKGGAEAGIQQLQGYF
FT                   HTTAPSEYKTVRNALDGWGNSTKLSPWLANGCLSVNQVLLALGEYEAQYSANESTYWIS
FT                   FELLWREYFQWSAYLHGARLFARDGINGSKKLNTFYSQRFMQWCEGSTPFPLVNALMKQ
FT                   LNVTGYMSNRGRQITASCLVNELALDWRYGAAYFEQQLIDYDVASNWGNWQYIAGVGAD
FT                   PRGGRHFNLDKQREIFDPEGDFIAKWGGESATAEVNSVDAADWPLADE"
FT   gene            702577..702723
FT                   /locus_tag="TERTU_0680"
FT   CDS_pept        702577..702723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0680"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ACR10644"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNU9"
FT                   /protein_id="ACR10644.1"
FT                   /translation="MILINLAMNVAKLIAGLIGDNPCVTYQFLSAIKKPVVQNRLYVSE
FT                   SLN"
FT   gene            complement(702726..704690)
FT                   /locus_tag="TERTU_0681"
FT   CDS_pept        complement(702726..704690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0681"
FT                   /product="ExsB"
FT                   /note="identified by match to protein family HMM PF02837;
FT                   match to protein family HMM PF03629"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0681"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11936"
FT                   /db_xref="GOA:C5BNV0"
FT                   /db_xref="InterPro:IPR005181"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="InterPro:IPR039329"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNV0"
FT                   /protein_id="ACR11936.1"
FT                   /translation="MPKQKAKKTMKNLLLLLFTLSFALAQYANAAVKLPRLLSDGLILQ
FT                   RETPNTIWGWASPNEKISVSVDGKTFKAKASTSGDWSVKIPAYDAGGPYTISVEGENTL
FT                   TIKDVYFGDVWVASGQSNMQTTLNRIEERYPDLVANANDPLIREFTVPREMNFKGPQKD
FT                   ITGGEWQASVSDKIGEHSAVAYFFAKKIQEKQNVPVGILGANFGGSPAECWISRDDLKQ
FT                   YPAQYKSIENFDDDGYLQSIKDADQQESNAWFAKLNGGDKGMQGKVKWYENSYDDDQWK
FT                   SLNMPSVWADEGIKPMTGIVWFRKEITLPDSVKDQDAFLRLGVIVDGDTAYINGEQVGS
FT                   TGYRYPPRRYKVKPGVVKPGKNIITLRVQVDNGQGEFVSEKPYYLQVGDTKIDLKGEWK
FT                   YKVANVIEPPKPKRFIPWNEPLGCYNAMLAPLFNMNIKGVIWYQGESNTGNPQEYATLF
FT                   PHLIKSWRRDWNQGDFPFLFVQLANYMSDPQEPSESQWAATRFAQFQTLDKVDNTAMAV
FT                   ISDVGEWNDLHPLNKKAVGERLALAAEALAYGNTDIEYSGPLFKNLERKKNKLIISFDH
FT                   VGDGLIAKDGKLGGFAIAGEDGKYVWAKAKIKKGKVVVWSKEVKNPVSVRYAWANDPNT
FT                   ANLYNKNGLPASVFEATVN"
FT   gene            704745..705431
FT                   /locus_tag="TERTU_0683"
FT   CDS_pept        704745..705431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0683"
FT                   /product="chromosome 3 open reading frame 37"
FT                   /note="identified by match to protein family HMM PF02586"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0683"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11114"
FT                   /db_xref="GOA:C5BNV1"
FT                   /db_xref="InterPro:IPR003738"
FT                   /db_xref="InterPro:IPR036590"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNV1"
FT                   /protein_id="ACR11114.1"
FT                   /translation="MAHMCGRFANHVQDMHRWVSILKHWPANIEHGEPVAPTGFNIAPT
FT                   QSVPVVCAAGTYAMRWGLVPSWSKDASPKFATFNARIETVAEKPTFRSTWNAKRRCLVP
FT                   ILGYYEWVQSGDGKQPYFVRQQHGGEILAMAGLWEQRGEMVSFTVLTEPASGKMSELHH
FT                   RMPVFLNEQNARPWLEGGYEFAPLSHGELRADLSFYPVSKRVNKASEAGASLLDPLSDD
FT                   GPDYAK"
FT   gene            complement(705419..706543)
FT                   /gene="anmK"
FT                   /locus_tag="TERTU_0682"
FT   CDS_pept        complement(705419..706543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="anmK"
FT                   /locus_tag="TERTU_0682"
FT                   /product="anhydro-N-acetylmuramic acid kinase"
FT                   /EC_number="2.7.1.-"
FT                   /note="identified by match to protein family HMM PF03702"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13456"
FT                   /db_xref="GOA:C5BNV2"
FT                   /db_xref="InterPro:IPR005338"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNV2"
FT                   /protein_id="ACR13456.1"
FT                   /translation="MAEAKSLFIGLMSGTSADSIDAGLVEFSENSFRLLATYDLPYDPR
FT                   TRQKIFDLARPGDNEIDRMGALDRQLGMLFAKAVNQLLEENQLRAEQITAIGSHGQTIR
FT                   HRTHSAGTPEQFSLQIGDPNTIAQLTGITTVADFRRRDMAASGQGAPLAPTFHHAMFSS
FT                   LKENRCILNIGGMANITYLPTDGSVLGYDTGPGNALMDAWINKFGTKRFDKNGEWAGDG
FT                   KINHELLDTLLSHSFFKMPAPKSTGREDFNVHWVNQAVEATITPFTPQDVQATLTELTA
FT                   ITIADAIRHSCTTGTHIYACGGGVHNRVLFARLAELLPGYTLSTTDDLGLHPDWVEAVA
FT                   FAWLAMRTLNKLPGNLPAVTGADHPLILGGVYFA"
FT   gene            complement(706654..707934)
FT                   /locus_tag="TERTU_0684"
FT   CDS_pept        complement(706654..707934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0684"
FT                   /product="putative M23 peptidase domain protein"
FT                   /note="identified by match to protein family HMM PF01551"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0684"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11731"
FT                   /db_xref="InterPro:IPR007340"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNV3"
FT                   /protein_id="ACR11731.1"
FT                   /translation="MALATTLMLPSKETQAKRQQEIVIPALAEALETSGHVGAATAPEP
FT                   TAPIEPETIVREETVKSGDNLSLLFKRAGLTDRDMMEVLAAENGKKLAALYPGHTVAFT
FT                   LSRDGKLEGLTYTKDRLTSFSFTRADNLFTYSEQKRTPDVQISTRSGVITESLFLAGKE
FT                   AQLDDRLVMELASIFGWDIDFVLDIRQGDSFKVAYEESYIDGEKIGNGNIVAAEFTNQN
FT                   KTYRAVRYEDANGNVQYYTPAGDTMRKEFLRTPIEFARISSPFNLKRKHPVLNKIRAHK
FT                   GTDYAAARGTPIKAAGDGKVIFAGRKGGYGNVVIIQHGQTYKTLYAHISKFRKGIRAGA
FT                   RVKQGQTIAYVGSTGLATGPHLHYEFYVNGSVRNPVTVKLPKAKAIAKAELPRFLNATQ
FT                   PLLAELDPTSGSTKLADSHTISTTKNL"
FT   gene            708336..709634
FT                   /gene="tyrS"
FT                   /locus_tag="TERTU_0686"
FT   CDS_pept        708336..709634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrS"
FT                   /locus_tag="TERTU_0686"
FT                   /product="tyrosine--tRNA ligase"
FT                   /EC_number="6.1.1.1"
FT                   /note="identified by match to protein family HMM PF00579;
FT                   match to protein family HMM TIGR00234"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0686"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13673"
FT                   /db_xref="GOA:C5BNV4"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNV4"
FT                   /protein_id="ACR13673.1"
FT                   /translation="MTAASNELLEDLQARGLVAQMTGDDALHAWLEQPRTLYCGFDPTA
FT                   DSLHIGSLVPLLTLKRFQMAGHKPLALVGGATGLIGDPSFKAQERKLNTPDIVAGWVDK
FT                   LRGQVSQFIEFDCGENAAEVVNNLDWIGQINVLDFLRDVGKHFSINNMVQKESVKQRLD
FT                   REGEGISFTEFTYMILQSYDFAELYKQYDCTLQIGGSDQWGNITGGTDLTRRLHGGQVF
FT                   GLTLPLVTKSDGTKFGKTETGTIWLDPAKTSPYAFYQFWLNTADADVYKFLRYFTFLSV
FT                   AEINAIEDTDKAAEGRPQAQSILAEEVTRLVHGDEGLAAAQRITQAMFSGDLADLSETD
FT                   LEQLALDGLPSGDLPSDYADKPLTSLLAECGMVKAAREAKDALGRKAVFINGTAYGAED
FT                   NMNASVCFAVERALYDRFYLVKLGKKKNFLFSR"
FT   gene            complement(709631..710950)
FT                   /locus_tag="TERTU_0685"
FT   CDS_pept        complement(709631..710950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0685"
FT                   /product="GGDEF domain protein"
FT                   /note="possible secreted protein, N-terminal signal
FT                   sequence; identified by match to protein family HMM
FT                   PF00990; match to protein family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0685"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12034"
FT                   /db_xref="GOA:C5BNV5"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNV5"
FT                   /protein_id="ACR12034.1"
FT                   /translation="MPSSPSQIRLRWIYIAFLLSLLAILAHGLIPHRKLELIPSADITS
FT                   LYSDEQSGGNTRAEWIDRDSYHFRCTYIDEPASSKYCGMNIAQGDGLKQGVDFSHFKYI
FT                   ALNLEYTGNAPILRVYFRHYGENYSTRSDSQRTAKYNRSLIPIEHLHGTLTLNIRQFTV
FT                   ADWWIARYGATQELLQPEFTNIINLGIDTPANTPVGVHEFRVVSMEAHGEWISREHWYL
FT                   VIGCFWFVALLLVSFQKYVTLRRQVSDSAQKLNEAITKARKLEAESAKYRELSQIDQLT
FT                   QTLNRRGLMQTIDRYDHAKSWFSTAVILLDVDHFKQINDNYGHNSGDKVLAQIGRILRE
FT                   NVRTQDDVGRWGGEEFILVCPKTTAAGATAIAEKIRAIIDYKTFSIENDFRVSVSVGIS
FT                   IGHRSEHFEDVYHRADHALYEAKNSGRNCVVVAAEDATIA"
FT   gene            complement(711091..711324)
FT                   /locus_tag="TERTU_0687"
FT   CDS_pept        complement(711091..711324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0687"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0687"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13592"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNV6"
FT                   /protein_id="ACR13592.1"
FT                   /translation="MPDRITLEMDTQSLFSLLAGRQITLAEIHCPEKSQKDVVMRFVLE
FT                   LTKAQLQKNSKLMVSGQTSGANGVKTVKVRTR"
FT   gene            711489..711839
FT                   /locus_tag="TERTU_0688"
FT   CDS_pept        711489..711839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0688"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0688"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14627"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNV7"
FT                   /protein_id="ACR14627.1"
FT                   /translation="MRNGQHAIKENRHSYARAFFGCAWELALMHVHPGCKVNAYFAVNH
FT                   LVDAGDKLCRVLVAIGCQHETECLLRLMRDYVLLGAGDSALDASRREQLLTLYNVVDEL
FT                   TQLCSSGHATQH"
FT   gene            712299..713162
FT                   /locus_tag="TERTU_0690"
FT   CDS_pept        712299..713162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0690"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0690"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11334"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNV8"
FT                   /protein_id="ACR11334.1"
FT                   /translation="MLCALGRGAFGAEPVVVTYPKLDGGKAYNNRLAYFESLLALALES
FT                   SELPFVLKPYGLPMSSADRNRQNLQQHVYDVAWIHTTPALERSLTAVKIPLLKGLIGWR
FT                   LLFVRAEDVAAFQQVDSVEDLRNLIAGQGYDYPDNSILTSAGLELRTGLHRDNVVQMLL
FT                   KNRVDFFPRSITEIYDEWSLLGEPGLAIEQHLVLRYPSAFYFFVRKGDEQLAAALTKGL
FT                   RTAHENGSFDELFMRHFGEYIRHSNLEQRKVISIPYPRLDERVELDKQGYWYKLNNERA
FT                   APVAHR"
FT   gene            713946..715445
FT                   /gene="rrsA"
FT                   /locus_tag="TERTU_0692"
FT   rRNA            713946..715445
FT                   /gene="rrsA"
FT                   /locus_tag="TERTU_0692"
FT                   /product="16S ribosomal RNA"
FT   gene            715659..716498
FT                   /locus_tag="TERTU_0693"
FT   CDS_pept        715659..716498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0693"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0693"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13075"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNV9"
FT                   /protein_id="ACR13075.1"
FT                   /translation="MKLKELPKSLALSWKLSRMSGEQMIGVSRAKADNCIVSFTSIPSR
FT                   LSILHLTVRSLLCQTLSPEKIVLWLHQSLENQIPAAVSRLLSDKFEVRFSEETCAHRKL
FT                   VESHRLFANKVIVTCDDDVMYPPNWLEKLWTEHQMHPDDVIGNECRHVRYDAEGCALPY
FT                   WEWKGVSAGESSPYTLAIGYSGVLYPPGCLHPDVAQRELYDALAPRADDLWFKAMSLRV
FT                   KTRTRRAKVPAEKPTPIAFSQRYSLKHSNVRSDGNLVQWQALDARYSLKQLMELQAR"
FT   gene            716546..717364
FT                   /locus_tag="TERTU_0694"
FT   CDS_pept        716546..717364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0694"
FT                   /product="glycosyltransferase, group 2 family protein"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0694"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13575"
FT                   /db_xref="GOA:C5BNW0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNW0"
FT                   /protein_id="ACR13575.1"
FT                   /translation="MKISVIFTTYNSPVWLEKVLWGFHHQTDDNFEIVIADDGSGEETR
FT                   ALVESFKSQTHRPVQHIWHEDDGFQKCKILNKAIVAAAGEYIVMTDGDCIPRSDFIGAH
FT                   RAAARPGCFLSGGYFKLPMSTSRAITLDDIASGACFKKSWLVENGVKPSLKFLKLTQSP
FT                   MVSSVLNTLTTTKRSWNGHNASCWKADALTVNGFDERMKYGGLDCEFGGRLLNAGIKAN
FT                   QIRYKAICVHLDHARGYVNDEDWKRNRIIRKTSIRERLVETPAGIKQASS"
FT   gene            complement(717369..718394)
FT                   /locus_tag="TERTU_0695"
FT   CDS_pept        complement(717369..718394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0695"
FT                   /product="glycosyltransferase family 4 domain protein"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12197"
FT                   /db_xref="GOA:C5BNW1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNW1"
FT                   /protein_id="ACR12197.1"
FT                   /translation="MKIAHIILSRGFAGTERSTVESCNTQCQDHEVLLILRKNQAKKSG
FT                   AGIRDRLDPKVTVAEVSSRFFTRAAIQKILNQWQPDVAHAHLRRATRLLAKCNTSAARI
FT                   STLHIGFNGPHFLAMDGVIAISPWQLNHIPAGFNGHIRWVRNSLEPHPKPNRGKIEELR
FT                   GNMGAATGTYLIGGVGRLSRSKGWDLLIPAFKAAAIPEAKLCIIGEGSQEEKLKSLAGN
FT                   SKNIVFLGYKTNVKDYYPAFDLFVCPSREEPMGRVVLEAMDAGVKVIASDIEGPRDMLE
FT                   EFSGIMFKSDDIDSLTEALKHAYKTRNQATPQQDLSPHYADAVNRDMVSFYQETLSRLK
FT                   K"
FT   gene            718578..719636
FT                   /locus_tag="TERTU_0696"
FT   CDS_pept        718578..719636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0696"
FT                   /product="glycosyltransferase family 4 domain protein"
FT                   /note="identified by similarity to SP:O68547; match to
FT                   protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0696"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11784"
FT                   /db_xref="GOA:C5BNW2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNW2"
FT                   /protein_id="ACR11784.1"
FT                   /translation="MINKNADCELILGNSNPRFSGVTSTMLQNLEFQQRVMSVRVLGKH
FT                   HLQDKSLAISFWQLAKLARNPRLDGRYRIFHARRNDEMLQALVLRWLFRAKFKIVFTST
FT                   AQRHHSRYTRWLLSKMDAVISTCGAAASYLESAPDKIIAHGIRQDTFHPIADKRQILSD
FT                   LGLRGTTAIGIFGRVRKQKGVHVFVDACLNVFPDFPDAVAVIGGAINNSNEALVAELKE
FT                   KIQAASLQDRIRFLGEQPFDMVPRLFGAMDVVAALSQNEGFGLTVLEAMATGAAVIASE
FT                   AGAWPEIITQGETGFVVPVNNVEAVAERMRWLLANPDMRRTMAEKGRDLVLQKYTVERE
FT                   ARELCDFFKTLQ"
FT   gene            719646..720569
FT                   /gene="lpxL"
FT                   /locus_tag="TERTU_0697"
FT   CDS_pept        719646..720569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxL"
FT                   /locus_tag="TERTU_0697"
FT                   /product="lipid A biosynthesis lauroyl acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="identified by match to protein family HMM PF03279;
FT                   match to protein family HMM TIGR02207"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0697"
FT                   /db_xref="EnsemblGenomes-Tr:ACR12227"
FT                   /db_xref="GOA:C5BNW3"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="InterPro:IPR011920"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNW3"
FT                   /protein_id="ACR12227.1"
FT                   /translation="MSRIPFKRRLLHPKFMVSWVGMVLWWLFVQLLPLGAQFWLGNRLG
FT                   DLLLKLNVSRTKIARQNIAVCFPDMDPQRQELMVRDTLRATGIGVFESGAAWFWPNFRL
FT                   RRHFDVIGLEHLKLAQSSGRGVLFMGIHFTPIEIGAACVNTVTSIDGFYRPHKNAVYEY
FT                   VQAVGRIWRNNKSDVIPNGDVRGIIKALRNGRAVNYAPDQDYGRRRSVFAPFFGIAAAT
FT                   VKAPAQLARAGNAEIVPWVTRRLKNRRYEIEIYPPITAELTGDEAQDAAVINRFIEARV
FT                   REIPEQYLWVHRRFKTRPEGEPSIYS"
FT   gene            complement(720606..721151)
FT                   /locus_tag="TERTU_0698"
FT   CDS_pept        complement(720606..721151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0698"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0698"
FT                   /db_xref="EnsemblGenomes-Tr:ACR10890"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNW4"
FT                   /protein_id="ACR10890.1"
FT                   /translation="MVNKLQIFVLGSLLLLTADVGAAELSLGVGATAYQTDYLTGNAEF
FT                   DSADHDGTDIKATFAIHNVYGEYQRHKVGVGLDYFNVNDQRLIGYRALDYRYQVSRHFQ
FT                   GGLFLGAASLDSGIPQNGYYGGVNLGLLDVVFDTDIVFEINIGSGLARDRTSKDVPGEK
FT                   PDIFLDFVASSITLQKRF"
FT   gene            complement(721145..722581)
FT                   /locus_tag="TERTU_0699"
FT   CDS_pept        complement(721145..722581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0699"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0699"
FT                   /db_xref="EnsemblGenomes-Tr:ACR11355"
FT                   /db_xref="InterPro:IPR026950"
FT                   /db_xref="InterPro:IPR038636"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNW5"
FT                   /protein_id="ACR11355.1"
FT                   /translation="MTILKRFTLAVSCATGLFLTSEATIAGSLYLPTNLSPEIESRIAR
FT                   LFVQANMPVVKRPISIKQVQLALDNLGSKDPDLSASVRRYLERYSSRTGVTHTSVATYA
FT                   STEGYHTLPNSRGTESDSQYEASALAYLALNDWALLNVGGYVTDRENRKDEFLEGTFLS
FT                   IGPDQMQVDIGYRPHWLGPFQESDMLLSTNAPALPGVTLSNILPFKFLGISYELFLAEM
FT                   SESDLIRSQEDRDTRNTGNPRLFGLHLSFQPVDGFAIGFNRLMQYGGADRDDSLSSLSQ
FT                   AFFNAKENDNVGIKGRDFGNQLSSITTSYTFTGRFPAAIYMEYAGEDTSYSSEYHLGNT
FT                   ALMFGIHLPKLTRSLDFSYEYAEWQNAWYTNGNYGDGLREYEIPMGHWGANYRVFKDAV
FT                   GAKAETAKLIWDIRNGHSLTFKWRQLENKYYASRDYVPAKEGSLEYALASGPFIIGATI
FT                   TTGTTVFDENYSSLSGFFRW"
FT   gene            complement(722602..723690)
FT                   /locus_tag="TERTU_0700"
FT   CDS_pept        complement(722602..723690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0700"
FT                   /product="lipopolysaccharide heptosyltransferase"
FT                   /EC_number="2.4.1.-"
FT                   /note="glycosyltransferase family 9 (GT9) domain in CAZy;
FT                   identified by similarity to SP:P24173; match to protein
FT                   family HMM PF01075"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0700"
FT                   /db_xref="EnsemblGenomes-Tr:ACR14134"
FT                   /db_xref="GOA:C5BNW6"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNW6"
FT                   /protein_id="ACR14134.1"
FT                   /translation="MSLAPKTTSREKSILVVRLGDIGDLVISNPIASLIKHHAHNVRQT
FT                   WVIEESQLPLMRNHPDIDHLIVWQSDRWSQLLKSGRWTQLGRELRHLRRQLKERHYDIA
FT                   LDLQGLFSSAFVARLSGARIRIGLGSKHGSYWLVTKTISRNIGEQTQMGSEYRYLLSQL
FT                   GMPDAPWQTYIAQPERRRADITEHLGFDYTREQYAVFAPFTTRAEKRWPVKYWQQIALR
FT                   IRGRYQLKTVILGTEDFAEEAQTIASVTGAINLIGKTQLDEAADVIRHASLFVGVATGF
FT                   THMAHTFKVPVVGIFGPSCPYSYAGPDTSKVIFHERFCSPCRKKPTCNNRYDCMVEIKP
FT                   DEVLAEIKPLMKAAAEFRKYSS"
FT   gene            724267..727141
FT                   /gene="rrlA"
FT                   /locus_tag="TERTU_0701"
FT   rRNA            724267..727141
FT                   /gene="rrlA"
FT                   /locus_tag="TERTU_0701"
FT                   /product="23S ribosomal RNA"
FT   gene            727382..727497
FT                   /gene="rrfA"
FT                   /locus_tag="TERTU_0702"
FT   rRNA            727382..727497
FT                   /gene="rrfA"
FT                   /locus_tag="TERTU_0702"
FT                   /product="5S ribosomal RNA"
FT   gene            727761..728630
FT                   /locus_tag="TERTU_0703"
FT   CDS_pept        727761..728630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0703"
FT                   /product="potential MltA-interacting MipA family protein"
FT                   /note="identified by match to protein family HMM PF06629"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0703"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13650"
FT                   /db_xref="InterPro:IPR010583"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNW7"
FT                   /protein_id="ACR13650.1"
FT                   /translation="MRFVWLCLIALIFSHAPAKVLATDIAGDVQSAGMRFSEDGGYWEF
FT                   GLGIGYIHNPYNTRQEQDFADLYGDIEGSAVFRYRGLFLEAVQDTQDGVNLGYNLWQDK
FT                   RWSVDFLAASANRFYDTELDTKIQSSDDEETRNRKLYNRHSLYMGTGVRVSHYIDDYVI
FT                   QYRLVTDTLDDNGLMSTLRLGRGWQYRNWNFHAIASVGYTSETTNNYWFGVDSRVATEK
FT                   YPAYRPGSSVSGSLQLGLAKPLTEKWVVKAFAGWIQHTKEARNSPFVDDSDEFYWTLSI
FT                   NRVFSWEM"
FT   gene            728674..729054
FT                   /locus_tag="TERTU_0704"
FT   CDS_pept        728674..729054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0704"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0704"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13218"
FT                   /db_xref="InterPro:IPR021559"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNW8"
FT                   /protein_id="ACR13218.1"
FT                   /translation="MPLIAVFSVGADDSGALTKTREDVLNAKPNRCIALRQGQFCYQKV
FT                   EFRWYVDGATEHCLYLESQEAPLVCWQGTKLHKYDYEFKALQGQKFFIRDEVSGDKVAE
FT                   TAVDVAWVYKSGKKVSTGWRLF"
FT   gene            729256..730839
FT                   /gene="prfC"
FT                   /locus_tag="TERTU_0705"
FT   CDS_pept        729256..730839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfC"
FT                   /locus_tag="TERTU_0705"
FT                   /product="peptide chain release factor 3"
FT                   /note="identified by similarity to SP:Q56121; match to
FT                   protein family HMM PF00009; match to protein family HMM
FT                   PF03144; match to protein family HMM TIGR00231; match to
FT                   protein family HMM TIGR00503"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0705"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13686"
FT                   /db_xref="GOA:C5BNW9"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR032090"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038467"
FT                   /db_xref="InterPro:IPR041732"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BNW9"
FT                   /protein_id="ACR13686.1"
FT                   /translation="MASSQLAKEIAKRRTFAIISHPDAGKTTITEKLLLFGNAIQLAGS
FT                   VKGKRGPHAKSDWMTMEQERGISVTSSVMQFPYKERVVNLLDTPGHEDFSEDTYRTLTA
FT                   VDSVLMVIDGAKGVEDRTIKLMEVCRLRDTPILSFINKMDRDIRDPVEVMDEIEDVLKI
FT                   AAAPINWPIGMGKEFKGVYNLYTDTIHLYEHGQGHTIPEDIQIKGLDSEEASALLGAYA
FT                   EDVREEIELVRGATHEFDLDAYHAGELTPVFFGTALGNFGVREMLDGFVEWAPAPLDRD
FT                   TAERKVAADEDKFSGFIFKIQANMDPKHRDRIAFMRVCSGRYSQGMKMRHVRLGKDVKI
FT                   ADAVTFLAGDRSQVEEAISGDIIGLHNHGTIQIGDTFSSGEILKFTGIPHFAPELFRRI
FT                   RLKDPLKTKQLQRGLQQLSEEGSTQVFFPLNNNDIVVGAVGVLQFEVVAYRLKDEYKVE
FT                   AIYEPVNVNTARWVDCSDDKKLAEFKRKCSDNLALDGGGHLTYLAPTRVNLSLSEERYP
FT                   DVAFRATREH"
FT   gene            730851..731465
FT                   /locus_tag="TERTU_0706"
FT   CDS_pept        730851..731465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0706"
FT                   /product="acyltransferase family protein"
FT                   /note="identified by match to protein family HMM PF01553"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0706"
FT                   /db_xref="EnsemblGenomes-Tr:ACR13250"
FT                   /db_xref="GOA:C5BNX0"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNX0"
FT                   /protein_id="ACR13250.1"
FT                   /translation="MGLFSRKDTELLPEMPAIVPRAGGAARRWLGRTLLRLSGWRLEGE
FT                   FPHHRQMVLAAAPHTSNWDFVIAMFVIMALGVRVSYMMKKEAFFWPFGALFMKLGGIPI
FT                   DRKAATDVVEQVTQWYRDHEKVWVVITPEGTRAKVSRWKTGFLRIADSAQVPVCLVAWD
FT                   YPSKTMHIGPVWPVSGDYEADLASIREYICTRYTGQNPENQ"
FT   gene            731488..732561
FT                   /locus_tag="TERTU_0707"
FT   CDS_pept        731488..732561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TERTU_0707"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF01594"
FT                   /db_xref="EnsemblGenomes-Gn:TERTU_0707"
FT                   /db_xref="EnsemblGenomes-Tr:ACR10836"
FT                   /db_xref="GOA:C5BNX1"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:C5BNX1"
FT                   /protein_id="ACR10836.1"
FT                   /translation="METHSPIARF