(data stored in ACNUC7421 zone)

EMBL: CP001616

ID   CP001616; SV 1; circular; genomic DNA; STD; PRO; 3471292 BP.
XX
AC   CP001616; ACFZ01000000-ACFZ01000018;
XX
PR   Project:PRJNA33873;
XX
DT   25-MAY-2009 (Rel. 100, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Tolumonas auensis DSM 9187, complete genome.
XX
KW   .
XX
OS   Tolumonas auensis DSM 9187
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Aeromonadales;
OC   Aeromonadaceae; Tolumonas.
XX
RN   [1]
RP   1-3471292
RX   DOI; 10.4056/sigs.2184986.
RX   PUBMED; 22180815.
RA   Chertkov O., Copeland A., Lucas S., Lapidus A., Berry K.W., Detter J.C.,
RA   Del Rio T.G., Hammon N., Dalin E., Tice H., Pitluck S., Richardson P.,
RA   Bruce D., Goodwin L., Han C., Tapia R., Saunders E., Schmutz J.,
RA   Brettin T., Larimer F., Land M., Hauser L., Spring S., Rohde M.,
RA   Kyrpides N.C., Ivanova N., Goker M., Beller H.R., Klenk H.P., Woyke T.;
RT   "Complete genome sequence of Tolumonas auensis type strain (TA 4)";
RL   Stand Genomic Sci 5(1):112-120(2011).
XX
RN   [2]
RP   1-3471292
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Tice H., Bruce D.,
RA   Goodwin L., Pitluck S., Chertkov O., Brettin T., Detter J.C., Han C.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Mikhailova N., Spring S.,
RA   Beller H.;
RT   ;
RL   Submitted (01-MAY-2009) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B310, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 9195a25b3b81c0e1dbbeeb928eb07ebe.
DR   BioSample; SAMN02598508.
DR   CABRI; DSM 9187.
DR   EnsemblGenomes-Gn; EBG00001075931.
DR   EnsemblGenomes-Gn; EBG00001075932.
DR   EnsemblGenomes-Gn; EBG00001075934.
DR   EnsemblGenomes-Gn; EBG00001075936.
DR   EnsemblGenomes-Gn; EBG00001075938.
DR   EnsemblGenomes-Gn; EBG00001075940.
DR   EnsemblGenomes-Gn; EBG00001075942.
DR   EnsemblGenomes-Gn; EBG00001075944.
DR   EnsemblGenomes-Gn; EBG00001075946.
DR   EnsemblGenomes-Gn; EBG00001075948.
DR   EnsemblGenomes-Gn; EBG00001075950.
DR   EnsemblGenomes-Gn; EBG00001075952.
DR   EnsemblGenomes-Gn; EBG00001075955.
DR   EnsemblGenomes-Gn; EBG00001075957.
DR   EnsemblGenomes-Gn; EBG00001075959.
DR   EnsemblGenomes-Gn; EBG00001075961.
DR   EnsemblGenomes-Gn; EBG00001075964.
DR   EnsemblGenomes-Gn; EBG00001075966.
DR   EnsemblGenomes-Gn; EBG00001075969.
DR   EnsemblGenomes-Gn; EBG00001075972.
DR   EnsemblGenomes-Gn; EBG00001075974.
DR   EnsemblGenomes-Gn; EBG00001075976.
DR   EnsemblGenomes-Gn; EBG00001075979.
DR   EnsemblGenomes-Gn; EBG00001075982.
DR   EnsemblGenomes-Gn; EBG00001075985.
DR   EnsemblGenomes-Gn; EBG00001075987.
DR   EnsemblGenomes-Gn; EBG00001075989.
DR   EnsemblGenomes-Gn; EBG00001075991.
DR   EnsemblGenomes-Gn; EBG00001075992.
DR   EnsemblGenomes-Gn; EBG00001075993.
DR   EnsemblGenomes-Gn; EBG00001075994.
DR   EnsemblGenomes-Gn; EBG00001075995.
DR   EnsemblGenomes-Gn; EBG00001075996.
DR   EnsemblGenomes-Gn; EBG00001075997.
DR   EnsemblGenomes-Gn; EBG00001075998.
DR   EnsemblGenomes-Gn; EBG00001075999.
DR   EnsemblGenomes-Gn; EBG00001076000.
DR   EnsemblGenomes-Gn; EBG00001076001.
DR   EnsemblGenomes-Gn; EBG00001076002.
DR   EnsemblGenomes-Gn; EBG00001076003.
DR   EnsemblGenomes-Gn; EBG00001076004.
DR   EnsemblGenomes-Gn; EBG00001076005.
DR   EnsemblGenomes-Gn; EBG00001076006.
DR   EnsemblGenomes-Gn; EBG00001076007.
DR   EnsemblGenomes-Gn; EBG00001076008.
DR   EnsemblGenomes-Gn; EBG00001076009.
DR   EnsemblGenomes-Gn; EBG00001076010.
DR   EnsemblGenomes-Gn; EBG00001076011.
DR   EnsemblGenomes-Gn; EBG00001076012.
DR   EnsemblGenomes-Gn; EBG00001076013.
DR   EnsemblGenomes-Gn; EBG00001076014.
DR   EnsemblGenomes-Gn; EBG00001076015.
DR   EnsemblGenomes-Gn; EBG00001076016.
DR   EnsemblGenomes-Gn; EBG00001076017.
DR   EnsemblGenomes-Gn; EBG00001076018.
DR   EnsemblGenomes-Gn; EBG00001076019.
DR   EnsemblGenomes-Gn; EBG00001076020.
DR   EnsemblGenomes-Gn; EBG00001076021.
DR   EnsemblGenomes-Gn; EBG00001076022.
DR   EnsemblGenomes-Gn; EBG00001076023.
DR   EnsemblGenomes-Gn; EBG00001076024.
DR   EnsemblGenomes-Gn; EBG00001076025.
DR   EnsemblGenomes-Gn; EBG00001076026.
DR   EnsemblGenomes-Gn; EBG00001076028.
DR   EnsemblGenomes-Gn; EBG00001076030.
DR   EnsemblGenomes-Gn; EBG00001076032.
DR   EnsemblGenomes-Gn; EBG00001076033.
DR   EnsemblGenomes-Gn; EBG00001076035.
DR   EnsemblGenomes-Gn; EBG00001076037.
DR   EnsemblGenomes-Gn; EBG00001076039.
DR   EnsemblGenomes-Gn; EBG00001076041.
DR   EnsemblGenomes-Gn; EBG00001076042.
DR   EnsemblGenomes-Gn; EBG00001076043.
DR   EnsemblGenomes-Gn; EBG00001076044.
DR   EnsemblGenomes-Gn; EBG00001076045.
DR   EnsemblGenomes-Gn; EBG00001076046.
DR   EnsemblGenomes-Gn; EBG00001076047.
DR   EnsemblGenomes-Gn; EBG00001076048.
DR   EnsemblGenomes-Gn; EBG00001076049.
DR   EnsemblGenomes-Gn; EBG00001076051.
DR   EnsemblGenomes-Gn; EBG00001076052.
DR   EnsemblGenomes-Gn; EBG00001076053.
DR   EnsemblGenomes-Gn; EBG00001076054.
DR   EnsemblGenomes-Gn; EBG00001076055.
DR   EnsemblGenomes-Gn; EBG00001076056.
DR   EnsemblGenomes-Gn; EBG00001076057.
DR   EnsemblGenomes-Gn; EBG00001076058.
DR   EnsemblGenomes-Gn; EBG00001076060.
DR   EnsemblGenomes-Gn; EBG00001076061.
DR   EnsemblGenomes-Gn; EBG00001076062.
DR   EnsemblGenomes-Gn; EBG00001076063.
DR   EnsemblGenomes-Gn; EBG00001076066.
DR   EnsemblGenomes-Gn; EBG00001076068.
DR   EnsemblGenomes-Gn; EBG00001076069.
DR   EnsemblGenomes-Gn; EBG00001076071.
DR   EnsemblGenomes-Gn; EBG00001076073.
DR   EnsemblGenomes-Gn; EBG00001076074.
DR   EnsemblGenomes-Gn; EBG00001076075.
DR   EnsemblGenomes-Gn; EBG00001076076.
DR   EnsemblGenomes-Gn; EBG00001076077.
DR   EnsemblGenomes-Gn; EBG00001076078.
DR   EnsemblGenomes-Gn; EBG00001076080.
DR   EnsemblGenomes-Gn; EBG00001076081.
DR   EnsemblGenomes-Gn; EBG00001076082.
DR   EnsemblGenomes-Gn; EBG00001076083.
DR   EnsemblGenomes-Gn; EBG00001076084.
DR   EnsemblGenomes-Gn; EBG00001076086.
DR   EnsemblGenomes-Gn; EBG00001076087.
DR   EnsemblGenomes-Gn; EBG00001076088.
DR   EnsemblGenomes-Gn; EBG00001076089.
DR   EnsemblGenomes-Gn; EBG00001076090.
DR   EnsemblGenomes-Gn; EBG00001076091.
DR   EnsemblGenomes-Gn; EBG00001076093.
DR   EnsemblGenomes-Gn; EBG00001076094.
DR   EnsemblGenomes-Gn; EBG00001076095.
DR   EnsemblGenomes-Gn; EBG00001076097.
DR   EnsemblGenomes-Gn; EBG00001076099.
DR   EnsemblGenomes-Gn; EBG00001076100.
DR   EnsemblGenomes-Gn; EBG00001076101.
DR   EnsemblGenomes-Gn; EBG00001076102.
DR   EnsemblGenomes-Gn; EBG00001076103.
DR   EnsemblGenomes-Gn; EBG00001076104.
DR   EnsemblGenomes-Gn; EBG00001076105.
DR   EnsemblGenomes-Gn; EBG00001076106.
DR   EnsemblGenomes-Gn; EBG00001076107.
DR   EnsemblGenomes-Gn; EBG00001076108.
DR   EnsemblGenomes-Gn; EBG00001076109.
DR   EnsemblGenomes-Gn; EBG00001076110.
DR   EnsemblGenomes-Gn; EBG00001076111.
DR   EnsemblGenomes-Gn; EBG00001076113.
DR   EnsemblGenomes-Gn; EBG00001076114.
DR   EnsemblGenomes-Gn; EBG00001076116.
DR   EnsemblGenomes-Gn; EBG00001076118.
DR   EnsemblGenomes-Gn; EBG00001076120.
DR   EnsemblGenomes-Gn; EBG00001076122.
DR   EnsemblGenomes-Gn; EBG00001076124.
DR   EnsemblGenomes-Gn; EBG00001076126.
DR   EnsemblGenomes-Gn; EBG00001076127.
DR   EnsemblGenomes-Gn; EBG00001076129.
DR   EnsemblGenomes-Gn; EBG00001076132.
DR   EnsemblGenomes-Gn; EBG00001076134.
DR   EnsemblGenomes-Gn; EBG00001076137.
DR   EnsemblGenomes-Gn; EBG00001076139.
DR   EnsemblGenomes-Gn; EBG00001076141.
DR   EnsemblGenomes-Gn; EBG00001076143.
DR   EnsemblGenomes-Gn; EBG00001076146.
DR   EnsemblGenomes-Gn; EBG00001076149.
DR   EnsemblGenomes-Gn; EBG00001076151.
DR   EnsemblGenomes-Gn; EBG00001076152.
DR   EnsemblGenomes-Gn; EBG00001076153.
DR   EnsemblGenomes-Gn; EBG00001076155.
DR   EnsemblGenomes-Gn; EBG00001076156.
DR   EnsemblGenomes-Gn; EBG00001076158.
DR   EnsemblGenomes-Gn; EBG00001076160.
DR   EnsemblGenomes-Gn; EBG00001076162.
DR   EnsemblGenomes-Gn; EBG00001076163.
DR   EnsemblGenomes-Gn; EBG00001076165.
DR   EnsemblGenomes-Gn; EBG00001076167.
DR   EnsemblGenomes-Gn; EBG00001076169.
DR   EnsemblGenomes-Gn; EBG00001076170.
DR   EnsemblGenomes-Gn; EBG00001076171.
DR   EnsemblGenomes-Gn; EBG00001076172.
DR   EnsemblGenomes-Gn; EBG00001076173.
DR   EnsemblGenomes-Gn; EBG00001076174.
DR   EnsemblGenomes-Gn; EBG00001076175.
DR   EnsemblGenomes-Gn; EBG00001076176.
DR   EnsemblGenomes-Gn; EBG00001076177.
DR   EnsemblGenomes-Gn; EBG00001076179.
DR   EnsemblGenomes-Gn; EBG00001076180.
DR   EnsemblGenomes-Gn; EBG00001076181.
DR   EnsemblGenomes-Gn; EBG00001076182.
DR   EnsemblGenomes-Gn; EBG00001076184.
DR   EnsemblGenomes-Gn; EBG00001076187.
DR   EnsemblGenomes-Gn; EBG00001076190.
DR   EnsemblGenomes-Gn; EBG00001076192.
DR   EnsemblGenomes-Gn; EBG00001076194.
DR   EnsemblGenomes-Gn; EBG00001076196.
DR   EnsemblGenomes-Gn; EBG00001076198.
DR   EnsemblGenomes-Gn; EBG00001076200.
DR   EnsemblGenomes-Gn; EBG00001076202.
DR   EnsemblGenomes-Gn; EBG00001076204.
DR   EnsemblGenomes-Gn; EBG00001076206.
DR   EnsemblGenomes-Gn; EBG00001076209.
DR   EnsemblGenomes-Gn; EBG00001076211.
DR   EnsemblGenomes-Gn; EBG00001076213.
DR   EnsemblGenomes-Gn; EBG00001076215.
DR   EnsemblGenomes-Gn; EBG00001076217.
DR   EnsemblGenomes-Gn; EBG00001076219.
DR   EnsemblGenomes-Gn; EBG00001076221.
DR   EnsemblGenomes-Gn; EBG00001076223.
DR   EnsemblGenomes-Gn; EBG00001076225.
DR   EnsemblGenomes-Gn; EBG00001076226.
DR   EnsemblGenomes-Gn; EBG00001076228.
DR   EnsemblGenomes-Gn; EBG00001076230.
DR   EnsemblGenomes-Gn; EBG00001076232.
DR   EnsemblGenomes-Gn; EBG00001076234.
DR   EnsemblGenomes-Gn; EBG00001076235.
DR   EnsemblGenomes-Gn; EBG00001076236.
DR   EnsemblGenomes-Gn; EBG00001076237.
DR   EnsemblGenomes-Gn; EBG00001076238.
DR   EnsemblGenomes-Gn; EBG00001076239.
DR   EnsemblGenomes-Gn; EBG00001076240.
DR   EnsemblGenomes-Gn; EBG00001076241.
DR   EnsemblGenomes-Gn; EBG00001076243.
DR   EnsemblGenomes-Gn; EBG00001076244.
DR   EnsemblGenomes-Gn; EBG00001076246.
DR   EnsemblGenomes-Gn; EBG00001076247.
DR   EnsemblGenomes-Gn; EBG00001076249.
DR   EnsemblGenomes-Gn; EBG00001076250.
DR   EnsemblGenomes-Gn; EBG00001076251.
DR   EnsemblGenomes-Gn; EBG00001076252.
DR   EnsemblGenomes-Gn; EBG00001076253.
DR   EnsemblGenomes-Gn; EBG00001076254.
DR   EnsemblGenomes-Gn; EBG00001076255.
DR   EnsemblGenomes-Gn; EBG00001076256.
DR   EnsemblGenomes-Gn; EBG00001076257.
DR   EnsemblGenomes-Gn; EBG00001076258.
DR   EnsemblGenomes-Gn; EBG00001076260.
DR   EnsemblGenomes-Gn; EBG00001076261.
DR   EnsemblGenomes-Gn; EBG00001076262.
DR   EnsemblGenomes-Gn; EBG00001076263.
DR   EnsemblGenomes-Gn; EBG00001076264.
DR   EnsemblGenomes-Gn; EBG00001076266.
DR   EnsemblGenomes-Gn; EBG00001076268.
DR   EnsemblGenomes-Gn; EBG00001076271.
DR   EnsemblGenomes-Gn; EBG00001076273.
DR   EnsemblGenomes-Gn; EBG00001076277.
DR   EnsemblGenomes-Gn; Tola_R0001.
DR   EnsemblGenomes-Gn; Tola_R0002.
DR   EnsemblGenomes-Gn; Tola_R0003.
DR   EnsemblGenomes-Gn; Tola_R0004.
DR   EnsemblGenomes-Gn; Tola_R0005.
DR   EnsemblGenomes-Gn; Tola_R0006.
DR   EnsemblGenomes-Gn; Tola_R0007.
DR   EnsemblGenomes-Gn; Tola_R0008.
DR   EnsemblGenomes-Gn; Tola_R0009.
DR   EnsemblGenomes-Gn; Tola_R0010.
DR   EnsemblGenomes-Gn; Tola_R0011.
DR   EnsemblGenomes-Gn; Tola_R0012.
DR   EnsemblGenomes-Gn; Tola_R0013.
DR   EnsemblGenomes-Gn; Tola_R0014.
DR   EnsemblGenomes-Gn; Tola_R0015.
DR   EnsemblGenomes-Gn; Tola_R0016.
DR   EnsemblGenomes-Gn; Tola_R0017.
DR   EnsemblGenomes-Gn; Tola_R0018.
DR   EnsemblGenomes-Gn; Tola_R0019.
DR   EnsemblGenomes-Gn; Tola_R0020.
DR   EnsemblGenomes-Gn; Tola_R0021.
DR   EnsemblGenomes-Gn; Tola_R0022.
DR   EnsemblGenomes-Gn; Tola_R0023.
DR   EnsemblGenomes-Gn; Tola_R0024.
DR   EnsemblGenomes-Gn; Tola_R0025.
DR   EnsemblGenomes-Gn; Tola_R0026.
DR   EnsemblGenomes-Gn; Tola_R0027.
DR   EnsemblGenomes-Gn; Tola_R0028.
DR   EnsemblGenomes-Gn; Tola_R0029.
DR   EnsemblGenomes-Gn; Tola_R0030.
DR   EnsemblGenomes-Gn; Tola_R0031.
DR   EnsemblGenomes-Gn; Tola_R0032.
DR   EnsemblGenomes-Gn; Tola_R0033.
DR   EnsemblGenomes-Gn; Tola_R0034.
DR   EnsemblGenomes-Gn; Tola_R0035.
DR   EnsemblGenomes-Gn; Tola_R0036.
DR   EnsemblGenomes-Gn; Tola_R0037.
DR   EnsemblGenomes-Gn; Tola_R0038.
DR   EnsemblGenomes-Gn; Tola_R0039.
DR   EnsemblGenomes-Gn; Tola_R0040.
DR   EnsemblGenomes-Gn; Tola_R0041.
DR   EnsemblGenomes-Gn; Tola_R0042.
DR   EnsemblGenomes-Gn; Tola_R0043.
DR   EnsemblGenomes-Gn; Tola_R0044.
DR   EnsemblGenomes-Gn; Tola_R0045.
DR   EnsemblGenomes-Gn; Tola_R0046.
DR   EnsemblGenomes-Gn; Tola_R0047.
DR   EnsemblGenomes-Gn; Tola_R0048.
DR   EnsemblGenomes-Gn; Tola_R0049.
DR   EnsemblGenomes-Gn; Tola_R0050.
DR   EnsemblGenomes-Gn; Tola_R0051.
DR   EnsemblGenomes-Gn; Tola_R0052.
DR   EnsemblGenomes-Gn; Tola_R0053.
DR   EnsemblGenomes-Gn; Tola_R0054.
DR   EnsemblGenomes-Gn; Tola_R0055.
DR   EnsemblGenomes-Gn; Tola_R0056.
DR   EnsemblGenomes-Gn; Tola_R0057.
DR   EnsemblGenomes-Gn; Tola_R0058.
DR   EnsemblGenomes-Gn; Tola_R0059.
DR   EnsemblGenomes-Gn; Tola_R0060.
DR   EnsemblGenomes-Gn; Tola_R0061.
DR   EnsemblGenomes-Gn; Tola_R0062.
DR   EnsemblGenomes-Gn; Tola_R0063.
DR   EnsemblGenomes-Gn; Tola_R0064.
DR   EnsemblGenomes-Gn; Tola_R0065.
DR   EnsemblGenomes-Gn; Tola_R0066.
DR   EnsemblGenomes-Gn; Tola_R0067.
DR   EnsemblGenomes-Gn; Tola_R0068.
DR   EnsemblGenomes-Gn; Tola_R0069.
DR   EnsemblGenomes-Gn; Tola_R0070.
DR   EnsemblGenomes-Gn; Tola_R0071.
DR   EnsemblGenomes-Gn; Tola_R0072.
DR   EnsemblGenomes-Gn; Tola_R0073.
DR   EnsemblGenomes-Gn; Tola_R0074.
DR   EnsemblGenomes-Gn; Tola_R0075.
DR   EnsemblGenomes-Gn; Tola_R0076.
DR   EnsemblGenomes-Gn; Tola_R0077.
DR   EnsemblGenomes-Gn; Tola_R0078.
DR   EnsemblGenomes-Gn; Tola_R0079.
DR   EnsemblGenomes-Gn; Tola_R0080.
DR   EnsemblGenomes-Gn; Tola_R0081.
DR   EnsemblGenomes-Gn; Tola_R0082.
DR   EnsemblGenomes-Gn; Tola_R0083.
DR   EnsemblGenomes-Gn; Tola_R0084.
DR   EnsemblGenomes-Gn; Tola_R0085.
DR   EnsemblGenomes-Gn; Tola_R0086.
DR   EnsemblGenomes-Gn; Tola_R0087.
DR   EnsemblGenomes-Gn; Tola_R0088.
DR   EnsemblGenomes-Gn; Tola_R0089.
DR   EnsemblGenomes-Gn; Tola_R0090.
DR   EnsemblGenomes-Gn; Tola_R0091.
DR   EnsemblGenomes-Gn; Tola_R0092.
DR   EnsemblGenomes-Gn; Tola_R0093.
DR   EnsemblGenomes-Gn; Tola_R0094.
DR   EnsemblGenomes-Gn; Tola_R0095.
DR   EnsemblGenomes-Gn; Tola_R0096.
DR   EnsemblGenomes-Gn; Tola_R0097.
DR   EnsemblGenomes-Gn; Tola_R0098.
DR   EnsemblGenomes-Gn; Tola_R0099.
DR   EnsemblGenomes-Gn; Tola_R0100.
DR   EnsemblGenomes-Gn; Tola_R0101.
DR   EnsemblGenomes-Gn; Tola_R0102.
DR   EnsemblGenomes-Gn; Tola_R0103.
DR   EnsemblGenomes-Gn; Tola_R0104.
DR   EnsemblGenomes-Gn; Tola_R0105.
DR   EnsemblGenomes-Gn; Tola_R0106.
DR   EnsemblGenomes-Gn; Tola_R0107.
DR   EnsemblGenomes-Gn; Tola_R0108.
DR   EnsemblGenomes-Gn; Tola_R0109.
DR   EnsemblGenomes-Gn; Tola_R0110.
DR   EnsemblGenomes-Gn; Tola_R0111.
DR   EnsemblGenomes-Gn; Tola_R0112.
DR   EnsemblGenomes-Gn; Tola_R0113.
DR   EnsemblGenomes-Gn; Tola_R0114.
DR   EnsemblGenomes-Gn; Tola_R0115.
DR   EnsemblGenomes-Gn; Tola_R0116.
DR   EnsemblGenomes-Gn; Tola_R0117.
DR   EnsemblGenomes-Gn; Tola_R0118.
DR   EnsemblGenomes-Gn; Tola_R0119.
DR   EnsemblGenomes-Gn; Tola_R0120.
DR   EnsemblGenomes-Tr; EBT00001678573.
DR   EnsemblGenomes-Tr; EBT00001678575.
DR   EnsemblGenomes-Tr; EBT00001678577.
DR   EnsemblGenomes-Tr; EBT00001678578.
DR   EnsemblGenomes-Tr; EBT00001678579.
DR   EnsemblGenomes-Tr; EBT00001678580.
DR   EnsemblGenomes-Tr; EBT00001678582.
DR   EnsemblGenomes-Tr; EBT00001678584.
DR   EnsemblGenomes-Tr; EBT00001678586.
DR   EnsemblGenomes-Tr; EBT00001678588.
DR   EnsemblGenomes-Tr; EBT00001678589.
DR   EnsemblGenomes-Tr; EBT00001678591.
DR   EnsemblGenomes-Tr; EBT00001678593.
DR   EnsemblGenomes-Tr; EBT00001678596.
DR   EnsemblGenomes-Tr; EBT00001678600.
DR   EnsemblGenomes-Tr; EBT00001678604.
DR   EnsemblGenomes-Tr; EBT00001678605.
DR   EnsemblGenomes-Tr; EBT00001678607.
DR   EnsemblGenomes-Tr; EBT00001678611.
DR   EnsemblGenomes-Tr; EBT00001678612.
DR   EnsemblGenomes-Tr; EBT00001678613.
DR   EnsemblGenomes-Tr; EBT00001678614.
DR   EnsemblGenomes-Tr; EBT00001678617.
DR   EnsemblGenomes-Tr; EBT00001678618.
DR   EnsemblGenomes-Tr; EBT00001678620.
DR   EnsemblGenomes-Tr; EBT00001678623.
DR   EnsemblGenomes-Tr; EBT00001678628.
DR   EnsemblGenomes-Tr; EBT00001678632.
DR   EnsemblGenomes-Tr; EBT00001678636.
DR   EnsemblGenomes-Tr; EBT00001678638.
DR   EnsemblGenomes-Tr; EBT00001678639.
DR   EnsemblGenomes-Tr; EBT00001678640.
DR   EnsemblGenomes-Tr; EBT00001678641.
DR   EnsemblGenomes-Tr; EBT00001678642.
DR   EnsemblGenomes-Tr; EBT00001678643.
DR   EnsemblGenomes-Tr; EBT00001678646.
DR   EnsemblGenomes-Tr; EBT00001678648.
DR   EnsemblGenomes-Tr; EBT00001678651.
DR   EnsemblGenomes-Tr; EBT00001678653.
DR   EnsemblGenomes-Tr; EBT00001678657.
DR   EnsemblGenomes-Tr; EBT00001678661.
DR   EnsemblGenomes-Tr; EBT00001678662.
DR   EnsemblGenomes-Tr; EBT00001678663.
DR   EnsemblGenomes-Tr; EBT00001678664.
DR   EnsemblGenomes-Tr; EBT00001678667.
DR   EnsemblGenomes-Tr; EBT00001678669.
DR   EnsemblGenomes-Tr; EBT00001678671.
DR   EnsemblGenomes-Tr; EBT00001678673.
DR   EnsemblGenomes-Tr; EBT00001678676.
DR   EnsemblGenomes-Tr; EBT00001678679.
DR   EnsemblGenomes-Tr; EBT00001678681.
DR   EnsemblGenomes-Tr; EBT00001678685.
DR   EnsemblGenomes-Tr; EBT00001678690.
DR   EnsemblGenomes-Tr; EBT00001678692.
DR   EnsemblGenomes-Tr; EBT00001678694.
DR   EnsemblGenomes-Tr; EBT00001678696.
DR   EnsemblGenomes-Tr; EBT00001678698.
DR   EnsemblGenomes-Tr; EBT00001678699.
DR   EnsemblGenomes-Tr; EBT00001678700.
DR   EnsemblGenomes-Tr; EBT00001678702.
DR   EnsemblGenomes-Tr; EBT00001678704.
DR   EnsemblGenomes-Tr; EBT00001678706.
DR   EnsemblGenomes-Tr; EBT00001678708.
DR   EnsemblGenomes-Tr; EBT00001678710.
DR   EnsemblGenomes-Tr; EBT00001678712.
DR   EnsemblGenomes-Tr; EBT00001678714.
DR   EnsemblGenomes-Tr; EBT00001678716.
DR   EnsemblGenomes-Tr; EBT00001678718.
DR   EnsemblGenomes-Tr; EBT00001678720.
DR   EnsemblGenomes-Tr; EBT00001678723.
DR   EnsemblGenomes-Tr; EBT00001678725.
DR   EnsemblGenomes-Tr; EBT00001678727.
DR   EnsemblGenomes-Tr; EBT00001678728.
DR   EnsemblGenomes-Tr; EBT00001678730.
DR   EnsemblGenomes-Tr; EBT00001678732.
DR   EnsemblGenomes-Tr; EBT00001678734.
DR   EnsemblGenomes-Tr; EBT00001678737.
DR   EnsemblGenomes-Tr; EBT00001678739.
DR   EnsemblGenomes-Tr; EBT00001678741.
DR   EnsemblGenomes-Tr; EBT00001678743.
DR   EnsemblGenomes-Tr; EBT00001678745.
DR   EnsemblGenomes-Tr; EBT00001678746.
DR   EnsemblGenomes-Tr; EBT00001678749.
DR   EnsemblGenomes-Tr; EBT00001678750.
DR   EnsemblGenomes-Tr; EBT00001678752.
DR   EnsemblGenomes-Tr; EBT00001678753.
DR   EnsemblGenomes-Tr; EBT00001678755.
DR   EnsemblGenomes-Tr; EBT00001678757.
DR   EnsemblGenomes-Tr; EBT00001678760.
DR   EnsemblGenomes-Tr; EBT00001678763.
DR   EnsemblGenomes-Tr; EBT00001678764.
DR   EnsemblGenomes-Tr; EBT00001678766.
DR   EnsemblGenomes-Tr; EBT00001678768.
DR   EnsemblGenomes-Tr; EBT00001678770.
DR   EnsemblGenomes-Tr; EBT00001678772.
DR   EnsemblGenomes-Tr; EBT00001678774.
DR   EnsemblGenomes-Tr; EBT00001678775.
DR   EnsemblGenomes-Tr; EBT00001678777.
DR   EnsemblGenomes-Tr; EBT00001678778.
DR   EnsemblGenomes-Tr; EBT00001678780.
DR   EnsemblGenomes-Tr; EBT00001678783.
DR   EnsemblGenomes-Tr; EBT00001678784.
DR   EnsemblGenomes-Tr; EBT00001678785.
DR   EnsemblGenomes-Tr; EBT00001678787.
DR   EnsemblGenomes-Tr; EBT00001678788.
DR   EnsemblGenomes-Tr; EBT00001678789.
DR   EnsemblGenomes-Tr; EBT00001678791.
DR   EnsemblGenomes-Tr; EBT00001678793.
DR   EnsemblGenomes-Tr; EBT00001678795.
DR   EnsemblGenomes-Tr; EBT00001678797.
DR   EnsemblGenomes-Tr; EBT00001678799.
DR   EnsemblGenomes-Tr; EBT00001678800.
DR   EnsemblGenomes-Tr; EBT00001678801.
DR   EnsemblGenomes-Tr; EBT00001678802.
DR   EnsemblGenomes-Tr; EBT00001678804.
DR   EnsemblGenomes-Tr; EBT00001678805.
DR   EnsemblGenomes-Tr; EBT00001678807.
DR   EnsemblGenomes-Tr; EBT00001678809.
DR   EnsemblGenomes-Tr; EBT00001678810.
DR   EnsemblGenomes-Tr; EBT00001678811.
DR   EnsemblGenomes-Tr; EBT00001678815.
DR   EnsemblGenomes-Tr; EBT00001678817.
DR   EnsemblGenomes-Tr; EBT00001678821.
DR   EnsemblGenomes-Tr; EBT00001678824.
DR   EnsemblGenomes-Tr; EBT00001678826.
DR   EnsemblGenomes-Tr; EBT00001678829.
DR   EnsemblGenomes-Tr; EBT00001678832.
DR   EnsemblGenomes-Tr; EBT00001678835.
DR   EnsemblGenomes-Tr; EBT00001678837.
DR   EnsemblGenomes-Tr; EBT00001678840.
DR   EnsemblGenomes-Tr; EBT00001678842.
DR   EnsemblGenomes-Tr; EBT00001678845.
DR   EnsemblGenomes-Tr; EBT00001678848.
DR   EnsemblGenomes-Tr; EBT00001678851.
DR   EnsemblGenomes-Tr; EBT00001678854.
DR   EnsemblGenomes-Tr; EBT00001678857.
DR   EnsemblGenomes-Tr; EBT00001678861.
DR   EnsemblGenomes-Tr; EBT00001678865.
DR   EnsemblGenomes-Tr; EBT00001678868.
DR   EnsemblGenomes-Tr; EBT00001678871.
DR   EnsemblGenomes-Tr; EBT00001678874.
DR   EnsemblGenomes-Tr; EBT00001678876.
DR   EnsemblGenomes-Tr; EBT00001678878.
DR   EnsemblGenomes-Tr; EBT00001678881.
DR   EnsemblGenomes-Tr; EBT00001678883.
DR   EnsemblGenomes-Tr; EBT00001678886.
DR   EnsemblGenomes-Tr; EBT00001678888.
DR   EnsemblGenomes-Tr; EBT00001678892.
DR   EnsemblGenomes-Tr; EBT00001678894.
DR   EnsemblGenomes-Tr; EBT00001678895.
DR   EnsemblGenomes-Tr; EBT00001678896.
DR   EnsemblGenomes-Tr; EBT00001678897.
DR   EnsemblGenomes-Tr; EBT00001678898.
DR   EnsemblGenomes-Tr; EBT00001678899.
DR   EnsemblGenomes-Tr; EBT00001678900.
DR   EnsemblGenomes-Tr; EBT00001678901.
DR   EnsemblGenomes-Tr; EBT00001678902.
DR   EnsemblGenomes-Tr; EBT00001678903.
DR   EnsemblGenomes-Tr; EBT00001678904.
DR   EnsemblGenomes-Tr; EBT00001678905.
DR   EnsemblGenomes-Tr; EBT00001678906.
DR   EnsemblGenomes-Tr; EBT00001678907.
DR   EnsemblGenomes-Tr; EBT00001678908.
DR   EnsemblGenomes-Tr; EBT00001678909.
DR   EnsemblGenomes-Tr; EBT00001678910.
DR   EnsemblGenomes-Tr; EBT00001678911.
DR   EnsemblGenomes-Tr; EBT00001678912.
DR   EnsemblGenomes-Tr; EBT00001678913.
DR   EnsemblGenomes-Tr; EBT00001678914.
DR   EnsemblGenomes-Tr; EBT00001678915.
DR   EnsemblGenomes-Tr; EBT00001678916.
DR   EnsemblGenomes-Tr; EBT00001678917.
DR   EnsemblGenomes-Tr; EBT00001678918.
DR   EnsemblGenomes-Tr; EBT00001678919.
DR   EnsemblGenomes-Tr; EBT00001678920.
DR   EnsemblGenomes-Tr; EBT00001678921.
DR   EnsemblGenomes-Tr; EBT00001678922.
DR   EnsemblGenomes-Tr; EBT00001678923.
DR   EnsemblGenomes-Tr; EBT00001678924.
DR   EnsemblGenomes-Tr; EBT00001678925.
DR   EnsemblGenomes-Tr; EBT00001678926.
DR   EnsemblGenomes-Tr; EBT00001678927.
DR   EnsemblGenomes-Tr; EBT00001678928.
DR   EnsemblGenomes-Tr; EBT00001678929.
DR   EnsemblGenomes-Tr; EBT00001678930.
DR   EnsemblGenomes-Tr; EBT00001678931.
DR   EnsemblGenomes-Tr; EBT00001678932.
DR   EnsemblGenomes-Tr; EBT00001678933.
DR   EnsemblGenomes-Tr; EBT00001678934.
DR   EnsemblGenomes-Tr; EBT00001678935.
DR   EnsemblGenomes-Tr; EBT00001678936.
DR   EnsemblGenomes-Tr; EBT00001678937.
DR   EnsemblGenomes-Tr; EBT00001678938.
DR   EnsemblGenomes-Tr; EBT00001678939.
DR   EnsemblGenomes-Tr; EBT00001678940.
DR   EnsemblGenomes-Tr; EBT00001678941.
DR   EnsemblGenomes-Tr; EBT00001678942.
DR   EnsemblGenomes-Tr; EBT00001678943.
DR   EnsemblGenomes-Tr; EBT00001678944.
DR   EnsemblGenomes-Tr; EBT00001678945.
DR   EnsemblGenomes-Tr; EBT00001678946.
DR   EnsemblGenomes-Tr; EBT00001678947.
DR   EnsemblGenomes-Tr; EBT00001678948.
DR   EnsemblGenomes-Tr; EBT00001678949.
DR   EnsemblGenomes-Tr; EBT00001678950.
DR   EnsemblGenomes-Tr; EBT00001678951.
DR   EnsemblGenomes-Tr; EBT00001678952.
DR   EnsemblGenomes-Tr; EBT00001678953.
DR   EnsemblGenomes-Tr; EBT00001678954.
DR   EnsemblGenomes-Tr; EBT00001678955.
DR   EnsemblGenomes-Tr; EBT00001678956.
DR   EnsemblGenomes-Tr; EBT00001678957.
DR   EnsemblGenomes-Tr; EBT00001678958.
DR   EnsemblGenomes-Tr; EBT00001678959.
DR   EnsemblGenomes-Tr; EBT00001678960.
DR   EnsemblGenomes-Tr; EBT00001678961.
DR   EnsemblGenomes-Tr; EBT00001678962.
DR   EnsemblGenomes-Tr; EBT00001678963.
DR   EnsemblGenomes-Tr; EBT00001678964.
DR   EnsemblGenomes-Tr; EBT00001678965.
DR   EnsemblGenomes-Tr; EBT00001678966.
DR   EnsemblGenomes-Tr; EBT00001678967.
DR   EnsemblGenomes-Tr; EBT00001678968.
DR   EnsemblGenomes-Tr; EBT00001678969.
DR   EnsemblGenomes-Tr; EBT00001678970.
DR   EnsemblGenomes-Tr; EBT00001678971.
DR   EnsemblGenomes-Tr; EBT00001678972.
DR   EnsemblGenomes-Tr; Tola_R0001-1.
DR   EnsemblGenomes-Tr; Tola_R0002-1.
DR   EnsemblGenomes-Tr; Tola_R0003-1.
DR   EnsemblGenomes-Tr; Tola_R0004-1.
DR   EnsemblGenomes-Tr; Tola_R0005-1.
DR   EnsemblGenomes-Tr; Tola_R0006-1.
DR   EnsemblGenomes-Tr; Tola_R0007-1.
DR   EnsemblGenomes-Tr; Tola_R0008-1.
DR   EnsemblGenomes-Tr; Tola_R0009-1.
DR   EnsemblGenomes-Tr; Tola_R0010-1.
DR   EnsemblGenomes-Tr; Tola_R0011-1.
DR   EnsemblGenomes-Tr; Tola_R0012-1.
DR   EnsemblGenomes-Tr; Tola_R0013-1.
DR   EnsemblGenomes-Tr; Tola_R0014-1.
DR   EnsemblGenomes-Tr; Tola_R0015-1.
DR   EnsemblGenomes-Tr; Tola_R0016-1.
DR   EnsemblGenomes-Tr; Tola_R0017-1.
DR   EnsemblGenomes-Tr; Tola_R0018-1.
DR   EnsemblGenomes-Tr; Tola_R0019-1.
DR   EnsemblGenomes-Tr; Tola_R0020-1.
DR   EnsemblGenomes-Tr; Tola_R0021-1.
DR   EnsemblGenomes-Tr; Tola_R0022-1.
DR   EnsemblGenomes-Tr; Tola_R0023-1.
DR   EnsemblGenomes-Tr; Tola_R0024-1.
DR   EnsemblGenomes-Tr; Tola_R0025-1.
DR   EnsemblGenomes-Tr; Tola_R0026-1.
DR   EnsemblGenomes-Tr; Tola_R0027-1.
DR   EnsemblGenomes-Tr; Tola_R0028-1.
DR   EnsemblGenomes-Tr; Tola_R0029-1.
DR   EnsemblGenomes-Tr; Tola_R0030-1.
DR   EnsemblGenomes-Tr; Tola_R0031-1.
DR   EnsemblGenomes-Tr; Tola_R0032-1.
DR   EnsemblGenomes-Tr; Tola_R0033-1.
DR   EnsemblGenomes-Tr; Tola_R0034-1.
DR   EnsemblGenomes-Tr; Tola_R0035-1.
DR   EnsemblGenomes-Tr; Tola_R0036-1.
DR   EnsemblGenomes-Tr; Tola_R0037-1.
DR   EnsemblGenomes-Tr; Tola_R0038-1.
DR   EnsemblGenomes-Tr; Tola_R0039-1.
DR   EnsemblGenomes-Tr; Tola_R0040-1.
DR   EnsemblGenomes-Tr; Tola_R0041-1.
DR   EnsemblGenomes-Tr; Tola_R0042-1.
DR   EnsemblGenomes-Tr; Tola_R0043-1.
DR   EnsemblGenomes-Tr; Tola_R0044-1.
DR   EnsemblGenomes-Tr; Tola_R0045-1.
DR   EnsemblGenomes-Tr; Tola_R0046-1.
DR   EnsemblGenomes-Tr; Tola_R0047-1.
DR   EnsemblGenomes-Tr; Tola_R0048-1.
DR   EnsemblGenomes-Tr; Tola_R0049-1.
DR   EnsemblGenomes-Tr; Tola_R0050-1.
DR   EnsemblGenomes-Tr; Tola_R0051-1.
DR   EnsemblGenomes-Tr; Tola_R0052-1.
DR   EnsemblGenomes-Tr; Tola_R0053-1.
DR   EnsemblGenomes-Tr; Tola_R0054-1.
DR   EnsemblGenomes-Tr; Tola_R0055-1.
DR   EnsemblGenomes-Tr; Tola_R0056-1.
DR   EnsemblGenomes-Tr; Tola_R0057-1.
DR   EnsemblGenomes-Tr; Tola_R0058-1.
DR   EnsemblGenomes-Tr; Tola_R0059-1.
DR   EnsemblGenomes-Tr; Tola_R0060-1.
DR   EnsemblGenomes-Tr; Tola_R0061-1.
DR   EnsemblGenomes-Tr; Tola_R0062-1.
DR   EnsemblGenomes-Tr; Tola_R0063-1.
DR   EnsemblGenomes-Tr; Tola_R0064-1.
DR   EnsemblGenomes-Tr; Tola_R0065-1.
DR   EnsemblGenomes-Tr; Tola_R0066-1.
DR   EnsemblGenomes-Tr; Tola_R0067-1.
DR   EnsemblGenomes-Tr; Tola_R0068-1.
DR   EnsemblGenomes-Tr; Tola_R0069-1.
DR   EnsemblGenomes-Tr; Tola_R0070-1.
DR   EnsemblGenomes-Tr; Tola_R0071-1.
DR   EnsemblGenomes-Tr; Tola_R0072-1.
DR   EnsemblGenomes-Tr; Tola_R0073-1.
DR   EnsemblGenomes-Tr; Tola_R0074-1.
DR   EnsemblGenomes-Tr; Tola_R0075-1.
DR   EnsemblGenomes-Tr; Tola_R0076-1.
DR   EnsemblGenomes-Tr; Tola_R0077-1.
DR   EnsemblGenomes-Tr; Tola_R0078-1.
DR   EnsemblGenomes-Tr; Tola_R0079-1.
DR   EnsemblGenomes-Tr; Tola_R0080-1.
DR   EnsemblGenomes-Tr; Tola_R0081-1.
DR   EnsemblGenomes-Tr; Tola_R0082-1.
DR   EnsemblGenomes-Tr; Tola_R0083-1.
DR   EnsemblGenomes-Tr; Tola_R0084-1.
DR   EnsemblGenomes-Tr; Tola_R0085-1.
DR   EnsemblGenomes-Tr; Tola_R0086-1.
DR   EnsemblGenomes-Tr; Tola_R0087-1.
DR   EnsemblGenomes-Tr; Tola_R0088-1.
DR   EnsemblGenomes-Tr; Tola_R0089-1.
DR   EnsemblGenomes-Tr; Tola_R0090-1.
DR   EnsemblGenomes-Tr; Tola_R0091-1.
DR   EnsemblGenomes-Tr; Tola_R0092-1.
DR   EnsemblGenomes-Tr; Tola_R0093-1.
DR   EnsemblGenomes-Tr; Tola_R0094-1.
DR   EnsemblGenomes-Tr; Tola_R0095-1.
DR   EnsemblGenomes-Tr; Tola_R0096-1.
DR   EnsemblGenomes-Tr; Tola_R0097-1.
DR   EnsemblGenomes-Tr; Tola_R0098-1.
DR   EnsemblGenomes-Tr; Tola_R0099-1.
DR   EnsemblGenomes-Tr; Tola_R0100-1.
DR   EnsemblGenomes-Tr; Tola_R0101-1.
DR   EnsemblGenomes-Tr; Tola_R0102-1.
DR   EnsemblGenomes-Tr; Tola_R0103-1.
DR   EnsemblGenomes-Tr; Tola_R0104-1.
DR   EnsemblGenomes-Tr; Tola_R0105-1.
DR   EnsemblGenomes-Tr; Tola_R0106-1.
DR   EnsemblGenomes-Tr; Tola_R0107-1.
DR   EnsemblGenomes-Tr; Tola_R0108-1.
DR   EnsemblGenomes-Tr; Tola_R0109-1.
DR   EnsemblGenomes-Tr; Tola_R0110-1.
DR   EnsemblGenomes-Tr; Tola_R0111-1.
DR   EnsemblGenomes-Tr; Tola_R0112-1.
DR   EnsemblGenomes-Tr; Tola_R0113-1.
DR   EnsemblGenomes-Tr; Tola_R0114-1.
DR   EnsemblGenomes-Tr; Tola_R0115-1.
DR   EnsemblGenomes-Tr; Tola_R0116-1.
DR   EnsemblGenomes-Tr; Tola_R0117-1.
DR   EnsemblGenomes-Tr; Tola_R0118-1.
DR   EnsemblGenomes-Tr; Tola_R0119-1.
DR   EnsemblGenomes-Tr; Tola_R0120-1.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00018; CsrB.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00514; His_leader.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01317; CRISPR-DR4.
DR   RFAM; RF01754; radC.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02194; HPnc0260.
DR   RFAM; RF02227; sX8.
DR   RFAM; RF02276; Hammerhead_II.
DR   SILVA-LSU; CP001616.
DR   SILVA-SSU; CP001616.
DR   StrainInfo; 161342; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4085314
CC   Source DNA and organism available from DSMZ: DSM 9187
CC   Contacts: Harry Beller (HRBeller@lbl.gov)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Tolumonas auensis TA 4, DSM 9187
CC   Culture Collection ID :: DSM 9187
CC   GOLD Stamp ID         :: Gi04053
CC   Isolation Site        :: freshwater mud
CC   Oxygen Requirement    :: Facultative
CC   Temperature Range     :: Mesophile
CC   Biotic Relationship   :: Free living
CC   Diseases              :: None
CC   Habitat               :: Fresh water, Mud
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3471292
FT                   /organism="Tolumonas auensis DSM 9187"
FT                   /strain="DSM 9187"
FT                   /mol_type="genomic DNA"
FT                   /country="Switzerland"
FT                   /isolation_source="sediment of freshwater lake"
FT                   /note="type strain of Tolumonas auensis"
FT                   /db_xref="taxon:595494"
FT   gene            12..1397
FT                   /locus_tag="Tola_0001"
FT   CDS_pept        12..1397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: asa:ASA_0001 chromosomal replication initiator
FT                   protein DnaA; TIGRFAM: chromosomal replication initiator
FT                   protein DnaA; PFAM: Chromosomal replication initiator DnaA;
FT                   Chromosomal replication initiator DnaA domain; SMART:
FT                   Chromosomal replication initiator DnaA domain; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91631"
FT                   /db_xref="GOA:C4L755"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4L755"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ACQ91631.1"
FT                   /translation="MTASLWQQCLTRLQEELPSGEFGLWIRPLQAEFGDRSLTLYAANR
FT                   FILDWVRDKYLLRINSLFTEICGADAPTLHFAVGRRPTAATVQMNTAAAPVADVRIGPA
FT                   ITVPSWTSKQDAMPEINHKSNINETYTFENFVEGKSNQLALAAAHQVAENPGGAYNPLF
FT                   LYGGTGLGKTHLLHAVGNGIRARKPNAKVIYMQSERFVQDMVKALQNNAIQEFQRYYRS
FT                   VDALLIDDIQFFAKKERSQEEFFHTFNALLEGNQQIILTSDRYPKEIDGVEDRLKSRFG
FT                   WGLTIAIEPPELETRVAILMRKAEENKIHLPHEVAFFIAKRLRSNVRELEGALNRVIAN
FT                   ARFTGKPINIDFVREALRDMLALQEKLVTIENIQKTVAEYYKIKVADLLSKRRSRSVAR
FT                   PRQLAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIAELREESNDIKEDYSNLIRT
FT                   LSS"
FT   gene            1416..2519
FT                   /locus_tag="Tola_0002"
FT   CDS_pept        1416..2519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: asa:ASA_0002 DNA polymerase III beta-subunit;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain; SMART: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91632"
FT                   /db_xref="GOA:C4L756"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:C4L756"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ACQ91632.1"
FT                   /translation="MQFSISRDSLLRPLQLVSGSIGGRPTLPILSNVLLNVTEQRLSLT
FT                   GTDLEVEMIGLVPLAGAVAVGSITTPARKLLDICRGLPDGAQLDFVLEGERLILRSGRS
FT                   RYSLSTLPAADYPNIEEWNSVLEFDISQQELKRLMEATQFSMASQDVRFYLNGMLFETS
FT                   GQGLRTVGTDGHRLATCRREVLNEPQSDHQVILPRKGVLELARLLENDDRTIRLQIGLN
FT                   NLRAEAEGFIFTSKLVDGRFPDYRRVFPRQSDKILIAERELLKQAFSRAAILSNEKFRG
FT                   VRLHLTTNLLHITANNPEQEEAEELIDVQYDGPELEVGFNVSYVLDVLNALKCEQVKWY
FT                   LTDANSSALVEDASNDDAQYVVMPMRL"
FT   gene            2525..3598
FT                   /locus_tag="Tola_0003"
FT   CDS_pept        2525..3598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: aha:AHA_0003 DNA
FT                   replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91633"
FT                   /db_xref="GOA:C4L757"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:C4L757"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ACQ91633.1"
FT                   /translation="MLHKLQIQHFRNLGQTEIYPSGGMNLLLGLNGSGKSSVLEAIHYL
FT                   SLGRSFRTHLTNRVIMQGEKAFTLFAQLELDEQSISIGLQKDRQGDTQLKIGGKSADKL
FT                   AQLASLLPLQLIHPEGYNLLTGGPQQRRAFIDWGVFHVEQAFFPLWGKVRRLLKQRNAL
FT                   LRQSSHYAPLAYWDQQLAEFSEALSVFRQQYCQALLPLVQQICQELLPEYTFQATFYAG
FT                   WQQEQGLHLLLQEGFERDRQLGHTAIGPHRADLRLRAEGVPVQDLLSRGQLKLLVCALR
FT                   LAQGLYLRQNSEKTCLFLIDDFASELDAEKRYVLAKRLQQCESQVFITAIDQQPLQEMM
FT                   QEFDCRLFHVKQGNITE"
FT   gene            3619..6036
FT                   /locus_tag="Tola_0004"
FT   CDS_pept        3619..6036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0004"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: aha:AHA_0004 DNA gyrase, B subunit; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: DNA topoisomerase type IIA
FT                   subunit B region 2 domain protein; DNA gyrase subunit B
FT                   domain protein; TOPRIM domain protein; ATP-binding region
FT                   ATPase domain protein; SMART: DNA topoisomerase II;
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91634"
FT                   /db_xref="GOA:C4L758"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:C4L758"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ACQ91634.1"
FT                   /translation="MSENTYDSSSIKVLKGLDAVRKRPGMYIGDTDDGSGLHHMVFEVM
FT                   DNSIDETLAGHCTDIVARIHEDGSVSVRDNGRGIPVDMHKEEGRSAAEVIMTILHAGGK
FT                   FDDNSYKVSGGLHGVGVSVVNALSDKLLLTIQRNGNIYQQTYFLGEPDAPLAIIGTCEG
FT                   TGTEIRFWPSLSIFSDVTFRYEILARRFRELSFLNSGVSIRLIDERDGREDHFHYEGGI
FT                   RAFVEYLNQNKTPIHQKAFYFDLAREDGISVEVAMQWNDAYQENVYCFTNNIPQRDGGT
FT                   HLAGFRSALTRTLNTYMDKEGYSKKAKTSASGDDAREGLTAVISVKVPDPKFSSQTKDK
FT                   LVSSEVKTAVEQAMGEKLDEYLLENPGEAKIIVGKIIDAARAREAARKAREMTRRKGAL
FT                   DIAGLPGKLADCQERDPALSELYLVEGDSAGGSAKQGRNRKYQAILPLKGKILNVEKAR
FT                   FDKMISSQEVGTLITALGCGIGRDEYNPDKMRYHNVIIMTDADVDGAHIRTLLLTFFYR
FT                   QMPEIIERGYVYIAQPPLYKVKKGKQEQYIKDEESLLEYQTTLALDGAELYVNDSAPAI
FT                   SGAQLEKMVLEYRTAQHLITRLARRLPEAVLQQLLILPVLTTEALKDEAQAKAWVAQLQ
FT                   HNLDEHGNNGSQYTLSVHRHAEHGVYLPQILLRQHGVEKHYQLGFEFLNSPEYQQIVNI
FT                   GQQITNLIEPTGFLKRGEKVRPVTSFEEALQILLDEGKRGLYIQRYKGLGEMNPEQLWE
FT                   TTMDPMTRRMLQVTIEDGMAADQLFATLMGDNVEPRRAFIESNALKVANLDI"
FT   gene            6230..7243
FT                   /locus_tag="Tola_0005"
FT   CDS_pept        6230..7243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0005"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: psa:PST_0371 spermidine/putrescine ABC transporter,
FT                   periplasmic spermidine/putrescine-binding protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91635"
FT                   /db_xref="GOA:C4L759"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C4L759"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACQ91635.1"
FT                   /translation="MRYWLSMLLLSLAGYCPASELVVYTWEYYLAPEVKSRFEQETGIH
FT                   IAEVNYNSDEARNRLLSGGYPPEFDIVSIDSLSLNDPVWRALFTVMPASIRKQNTAIDP
FT                   VFTARCGDLSVPYMWGSVGIAYRRSQVSEPITRWQQLFTPEPTLSGRIVMVDDTFDLVS
FT                   VALKAAGFSINTHNKSELQAAYHLLQKQRPSVATYQLSFAAVSDQQFGKRIAAAMVYSG
FT                   DFYALQQNSEYKDWTYVVPEEGSPLWLDCMSILKTSQHKAEAQRFLTFLTRPDIALLNG
FT                   QTMGFTPALKKSYLPASMQNNAIIYPPVKQLQRSEFYNADVSKNELRSAIYFSVLK"
FT   sig_peptide     6230..6295
FT                   /locus_tag="Tola_0005"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.797) with cleavage site probability 0.360 at
FT                   residue 22"
FT   gene            7240..9666
FT                   /locus_tag="Tola_0006"
FT   CDS_pept        7240..9666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0006"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   extracellular sensor"
FT                   /note="KEGG: psp:PSPPH_4065 GGDEF domain/EAL
FT                   domain-containing protein; TIGRFAM: diguanylate cyclase;
FT                   PFAM: EAL domain protein; GGDEF domain containing protein;
FT                   histidine kinase HAMP region domain protein; SMART: EAL
FT                   domain protein; GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91636"
FT                   /db_xref="GOA:C4L760"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:C4L760"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACQ91636.1"
FT                   /translation="MKGLHRKLLLTLLPVVILPLLALGLQSMMKLGDMANRNMELRLTS
FT                   LATTINEHLNGELRRNTVELAQLPNAEALISYLATKVTGTQKVYMGTRVQRMFHQLLVG
FT                   NKGFLQLSLLNSDNKELLRVGEGINPFHDIAPSNLIFMQYWAAQAAASDQFNSLMYSPE
FT                   MDEYVYKQGLRFIRSGPEISRDGEPVQRYSLILTYSLRKFGEMFLKQQVQQGIYLLLLD
FT                   KSNTFIAGEAPLGWRSGGPETDEISLPGGDYLVRRLPLADGLILQALIPQKLMTAEATE
FT                   LRITTAIWLIISSLILLALLHVVLKRLILNPVSDLRNLMKQVATHEISEISLVLAEDEM
FT                   AELHNHFSGMLSQLEVSKRELERAAFIDPLTGIGNRSAFIRCLQNMVERHNEQPFHFYL
FT                   VQLKLHNLTWINNTFGAKTGDRALQLISRLLQQLLHEHILANAKCVCLARSGSDEFIFS
FT                   VPSYYPVDGNGQDTAALPDANAICELLAARFGQPVMLGSYSIKLRFSAGIVRFPDIANG
FT                   VEELMEGVSKARRLASRYQGNHWLQLDNEMVQHIREDRWLESELRQAIVGQQCFVVYQP
FT                   QYDIHSGHIVGAEALLRWRHPSYGMVPPDRFIPIAEVSGQIMDIDLWVLDQACQCLGKL
FT                   TAKGITDFRLAVNASGTELSNPAYPDAVRSTLLRYDIPPHRFGIEITETAIVELDEVAQ
FT                   MTVRALKEIGVEIELDDFGTGYTSLSHLTNLQLDVLKIDRSYIMQLESNPKLVDSILQL
FT                   ADAFSLRVIAEGVETIEQLKLLQQKRCHMAQGFLLSKPITEEELIALLFDDSLAD"
FT   sig_peptide     7240..7308
FT                   /locus_tag="Tola_0006"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.662 at
FT                   residue 23"
FT   gene            complement(9727..10968)
FT                   /locus_tag="Tola_0007"
FT   CDS_pept        complement(9727..10968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0007"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   aha:AHA_0009 valine--pyruvate transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91637"
FT                   /db_xref="GOA:C4L761"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C4L761"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ACQ91637.1"
FT                   /translation="MQFSQFGEKFTRLAGISQLMDDLNQGLKNPDAIMLGGGNPAAIPE
FT                   MVELFRQETALQLENGALLKAMLNYDGPQGHDGFRQALAELFRKEYGWDISADNIALTN
FT                   GSQSAFFNLFNLLAGDYADGKKKKVLFPLAPEYIGYADGGLAEDQFVACKPHIDFLENG
FT                   LFKYQVDFDALEVGDDIGMICVSRPTNPTGNVLTDEEIIKLDEIAQAKNIPLIIDNAYG
FT                   TPFPHIIFSEVTPFWNQNTILCMSLSKLGLPGLRCGIVIANTAIINALSNISGIINLAP
FT                   SGIGPALMQRWVESGDILRHSADIIAPFYQQKAQQAVAWLQEAIPAPKLRIHKPEGALF
FT                   LWLWFEGLPVSCQELYEKLKQHGLIIVPGHYFFPGLPDKNWRHQYECIRLNYAQPEEKV
FT                   KQGIAILQQVINEL"
FT   gene            complement(11074..13146)
FT                   /locus_tag="Tola_0008"
FT   CDS_pept        complement(11074..13146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0008"
FT                   /product="glycyl-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="KEGG: eck:EC55989_4013 glycine tRNA synthetase, beta
FT                   subunit; TIGRFAM: glycyl-tRNA synthetase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91638"
FT                   /db_xref="GOA:C4L762"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4L762"
FT                   /inference="protein motif:TFAM:TIGR00211"
FT                   /protein_id="ACQ91638.1"
FT                   /translation="MATENFLIELGTEELPPKALRKLAQAFADNFTAELDKAGLAHQGV
FT                   QWFAAPRRLALKVAALADKQADKQVEKRGPAVSAAFDAAGNPTPAAAGWAKSNGIEVAQ
FT                   ADRLATDKGEWLVYRANVAGQPTTGLLPAMAATALAGLPIPKPMRWGAKRTQFIRPVHT
FT                   LCMLFGAELVDGEILGLRSARIIRGHRFMGEAQFEISHADQYPALLLEKGKVQADYETR
FT                   KAFIKAGAEAAAQQLGGIADIEESLLEEVTSLVEWPVILTATFEEKFLAVPAEALVHTM
FT                   KGDQKYFPVYDNNGKLLPNFIFVSNIESKDPAQIIQGNERVVRPRLSDAEFFFNTDKKH
FT                   SLASRLESLDTVLFQQQLGTLKDKSVRIAEMSAFIAAQIGADVEHATRAGLLSKCDLMT
FT                   NMVMEFTDTQGVMGMHYARHDHEAEDVAVALNEQYMPRFAGDNLPNGLVACAVAIADKL
FT                   DTLAGIFGIGQAPKGDKDPFALRRAAIGTLRIIVEKQLDLDLVDVVSKAAELYDGKISN
FT                   KSVVDEVVDFMLGRFRASYQEAGIAVDVIQAVLARRPTRPADFDARVKAVSHFRTLDAA
FT                   EALAAANKRVSNILAKFDGKLKDSVDAALLQDPAEQVLAQQVAAMETKLAPLFANGEYQ
FT                   LALTELAALREAVDTFFDKVMVMADDEALKLNRLTLLARLQALFLQAADISLLQQ"
FT   gene            complement(13160..14074)
FT                   /locus_tag="Tola_0009"
FT   CDS_pept        complement(13160..14074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0009"
FT                   /product="glycyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="KEGG: asa:ASA_4260 glycyl-tRNA synthetase subunit
FT                   alpha; TIGRFAM: glycyl-tRNA synthetase, alpha subunit;
FT                   PFAM: glycyl-tRNA synthetase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91639"
FT                   /db_xref="GOA:C4L763"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4L763"
FT                   /inference="protein motif:TFAM:TIGR00388"
FT                   /protein_id="ACQ91639.1"
FT                   /translation="MQKFDIKTFQGLILSLQDYWARQGCVISQPLDMEVGAGTSHPMTF
FT                   LRSIGPEPMNCAYVQPSRRPTDGRYGENPNRLQHYYQFQVILKPSPDNIQELYLGSLRE
FT                   LGFDPLVHDIRFVEDNWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECFPVTGEI
FT                   TYGLERLAMYIQGVDSLYDLVWADGPLGKVTYRDVFHQNEVEQSTYNFEHADVPFLFQL
FT                   FDQCEKECQHLLNLELPLPLPAYERILKAAHAFNLLDARHAISVTERQRYILRIRTLSK
FT                   AVAEAYYAARERLGFPMCKATQA"
FT   gene            14180..14755
FT                   /locus_tag="Tola_0010"
FT   CDS_pept        14180..14755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0010"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /EC_number="3.2.2.20"
FT                   /note="KEGG: aha:AHA_0129 DNA-3-methyladenine glycosylase
FT                   I; TIGRFAM: DNA-3-methyladenine glycosylase I; PFAM:
FT                   methyladenine glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91640"
FT                   /db_xref="GOA:C4L764"
FT                   /db_xref="InterPro:IPR004597"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:C4L764"
FT                   /inference="protein motif:TFAM:TIGR00624"
FT                   /protein_id="ACQ91640.1"
FT                   /translation="MERHCAWIMRDPDYIDYHDQQWGRPEYDDRKLFAMLCLEGQQAGL
FT                   SWLTILKRIPDYHALFADFDPLVLAAFDEQQVNELMSDQRIIRNRLKIQAIIQNARAYL
FT                   ALQQQGIQFSAWIWQFVGGNPMINHWQHSSEVPVSTPQAEAMSKALKKAGFKFVGPTIC
FT                   YAYMQAVGMVNDHLIDCPWHPLCNNPLS"
FT   gene            14771..15787
FT                   /locus_tag="Tola_0011"
FT   CDS_pept        14771..15787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0011"
FT                   /product="Mg2 transporter protein CorA family protein"
FT                   /note="PFAM: Mg2 transporter protein CorA family protein;
FT                   KEGG: ypb:YPTS_2334 Mg2 transporter protein CorA family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91641"
FT                   /db_xref="GOA:C4L765"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:C4L765"
FT                   /inference="protein motif:PFAM:PF01544"
FT                   /protein_id="ACQ91641.1"
FT                   /translation="MSENLPFHSHPKSPLHPPKALVPLEPVLAMQLDGNGRYHKLSAGG
FT                   TVPVERCWLHLDYSAESAKEWLNHSPLLPDVIRHSLLGESNRPKLVKVNGGLLLTLRGI
FT                   NHNEGQRPDHMVAIRFYITEKLIVSTRHRRVYAVEQIVRNLRQGLGPKSTADWLVDVCE
FT                   NLAEQAGDFIDELMDKIVRLEDEILGHRMPSRRELVEIRRQLIVLRRYLAPQRDVFSRL
FT                   ANEKINWLEKDDLRHLQDIADRMGRWLEDLDASIARTSLLADEINALMTEAMNRRTYIM
FT                   SLFAMVFLPLSFCTGLLGVNLGGIPGNDSPWGFVGFCLLLLIFASSILTWLKLRKWV"
FT   gene            15905..16906
FT                   /locus_tag="Tola_0012"
FT   CDS_pept        15905..16906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0012"
FT                   /product="sulfate ABC transporter, periplasmic
FT                   sulfate-binding protein"
FT                   /note="TIGRFAM: sulfate ABC transporter, periplasmic
FT                   sulfate-binding protein; PFAM: extracellular solute-binding
FT                   protein family 1; KEGG: asa:ASA_0593 ABC-type sulfate
FT                   transport system, periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91642"
FT                   /db_xref="GOA:C4L766"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="InterPro:IPR034408"
FT                   /db_xref="UniProtKB/TrEMBL:C4L766"
FT                   /inference="protein motif:TFAM:TIGR00971"
FT                   /protein_id="ACQ91642.1"
FT                   /translation="MKKSVLSALGLLAALTSQSVFAAEVTLLNVSYDPTRELYQDYNRI
FT                   FSQYWQQQHGDTVDVNQSHGGSGKQARAVIEGLSADVITLALAQDINKVAQQGLVAADW
FT                   ESKLPNHAAPFTSTIVFLVRKDNPKQIKDWDDLIRPDIEVVTPNPKTSGGARWNYLAAW
FT                   GYALHKTGNEQGARDFVSKLYRNVKVLDSGARAATTSFVERDLGDVLIAWENEAYLVLN
FT                   ELGKDKFELVTPSESILAEPPVAVVDKVAKKHGTEAVAKAYVEHLYSDEAQRIAGKHYY
FT                   RPSNPVIAKEFAKKFAPVKLFTIRELEGDWAKAQQKHFASGGTFDQVYQPGQ"
FT   sig_peptide     15905..15973
FT                   /locus_tag="Tola_0012"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            16969..17496
FT                   /locus_tag="Tola_0013"
FT   CDS_pept        16969..17496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0013"
FT                   /product="protein of unknown function DUF1234"
FT                   /note="PFAM: protein of unknown function DUF1234; KEGG:
FT                   aha:AHA_0605 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91643"
FT                   /db_xref="GOA:C4L767"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4L767"
FT                   /inference="protein motif:PFAM:PF06821"
FT                   /protein_id="ACQ91643.1"
FT                   /translation="MNNILLVPGLYDSGPQHWQTLWHQQNPHWLRVEQSDWTTPDLLRW
FT                   AAPVIRLLENSQEPLTLVAHSFGCLASLYAARQLPEKVSSLFLVAPADPDLLGVQEALI
FT                   NHPAPVAGRIIASSNDPWMPLDRVCFWSQRWRLPLSLLGPLRHINAESGHGTWPEGLEL
FT                   LHWHCQQLSKEA"
FT   gene            17735..18571
FT                   /locus_tag="Tola_0014"
FT   CDS_pept        17735..18571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0014"
FT                   /product="sulfate ABC transporter, inner membrane subunit
FT                   CysT"
FT                   /note="TIGRFAM: sulfate ABC transporter, inner membrane
FT                   subunit CysT; sulfate ABC transporter, inner membrane
FT                   subunit; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: aha:AHA_0606
FT                   sulfate/thiosulfate ABC transporter, permease protein CysT"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91644"
FT                   /db_xref="GOA:C4L768"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011865"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C4L768"
FT                   /inference="protein motif:TFAM:TIGR02139"
FT                   /protein_id="ACQ91644.1"
FT                   /translation="MRFRSHSVLPGFAPTLGFSLLYLSLMVLLPLSALVLYSVTKQDMG
FT                   QFWQVVSSPRVVASYKLSFGASAVAALLNTFFGSIIAWILVRYQFFGKRIMDALIDLPF
FT                   AMPTAVSGIALSAIYAGNGWIGQFFAPYGIKLAFNPAGIVIALTFIGLPFVVRTMQPVL
FT                   KEHERELEEAAACLGASRWITFRKIIFPAMVPAALTGFALAFARAVGEYGSVIFIAGNL
FT                   PMVSEIAPLMIMSHLEEYDYAGAAAIASVMLGVSFVLLLLINQLQAWSWQRLGGVR"
FT   sig_peptide     17735..17836
FT                   /locus_tag="Tola_0014"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.767) with cleavage site probability 0.301 at
FT                   residue 34"
FT   gene            18571..19386
FT                   /locus_tag="Tola_0015"
FT   CDS_pept        18571..19386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0015"
FT                   /product="sulfate ABC transporter, inner membrane subunit
FT                   CysW"
FT                   /note="TIGRFAM: sulfate ABC transporter, inner membrane
FT                   subunit CysW; sulfate ABC transporter, inner membrane
FT                   subunit; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: aha:AHA_0607
FT                   sulfate/thiosulfate ABC transporter, permease protein CysW"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91645"
FT                   /db_xref="GOA:C4L769"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011866"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C4L769"
FT                   /inference="protein motif:TFAM:TIGR02140"
FT                   /protein_id="ACQ91645.1"
FT                   /translation="MNSITTESRWVRYILILVGVGWFAALLLLPLAIVFTQALAKGLSF
FT                   FWQSLIDTDALAALRLTLFTVICSVPMNILFGLTAAWAIGRFRFRGRQALITLIDLPFS
FT                   VSPVIAGLMFVLLFGNRGWLGEWLQAHDISIIFNTPGIILATMFITVPFVVRELLPQME
FT                   ARGSEEEEAAQVLGANGWQTFWRVTLPGIRWSLLYGVILCTARAVGEFGAVSVVSGHIR
FT                   GQTNTLPLHIEILYNEYQTNAAFAVASLLALFGLFTLLAETVLNRLRHR"
FT   sig_peptide     18571..18693
FT                   /locus_tag="Tola_0015"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.981 at
FT                   residue 41"
FT   gene            19404..20489
FT                   /locus_tag="Tola_0016"
FT   CDS_pept        19404..20489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0016"
FT                   /product="sulfate ABC transporter, ATPase subunit"
FT                   /note="KEGG: aha:AHA_0608 sulfate/thiosulfate ABC
FT                   transporter, ATP-binding protein; TIGRFAM: sulfate ABC
FT                   transporter, ATPase subunit; PFAM: ABC transporter related;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91646"
FT                   /db_xref="GOA:C4L770"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005666"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR014769"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR024765"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041193"
FT                   /db_xref="UniProtKB/TrEMBL:C4L770"
FT                   /inference="protein motif:TFAM:TIGR00968"
FT                   /protein_id="ACQ91646.1"
FT                   /translation="MSIQVEHIEKRFNQFAALHDINITFPTGELVALLGPSGCGKTTLL
FT                   RIIAGLEQADSGRILLNGTDASEMHVRERNVGFVFQHYALFRHMTVFENVAFGLRVKPR
FT                   KTRPNENEIQKKVKSLLDLIQLGHVADRYPTQLSGGQRQRVALARALAVEPQVLLLDEP
FT                   FGALDAQVRKELRRWLRRLHDELHVTSLFVTHDQEEALEVADRVVLMNAGRIEQFATPQ
FT                   EVYEKPATEFVHRFLGTVNLFHGQLHSGQLDISGSTLTNNVSGQTAADVNSIAYVRPHE
FT                   LDLLPAAAAQGIPATVVRILPFGAAYRVEVTANNGVARTLIEVDVPRERVIMLELLPGK
FT                   SVRLVARQAQLYQPETKDNVA"
FT   gene            20486..21442
FT                   /locus_tag="Tola_0017"
FT   CDS_pept        20486..21442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0017"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: spe:Spro_2917 transcriptional regulator
FT                   CysB-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91647"
FT                   /db_xref="GOA:C4L771"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037423"
FT                   /db_xref="UniProtKB/TrEMBL:C4L771"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACQ91647.1"
FT                   /translation="MNFQQLKIIREAARCHFNLTEVANTLYTSQSGVSRHIKELEDELG
FT                   VELFIRRGKRLLGMTEPGKALLTMAERILTEANNIRRLADNFANSDRGRLHVATTHTQA
FT                   RYALPGIIKEFRTQYPQVQLVLHQGSPSEIVSMLLSGETDIGLTSELMADYEEIAAFPY
FT                   YSWHHAILVPRGHPLTELPEVTLEDLSAWPLVTYQTGLTGRTKIDAAFAMAGIVPDIVL
FT                   SAQDSDVIKTYVELGLGVGILADMAIDAVKDSNLVRLNAEHLFPANTAWFGMKKGKFQP
FT                   NFAWHFLQICNPSLAISDIQAQVFATGELQTPLHYEI"
FT   gene            complement(21483..21731)
FT                   /locus_tag="Tola_0018"
FT   CDS_pept        complement(21483..21731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0018"
FT                   /product="SirA family protein"
FT                   /note="PFAM: SirA family protein; KEGG: ypb:YPTS_0229 SirA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91648"
FT                   /db_xref="GOA:C4L772"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR022931"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4L772"
FT                   /inference="protein motif:PFAM:PF01206"
FT                   /protein_id="ACQ91648.1"
FT                   /translation="MTFSADDINQTLDASGLRCPEPVMMVRKTVRLMQEGETLLVIADD
FT                   PATVRDIPSFCRFMDHTLLASDTEQPPYRYLIRKGLN"
FT   gene            complement(21771..23024)
FT                   /locus_tag="Tola_0019"
FT   CDS_pept        complement(21771..23024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0019"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: aha:AHA_0135 ABC-type sugar transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91649"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C4L773"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACQ91649.1"
FT                   /translation="MTFRSYLVSSLMLSLVSVSAMASSVEVLHWWTAGGEAQAAGVLRS
FT                   YWQALGNEWQDSAISGGGGQSAMTVLKSRALSGTPPEAAHLKGSELQEWAALGFLRNLD
FT                   NVARQGEWEKVLPEFVQHSVQSKGHYVAVPVGIHRVNWLWINPKVFERYQLSPPENWSQ
FT                   LLTIAKKLKQAGITPLALGDDQWQLSILFEAIVLGEGGSDFYRRAFVQLDQTALQSDTM
FT                   QHLLELFHQLRDYIADDYGGTKWNQATHMLVEGSAAMQLMGDWVKGELTAAKVVPGKDI
FT                   LCLPAPGTDGKFSYNLDSIAMFDVQSPQKQQAQLQLVNMIMTSDFQHAFNRVKGSIPVL
FT                   NNQTLTDFDQCAQHSAQQLQQAIQQQELVPSMAEGMANSSYVRQAIGDVLVGYFNNPDG
FT                   DAEQAARRLARAVLSAQR"
FT   sig_peptide     complement(22956..23024)
FT                   /locus_tag="Tola_0019"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.979 at
FT                   residue 23"
FT   gene            complement(23028..24437)
FT                   /locus_tag="Tola_0020"
FT   CDS_pept        complement(23028..24437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0020"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; histidine kinase HAMP
FT                   region domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase HAMP region domain
FT                   protein; histidine kinase A domain protein; KEGG:
FT                   aha:AHA_0136 signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91650"
FT                   /db_xref="GOA:C4L774"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C4L774"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACQ91650.1"
FT                   /translation="MLLLLLLAIVLAQSLISGIWMQQLEKRELDGMLAATRDLANSAAA
FT                   TVSFFKSLPLQYRPIALDQLRNMGGSRFFVSLNKQEIVLNGIQDSPKKQLVLKEVNQTL
FT                   LHKLGQSMLIKADFSYPADLHVFNNETLLSDIPPSWSRYTLLMEPINPPILVTQIKLDN
FT                   GEWLYLAALLPAPYMSLDENVVSPHQFRFIILLTIILFPFTFALVRWQTRPLRHLAAAA
FT                   VSLGKDIDQPPLPEAGASEIVAVTRAINIMQQRIRRYIGDREKLFSSISHDLKTPITRL
FT                   RLRVELLDDDSQIAKFSKDLDDLEMMVKGALQTVKDTHIHENIEAIDINVLLNSMAEDY
FT                   NLLEQHLTIEGHCKHLYRGKPLALKRCIANLIDNAIKYGDQARVIVMDDLEKNSNTNML
FT                   YLYVIDEGPGLPEHQLEKVFEPYYRLAQDSSGNGLGLGIARSIARAHGGDLVLENRPHG
FT                   GLQAILSLPRN"
FT   gene            complement(24490..25212)
FT                   /locus_tag="Tola_0021"
FT   CDS_pept        complement(24490..25212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0021"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: asa:ASA_4252 two-component system response
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91651"
FT                   /db_xref="GOA:C4L775"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C4L775"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACQ91651.1"
FT                   /translation="MAKGKPILIVDDDQEIRELLKEYLTRAGFDVLTACDGVEMYQQLA
FT                   LSTPELIILDIMMPGDDGFSLCQQIRRKSQVPIIMLTAASDEADRVIGLELGADDYIAK
FT                   PFSPRELMARIKALLRRAEFRQPEKEVVSGRKLKFAGWTLDTRTQLLTHEDGSGIDLTG
FT                   SDFILLHLFLQHPGQVLDRDTISDATRGRESLPMERGIDVQISRLRQKLGDNGKGPRII
FT                   KTIRGSGYMLIAEVEHED"
FT   gene            25420..25944
FT                   /locus_tag="Tola_0022"
FT   CDS_pept        25420..25944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0022"
FT                   /product="Protoporphyrinogen oxidase"
FT                   /EC_number="1.3.3.4"
FT                   /note="KEGG: asa:ASA_4245 protoporphyrinogen oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91652"
FT                   /db_xref="GOA:C4L776"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR026816"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C4L776"
FT                   /inference="protein motif:PRIAM:1.3.3.4"
FT                   /protein_id="ACQ91652.1"
FT                   /translation="MTKRILVLYSSREGQTRKIVDAILAHAPDWQAEVHNLHELPVIDL
FT                   TPYDKVLIAASIRYGHFHSSLNKFVEQHYSALKEKEAAFIAVNLVARKPGKNTPETNLY
FT                   TRKWLQQSSWKPQHVAVFAGALRYSRYTWWQKRIIQLIMWMTGGSTDTSSDIEFTNWTN
FT                   VQKFAERLLKS"
FT   gene            26293..27826
FT                   /locus_tag="Tola_R0001"
FT   rRNA            26293..27826
FT                   /locus_tag="Tola_R0001"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            27896..27972
FT                   /locus_tag="Tola_R0002"
FT                   /note="tRNA-Ile1"
FT   tRNA            27896..27972
FT                   /locus_tag="Tola_R0002"
FT                   /product="tRNA-Ile"
FT   gene            27984..28059
FT                   /locus_tag="Tola_R0003"
FT                   /note="tRNA-Ala1"
FT   tRNA            27984..28059
FT                   /locus_tag="Tola_R0003"
FT                   /product="tRNA-Ala"
FT   gene            28266..31152
FT                   /locus_tag="Tola_R0004"
FT   rRNA            28266..31152
FT                   /locus_tag="Tola_R0004"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            31281..31394
FT                   /locus_tag="Tola_R0005"
FT   rRNA            31281..31394
FT                   /locus_tag="Tola_R0005"
FT                   /product="5S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            31457..31533
FT                   /locus_tag="Tola_R0006"
FT                   /note="tRNA-Asp1"
FT   tRNA            31457..31533
FT                   /locus_tag="Tola_R0006"
FT                   /product="tRNA-Asp"
FT   gene            31726..32523
FT                   /locus_tag="Tola_0023"
FT   CDS_pept        31726..32523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0023"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aeh:Mlg_2795 Mn2+-dependent serine/threonine
FT                   protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91653"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C4L777"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACQ91653.1"
FT                   /translation="MFVIKFINHEADVADSFITQMREVVLSNPAARNLETFRMIKSTAN
FT                   RSVYCCSLNERIFYIKLYSFSSPIKYLKHLFRYSHGIHGYKKSIRLLNENVSTATPVLA
FT                   MSYLGGLRSLVVHEAIPGVDAEAFFVNYSNNKNLRSTVLKKIGALIAELFAKGFSHGDM
FT                   NFGGFIVDAKDGNVSVSLIDVDNITNNPKQRFRDIVNFNAHLFVTAKKAQVEMLSSDEL
FT                   REMYLSMLGIYNFDMTETSFFQRLNQATELKLIKWGQKGYIAI"
FT   gene            complement(32561..33280)
FT                   /locus_tag="Tola_0024"
FT   CDS_pept        complement(32561..33280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0024"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG: vsp:VS_1873
FT                   transposase (orfB) of insertion sequence ISVisp1 ; IS3
FT                   family subgroup IS3"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91654"
FT                   /db_xref="GOA:C4L778"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C4L778"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ACQ91654.1"
FT                   /translation="MLLTHIKRVFKASAERYGSPKVYQALRTQGVVVSQKRVARLMREN
FT                   GLKARVERVYKQLNKMRAELKVLPNHRLQTPKPTGPNQQWSSDVTYIRHGHRHVFLAVI
FT                   VDLWSRKIIGWALHEKLNAELSVAALYQALKQRKPKPGLILHTDRGVEFRAQAMQIWLN
FT                   KFGIRHSMNRPGRCTDNAEVESFFKTLKSELIYENYFPTVSALRDQISRYIRNFYNKVR
FT                   LHSSLNYVSPIQFEHAA"
FT   gene            complement(33397..33741)
FT                   /locus_tag="Tola_0025"
FT   CDS_pept        complement(33397..33741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0025"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   abo:ABO_1787 transposase, OrfA"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91655"
FT                   /db_xref="GOA:C4L779"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C4L779"
FT                   /inference="protein motif:PFAM:PF01527"
FT                   /protein_id="ACQ91655.1"
FT                   /translation="MPAYTNAKRIFKYSDEFKMKAVQWSFDPQRSVKDVAAALDIHPFM
FT                   LSRWRKEFREGKYGPMKPTTKPSKPNAQLKEQDKLKKLRKRIAELEEENDILKKWQRFL
FT                   AEERRKHSNS"
FT   gene            complement(33812..34897)
FT                   /locus_tag="Tola_0026"
FT   CDS_pept        complement(33812..34897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0026"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   hip:CGSHiEE_00235 lipooligosaccharide glycosyl transferase
FT                   G"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91656"
FT                   /db_xref="GOA:C4L780"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:C4L780"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACQ91656.1"
FT                   /translation="MGSDKLNNDRITGINIIYHTIKPGGGMERYALDLIENLSARNIPL
FT                   RVIARKINWPGIAPSNVEFVKVPDFTPFSRVNKHLFDVTASKYINSAWPTIGLTRVAGS
FT                   TDIAVVGGTHKGYLNAIKKKHHGIFDYLTIKRETSFYKNAKCIVAHSRQVGQEVIDHYQ
FT                   IDKDKLHIIYPPVSFSSFSLAARKEREQIRKELGVQDDQILLLFPSNNHDRKGLDLILT
FT                   ALERSDKRFVLAIASRKAVTHPRVINLGFRNNMPALYAAADAAILASKYEPFGLVGPEA
FT                   VLCGTPVILANTVGATEVIAEPACTRFQLTPESLTDALEKFLKMQKSEPLIITKPDLLM
FT                   PQITDVDQHCTELLELLKKTN"
FT   gene            complement(34936..35970)
FT                   /locus_tag="Tola_0027"
FT   CDS_pept        complement(34936..35970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0027"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   mmw:Mmwyl1_3481 glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91657"
FT                   /db_xref="GOA:C4L781"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:C4L781"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACQ91657.1"
FT                   /translation="MTPTIMHVNLAKGFRGGERQTELLIKELAKHDLKQYLVCRDNSPL
FT                   REHLKAVSNLEFITANHQLMGHFAVHQKIDMIHAHEAKAVHWAWIENRLRGTPYILTRR
FT                   VPQQIKQNLFNKLCYKYASQAVAISSPIASYLSGLQLAPVTTIPSALAHLPHNPDISKE
FT                   IKKQYPDKFLIGHAGALVDKHKGQREIIKAATLLENKVPNIHFIMLGDGPDAEQLKDES
FT                   KTLTNMEWLGFKQNPGDYFAALDLFVFPSRNEGLGSTLLDVMDFMVPIIASDVDGIPDI
FT                   VKHEQTGLLIPVNNADALAKAILRLFNDKPLREQLATTAKEKLDNFTPATMAKRYLALY
FT                   RSLL"
FT   gene            complement(36034..36819)
FT                   /locus_tag="Tola_0028"
FT   CDS_pept        complement(36034..36819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0028"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   pmu:PM1306 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91658"
FT                   /db_xref="GOA:C4L782"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C4L782"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACQ91658.1"
FT                   /translation="MNKDALISAILIVKNEEQHLAACLDTIKDWVSEIIILDSGSTDDT
FT                   LKIAERYQAKVYQDIDWQGFGVQRQRAQRLANGTWCLWLDADERVTPELRQEIESVIAK
FT                   PADNTGYSIPRLNWYFGRYIRHCGWYPKPVLRLYPRALTTYNDSYVHEKVIVPQDMTVK
FT                   RLKNDLLHYPYKNLRHHVTKSSCYAHDWALAKYQQGKRTTLIAASMHSLLRFCRMYFFQ
FT                   RGLLDGSAGFLLSVISAYYTFLKYAELWVMQRSSSDKPK"
FT   gene            complement(36812..37879)
FT                   /locus_tag="Tola_0029"
FT   CDS_pept        complement(36812..37879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0029"
FT                   /product="glycosyl transferase family 9"
FT                   /note="PFAM: glycosyl transferase family 9; KEGG:
FT                   asa:ASA_0037 ADP-heptose--LPS heptosyltransferase III"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91659"
FT                   /db_xref="GOA:C4L783"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:C4L783"
FT                   /inference="protein motif:PFAM:PF01075"
FT                   /protein_id="ACQ91659.1"
FT                   /translation="MPLFLRAPEALCLIRLSAIGDCVHAVAMVQAIQRQWPQTKITWIM
FT                   GKAEASLLHDLPGVEVIVFDKNAGFRAYTSIWKQLRDRHFDALLHMQSALRASLLTLGI
FT                   KADKTLGFDQQRAGDGQSLFTNLKVPSPQSPHVLDGFMAFAAELGVHDLTPQWHIPVAE
FT                   TDNDWAKQNISGEKPTLLIAPSASKAYKNWTKEGYAALADHAAAQGFQVMLCGGPSPQE
FT                   KSFAEEISALCQHKPVNLVGQTTLKRLLALIKQATLVLAPDTGPAHMATAVGTPVIGLY
FT                   AHHNPARTGPYFCKDYVVSVYQALIEAQTGKKMAQLAWRTRLKQADAMRHIRIADVKLQ
FT                   FDNLAAQIQETRAHE"
FT   gene            complement(37983..39008)
FT                   /locus_tag="Tola_0030"
FT   CDS_pept        complement(37983..39008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0030"
FT                   /product="lipopolysaccharide heptosyltransferase II"
FT                   /note="TIGRFAM: lipopolysaccharide heptosyltransferase II;
FT                   PFAM: glycosyl transferase family 9; KEGG: asa:ASA_4220
FT                   ADP-heptose-LPS heptosyltransferase II"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91660"
FT                   /db_xref="GOA:C4L784"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011910"
FT                   /db_xref="UniProtKB/TrEMBL:C4L784"
FT                   /inference="protein motif:TFAM:TIGR02195"
FT                   /protein_id="ACQ91660.1"
FT                   /translation="MSNMLIIGPAWVGDMVMSQSLYITLKQQHPHMKLHVMAPRWCLPL
FT                   LARMPQVDKAIEMPLGHGDFNLAARWRLGRQLKNNKYDQAIVLPNSLKSALIPLFAGIP
FT                   LRTGWKGESRYGVLNDLRRNKESFPLMVERYCALAFPRRKMHSAKDLPAIPYPALQVDT
FT                   EQQTAVKERLSLTTERAVLGLCPGAEFGPAKRWPEQHYATVAQRWIDSGGDVWIFGSAK
FT                   DQPVARTIQAHLTPEQQAHCHLIAGTTSLTEALDLLAACNKVVSNDSGLMHIAAAVGTP
FT                   LVAVYGSTSPGYTPPLSQKVQVVQTDINCRPCFKKQCPLKHLKCLTELSPETVWQALAA
FT                   L"
FT   gene            complement(39008..40258)
FT                   /locus_tag="Tola_0031"
FT   CDS_pept        complement(39008..40258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0031"
FT                   /product="O-antigen polymerase"
FT                   /note="PFAM: O-antigen polymerase; KEGG: msu:MS0243 RfaL
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91661"
FT                   /db_xref="GOA:C4L785"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:C4L785"
FT                   /inference="protein motif:PFAM:PF04932"
FT                   /protein_id="ACQ91661.1"
FT                   /translation="MPVSSEQVKSLIIQSCYFLFGVLCISTRSGYSYAPAVLLLMSLPL
FT                   LFRKQTYQILDRNGWLLFAILLIYPLVHGLSILTDGGTIKEFDRPSKVIMGAAILLFCL
FT                   RNPPRFKWLMLGIATGAITAGSRALFDRLVTGYGRAFEWMVPIQGGDISMTLGLLSLCG
FT                   VMWSIKTANKGLIVYFALASILGVLGSILSGSRGGWVLFPVILFVIYRIFKDWFSPKVK
FT                   LGMGLALCLLVAFCLTPQSGVPTRIAAAKSDISLYLSGQNKNTSLGHRFEIWKSSVDSF
FT                   LEKPLFGWGYHGVRQSQEQQYKQGLITKEAYDFNSHAHNQFLDEMAKRGIIGLGALLAL
FT                   LLIPLYLFKQYLNQSFTPETRTLAAAGVIVVLSTIDYSLSQAFLYHSSGIVFYCASIIF
FT                   LYSAVRSQQPINGKSLL"
FT   gene            complement(40343..41296)
FT                   /locus_tag="Tola_0032"
FT   CDS_pept        complement(40343..41296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0032"
FT                   /product="ADP-L-glycero-D-manno-heptose-6-epimerase"
FT                   /note="TIGRFAM: ADP-L-glycero-D-manno-heptose-6-epimerase;
FT                   PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; KEGG: aha:AHA_4232
FT                   ADP-L-glycero-D-manno-heptose-6-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91662"
FT                   /db_xref="GOA:C4L786"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR011912"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4L786"
FT                   /inference="protein motif:TFAM:TIGR02197"
FT                   /protein_id="ACQ91662.1"
FT                   /translation="MIIVTGGAGFIGSNLVKALNQAGRKDIVVVDDLTDGTKFVNLVDL
FT                   DIADYIDKDEFIARIVSGDHFEEWGGISAILHQGACSATTEWNGKFVMDVNYEYSKDLL
FT                   HYCLEYGVQFIYASSAATYGGRNDNFIEERRFEQPLNVYGYSKFLFDEYVRRILPETDL
FT                   QIVGLKYFNVYGPREQHKGSMASVAFHLNNQVLKGENVKLFEGCDGFPNGGQTRDFIYV
FT                   EDVAKVVLWFMNHPDKSGIFNCGTGKAEPFQNVAEAVLKHHGKGEIEYIPFPDHLKGRY
FT                   QSFTQADLTKLRATGCDVKFRTVAEGVAEYMAWLNK"
FT   gene            complement(41396..42505)
FT                   /locus_tag="Tola_0033"
FT   CDS_pept        complement(41396..42505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0033"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; TOBE domain protein;
FT                   Transport-associated OB domain protein; SMART: AAA ATPase;
FT                   KEGG: spe:Spro_4470 maltose/maltodextrin transporter
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91663"
FT                   /db_xref="GOA:C4L787"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR015855"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:C4L787"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACQ91663.1"
FT                   /translation="MAGVILRNVCKTFGDVTISKDINLDIEDGEFVVFVGPSGCGKSTL
FT                   LRMIAGLEDITSGELLIGEQRMNEVPPAERGVGMVFQSYALYPHLSVADNMSFGLKLAG
FT                   ASKTEIQQRVQQAADILQLGALLDRQPKALSGGQRQRVAIGRTLVGEPNVFLLDEPLSN
FT                   LDAALRVQMRIELARLHKRLGCTMIYVTHDQIEAMTLAHKIVVLDGGLVSQVGKPLALY
FT                   HYPANRFVAGFLGSPKMNFLPVTVLAAESARVQVEIAGQTSLWLPVDGTSVSAGDQMTL
FT                   GIRPEHLLDAAASPHQLHGTILVAEQLGNETQIHLQLAGQEHPLVYRHHDVAVVRDGTA
FT                   LTIGLPAERCHLFHADGRACQRLHPEPGV"
FT   gene            complement(42652..43527)
FT                   /locus_tag="Tola_0034"
FT   CDS_pept        complement(42652..43527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0034"
FT                   /product="Maltose operon periplasmic"
FT                   /note="PFAM: Maltose operon periplasmic; KEGG: yen:YE3861
FT                   maltose regulon periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91664"
FT                   /db_xref="GOA:C4L788"
FT                   /db_xref="InterPro:IPR010794"
FT                   /db_xref="UniProtKB/TrEMBL:C4L788"
FT                   /inference="protein motif:PFAM:PF07148"
FT                   /protein_id="ACQ91664.1"
FT                   /translation="MKYTTLAFLLSLTIGGLAAPVFAAEDNHTAPAITASQLQTIHWQS
FT                   VQAGENAEFDMNASGQNLSLNQISGKVLALQLPADHGTLTLRLRSLIDGKQVFSPNVLV
FT                   LDQQQQPAAFYSSNQFSYQPASLLTGDRLEGTLKLSPAPGQKSIYLLIYTTPQDVAQHT
FT                   TLEGAVKAYAKATGNQPPNIPDPVAQHSAQGHLSLKVTTERNNDAVTIGSNHSGIAAAS
FT                   PVAAPATQEITAPAVTGLLPETENYFNLQIRQAVKNSDMARALTLVGEAEHLGSATART
FT                   TFINSVQPRK"
FT   sig_peptide     complement(43456..43527)
FT                   /locus_tag="Tola_0034"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            complement(43594..44829)
FT                   /locus_tag="Tola_0035"
FT   CDS_pept        complement(43594..44829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0035"
FT                   /product="porin LamB type"
FT                   /note="PFAM: porin LamB type; KEGG: ypb:YPTS_3827 porin
FT                   LamB type"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91665"
FT                   /db_xref="GOA:C4L789"
FT                   /db_xref="InterPro:IPR003192"
FT                   /db_xref="InterPro:IPR036998"
FT                   /db_xref="UniProtKB/TrEMBL:C4L789"
FT                   /inference="protein motif:PFAM:PF02264"
FT                   /protein_id="ACQ91665.1"
FT                   /translation="MMHHLQKLPLALAIGAVLSSASAMAVDFHGYARSGIGWTSDGGEQ
FT                   QCHQLAGAGAKYRLGNECETYAELKLGQELYKENDQVFALDTNVAYSVSQQNDWESTSP
FT                   AFREMNVQGKNLIAALPGANLWAGKRFYQRHDVHMIDFYYWDISGPGAGLENIDLGFGK
FT                   LSAAVTRDTESGGSTAWIDGTETTKDTNNDIFDVRLASLATNTDGTLELGATYGHANTA
FT                   DGYELADDASENGVMLTAEHTQSMLNGFNKFVVQYATDSMTSWNNGHAQGASVNNNGSM
FT                   VRVIDHGAISLNDKWDLMYVGLYQDTDLDNDNGSTWYSAGVRPMYKWTPIMSTQFEAGY
FT                   DHVKDQASDETNKQYKVTLAQQWQAGNNQWARPAIRLYATYAKWDEKFGTGTSSLADDN
FT                   QVTFGAQFEAWW"
FT   sig_peptide     complement(44752..44829)
FT                   /locus_tag="Tola_0035"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 26"
FT   gene            complement(44902..46011)
FT                   /locus_tag="Tola_0036"
FT   CDS_pept        complement(44902..46011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0036"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; TOBE domain protein;
FT                   Transport-associated OB domain protein; SMART: AAA ATPase;
FT                   KEGG: spe:Spro_4470 maltose/maltodextrin transporter
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91666"
FT                   /db_xref="GOA:C4L790"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR015855"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:C4L790"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACQ91666.1"
FT                   /translation="MAGVTLRNVCKTYGEVAISKDINLEINNGEFVVFVGPSGCGKSTL
FT                   LRMIAGLEDISAGDLMIGERRMNDVPPAERGVGMVFQSYALYPHLSVADNMSFGLKLAG
FT                   AGKPQIQQRVNHASEVLQLAHLLERKPKALSGGQRQRVAIGRTLVAEPQVFLLDEPLSN
FT                   LDAGLRVQMRIEIARLHKRLRSTMIYVTHDQVEAMTLADKIVVLEGGSIAQVGKPLELY
FT                   HYPANRFVAGFIGSPKMNFLPVRVHATEAERVQVELPDEQLLWLQVDSRDVQIGSMLSL
FT                   GIRPEHLLPGEAAEYRLRGEVSVVEQLGNETQIHVQMPTIQQNLVYRHNDVALVEEGSM
FT                   IEIGLPVQRCHLFREDGTACRRLHKELGV"
FT   gene            46482..47663
FT                   /locus_tag="Tola_0037"
FT   CDS_pept        46482..47663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0037"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: yen:YE3866 maltose ABC transporter periplasmic
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91667"
FT                   /db_xref="GOA:C4L791"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006060"
FT                   /db_xref="UniProtKB/TrEMBL:C4L791"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACQ91667.1"
FT                   /translation="MKKIKNLALTALAALVISAPAMAKLQEGKLVIWINGDKGYNGLAE
FT                   VGKKFEQDTGVQVLVEHPDKMEEKYPQVAASGDGPDIVFWAHDRFGGYAQSGLLTEVHP
FT                   SKELQDKMFPFTWDAVRFNGKLIGYPVAVEALSLIYNKDLIKTPPKSWEDIPALDKELR
FT                   AKGKSAIMWNLQEPYFSWPLLAAAGGYAFKTTPDGYDAKDVGVNNAGAQAGLQFIVDLV
FT                   KNKHISADVDYSIADAAFNKGETAMTINGPWAWSNSDKSGINYGVAQLPTFQGKPSKAF
FT                   VGVLTAGINSASPNKDLAAEFLENYLLTDDGLDKVNKDKPLGAVSLMSFQKKLEADPRI
FT                   AATMANAKAGEIMPNIPQMTAFWYAEKNAIVNATAGRQPVKEALDEVAKQMTK"
FT   sig_peptide     46482..46553
FT                   /locus_tag="Tola_0037"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            47733..49319
FT                   /locus_tag="Tola_0038"
FT   CDS_pept        47733..49319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0038"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: spe:Spro_4473 maltose
FT                   transporter membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91668"
FT                   /db_xref="GOA:C4L792"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR029345"
FT                   /db_xref="InterPro:IPR030156"
FT                   /db_xref="InterPro:IPR035277"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C4L792"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACQ91668.1"
FT                   /translation="MQLSVAHTTPPRLPQNKKWWRSAMFTRSLLGLVAVLNGYLIVQMY
FT                   AQREYLFAMLTLLLAGTGIYLFASRKAYSWRYVYPGLVGMGLFVLFPLFCTIGIAFTNY
FT                   SAVHQLSFERAQSVILDRQFQSGNTLNFTLLGSDGHWQLQLQDSETNQTLLSAPFALDN
FT                   QPQRLNMVPKTADTGATKAPLKVITQNRQALGQLTAVMPDGSELVMSSLRQFSAIKPLY
FT                   TLQEDDRGLRNNQTGELYQPNDEMGFYQAVDAKGEWIADTRMSPGYTVTIGWDNFLRVL
FT                   QDKGIQQPFIKIFIWTVLFAGLTVMFTLAVGMVLACLVQWQPLKGKAMYRLLLILPYAV
FT                   PGFISILIFKGLFNQSFGEINMLLEQMFGLKPEWFTNPMLAKAMILIVNVWLGYPYMMI
FT                   LCMGLLKAIPDDLYEASALDGATPLQNFFRITLPLLIKPLTPLLIACFAFNFNNFVLIQ
FT                   LLTNGGPNMLGTSTPAGNTDLLVSYTYRIAFEGSGGQDFGLAAAIATLIFLLVGALAIL
FT                   NLKASKLSVEQ"
FT   gene            49331..50221
FT                   /locus_tag="Tola_0039"
FT   CDS_pept        49331..50221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0039"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: vha:VIBHAR_05216 maltose
FT                   transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91669"
FT                   /db_xref="GOA:C4L793"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C4L793"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACQ91669.1"
FT                   /translation="MAIVQTKALRYRLWAAHAGLWCFIALIMFPLLMVIAISLRSGNFA
FT                   TGELIPSHPSLEHWKLALGFSVTNPDGSVTPPPFPVLLWLWNSVKVAFVTAVGIVALST
FT                   TCAYAFARMKFRGKSALLKGMLIFQMFPAVLSLVALYALFDRIGQYIPFLGLNTHGGLI
FT                   FAYLGGIALHVWTIKGYFETIDGSLEEAAALDGATPWQAFRLVLLPLSVPILAVVFILS
FT                   FIGAVTEVPIASLLLRDVSSYTLAVGMQQYLYPQNYLWGDFAAAAVLSAIPITVVFLLA
FT                   QRWLVGGLTAGGVKG"
FT   gene            50378..50647
FT                   /locus_tag="Tola_0040"
FT   CDS_pept        50378..50647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0040"
FT                   /product="prevent-host-death family protein"
FT                   /note="TIGRFAM: prevent-host-death family protein; PFAM:
FT                   protein of unknown function DUF172; KEGG: sbn:Sbal195_4669
FT                   prevent-host-death family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91670"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:C4L794"
FT                   /inference="protein motif:TFAM:TIGR01552"
FT                   /protein_id="ACQ91670.1"
FT                   /translation="MGVMETLTANQAKTQFGDMLLKVQRAPVQISRNGKPVAVLLSVED
FT                   YQALEAIKLRLLQEKIEQARADIAAGKLVEGDALFSSLLNGEFD"
FT   gene            50631..50963
FT                   /locus_tag="Tola_0041"
FT   CDS_pept        50631..50963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0041"
FT                   /product="plasmid stabilization system"
FT                   /note="PFAM: plasmid stabilization system; KEGG:
FT                   sbn:Sbal195_4670 plasmid stabilization system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91671"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR028344"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:C4L795"
FT                   /inference="protein motif:PFAM:PF05016"
FT                   /protein_id="ACQ91671.1"
FT                   /translation="MESSISEMRYVFTDEAKADLIQIRRFTLKNWGQNQSVHYLQELQQ
FT                   TLSRLTIMPQMGICREQDLGNGIYSFPYASHTIYYTLLNEQLIVMAVLHQSMVPDSHLE
FT                   NRKVKI"
FT   gene            51060..52019
FT                   /locus_tag="Tola_0042"
FT   CDS_pept        51060..52019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0042"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   mxa:MXAN_0965 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91672"
FT                   /db_xref="GOA:C4L796"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR024884"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C4L796"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACQ91672.1"
FT                   /translation="MRYTNQDGSQRSFPLKHVLRRQTGWHGERQPRSGRTGIPVPIVHN
FT                   DGADLHHQQHDTLTWIGHSSFLLQLGGLNMLIDPVMSSSLGGVVPRNAPPGLSWSALPK
FT                   KIDVVMITHNHRDHMDVPTLKKLGPNPLYLVPHGMRHWFLKNGFPHVQELAWWQQTQVG
FT                   NATMTFVPAQHWSRRGLMDMNTSWWGGFVMEHDGFRLYHAGDTAWFDGFREIGRRCGPI
FT                   DVAMLPIGAYAPRWFMRHQHMDPDDALKAFVALEAKLFVAMHWGTFKLTDEPLNEPPIR
FT                   LRDLWHKLQLPLARLAIPAIGQTLEFPRIDLSVALAVK"
FT   gene            complement(52148..54268)
FT                   /locus_tag="Tola_0043"
FT   CDS_pept        complement(52148..54268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0043"
FT                   /product="4-alpha-glucanotransferase"
FT                   /EC_number="2.4.1.25"
FT                   /note="KEGG: yen:YE3992 4-alpha-glucanotransferase;
FT                   TIGRFAM: 4-alpha-glucanotransferase; PFAM: glycoside
FT                   hydrolase family 77"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91673"
FT                   /db_xref="GOA:C4L797"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C4L797"
FT                   /inference="protein motif:TFAM:TIGR00217"
FT                   /protein_id="ACQ91673.1"
FT                   /translation="MDISVIEAAAKAAGIADSYISALGQPVQIAISTQEKILAALGHTS
FT                   PENNLLPAVSVFRQGELFRVLLQDAVTDTCHWRLQPESGKPLRGVLANGFLTLPDNLPL
FT                   GYHKLCLLQGRKVIAESRIIIAPARCYEPPAIQQGKKTWGACVQLYTLRSEENWGIGDF
FT                   ADLKQMVTALAAQGADFVGLNPLHALYPASPDSASPYSPSSRRWLNIIYIAVHKLPDFQ
FT                   LSSAAQLWWQNPEIQQQLQAARASDYVDYPQVTALKLAGLKLAYQYFASLPDDIPRVGE
FT                   FEQFRRQQGESLQQQATYDALHAWLKQQDEHAWGWPAWPAEYQQWESPALQLFRQEHAD
FT                   EIRFYAWLQWLTQGQLQECQQSARDAGMLIGIYRDLAVGVTEGGTETWCDRELYCLKAS
FT                   VGAPPDILGPLGQNWGLPPMSPQVMRQRGYQPFIDLIQSNMKACGALRIDHVMGLLRLW
FT                   WVPQGSTAVEGAFVSYPVDDLLAILALESQRHQCMVIGEDLGTVPDEIVAKLRDNGVYS
FT                   YKVFYFERAPAPDSGFYSPRDYPAQAMTTLSTHDMPTLYGYWQADDLTLGQKLGLYPDA
FT                   EVLSGLYADREQAKQRMLDSLHSLHSLPEEYSRQAQGMMMNPALNRGIHCHVAQSNSAL
FT                   LGLQPEDWLNMTMPVNIPGTTHEIYPNWRRKLSCTLEAMFNDSDVISLLAEINRRRRQL
FT                   YPNNLELQVGGK"
FT   gene            complement(54278..56713)
FT                   /locus_tag="Tola_0044"
FT   CDS_pept        complement(54278..56713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0044"
FT                   /product="glycogen/starch/alpha-glucan phosphorylase"
FT                   /EC_number="2.4.1.1"
FT                   /note="KEGG: ypb:YPTS_3971 glycogen/starch/alpha-glucan
FT                   phosphorylase; TIGRFAM: glycogen/starch/alpha-glucan
FT                   phosphorylase; PFAM: glycosyl transferase family 35"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91674"
FT                   /db_xref="GOA:C4L798"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:C4L798"
FT                   /inference="protein motif:TFAM:TIGR02093"
FT                   /protein_id="ACQ91674.1"
FT                   /translation="MTIKKQSKKPALFSAAEFEAALTRQWQRLGLQSATEMTPYQWWLA
FT                   VSAAVNEQVAARRTEGQLRAATGAERHVNYLSLEFLVGRLTLNNLISLDCADVVADVVR
FT                   KYGRELTDLLEQEVDPGLGNGGLGRLAACFLDSMAAVDQPAIGYGLSYQYGLFRQSFRN
FT                   GEQQEAPDDWHSEHYPWLTRHTGLTLPVGFGGEVRTDDEDRQYWVPALVVQGEAHDLPI
FT                   LGYHNQVVQTLRLWHASHPTPLDLQKFNDGEYLQAVDAGVTASKLSKVLYPSDNHQPGK
FT                   ELRLMQQYFHCACSIADILHRHLAAGRTLLSLPDYEVIQLNDTHPTIAIPELMRVLLDD
FT                   HQMCWEDAWSICTRLFAYTNHTLLPEALECWPQDLVATLLPRHFYIIDEIDRRFMAQAQ
FT                   QQWPDNEDVWQKVAVIYDGQIRMANLCVVTCFAVNGVAQLHSDLVKSDLFPEYNDLWPH
FT                   KFHNVTNGITPRRWLKQCNPDLATLLDETLKVDWARDLDTLRDLEPFAAKTDFRHRYRD
FT                   IKFANKQRLADYVWQTQGIKLDPHAIFDVQIKRLHEYKRQHLNLLQIIARYQQLRAQPN
FT                   LAVPPRVFLFAAKAAPGYHLAKNIILAINKVAERINNDPFVNDKLKVVFLPDYRVTMAE
FT                   LLIPAADVSEQISTAGKEASGTGNMKLAMNGALTVGTLDGANVEISEQVGRDNLFIFGH
FT                   TVDEVKAMLAAGYQPQHYYQQNPRLKAALDELMSGYYTPDNTQALQPLWHSLLEGGDPY
FT                   LVLADFDAYWEAQQQVDALYQQPEEWLRRCILNTARTGMFSSDRSIRDYQRQIWQPAV"
FT   gene            56970..59690
FT                   /locus_tag="Tola_0045"
FT   CDS_pept        56970..59690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0045"
FT                   /product="ATP-dependent transcriptional regulator,
FT                   MalT-like, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; SMART: regulatory
FT                   protein LuxR; KEGG: spe:Spro_4637 transcriptional regulator
FT                   MalT"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91675"
FT                   /db_xref="GOA:C4L799"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR023768"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041617"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:C4L799"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ACQ91675.1"
FT                   /translation="MLIPSKLSRPVRLQNAITRERLLQRLQTALDYRLVLLHGPAGYGK
FT                   TTLIAQWAATLPHVGWFSLDDSDNQPERFARYLVAALQHATGGHCVKSESLSQKHQYAR
FT                   LSSLLGQVFAELADWTEPTYLIIDDYHLIDNEEIHEAMRFFLRNQPDNLTLVVISRALP
FT                   PLGIANLRVREQLLELDNQLLAFNHQEAQQFFCNRLTTPMDEQESATLCDEVEGWATAL
FT                   QLIALSSPDSRSTVHQSARKLSGLNTTYLWEYLAEEVMDRIDAPTRDFLLRCSVLRSMN
FT                   DSLVAKLTGRQDGLAQLGELERRGLFVQRMDMDGDTIWFRFHPLFASFLQHCCLQQLAA
FT                   ELPELHRRAAAGWQALNIPSEAIHHALAASDALLLREILLQYGWSLFHHGELALLSGCL
FT                   EALPYDELIQSPNLVLLQAWLAQSQHRYTQVDALLERAKQAMAEHQVRLNDALQGEFNA
FT                   LRAQVALNANQPEEAIHLAREALQQLPPTNFYGRIVATSVIGEVHHYLGQLSSALPMMQ
FT                   RTEQMARRHGTYHYALWALLQQSEILIAQGFLQAAYEVQDKALELVQNQHLEQLPLHEF
FT                   LLRIRAQVLWSWYRLDEAESCARQGLQVLAGYEQKQQLQCVAMLAKVSLARGDIDNASQ
FT                   HLQRCEVLLHNADYHSDWINNADIPRLLYWQMTGDKQSVRNWLAQAERPDAACNHFLQG
FT                   QWRNIARAHLILEENDLAAEILQHLNEEARRLNLYSDLNRNLLLCTVLHWQCDERSEAQ
FT                   RTLMEALTLSNRTGFVSHFVIEGEIVAQLLRQLLQLNTLSEMEQHKAQRLLKDINQHHR
FT                   HKFAHFDEGFVEKLLNHPNVPELIRTSPLTQREWQVLGLIYSGYSNEQIAVELDVAATT
FT                   IKTHIRNLYQKLGILHRQDAVEQAQKLLKLMGYGV"
FT   gene            complement(59739..60653)
FT                   /locus_tag="Tola_0046"
FT   CDS_pept        complement(59739..60653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0046"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: yen:YE3185
FT                   fructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91676"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7A0"
FT                   /inference="protein motif:PFAM:PF00480"
FT                   /protein_id="ACQ91676.1"
FT                   /translation="MRIGIDLGGTKIEVIALDSDGGELFRKRVPTPRHDYQQTLEAITG
FT                   LVLDAEAATGKKGSVGLGIPGTISPFTGKVKNANSTWLNGQPLDKDLEAMLDRPVRIAN
FT                   DANCLAVSEATDGAGAGGKLVFAVIIGTGCGSGIAINSHVHAGGNGIAGEFGHNPLPWI
FT                   DEEEWNYQNATPCYCGKKGCIETYVSGTGFANSYKFNTGKELKGAEIMALVAQGDAAAI
FT                   KAIEDYERRLAKALAHAVNLMDPDVIVLGGGMSNVERIYDNLPRLMKEYVFGGECETPV
FT                   RKALHGDSSGVRGAAWLWQRDDL"
FT   gene            60767..61507
FT                   /locus_tag="Tola_0047"
FT   CDS_pept        60767..61507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0047"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: spe:Spro_1035 two component transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91677"
FT                   /db_xref="GOA:C4L7A1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7A1"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACQ91677.1"
FT                   /translation="MKNKILVVDDDIAICELLTDVLSEHVFEVRSCHLAQAALQTLQQE
FT                   PDIALVLLDLMLPDMSGLLLLQQIRMQFPDLPVIMLTGLATESDMVVGLEMGADDYIAK
FT                   PFVPRIVVARAKAVLRRTPVSDNPQRRIAVPISGPGFRFDGWLLNTHTGRLHTPDGDDI
FT                   ELTQGEYSLLTVLLKNARKVLTRDQLLEMTHSDALDVFDRTIDVLIMRLRRKIEPNPKQ
FT                   PEYIRTIRGAGYVMSREVTVVHKA"
FT   gene            complement(61508..62533)
FT                   /locus_tag="Tola_0048"
FT   CDS_pept        complement(61508..62533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0048"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: spe:Spro_1034
FT                   ribokinase-like domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91678"
FT                   /db_xref="GOA:C4L7A2"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7A2"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ACQ91678.1"
FT                   /translation="MNAPRCGILAAGTMLVDHVHLIDDWPEQGRLATILHTENATGGAV
FT                   PNVLRTLARMKTGLPLAAAGLVGDDLDGEFIRQCLSDDDIDCRWLQTAALPTSMTQVMT
FT                   NQRNGQRTFFHAHGSNAAFDAHILEGLHSPHKIVHLAYLLLLQQLEKPDPEYGVVAARL
FT                   FHQLQQKGYLTALDLVSIDDPERAKRVVLPALPYVDYLIINELEAATLTGQPLRTSEGK
FT                   PDLIQIPHAAKNLLQQGVRQVVVIHCPEGAWAENTNGDSLFTPSYWIEPQEIAGTVGAG
FT                   DAFCAGVLYGLHQQWGLLETLQLGNACARFNLRSTNAIDGAAPLGELQAFIAAQTAGNK
FT                   G"
FT   gene            complement(62533..63393)
FT                   /locus_tag="Tola_0049"
FT   CDS_pept        complement(62533..63393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0049"
FT                   /product="ketose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.29"
FT                   /note="KEGG: ent:Ent638_0285 hypothetical protein; TIGRFAM:
FT                   ketose-bisphosphate aldolase; PFAM: ketose-bisphosphate
FT                   aldolase class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91679"
FT                   /db_xref="GOA:C4L7A3"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7A3"
FT                   /inference="protein motif:TFAM:TIGR00167"
FT                   /protein_id="ACQ91679.1"
FT                   /translation="MPLISLAQGLSHARAHGYALGAFNVLDTHFLRALFAAAKAQRSPF
FT                   IINIAEVHFKYVSLEAICAAIKAEAALHDIPVVLNLDHGTSFDAVMKAIRLGFTSVMFD
FT                   GSGLSYEENIRQTAEVVKMCHALDISVEAELGAVGGDEGGSLYGSCDSSKFTDPSKATD
FT                   FVTRTGIDALAVAIGNAHGKYRGEPKLDFPRLQAIQEQTGLPLVLHGGSGISDADFRKA
FT                   ISLGIHKINFYTGMSQNALVAVEQAMQHRETAYDELAHMLMGIEAAIQKTVEEQMQIFG
FT                   SAGKA"
FT   gene            complement(63406..64095)
FT                   /locus_tag="Tola_0050"
FT   CDS_pept        complement(63406..64095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0050"
FT                   /product="protein of unknown function DUF1498"
FT                   /note="PFAM: protein of unknown function DUF1498; KEGG:
FT                   yps:YPTB3804 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91680"
FT                   /db_xref="InterPro:IPR010864"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7A4"
FT                   /inference="protein motif:PFAM:PF07385"
FT                   /protein_id="ACQ91680.1"
FT                   /translation="MRRSQLNEILADSQALFAQHQIYLPPFAHFTPQDWTTQDLTRFQE
FT                   VFDLQLGWDVTDMGSNDFANTGLTLFTLRNGSVGGKPYPKPYAEKIMISREGQQTPLHF
FT                   HWYKMEDIIHRGGGNMIIELYNRTADEQCDTTDVEVVLDGERQRHKAGSRLRLTAGQSI
FT                   SLTQGLYHSFWAEPGHGPVILGEVSMVNDDRRDNRFLRPQSRFSEIEEDTDPLHLLCNE
FT                   YARFLPL"
FT   gene            complement(64096..65541)
FT                   /locus_tag="Tola_0051"
FT   CDS_pept        complement(64096..65541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0051"
FT                   /product="xylulokinase"
FT                   /note="TIGRFAM: xylulokinase; PFAM: carbohydrate kinase
FT                   FGGY; KEGG: ent:Ent638_0157 xylulokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91681"
FT                   /db_xref="GOA:C4L7A5"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006000"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7A5"
FT                   /inference="protein motif:TFAM:TIGR01312"
FT                   /protein_id="ACQ91681.1"
FT                   /translation="MFLGIDLGTSSLKVVLLDNNEKLIDSVSMPLSVQHPQPGFSEQHP
FT                   DDWWQALQQAMLQFKKRQAAALQQVRAIGFSGQMHGATLLDERGSVLRPCILWNDGRSA
FT                   EECRWLEQRADFIGITGNRVMAGFTAPKLLWVQRHEPDIFARTAHILLPKDYLRYRMSG
FT                   DFASDMADSAGTLWLDTARRQWSEELLVACNLTVNQMPELYEGNQVTGTLYDTLADDWG
FT                   LPRNTPLIAGAGDNAASAIGLGVLKAGDGFVSLGTSGVIFVAADQHYANPQQAVHSFCH
FT                   ALPERWHQMAVTLSAAASLSWFSRLTSTPEAQLAQEAEQHDAGDVLFAPFLNGERTPWN
FT                   APHVRGAFFGLADQHQRGHLARAVMEGVAFSLADGYRALQQAGCAPHQMIATGGGARSQ
FT                   FWLQMIADLTQCRIIVPTYADVGAAFGAARLARLAIEPEALSHLTSHAVPATAIIRPQS
FT                   QPDLQARYQRYQQLTRWLCQQEG"
FT   gene            complement(65651..66592)
FT                   /locus_tag="Tola_0052"
FT   CDS_pept        complement(65651..66592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0052"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: ecs:ECs5071 putative
FT                   carbohydrate binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91682"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7A6"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ACQ91682.1"
FT                   /translation="MRLNKLMSTLVAAAVITTAPLAQAKDLKSIGVTVGDLANPFFVQI
FT                   TKGAEMKARELAGQDVKVTLVSSGYDLGQQVTQIDNFIAAGVDMIVLNAADSKGIAPAV
FT                   KRAQQAGIVVVAVDVAAEGADATVTSNNTQAGELGCQYIADKLQGRGDVVIINGPPVSA
FT                   VTNRVDGCMTTLNKYKDIKVLSSNQNGKGSREGGLEVMTSLLAAHPKIDAVFAINDPTG
FT                   IGADLAAKQAQRSEFFIVGVDGSPDAEEALKRDNNLFVATPAQDPQVMASRAVEIGYDI
FT                   LQGKPAPKEPVLIPVTMIDRNNVKDYKGWTVK"
FT   sig_peptide     complement(66518..66592)
FT                   /locus_tag="Tola_0052"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.984 at
FT                   residue 25"
FT   gene            complement(66666..67667)
FT                   /locus_tag="Tola_0053"
FT   CDS_pept        complement(66666..67667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0053"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   kpe:KPK_5180 putative ribose ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91683"
FT                   /db_xref="GOA:C4L7A7"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7A7"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACQ91683.1"
FT                   /translation="MSNAMSTPNTHTAATSPEKKFTLHSVIQSVGILPVLILIFIGFSL
FT                   MTPNFATESNIMNIVRQSSINTVLAAGMTFVIITGGIDLSVGSILGATAVMAMVTSLSP
FT                   ELGLLSIPVALMGGLLMGTLNGVMVAYIGLPPFIATLGTYTALRGAAYLLADGTTVINN
FT                   DISFEWIGNAYLGPIPWLVVIGFVVIGICWFILRKTTLGMHVYAVGGNANAARLTGIKV
FT                   GLVLTFVYAMSGLMAGLGGIMSASRLYSANGNLGVGYELDAIAAVVLGGTSLSGGIGSI
FT                   TGTLIGALIIAAMNNGMTLMGVSYFWQLVIKGCVIIIAVLIDKYRTRKHAGA"
FT   gene            complement(67681..69204)
FT                   /locus_tag="Tola_0054"
FT   CDS_pept        complement(67681..69204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0054"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ent:Ent638_0289 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91684"
FT                   /db_xref="GOA:C4L7A8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015861"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7A8"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACQ91684.1"
FT                   /translation="MSDKQPILEMRNIAKRFGQFYALKDVSLTIYPGEVHSLMGENGAG
FT                   KSTLMKILAGAYTATAGEIFIDGKPFTINGPKDALNAGITLIYQEINLAPNLTVAENIF
FT                   LGSELTRNGMVNRQKMEEETQIVLDRLAARFKASAKVSNLSIAEQQQVEIARALHRKSR
FT                   VLVMDEPTAALSSRETDMLFALIKKLRSEGMAIIYISHRMAEIYELSDRVSVLRDGQYI
FT                   GSLMRSELSASELVRMMVGRPLNDLFNKDRTIPKGDMVLECQDLTDEDKVLSGTLNVRA
FT                   GEIIGLSGLVGAGRSELAQMIFGARKVASGEIKLRGKPLEIRNPRDAIDCGIGFLTENR
FT                   KEQGLFLEMTVHDNIVMATIERDSKFGVLSEQKNRAISDTAIKTLNIRVPHSQVAAGSL
FT                   SGGNQQKLLISRWVAIHPKLLILDEPTRGVDVGAKSEIYRMMTDMARKGVAILMISSEL
FT                   PEIVGMSDRVYVMRAGSIVGELDGEAITQENIMELATGATHHIAGTAVA"
FT   gene            69362..71980
FT                   /locus_tag="Tola_0055"
FT   CDS_pept        69362..71980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0055"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   response regulator receiver; histidine kinase HAMP region
FT                   domain protein; histidine kinase A domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; response regulator receiver; histidine
FT                   kinase HAMP region domain protein; KEGG: spe:Spro_1028
FT                   multi-sensor hybrid histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91685"
FT                   /db_xref="GOA:C4L7A9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7A9"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACQ91685.1"
FT                   /translation="MPSLSSRRKPLFSGVRGRLLSFNLLVVSLTLAIGIIAVFGFNNAG
FT                   RLLTEMQESTLSEMNSGMEVGVKTAKVATVAVSLTQVIGAMEYQSESDLLKTSLQGLRD
FT                   SLAKMAAAPLAQQQPQLINSIHTRSDELQESVRRLLDLTRTRHLERHDLLGVIYQAQSQ
FT                   LELLAKDNGAGWPTALEQTLFANMLEMTLTIPASPDVLTQLSLLRQRWQQMIPQVDSAR
FT                   QRILLELCNTLQPVDELNQKLQNSDLAIAYHTFRIKALVNLLDQDINQYVQLVVHSASS
FT                   RAELTHNKLQTSTFTIEIFGLLAVIITALAGNYIYDNMGVLVSAIADAMTRLSKGERTV
FT                   KVPALNRQDELGDLARAFNVFANNAASLARVTKLFKEKSIQLETTFLSIRDGFALFDAE
FT                   GALIVCNPQYASLLQLDQIAHGSHFREVLQRLQQNGAQRSDGKPLSPDHLWRAEDNVLT
FT                   LELQLAGERYVELRLNRLADMSMASMVLDRTDRKILEAELIHSQKMKAVGHLTGGIAHD
FT                   FNNLLAVILGNLELLLTDDDALAERTRQRIERAYKATERGAQLTQRLLAFSRKQALRPR
FT                   AIDLAELVTNLRELMEHSLPASLRLELDIQSELRPAWMDANQLENSLLNLVVNARDAME
FT                   GRSGVIRIRLFNQRVQRTSGRVQDMVTVEVIDQGCGMTPEVLQRVFEPFFTTKVAGKGS
FT                   GLGLSMVYGFVRQSGGRVQIDSEPERGTCVRLQLPCAEAEPIALPSATVSAPVWSDDEM
FT                   PLVVVLEDQADVRQTLCEYLHSMGCLTMDTDCSEQALSWVRTIPEVQLLISDIVLPGQA
FT                   SGIEVVQQAQQLRRDIKLLLVSGHDFSEQAASQSWPLLIKPYTRADLVTQLTRLWQKKT
FT                   A"
FT   sig_peptide     69362..69484
FT                   /locus_tag="Tola_0055"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.818) with cleavage site probability 0.485 at
FT                   residue 41"
FT   gene            72198..72446
FT                   /locus_tag="Tola_0056"
FT   CDS_pept        72198..72446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0056"
FT                   /product="outer membrane lipoprotein"
FT                   /note="KEGG: asa:ASA_1294 outer membrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91686"
FT                   /db_xref="GOA:C4L7B0"
FT                   /db_xref="InterPro:IPR006817"
FT                   /db_xref="InterPro:IPR016367"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7B0"
FT                   /inference="similar to AA sequence:KEGG:ASA_1294"
FT                   /protein_id="ACQ91686.1"
FT                   /translation="MNKYQVLLGTIALSSTLLVGCANTSKVESDVQTLTGKVDQLATEI
FT                   GSIKDGQSKLAADVADAKAEAARANARLDNLATSYKK"
FT   sig_peptide     72198..72260
FT                   /locus_tag="Tola_0056"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.959) with cleavage site probability 0.281 at
FT                   residue 21"
FT   gene            complement(72691..73614)
FT                   /locus_tag="Tola_0057"
FT   CDS_pept        complement(72691..73614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0057"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   aha:AHA_3584 LysM domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91687"
FT                   /db_xref="GOA:C4L7B1"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="InterPro:IPR041597"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7B1"
FT                   /inference="protein motif:PFAM:PF03734"
FT                   /protein_id="ACQ91687.1"
FT                   /translation="MNIMRNAMPALLCGLMLTSLSASAIEYELPEANSRLVGQNVEYVV
FT                   PADSKQPLEAIAAKYQIGLSGMMEANPGVDPYLPHPGSTLVIPHQLILPDTPRQGIVIN
FT                   VAEMRLYYYPKGKNTVEVLPIGIGQLGTDTPENWVTSVQRKRANPTWTPTAKVRREYAE
FT                   KGEPLPAVWPAGPDNPMGLFALYIGNLYAIHGTNAPFGIGLRVSHGCVRLRNDDIEHLF
FT                   NVVPVGTRVQFVNQPIKVTHEPDGLRYMEVHEPLSRTFEELSSKEPSTLTMSPAVGRFI
FT                   ANADTDSHIVKQALEERSGMPTVINP"
FT   sig_peptide     complement(73540..73614)
FT                   /locus_tag="Tola_0057"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.787 at
FT                   residue 25"
FT   gene            73906..77298
FT                   /locus_tag="Tola_0058"
FT   CDS_pept        73906..77298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0058"
FT                   /product="exodeoxyribonuclease V, gamma subunit"
FT                   /EC_number="3.1.11.5"
FT                   /note="KEGG: aha:AHA_3976 exodeoxyribonuclease V, gamma
FT                   subunit; TIGRFAM: exodeoxyribonuclease V, gamma subunit;
FT                   PFAM: Exodeoxyribonuclease V RecC subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91688"
FT                   /db_xref="GOA:C4L7B2"
FT                   /db_xref="InterPro:IPR006697"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041500"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7B2"
FT                   /inference="protein motif:TFAM:TIGR01450"
FT                   /protein_id="ACQ91688.1"
FT                   /translation="MFRVYHSNQLDVLKSLLAHLIQLSPLQPALAAETILVQSPGMAQW
FT                   LKQALAQDLGVAANITFPLPSSFIWQMFHQVLPEVPQENPYTKPAMLWRLMQLLPQCMD
FT                   DVLFAPLAGYLAEDHDGRRCYQLCQRIADLFDQYLVYRPDWIVDWESGGAQGAETQLWQ
FT                   PVLWRKLVALTEQQASHLHRVNLFSSFINTLKAGKPKAVLPQRLFVFGISSLPPHYLEA
FT                   LMALGEHCEVHLLLTNPCRYYWGDLQEENQINQRVLNKLLAQRREQWQQAEQHKPLLPE
FT                   TDWQQLFSDEGEQQGNPLLVSLGKQGRDYLSLLAEISAAEIDAFAEINGDSLLHLLQQD
FT                   LLELQDGTRLRPKRPISASDRSLVLHGCHSPLREVEVLHDQLLQRFAADPTLTPKEVVV
FT                   MVADINRYGPYVQAVFGNATGERYIPFSISDRSATQENPLLQSFLTLLSLPDQRCTATE
FT                   LLELLAVPALLKRFGLAEADLTTLRRWAMESGVRWGLESGDGERFELPPRERHTWSFGL
FT                   ERMLLGFASGNETLFADVAPYTAIEGQNAVKLGQLARFIAQVMALRDELETARPITEWQ
FT                   NLVDRLLLDFYLPQEQLEEDDAAALNLIRSTLQSWQQRLSQMQYQEPLPLTVFHDHLQS
FT                   ELNAVRGGQQFLAGRVNFCTLMPMRAIPFRLVCLLGMNDGLYPRSMPPLGFDLMADQPR
FT                   KGDRSRREDDRYLFLEALLAAQQQLYISYVAHSAIDNRDLMPSVLVTELVEYCQRAFLL
FT                   PEDEEKAETEQETALHQHLLTGHPLVPYDRRYFSPTVPPATADLFSYAAEWLPALTPTG
FT                   QAGFFDARLSLPEELQGKPEIELADWLRFFRNPVAGFFRRRLRVQFVEREAALEETEPF
FT                   WLDKLQQYQLRERLLRYQRLDVDQAVWQARLLAEGMLPDGEFGRLALQADAKNLAPLAA
FT                   ALQTWPLATAQRETFHLDFAGWQLLGSVGEVYAGQLVRHRVSKLKASWLVAIWLEHLAL
FT                   SAAGKLTQPTRLLALDNGKLGEWLLAVLSADAAREQLLLWWQAFTEGMQRPLCLPVNTA
FT                   WQWLEKATTESGCLGDDAQQLQAREAAQKTYTGDGTFVSGEGQDTYLARCFPELSSEYW
FT                   EEIEEWAVQLLLPLRQHLQEAEA"
FT   gene            77295..80822
FT                   /locus_tag="Tola_0059"
FT   CDS_pept        77295..80822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0059"
FT                   /product="exodeoxyribonuclease V, beta subunit"
FT                   /EC_number="3.1.11.5"
FT                   /note="KEGG: spe:Spro_3814 exonuclease V subunit beta;
FT                   TIGRFAM: exodeoxyribonuclease V, beta subunit; PFAM:
FT                   UvrD/REP helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91689"
FT                   /db_xref="GOA:C4L7B3"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR004586"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7B3"
FT                   /inference="protein motif:TFAM:TIGR00609"
FT                   /protein_id="ACQ91689.1"
FT                   /translation="MSIPLDILTFPLGGLRLIEASAGTGKTYTIAGLYLRLLLGHGSGD
FT                   AAFGTPLPVDRILVVTFTEAATAELRQRILKAIRDTRRALEVGHSDDQLIQNLISECPD
FT                   QKLALRQLLTAERQMDEAAIYTIHGFCQRMLTQNAFESGSLFDNEFLTEEQTLRAGAVA
FT                   DFWRHITYQADALLAQALLDHWKGPEDLLREISPHLALSGLQCQPRTAETLAERHQAII
FT                   SRLNMFREAWQAAAGELESLISGSDVDKRSYSKKNLPNWLQKVGDWVNAPLSSYSLPKE
FT                   LSRFAGNELAAKSKSGTVPSHPLFAQIETLLAQPNDIDDVVIADALTQVRARLQQQKLR
FT                   QQQLSFDDLLTNLARALNSERGVLLAERIREQYPVAMIDEFQDTDPLQYQIFSTLYAHN
FT                   PECGFYMIGDPKQAIYAFRGADIFTYMQAKQQVAAHYTLQTNFRSTDELVTAVNALFAH
FT                   SGAPFIYQQDIPFEAVRAKGKKAGFVLQGLPQTALQCCFPLEGTGEVSGAAYQQRMALA
FT                   AAAQIHTWLVGAQQQQATLDGKPLRPNDIAVLVRSGREAAVMQQALRECGIASVYLSNR
FT                   ESVFAQAVAQDVARLLEACLNPQDEMLIRAAMATGLQGWTVSQLARLNDDETLWEQTVE
FT                   HIRLAGELWRNRGILPMLRQWLFWYQIPERLLADTNGERQLTDVLHLGELLQTAASTLN
FT                   GEHALLRWLLERCHQPNGDADEQQLRLDSERQRVQIVTIHKSKGLQYGLVLLPFICAYR
FT                   GNDMPRYHTGNGVQLDLTGSEHAWEKAAEERLAEDLRLLYVALTRGVFVTWLGLADLKI
FT                   NSKTKAKDDRPAALDYLLKNDSDSALTVRFRQWLQQLNNHDRAAEVAEIAFPQTPYHEI
FT                   SVPLPAPQARHFSGQLERNWRVTSYSALTVSHSTYQPTPPLPVVVSDEEPQAPRFDVFS
FT                   FPRGAHAGTFLHSLLEDLDFGADDAFCRKWITEHLQGVQLSHDWQPEPWQPVLEQWLTQ
FT                   ILNSELFPGLSLSQLTPQQCLSEMEFLLPLAPLSAPALNRCLAAGDALSANAPPLAFNE
FT                   VQGMLKGFIDLVFEHQGRFYVVDYKSNYLGDNPAAYQQDAMAQAMLEHRYDVQYQLYTL
FT                   ALHRYLRCRLPDYDYERHIGGVCYLFLRGMNGDAGSGVYATKPDKQHIAALDALFAGQS
FT                   EIGSGEFTV"
FT   gene            80819..82717
FT                   /locus_tag="Tola_0060"
FT   CDS_pept        80819..82717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0060"
FT                   /product="exodeoxyribonuclease V, alpha subunit"
FT                   /EC_number="3.1.11.5"
FT                   /note="KEGG: aha:AHA_3974 exodeoxyribonuclease V, alpha
FT                   subunit; TIGRFAM: exodeoxyribonuclease V, alpha subunit;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91690"
FT                   /db_xref="GOA:C4L7B4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006344"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="InterPro:IPR041851"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7B4"
FT                   /inference="protein motif:TFAM:TIGR01447"
FT                   /protein_id="ACQ91690.1"
FT                   /translation="MTFTFPALTPCWQALLEARLLRDLDVQLAQLLARWDADESVQLAV
FT                   ALTSQELGRGHVCFDLSTWPERLAQWQAQLSQAALSWPETTVAALDAKLQQSPLVRVIT
FT                   DPSDAEEQGQPLTLFAGRLYLSRYFRFEQQVACWLQQASLPADNAVNATELAAQLRQLF
FT                   TPQPETDWQAVAVATACEGRFTLISGGPGTGKTTTVTKLLALLVAQSEQSLLIRLAAPT
FT                   GKAAARLTESIAKAKTELATQVNADWLEGIPTQASTLHRLLGVIPGQPEFRHHAQNPLP
FT                   LDVLVVDEASMIDLPMMARLLAALPPQARLILLGDKDQLASVEAGAVLGDICRFVAQGI
FT                   SQPQAECLQQRTGYDLQPYVQVTGHPLCDRLCLLRKSWRFAADSGIGKLAEAVNNGDEK
FT                   TAQAVWTRDYRDIRLHSDEQRLEMAVKLAAEGYHAYLALLDKPMSAEGAVALLQAFNQI
FT                   RLLCALHDGPWGINGMNQAIGQRLQTQGRLQMTADWFAGRPVMITENDYGLGLYNGDIG
FT                   IAASDGERLRVWFVLPDGKAHGFLPSRLPAHDTAWAMTVHKSQGSEFTHTLLLLPPETN
FT                   PLLTRELLYTGITRAREQLDLFATPEVLALMVRKQTERYSGLVTMLETMRALHDAE"
FT   gene            82880..83773
FT                   /locus_tag="Tola_0061"
FT   CDS_pept        82880..83773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0061"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /EC_number="1.5.1.20"
FT                   /note="KEGG: aha:AHA_3949 5,10-methylenetetrahydrofolate
FT                   reductase; TIGRFAM: 5,10-methylenetetrahydrofolate
FT                   reductase; PFAM: methylenetetrahydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91691"
FT                   /db_xref="GOA:C4L7B5"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7B5"
FT                   /inference="protein motif:TFAM:TIGR00676"
FT                   /protein_id="ACQ91691.1"
FT                   /translation="MSFDSARQVEALNQNLAELSGDINVSFEFFPPATESMEQTLWNSI
FT                   ERLSKLKPSFVSVTYGANSGTRDRTHSIIKDIKERTGLVAAPHLTCVDATRDELRAIAK
FT                   DYWDNGIRNIVALRGDLPPGAGKPEMYANDLVALLKEVADFDISVAAYPEVHPEAKSAQ
FT                   ADLLHLKRKIDAGANRAITQFFFDVESYLRFRDRCAAIGIEAEIVPGILPVSNYKNLLK
FT                   FAGFTNVKIPQWLHQRFEGIADDDQMTRNMVGASIAIDMARVLSREGVKDFHFYTLNRS
FT                   ELTYAICHTLGVRPKA"
FT   gene            complement(83843..84997)
FT                   /locus_tag="Tola_0062"
FT   CDS_pept        complement(83843..84997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0062"
FT                   /product="putative transcriptional regulator, GntR family"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   pag:PLES_36731 putative aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91692"
FT                   /db_xref="GOA:C4L7B6"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7B6"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ACQ91692.1"
FT                   /translation="MFAQRIQHLTSSIIREILASAQKPNVISFAGGLPAEGSFPDIDWS
FT                   VLPNKVRQYGMSEGEPELREAIAAEARQKGISCDASQVLILSGSQQGLDLVSKLFIDPD
FT                   SNVLVESPTYLAALQCFNLFQANCRGVNLSSQGPDIANFEHQIRDYKPRFTYLIPSFQN
FT                   PSGTCYTPESRQAVAALLDQYNLPLIEDEPYCELDYDNLAKPPICSFMKTAPWIYFGSF
FT                   SKVLIPGLRIGYLIAHPDLITPLVRLKQASDLHTNRPGQWLALEYMNSADKPQRLERLR
FT                   EFYRVRRDAFAAALESEFADLAEWQIPSGGLFFWLKLKKTVDTRPLLKIALEAGVAFMP
FT                   GEAFFAEENPPHGYIRLNFSHTEPELMVEGLRRLRKVLLESDNA"
FT   gene            85130..85627
FT                   /locus_tag="Tola_0063"
FT   CDS_pept        85130..85627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0063"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: bcr:BCAH187_A2582 transcriptional
FT                   regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91693"
FT                   /db_xref="GOA:C4L7B7"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7B7"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACQ91693.1"
FT                   /translation="MVDQNNQNSLNAALELFHFAFRAFTSGPDAILAEQGLQRVHHRIL
FT                   YFVGRNPAISVNALLKILGVSKQALNGPLRALKELDLIDANSDEFDKRIKRLTLSEQGQ
FT                   ALENRLSQSQRELMTQVFTDAGEDAEQHWRAIMLKLAETKFAHLLNQDNSDKAGEGWSA
FT                   EC"
FT   gene            complement(85677..87146)
FT                   /locus_tag="Tola_0064"
FT   CDS_pept        complement(85677..87146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0064"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: DEAD/DEAH box helicase domain protein;
FT                   helicase domain protein; SMART: DEAD-like helicase ;
FT                   helicase domain protein; KEGG: slo:Shew_0604 DEAD/DEAH box
FT                   helicase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91694"
FT                   /db_xref="GOA:C4L7B8"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028622"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7B8"
FT                   /inference="protein motif:PFAM:PF00270"
FT                   /protein_id="ACQ91694.1"
FT                   /translation="MSFTELGLSEPLLRAVKDKGYDTPSPIQLQAIPAVLAGQDVMAAA
FT                   QTGTGKTAGFTLPLLHRLSRGNPARSNAVRALVLTPTRELAAQVAESVTTYGKYLPLKS
FT                   VVVFGGVNINPQMLAMRKGADVLVATPGRLLDLVSQNALHFRQLEVLILDEADRMLDMG
FT                   FIRDIRKIINMLPKDRQTLMFSATFSDEIRTLAKGLLNEPVQIDVAPRNTTAETIKQTI
FT                   CPVDKGRKPALLCHLIKHNNWQQVLVFMRTKHGANKLVTQLETAGIQAAAIHGNKSQGA
FT                   RTRALSGFKDGSVRVLVATDIAARGIDIAQLPQVVNYELPNIAEDYVHRIGRTGRAGME
FT                   GHAISLVSADEQPLLVDVEKLIKQILPREEFDGFKPQNPVAMTTEAQLTRPVKKPKKPK
FT                   MFDDGRSQEPRQQRSPRSSQGEQHKAHSPHTGQPRPHQPKQAEGAAKPASPTRSGTQRA
FT                   GQPSRSANAPAGRPQGNRSAAGGQRSSKPQH"
FT   gene            complement(87219..88628)
FT                   /locus_tag="Tola_0065"
FT   CDS_pept        complement(87219..88628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0065"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: DEAD/DEAH box helicase domain protein;
FT                   helicase domain protein; DbpA RNA-binding domain protein;
FT                   SMART: DEAD-like helicase ; helicase domain protein; KEGG:
FT                   asa:ASA_3744 ATP-dependent RNA helicase DbpA"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91695"
FT                   /db_xref="GOA:C4L7B9"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7B9"
FT                   /inference="protein motif:PFAM:PF00270"
FT                   /protein_id="ACQ91695.1"
FT                   /translation="MSDTNSAATAASSAFAQLALQPALLENLTALGYSEMTPIQAQSLP
FT                   AVLQGKDVLAQAKTGSGKTAAFALGLLQGLDVKSLNVQGLVLCPTRELADQVAGEIRRL
FT                   ARLIPNVKVLTLCGGMPIGPQFSSLEQGAHIVVGTPGRVQKHLDKESLSLAALKTWVLD
FT                   EADRMLDMGFADAMREIAKVCPRQRQTLLFSATYPEDIQRLSTEFQRNPLSVRVESTHS
FT                   AVQIEQRFFELPNQEAKFPALLKLLQHYQPRSTVIFCNMKHQTQQVADALSAQGYSALA
FT                   LNGDLEQRERDQVVVRFSNQSCAILVATDVAARGLDIKELQAVVNYDLTPDPEIHVHRI
FT                   GRTGRAGQTGLALTLTTASQTNRVLQIEDYQQSQAVWGNLDELKKNPDNMKPEMVTLCL
FT                   DGGRKSKVRPGDILGALTKEAGFNGQHIGKINIAELHAYVAVHHSIANKVYGYLQDGKI
FT                   KGRKVRVRKLV"
FT   sig_peptide     complement(88578..88628)
FT                   /locus_tag="Tola_0065"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.938) with cleavage site probability 0.377 at
FT                   residue 17"
FT   gene            88973..89734
FT                   /locus_tag="Tola_0066"
FT   CDS_pept        88973..89734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0066"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: regulatory protein DeoR; SMART: regulatory
FT                   protein DeoR; KEGG: aha:AHA_1651 glycerol-3-phosphate
FT                   regulon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91696"
FT                   /db_xref="GOA:C4L7C0"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7C0"
FT                   /inference="protein motif:PFAM:PF08220"
FT                   /protein_id="ACQ91696.1"
FT                   /translation="MKQSQRHQNILNLLNQHGFVSTEEMVAQFDVSPQTIRRDLNELAE
FT                   QKQIIRHHGGASLPDSSTSNTAYSTRKVMQLAEKERIAAQVAARIPDGASLFIDIGTTT
FT                   EAIARALLHHKDLRIVTNNLNVAMILTEKDDFKVIIAGGEIRNRDGGIIGEATRDFIGQ
FT                   FRMDFGIIGISGIDMTGALLDFDYHEVRVAQSIIAHSRQVFLATDHTKFGRNAMVNLGN
FT                   ISQVDVLFTDQQPPEEIQRIMQQGQVECCIC"
FT   gene            complement(89950..91491)
FT                   /locus_tag="Tola_0067"
FT   CDS_pept        complement(89950..91491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0067"
FT                   /product="Glycerol-3-phosphate dehydrogenase"
FT                   /EC_number="1.1.5.3"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   aha:AHA_1652 glycerol-3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91697"
FT                   /db_xref="GOA:C4L7C1"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7C1"
FT                   /inference="protein motif:PRIAM:1.1.99.5"
FT                   /protein_id="ACQ91697.1"
FT                   /translation="MMNTIPHYDLVVIGGGINGTGIAADAAGRGLSVALFEADDLASAT
FT                   SSASSKLIHGGLRYLEHYEFRLVKEALAERETLLRMAPHIAHPMRFRLPHRPHLRPAWM
FT                   IRAGLFLYDHLAKRVTLPACSSIKFSPNDGVQPHLVKGFEYSDAWVDDARLVVLNAMQA
FT                   RNHGARVDTRTACVKARREKEHWQLTLQDQLNGNTFEVTANALVNATGPWVKRLFDEAM
FT                   ELKSPRNIRLVKGSHIIVPRIHEREEAYILQNEDKRIVFVIPYQQHFSLIGTTDLEYKG
FT                   DLRAVKINEEEVQYLCDVVNKHFIHQIAPKDVVWSYSGVRPLCDDESSSPQAVTRDYTL
FT                   ELADEQGKAPLLSVFGGKLTTYRKLAQAACHKLAPYFPQAREDWTATSKLPGADFEGNV
FT                   LHLTQKYRKQAPWLDAATARRIASCYGSLAAGWLPKELTLNFGSELCREEVDYLMEQEW
FT                   ACSAEDILWRRTKLGLTLSDAAQAQLKAYVAQRMAVRCGKPVTQIKENIEETSAA"
FT   gene            complement(91663..93156)
FT                   /locus_tag="Tola_0068"
FT   CDS_pept        complement(91663..93156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0068"
FT                   /product="glycerol kinase"
FT                   /note="TIGRFAM: glycerol kinase; PFAM: carbohydrate kinase
FT                   FGGY; KEGG: asa:ASA_2710 glycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91698"
FT                   /db_xref="GOA:C4L7C2"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7C2"
FT                   /inference="protein motif:TFAM:TIGR01311"
FT                   /protein_id="ACQ91698.1"
FT                   /translation="MTKQRYVVALDQGTTSSRAIIFDHDARIVAVSQREFTQHYPQPGW
FT                   VEHDPMEIWATQSSTLTEALAKSGIHNDEIAAIGITNQRETTVVWEKATGKPVYNAIVW
FT                   QCRRTAAICEELKARGLDNYVRENTGLLLDAYFSGTKVKWILDNVEGAREKAERGELLF
FT                   GTIDTWLIWKMTNGEVHVTDPTNASRTMLYNIRDLQWDGHILQELGIPASMLPQVRPSS
FT                   EVYGYTTRGGGAQIPISGIAGDQQAALFGQLCFEKGMAKNTYGTGCFLLMNTGETPVKS
FT                   ESGLLTTIAVGPTGNVNYALEGSVFMGGATVQWLRDELRLIDDATDTGYFAGKVKDSNG
FT                   VYLVPAFVGLGAPYWDPYARGAIVGLTRGANRNHIIRAALESIAYQSRDVLDAMQKDSG
FT                   IRLASLKVDGGAVANDFLMQFQSDIMGTTVVRPKLIETTALGAAFLAGLAVGFWESTAE
FT                   LSDKFSIDREFEPALPAEQREQLYSGWQKAVTRSQHWVD"
FT   gene            complement(93324..93491)
FT                   /locus_tag="Tola_0069"
FT   CDS_pept        complement(93324..93491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0069"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aha:AHA_0716 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91699"
FT                   /db_xref="GOA:C4L7C3"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7C3"
FT                   /inference="similar to AA sequence:KEGG:AHA_0716"
FT                   /protein_id="ACQ91699.1"
FT                   /translation="MARLFLLPFLLALGWTLWLVYFRIPLYQGRKGFYWIIGVSGVLVA
FT                   FFSLMLFITH"
FT   gene            93545..94498
FT                   /locus_tag="Tola_0070"
FT   CDS_pept        93545..94498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0070"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   asa:ASA_0714 quinone oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91700"
FT                   /db_xref="GOA:C4L7C4"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7C4"
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /protein_id="ACQ91700.1"
FT                   /translation="MAQLQITRFGGVDVLQLTEKELPAPAADQVLLAVLLASVNPIDAK
FT                   TRAGLGWAAQKFKDALPWTPGFDVCGVVREAGSDVTTFSVGQRVCGMTSGGGAYASAML
FT                   APAAELLPVPKNITHAQAAALPLAGLTARQGLFEFGQLQAGETVLISAAAGGVGHIAVQ
FT                   LAKQAGATVVATASEANHDFLLKLGADKVVDYHDAEAMAALTGQVDFVFDLVGFDSGLT
FT                   ALSLLKAGGRQVTVPTIAVPAIKAVAETQGKTVSGMLVHQDADGLAALLALCSAGKLQV
FT                   HVSKIYPLAEGAKAHQAIESGRTRGKLLLDPGSQEM"
FT   gene            94499..95107
FT                   /locus_tag="Tola_0071"
FT   CDS_pept        94499..95107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0071"
FT                   /product="beta-phosphoglucomutase family hydrolase"
FT                   /note="TIGRFAM: beta-phosphoglucomutase family hydrolase;
FT                   HAD-superfamily hydrolase, subfamily IA, variant 3; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; KEGG:
FT                   cja:CJA_3014 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91701"
FT                   /db_xref="GOA:C4L7C5"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010976"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7C5"
FT                   /inference="protein motif:TFAM:TIGR02009"
FT                   /protein_id="ACQ91701.1"
FT                   /translation="MFDVNAYQNYAAWIFDLDGTLSNTLQAHDLAWQHALTQFAIPFTS
FT                   ERMQQLGGVPIPDTVEILADEAGIRVDVPAVVNVRDRRFYELLPTTLSPTPLVAGVVLP
FT                   FLGEKPMAVGTGCHTDMARRILAGLSLDHYLPVVVGADQVTNPKPAPDTFLLAAEKLGV
FT                   KPERCLVFEDADAGLKAAAAAGMAAVDVRKLWPVQRPLQ"
FT   gene            95247..97280
FT                   /locus_tag="Tola_0072"
FT   CDS_pept        95247..97280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0072"
FT                   /product="type VI secretion system Vgr family protein"
FT                   /note="TIGRFAM: type VI secretion system Vgr family
FT                   protein; Rhs element Vgr protein; PFAM: Rhs element Vgr
FT                   protein; KEGG: pst:PSPTO_5415 rhs element Vgr protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91702"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7C6"
FT                   /inference="protein motif:TFAM:TIGR03361"
FT                   /protein_id="ACQ91702.1"
FT                   /translation="MFFEANEARFLFAVPGHAAAFQVLRFSGEEYISKSFDFRVTLVCE
FT                   DNQLDLASFLYQPCVLKIKSPDRIREITGVVYDISQHDTGLRFTEYHITVKPRFDLLQL
FT                   RVNYRIYQQLATQQIVEQLLQEAGFTTLDYRWRLHEQHQPREYCVQYAESDYDFIHRIL
FT                   SEEGIHYHYATQNGQTVLVFGDSNAAFANGVAMDYLPASGLNPDKPALRECQTFWRTVS
FT                   GKVSGRDFTFLRPVTPLDSEVTPPPVAQNHQTQISAKNQPSAQANPSDKLEEYRWPNLS
FT                   DTEAENLRQNKLALARHMQAAIELQGVTDHGDLVAGKFTTFHELPRREFEPLWLVRQVH
FT                   HEGEQPQVLEETSGGQASYHNQFVAVPWQVLFVPGWWSKRPDLPGYQTAIVTGPKGEEI
FT                   YTDVYGRIKVQFHWDKEGQGDDKTSCWLRVAQGWAGDRYGSHWIPRVGQEVVVSFEHGN
FT                   PDRPLVLGCVYNGANQHPYALPAHKTRTVFKTLSTPGGGGFNELRFEDKKGREQIFLHA
FT                   QRDWELMVKANAYATIDGDSHRLTQGNVIERVKHDRSETVKKERFEELNADDRLKLKGT
FT                   QQQQIEQSFMVSVADELHQNAAIKINMEAGAGLTLKVGGSFITLSPAGVQMVAPAISLN
FT                   GGGAPLVGSDLSLLDMIKPIGAVVAAARSAKAAASKRCRKQK"
FT   gene            97280..98143
FT                   /locus_tag="Tola_0073"
FT   CDS_pept        97280..98143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0073"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vfm:VFMJ11_A1068 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91703"
FT                   /db_xref="InterPro:IPR025391"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7C7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACQ91703.1"
FT                   /translation="MMTLDDWQQKLPATYMVYALIDPLADNKPLEYWYRQADQTDAWPL
FT                   YAGTEFKDEVLYGLWLLPLAQLPGWQAWWREQEAAGYATGMLIASEHMPGKLVQHWQSL
FT                   LLAGLDGEEVIFRYYDPRILGPMLYTFTEEETRRFLGPTNELVVWHQNDWLITSPYPEL
FT                   DLTEHAEPWWRMQDGHFVGQPGEKEITLFNLEQWLWRNANELTTVLYERNGPISEQLEQ
FT                   TYQRAMSGSIPELWQPAWMILDLMGYLHWWPKIQSLKEIRGADEQRDVMAKVIQQIKKA
FT                   QTGGAE"
FT   gene            98146..99360
FT                   /locus_tag="Tola_0074"
FT   CDS_pept        98146..99360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0074"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: esa:ESA_00293 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91704"
FT                   /db_xref="InterPro:IPR017483"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7C8"
FT                   /inference="similar to AA sequence:KEGG:ESA_00293"
FT                   /protein_id="ACQ91704.1"
FT                   /translation="MTAKINQCRDCQPKDQWIEIRLVDEMNQPFGSLSGKLKDSSGVEH
FT                   QVTLSGGYLLLTDLPAGPVELKIETSALLNEAKKHKPRPSPQTSPAKEYADKHKGYEKS
FT                   KIKYQFITMGDVWQLEPGMVSDRHKAGQTGKLLRMVSNNSYFLEVRALTQLHLPLVIFQ
FT                   SQKPMDDIKADDMQSGDMSRNQIMNLGMFKPFSKLDYEFDLPASDHFANFRLFASSVSW
FT                   GEYGSLTKMMIDRFEQNVGGKFTHPLLDKAAKSHQNTDAVVDKISDAISAELKKKSGEL
FT                   EDNDIKKIWNSLATGKNSIHLPGFDTTPDWFNGLGITVHGIWSLQLTLQNLSIDLVNRT
FT                   FNGVVSFKAQDHFGLNVDDVSGDKYFEFLRLFRSWFILQRYKGFGYKPFITEMNHTRKI
FT                   SGDFR"
FT   gene            99357..99872
FT                   /locus_tag="Tola_0075"
FT   CDS_pept        99357..99872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0075"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ses:SARI_02597 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91705"
FT                   /db_xref="GOA:C4L7C9"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7C9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACQ91705.1"
FT                   /translation="MIYNLKMKKSHVGWLFFIFVILYFTSDYWLPSKIDTIYKSEFESD
FT                   QGSFVITIANPPLTKKDMLSFWSENKKYILDEVNGLDEGESILFVKNEFENKSKEEAVQ
FT                   FCLLEQKNDEEPCVSYSDRLFIAERENINRVKSYRLTFSDYYGASSCAIYERDDGEKEY
FT                   NNDCTDVK"
FT   gene            complement(99965..100525)
FT                   /locus_tag="Tola_0076"
FT   CDS_pept        complement(99965..100525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0076"
FT                   /product="transferase hexapeptide repeat containing
FT                   protein"
FT                   /note="PFAM: transferase hexapeptide repeat containing
FT                   protein; KEGG: aha:AHA_0748 carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91706"
FT                   /db_xref="GOA:C4L7D0"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7D0"
FT                   /inference="protein motif:PFAM:PF00132"
FT                   /protein_id="ACQ91706.1"
FT                   /translation="MIRKNPSGHLPVIAESAYVDKTAIICGKVIIKDNVFVGPYAVIRA
FT                   DEVDANGEMEPIVIGANSNIQDGVVIHSKSGAAVTIGEYSSIAHRSIVHGPCKVGNRVF
FT                   IGFNTVLFNCEVGDGAVIRHNSVIDGQDLPAEFYVPSSTRICPQTNLDEIPRVTVAATE
FT                   FSEDVAHTNIDLVKGYKALQNEF"
FT   gene            complement(100742..101848)
FT                   /locus_tag="Tola_0077"
FT   CDS_pept        complement(100742..101848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0077"
FT                   /product="cobalamin synthesis protein P47K"
FT                   /note="PFAM: cobalamin synthesis protein P47K; cobalamin
FT                   synthesis CobW domain protein; KEGG: asa:ASA_0434
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91707"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036627"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7D1"
FT                   /inference="protein motif:PFAM:PF02492"
FT                   /protein_id="ACQ91707.1"
FT                   /translation="MSESRFDTEDFRIPVTVLTGFLGSGKTTLLNYWVKQPEMANCAVL
FT                   INEFGAVGLDHHLVEKLDDNVVMLESGCVCCTVQGDLVNALRDLFMRAMRREIKPFQRV
FT                   LIETTGLADPGPVLFTLRNDPFFAQRYRFDGTVTVVDVCHITRQLNQQYEAVKQVALAD
FT                   LLVLTKSDIADFGVLPEVENLLQRINPMAPRHIAIKGELSPAVLEQNGPFGSGSQRSTQ
FT                   EIRKWLQGAIAELGLASPMKPATPTVSPLIANAPVASAHSDIDAFCLRYTKPIPTARFL
FT                   DGLRMVQMRYPERLLRFKAILWLEEQDTPVVVHGVHDQLYPIMNLPAWPNGEPASELVF
FT                   IMKQTDRQEVEEMLQEEFFPKYPRFQYE"
FT   gene            complement(101980..102168)
FT                   /locus_tag="Tola_0078"
FT   CDS_pept        complement(101980..102168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0078"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hypothetical protein LOC690456"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91708"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7D2"
FT                   /inference="similar to AA sequence:KEGG:690456"
FT                   /protein_id="ACQ91708.1"
FT                   /translation="MAGYRAGYGDEDEDVWGEGPDEEEEGVEPDWDDDEDEEWDEETGD
FT                   WSEGEDDFDLDPDDEEE"
FT   gene            complement(102315..102755)
FT                   /locus_tag="Tola_0079"
FT   CDS_pept        complement(102315..102755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0079"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: asa:ASA_0046
FT                   universal stress protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91709"
FT                   /db_xref="GOA:C4L7D3"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7D3"
FT                   /inference="protein motif:PFAM:PF00582"
FT                   /protein_id="ACQ91709.1"
FT                   /translation="MNQEHSYNHVLVALDINDDFQPLLERAIAVARRHNAKLSVLHVDI
FT                   NLRDLYTEMVDIDVERVQRKVLADTKNKLDTILAGIDYPLERSMVMCGDLVEEVNQVVD
FT                   AQNIDLLICGHHQSFWNLLASAARQLMNSVRCDLLIIPIPAK"
FT   gene            complement(102770..104632)
FT                   /locus_tag="Tola_0080"
FT   CDS_pept        complement(102770..104632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0080"
FT                   /product="potassium efflux system protein"
FT                   /note="TIGRFAM: potassium efflux system protein; PFAM:
FT                   sodium/hydrogen exchanger; TrkA-N domain protein; KEGG:
FT                   asa:ASA_3987 glutathione-regulated potassium efflux system
FT                   protein KefC"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91710"
FT                   /db_xref="GOA:C4L7D4"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7D4"
FT                   /inference="protein motif:TFAM:TIGR00932"
FT                   /protein_id="ACQ91710.1"
FT                   /translation="MEQNMLFDAAIFLTAAVVSVPLARRLGLGSVLGYLIAGVIIGPYL
FT                   FNFVGASDEVMHVAEFGVVLMLFLIGLELKPALLWQLKGPIIGIGGSQVLFTSTAFTLI
FT                   ALVFGLRWQQALAVGMILALSSTAIVLQSLTERRMLKSEAGQTSFSVLLFQDIAVIPML
FT                   ALLPFLAPGIRFEPEPSALSGWQNGLLIALVISGIVLGGHYLMRPVFRFIAQSGLREIF
FT                   VAAALLLVILTALATEAVGLSPALGTFLAGVVLAESEYRHELEANIEPFKGLLLGLFFI
FT                   SVGAGINFSLLAEHPFLIAGLLLLLLSVKFLILQGVGGLAHMTHGHRWSFAFALAQGSE
FT                   FAFVLFSFAQQLKLFDTQLTALLTLTVALSMAFTPLLLMLNHYLQSKWQAEEKEERAAD
FT                   QIDEQDNPVIIVGFGRFGQVIGRLLHAHGIGTTVLDNDVSHIDMLRKYGYKVFYGDADR
FT                   IDLLQAAGADKAKLLIVAVSNQAKSIALCELAQRHFPQLKILVRAVDRAHAHQLLQLGV
FT                   ELIYRETVGSAVDLGVSALRQLGIRGNLAWRAGQTFKEHDEKLLREQTAFLDDEKMYIT
FT                   KSVQYRHILAEMLQATQQDRHSELMHAWEHMDDEDEEDEHEGIH"
FT   gene            complement(104632..105228)
FT                   /locus_tag="Tola_0081"
FT   CDS_pept        complement(104632..105228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0081"
FT                   /product="NAD(P)H dehydrogenase (quinone)"
FT                   /note="PFAM: NAD(P)H dehydrogenase (quinone); KEGG:
FT                   asa:ASA_3986 glutathione-regulated potassium-efflux system
FT                   ancillary protein KefG"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91711"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7D5"
FT                   /inference="protein motif:PFAM:PF02525"
FT                   /protein_id="ACQ91711.1"
FT                   /translation="MKRILIIFAHPGYHRSHANRAMLRGLKGLEDVKVHDLYQHYPNMF
FT                   IDVAREQRMLRDYDIIVFQHPIYWYSCPAILKEWMEQVLEYGYAFGPEGNALKHKYLLA
FT                   AVTTGGSAASYSTTGHNHHPITDYLLPIQQSGLMCGMRWLPPFVVYGYHSVNDPDYLKM
FT                   KGQQYRRLLTALRDEEFTPQQLHNATYLTDLLKEL"
FT   gene            105462..107528
FT                   /locus_tag="Tola_0082"
FT   CDS_pept        105462..107528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0082"
FT                   /product="Oligopeptidase B"
FT                   /EC_number="3.4.21.83"
FT                   /note="PFAM: peptidase S9A prolyl oligopeptidase domain
FT                   protein beta-propeller; peptidase S9 prolyl oligopeptidase
FT                   active site domain protein; KEGG: asa:ASA_3983 protease II"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91712"
FT                   /db_xref="GOA:C4L7R3"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR002471"
FT                   /db_xref="InterPro:IPR023302"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7R3"
FT                   /inference="protein motif:PRIAM:3.4.21.83"
FT                   /protein_id="ACQ91712.1"
FT                   /translation="MNSILPPIATQHPHSLIFHGDERIDPYYWLRDDTRSNPEVLDYLH
FT                   AENGYAEAMLRPTEALQKTLYQEMVDRQLPDDSSVPYYLKGYWYRSRYLPEQEYPLYER
FT                   LAARPDAPTELLLDGNQRAAGVDFYDLGALEVSPSNHWMACGEDFVSRRQYQISVRNLQ
FT                   TGEWLPDLLENTSGDVVWSADSAGFFYVRLDSETLLPYQVWYHTLGADPAQDKLVYEEA
FT                   DNTYYLHISHSRSEEYLLISLSSTLSSEVHLLSLKTPHGTPTLFLARRRGHEYGLDHFQ
FT                   QHFYVRSNREGRNFALYLADDGAEQHWQCLLPVREHTLLQDFVLFRNALFVEERDAGLT
FT                   RLRELDLQGKEVRTIAVDDPAYVLWLGTNPDPDNPEFRYGYASLTTPTTHYALDIASGE
FT                   RKMLKRQPVLGDFKPDYYQSQRLWIEARDGTQVPVSLVYRKDLYQPGQNPLLVYGYGAY
FT                   GMSEDPYFASSRLSLLDRGFIFAIAHVRGGEELGRHWYEQGRQLKKMNSFTDFIDATEG
FT                   ILAAGYGDPKRVFATGGSAGGLLMGAVANMAPERYLGVVAVVPFVDTLTSMLDESIPLT
FT                   TGEYDEWGDPRDPAVYQYIKSYSPYDQIKPQAYPHLLVVSGLHDSQVQYWEPAKWVAKL
FT                   RANKTDDHLLLLSMDMDAGHGGKSGRYRYFLDIAQEYAFMLALADTSINSASI"
FT   gene            107633..107932
FT                   /locus_tag="Tola_0083"
FT   CDS_pept        107633..107932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0083"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   asa:ASA_3969 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91713"
FT                   /db_xref="InterPro:IPR005272"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7R4"
FT                   /inference="protein motif:PFAM:PF04175"
FT                   /protein_id="ACQ91713.1"
FT                   /translation="MTTVDHMEEVCEACGCVAEVGTIIRDGDDLVMIPVEGDNEEDARA
FT                   RQERYIAVAKEACPDVLVSSELQTVEDGVVLNTTLQFTCTAEKMIFEMRARFVR"
FT   gene            complement(108762..109361)
FT                   /locus_tag="Tola_0084"
FT   CDS_pept        complement(108762..109361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0084"
FT                   /product="flavoprotein WrbA"
FT                   /note="TIGRFAM: flavoprotein WrbA; PFAM: flavodoxin/nitric
FT                   oxide synthase; NADPH-dependent FMN reductase; KEGG:
FT                   ypm:YP_1536 TrpR binding protein WrbA"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91714"
FT                   /db_xref="GOA:C4L7R5"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010089"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR037513"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4L7R5"
FT                   /inference="protein motif:TFAM:TIGR01755"
FT                   /protein_id="ACQ91714.1"
FT                   /translation="MTKVLVLYHSMYGHIETMANSIAEGAREVSGVEVTIKRVPETMDP
FT                   ARFAAAGGKTEQSAPVATPAELVDYDAIIFGVPTRFGNMTAQMRNFLDQTGGLWAKGAL
FT                   FGKIASVFASTGVGGGQEMTITSTWTTLAHHGMVIVPIGYGTAEMFDISHVGGGTPYGA
FT                   TTLAGGDGSRQPDARELAIARFQGKHVATVAAKMKG"
FT   gene            complement(109528..109899)
FT                   /locus_tag="Tola_0085"
FT   CDS_pept        complement(109528..109899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0085"
FT                   /product="phage shock protein C, PspC"
FT                   /note="TIGRFAM: phage shock protein C; PFAM: PspC domain
FT                   protein; KEGG: hch:HCH_05445 phage shock protein PspC"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91715"
FT                   /db_xref="GOA:C4L7R6"
FT                   /db_xref="InterPro:IPR007168"
FT                   /db_xref="InterPro:IPR014320"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7R6"
FT                   /inference="protein motif:TFAM:TIGR02978"
FT                   /protein_id="ACQ91715.1"
FT                   /translation="MNSSGRKLYRSSNQAWLGGVCAGVAECYGQPVWLVRILMITLFVF
FT                   SGSLGILVYLAGVFLLEKQPTQLPPQPGIRPQFGYGEDTAQRARQLGERMKKLDQRLQA
FT                   MERYVTSSRYRFDKEFNKL"
FT   gene            complement(109913..110170)
FT                   /locus_tag="Tola_0086"
FT   CDS_pept        complement(109913..110170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0086"
FT                   /product="phage shock protein B"
FT                   /note="TIGRFAM: phage shock protein B; PFAM: shock B family
FT                   protein; KEGG: hch:HCH_05444 phage shock protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91716"
FT                   /db_xref="GOA:C4L7R7"
FT                   /db_xref="InterPro:IPR009554"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7R7"
FT                   /inference="protein motif:TFAM:TIGR02976"
FT                   /protein_id="ACQ91716.1"
FT                   /translation="MSLMMFFFVPAVVFLALVAPVWLILHYWTQSRLNRGLSAEERLQM
FT                   EDALALANRLEQRISALETILDVQQPDWRRHDDNRNHRSS"
FT   gene            complement(110170..110844)
FT                   /locus_tag="Tola_0087"
FT   CDS_pept        complement(110170..110844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0087"
FT                   /product="phage shock protein A, PspA"
FT                   /note="TIGRFAM: phage shock protein A; PFAM: PspA/IM30
FT                   family protein; KEGG: hch:HCH_05443 phage shock protein A
FT                   (IM30), suppresses sigma54-dependent transcription"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91717"
FT                   /db_xref="InterPro:IPR007157"
FT                   /db_xref="InterPro:IPR014319"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7R8"
FT                   /inference="protein motif:TFAM:TIGR02977"
FT                   /protein_id="ACQ91717.1"
FT                   /translation="MGIFSRFSDIINSNLTALLDRAEDPAKMVRMMIQEMEETLVEVRT
FT                   SSARVLADRKEQERRLQRLQSDVLDWEHKARLALSKGRDDLARAALAEKQAVEETLQLA
FT                   GRELKVIEDQLCVLNEEISQLQQKLDDAKAKQQSLLAREQTSRSRMDIRRSSNREKLEE
FT                   AFRKFEAYERKMDNMEAEVEAQDLGRTRTLHDEFTELTRNDKVESELEALKASMTNQRS
FT                   EH"
FT   gene            111021..112055
FT                   /locus_tag="Tola_0088"
FT   CDS_pept        111021..112055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0088"
FT                   /product="sigma54 specific transcriptional activator, PspF,
FT                   Fis family"
FT                   /note="KEGG: hch:HCH_05441 psp operon transcription
FT                   activator PspF (sigma 54-dependent); TIGRFAM: psp operon
FT                   transcriptional activator; PFAM: sigma-54 factor
FT                   interaction domain-containing protein; helix-turn-helix
FT                   Fis-type; ATPase associated with various cellular
FT                   activities AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91718"
FT                   /db_xref="GOA:C4L7R9"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014317"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7R9"
FT                   /inference="protein motif:TFAM:TIGR02974"
FT                   /protein_id="ACQ91718.1"
FT                   /translation="MTTPKQHVIGSSEIWHQVLQQASQLAPLNRPVLLIGERGTGKELI
FT                   AERLHYLSKRWQQPYLQVNCAAMQENLLESELFGHEVGSFTGATRSREGLFERADGGTL
FT                   FLDELATASLQVQEKLLRVIEYGRFERLGGSKTLRVDVRVVAACNEDLPALVGQGRFRG
FT                   DLLDRLAFDVLNLPPLRYRKEDIAELAEHFALRMCLELGYDYFSGFTVHALQQLMEHDW
FT                   PGNVRELKNVVERSIYRHADPAKPVADIVLDPFASPWRTSSAMISPSVIPVSAEPHISP
FT                   VLQTCDLKTELARLEQRLILQALQQQHFHQRRTAQALGVSYDQLRAALRKYPHLLTKRS
FT                   SNEG"
FT   gene            112630..112872
FT                   /locus_tag="Tola_0089"
FT   CDS_pept        112630..112872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0089"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aha:AHA_0359 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91719"
FT                   /db_xref="InterPro:IPR019620"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7S0"
FT                   /inference="similar to AA sequence:KEGG:AHA_0359"
FT                   /protein_id="ACQ91719.1"
FT                   /translation="MSQSVHGHDVMHMMLELGGQFTRDSLKSAIETRFGADTRFHTCSA
FT                   EDMTAEQLIDFLQAKGKFVASDAGFNTREEHICQH"
FT   gene            complement(112938..113480)
FT                   /locus_tag="Tola_0090"
FT   CDS_pept        complement(112938..113480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0090"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppu:PP_0737 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91720"
FT                   /db_xref="GOA:C4L7S1"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR018550"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7S1"
FT                   /inference="similar to AA sequence:KEGG:PP_0737"
FT                   /protein_id="ACQ91720.1"
FT                   /translation="MSITSVTPIRSVTILLSSMAMFISAASSAADLSLALGHSGDSTMT
FT                   YRTGIQFPWQQSWFETEAGRLSGYWTVGYTYWDSQDKVNTHSLSASPVLTWEFGARGAD
FT                   VQPFIEAGIGLAAFSRNKIEDRELGSSVNFEDRFGFGIRFYQRHTIGAQALHYSNAGIS
FT                   SDNAGIESYNIYYRFDF"
FT   sig_peptide     complement(113391..113480)
FT                   /locus_tag="Tola_0090"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.960 at
FT                   residue 30"
FT   gene            113665..114252
FT                   /locus_tag="Tola_0091"
FT   CDS_pept        113665..114252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0091"
FT                   /product="multiple antibiotic resistance (MarC)-related
FT                   protein"
FT                   /note="PFAM: multiple antibiotic resistance (MarC)-related
FT                   protein; Integral membrane protein TerC; KEGG: asa:ASA_3972
FT                   multiple antibiotic resistance protein MarC"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91721"
FT                   /db_xref="GOA:C4L7S2"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7S2"
FT                   /inference="protein motif:PFAM:PF01914"
FT                   /protein_id="ACQ91721.1"
FT                   /translation="MSVITAAVMLFLIMDPVGNLPVFLSILRHLPAERRRKVMIRELLI
FT                   SLAVMLLFLFTGQELLNLLNLKQEAVSIAGGIVLFLIALRMIFPGQGGVTGLPEGEEPL
FT                   IVPMAIPMIAGPSILAALVLLSHQYPDQMTDWVLALLLSWGASAVILMFYEQVHKLLGE
FT                   RVLTAMERLMGMLLVMISVQMLLDGAVQYLHR"
FT   gene            complement(114313..116946)
FT                   /locus_tag="Tola_0092"
FT   CDS_pept        complement(114313..116946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0092"
FT                   /product="Phosphoenolpyruvate carboxylase"
FT                   /EC_number="4.1.1.31"
FT                   /note="PFAM: phosphoenolpyruvate carboxylase; KEGG:
FT                   asa:ASA_0576 phosphoenolpyruvate carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91722"
FT                   /db_xref="GOA:C4L7S3"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018129"
FT                   /db_xref="InterPro:IPR021135"
FT                   /db_xref="InterPro:IPR022805"
FT                   /db_xref="InterPro:IPR033129"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4L7S3"
FT                   /inference="protein motif:PRIAM:4.1.1.31"
FT                   /protein_id="ACQ91722.1"
FT                   /translation="MNDMYAALRGNVGMLGHLLGKTIKEHLGDEFLDKIENIRQLAKSS
FT                   RQGNEEDRQKLITTLKNLSDDELLPVARAFSQFLNLANVAEQFHSMSRQGELHTTLDPL
FT                   DSLFDKLKNANLSEQEIIDTVCELDIELVLTAHPTEVTRRTLIHKHVQLNECLEELELQ
FT                   DLTPRECKFIQHRIEQLVNQSWHTNEIREQRPTPVDEAKWGFAVIENNLWPAIPLFLRQ
FT                   LDDRLQENFGIRLPLRAHPVRIASWMGGDRDGNPFVTAKVTQEVLLLSRWVAINLFLTD
FT                   IQELVSELSMTDCNEELRQRVGECSEPYRAILRVVRDSLRETQQAVTAKLQGQYTENRD
FT                   LITRTEQLREPLELCYRSLQSCGMSIIADGMLLDVLRKLACFGVNLLKLDIRQDGERHG
FT                   QVLSELTQYLELGDYAEWRETEKQEFLLKELASRRPLLPANWQPSAESQEVVDTCRVIA
FT                   QTDPDAFGIYIISMARQPSDVLAVQLLLKEVGCKFHMPIAPLFETQNDLQNAAAVLNRL
FT                   LSVEWYRNYIRGQQYVMIGYSDSAKDAGMMSAGWAQYRAMEDLVAIAEREDLKLTLFHG
FT                   RGGTIGRGGGPAHQAILSQPPGSLKGGFRVTEQGEMIRFKFGLPEVAIHNFKLYTSAVL
FT                   EANLLPPPKPEAAWYDVMDKLSEISCQHYRSIVRDEPDFVPYFRAATPEMELGKLPLGS
FT                   RPSKRKPNGGVESLRAIPWIFAWTQNRLMLPSWLGAHVALQAVMDEGKEDLLKEMDQQW
FT                   PFFHTRLEMLEMVFLKADLWLAEYYDLRLAPENLWPLGKRLRQELQDSINVVLQLLPKR
FT                   GELLDDQPWIKESIKLRNPYTDPLNVLQVELLHRSRATPDEVNPQVDQALMVTIAGIAA
FT                   GMRNTG"
FT   gene            complement(117076..118221)
FT                   /locus_tag="Tola_0093"
FT   CDS_pept        complement(117076..118221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0093"
FT                   /product="acetylornithine deacetylase (ArgE)"
FT                   /note="TIGRFAM: acetylornithine deacetylase (ArgE); PFAM:
FT                   peptidase M20; peptidase dimerisation domain protein; KEGG:
FT                   asa:ASA_0577 acetylornithine deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91723"
FT                   /db_xref="GOA:C4L7S4"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010169"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7S4"
FT                   /inference="protein motif:TFAM:TIGR01892"
FT                   /protein_id="ACQ91723.1"
FT                   /translation="MSNLDFFQMYRDIIALPSISSTDPAWDQSNQSVIELLASWFEKLG
FT                   MQIDITPVPGTAGKFNLIATIGSGDGGLLLAGHTDTVPFDAGRWQKDPFQLTQDGDRIY
FT                   GLGTIDMKGFFVFIVEALKDIDLTQLKKPLRILATADEETSMAGAKAIADTHPIRPDYA
FT                   VIGEPTGLVPVFMHKGHMSEAIRVTGKSGHSSNPANGVNAIEIMHKVLTQVLIMQQELK
FT                   QKYHNAHFDVPYPTLNLGSIHGGDSANRICGGCELCIDLRPIPGVMPEDLIAELKRHLA
FT                   PVEAEFPGAISLTHLHEPVPPYGCDENSLLVKEAEQLSGNQAEVVNYCTEAPFIQQLGC
FT                   ETIVMGPGHIAQAHQPDEYLDLSFVKPTTELLRHLVQRFCL"
FT   gene            118465..119472
FT                   /locus_tag="Tola_0094"
FT   CDS_pept        118465..119472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0094"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="KEGG: aha:AHA_0593 N-acetyl-gamma-glutamyl-phosphate
FT                   reductase; TIGRFAM: N-acetyl-gamma-glutamyl-phosphate
FT                   reductase; PFAM: Semialdehyde dehydrogenase NAD - binding;
FT                   Semialdehyde dehydrogenase dimerisation region"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91724"
FT                   /db_xref="GOA:C4L7S5"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4L7S5"
FT                   /inference="protein motif:TFAM:TIGR01850"
FT                   /protein_id="ACQ91724.1"
FT                   /translation="MLNVVIIGASGYAGAELALLVHKHPELNLKGLYVSAGSQDANKPF
FT                   SALHPQCLGLVDLPVKPLDEAGMLEAKTGTDLVCLATAHEVSMNLAPQFLDAGIPVFDL
FT                   SGAFRVQQDGFYDKYYGFTHDQPEWLAKAVYGLAEWNAEQIKKTDLVAVAGCYPTASLL
FT                   ALKPLMEAGLIKADTTPIINAVSGVSGAGRKAAIGTSFCEVSLNPYGVFNHRHQPEISY
FT                   HLGGKVVFQPHLGNFVRGILATIYVQLADGVTAEQIDAAYQQAYSHSPIVRLSKQWPSI
FT                   RSVAGTPFCDLHWQMQDGLLIVGSAIDNLLKGASSQALQCINLRFGFAPTTGLM"
FT   gene            119490..120272
FT                   /locus_tag="Tola_0095"
FT   CDS_pept        119490..120272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0095"
FT                   /product="acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="KEGG: asa:ASA_0579 acetylglutamate kinase; TIGRFAM:
FT                   acetylglutamate kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91725"
FT                   /db_xref="GOA:C4L7S6"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7S6"
FT                   /inference="protein motif:TFAM:TIGR00761"
FT                   /protein_id="ACQ91725.1"
FT                   /translation="MTQQVPLIIKLGGALLETEGALTAFIGGIQHFLKQYPRPLVLVHG
FT                   GGCLVDDLLKALGKTSTKKNGLRVTPFDQIPYVVGALAGTANKQMMAEAIAQGLNPVGL
FT                   SLADGGLCEVTQLDPELGAVGDCKPKNPALLKALLAQDFLPVISSIGITAQGQLMNVNA
FT                   DQAAIALAELLDADLLMLSDVVGILDANKQLIPELDPAKTEQLIADGVITDGMAVKVKA
FT                   ALQVSAAIQKPIVVASWRDPELLVKLANGEAAGTRLQA"
FT   gene            120299..121210
FT                   /locus_tag="Tola_0096"
FT   CDS_pept        120299..121210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0096"
FT                   /product="ornithine carbamoyltransferase"
FT                   /note="TIGRFAM: ornithine carbamoyltransferase; PFAM:
FT                   aspartate/ornithine carbamoyltransferase carbamoyl-P
FT                   binding domain; aspartate/ornithine carbamoyltransferase
FT                   Asp/Orn-binding region; KEGG: aha:AHA_0595 ornithine
FT                   carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91726"
FT                   /db_xref="GOA:C4L7S7"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7S7"
FT                   /inference="protein motif:TFAM:TIGR00658"
FT                   /protein_id="ACQ91726.1"
FT                   /translation="MRHLLDTTEFNKSELEALIALGREMKANPAAFRTGLAGKNIVTLF
FT                   EKQSLRTRVTFDIGINRLGGHAVYLDQQNGVMGQRESVKDFAMNLSRWCDGIVARVFDH
FT                   KTLLGLREHATVPVVNSLCNLYHPCQALADFMTIAENYDDLSKVKLAYLGDGNNVAHSL
FT                   LITGAILGTDVTVVSPKGSGPDAQIFNLAAELARQSGAKLAVTDNCADIRGFDVAYTDT
FT                   WVSMGDNTPMDAVKDKFMPYQINQALLDNTGIRHVLHCQPAHRELEITSEVMDGPASLI
FT                   MDEAENRMHIQNAILHTLINQA"
FT   gene            121300..122685
FT                   /locus_tag="Tola_0097"
FT   CDS_pept        121300..122685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0097"
FT                   /product="argininosuccinate lyase"
FT                   /note="TIGRFAM: argininosuccinate lyase; PFAM: fumarate
FT                   lyase; KEGG: asa:ASA_0582 argininosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91727"
FT                   /db_xref="GOA:C4L7S8"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4L7S8"
FT                   /inference="protein motif:TFAM:TIGR00838"
FT                   /protein_id="ACQ91727.1"
FT                   /translation="MALWGGRFSQAADTRFKQFNDSLRFDYRLAEQDIVGSIGWSKALV
FT                   SVGILTAEEQAKLEVALLALKAEVEADPEQILRSDAEDIHSWVEGKLIERVGDLGKKLH
FT                   TGRSRNDQVATDLKLWCKQQGNLLLDSIHGLQTKLVATARQYQTTVLPGYTHLQRAQPV
FT                   TFSHWALAYVEMLDRDYSRLQDALKRLNTSPLGSGALAGTAYAIDRQVLALDLGFDRAT
FT                   RNSLDSVSDRDHVIELMSSAALSMIHLSRFAEDLIFYASGEAGFIELSDKVTSGSSLMP
FT                   QKKNPDALELIRGKTGRVAGALNGMLMTLKALPLAYNKDMQEDKEGLFDALDTWHDCLD
FT                   MAQLVLEDLKVNEPVTKAAAMGGYSNATELADYLVAKGIPFREAHHIVGEAVVYAITQQ
FT                   KPLEDLSVAEFKQFNAVIADDVYPILSLESTLAKRQALGGVCAEQIAFALQQAEQHLST
FT                   RHK"
FT   gene            122972..123283
FT                   /locus_tag="Tola_0098"
FT   CDS_pept        122972..123283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0098"
FT                   /product="ribosomal protein S10"
FT                   /note="TIGRFAM: ribosomal protein S10; PFAM: ribosomal
FT                   protein S10; KEGG: aha:AHA_0308 ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91728"
FT                   /db_xref="GOA:C4L7S9"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4L7S9"
FT                   /inference="protein motif:TFAM:TIGR01049"
FT                   /protein_id="ACQ91728.1"
FT                   /translation="MQNQRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTR
FT                   KERFTVLISPHVNKDARDQYEIRTHKRLVDIVEPTDKTVDALMRLDLAAGVDVQISLG"
FT   gene            123306..123944
FT                   /locus_tag="Tola_0099"
FT   CDS_pept        123306..123944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0099"
FT                   /product="ribosomal protein L3"
FT                   /note="PFAM: ribosomal protein L3; KEGG: aha:AHA_0309
FT                   ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91729"
FT                   /db_xref="GOA:C4L7T0"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4L7T0"
FT                   /inference="protein motif:PFAM:PF00297"
FT                   /protein_id="ACQ91729.1"
FT                   /translation="MTLGLVGRKLGMTRVFTEDGVSIPVTVIEVEANRVTQLKTLETDG
FT                   YTAVQVTTGVKKASRLTKAEAGHFAKAEVEAGRGLWEFRLNDGEGADLTVGSELKVDIF
FT                   ADVKKADVTGISKGKGFAGVVKRWNFRTQDMTHGNSRSHRVPGSIGQNQSPGKVFKGKK
FT                   MAGHLGCERVTVQSLDIVRVDVERNLLLIKGAVPGATNGDVIVKPAVKA"
FT   gene            123962..124567
FT                   /locus_tag="Tola_0100"
FT   CDS_pept        123962..124567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0100"
FT                   /product="ribosomal protein L4/L1e"
FT                   /note="PFAM: ribosomal protein L4/L1e; KEGG: aha:AHA_0310
FT                   50S ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91730"
FT                   /db_xref="GOA:C4L7T1"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4L7T1"
FT                   /inference="protein motif:PFAM:PF00573"
FT                   /protein_id="ACQ91730.1"
FT                   /translation="MELVLKDAQSALQVSETTFGREFNEALVHQVVVAYAAGARQGTRA
FT                   QKTRSEVSGGGKKPWRQKGTGRARAGTIRSPIWRGGGVTFAAKPQDHSQKVNRKMYRGA
FT                   IQSILSELVRQDRLVVVEKFGVDAPKTKELLTKLQALDLKDVLIVTPEVEENLFLAARN
FT                   LYKVDVRDVTGIDPVSLIAFDKVLMTADAVKQIEEMLA"
FT   gene            124564..124869
FT                   /locus_tag="Tola_0101"
FT   CDS_pept        124564..124869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0101"
FT                   /product="Ribosomal protein L25/L23"
FT                   /note="PFAM: Ribosomal protein L25/L23; KEGG: asa:ASA_4085
FT                   ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91731"
FT                   /db_xref="GOA:C4L7T2"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4L7T2"
FT                   /inference="protein motif:PFAM:PF00276"
FT                   /protein_id="ACQ91731.1"
FT                   /translation="MIREERLLKVLKAPHISEKSTMVAEKLNTIVFKVATDATKAEIKA
FT                   AVEKLFEVKVEAVRTLNVVGKTKRTGSRMGRRSDWKKAYVTLVEGQDIDFVGGAAE"
FT   gene            124884..125705
FT                   /locus_tag="Tola_0102"
FT   CDS_pept        124884..125705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0102"
FT                   /product="ribosomal protein L2"
FT                   /note="TIGRFAM: ribosomal protein L2; PFAM: ribosomal
FT                   protein L2; KEGG: asa:ASA_4084 50S ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91732"
FT                   /db_xref="GOA:C4L7T3"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4L7T3"
FT                   /inference="protein motif:TFAM:TIGR01171"
FT                   /protein_id="ACQ91732.1"
FT                   /translation="MAIVKCKPTSPGRRHVVKVVTPELHKGKPFAGLLEEKRKTGGRNN
FT                   NGRITTRHIGGGHKQHYRLIDFKRNKDGIPAKIERLEYDPNRSANIALVLYADGERRYI
FT                   LAPKNLKAGDPIVSGVDAPIKAGNALPMRNIPVGTTVHAVEMKPGKGAQIARSAGASVQ
FT                   ILAREGAYVTLRLRSGEVRKVLAECRATVGEVGNAEHMLRQLGKAGANRWRGIRPTVRG
FT                   MAMNPVDHPHGGGEGRNKGIQPVSPWGTPAKGYRTRSNKRTDKYIVRRRNK"
FT   gene            125727..126005
FT                   /locus_tag="Tola_0103"
FT   CDS_pept        125727..126005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0103"
FT                   /product="ribosomal protein S19"
FT                   /note="TIGRFAM: ribosomal protein S19; PFAM: ribosomal
FT                   protein S19/S15; KEGG: asu:Asuc_0463 30S ribosomal protein
FT                   S19"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91733"
FT                   /db_xref="GOA:C4L7T4"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4L7T4"
FT                   /inference="protein motif:TFAM:TIGR01050"
FT                   /protein_id="ACQ91733.1"
FT                   /translation="MPRSLKKGPFIDLHLLKKVEKAVESADKKPIKTWSRRSMIIPDMI
FT                   GLTIAVHNGRQHVPVYVSDEMVGHKLGEFAPTRTYRGHAADKKAKKK"
FT   gene            126013..126360
FT                   /locus_tag="Tola_0104"
FT   CDS_pept        126013..126360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0104"
FT                   /product="ribosomal protein L22"
FT                   /note="TIGRFAM: ribosomal protein L22; PFAM: ribosomal
FT                   protein L22/L17; KEGG: aha:AHA_0314 ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91734"
FT                   /db_xref="GOA:C4L7T5"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7T5"
FT                   /inference="protein motif:TFAM:TIGR01044"
FT                   /protein_id="ACQ91734.1"
FT                   /translation="MMEAIAKHRFARTSAQKARLVADQVRGLPVDRALNLLAFSPKKAA
FT                   ELIKKVLESAVANAEHNEGADIDTLKVQTIMVDEGPSLKRIRARAKGRADRIVKRTAHI
FT                   TVVVSDAKAGR"
FT   gene            126364..127080
FT                   /locus_tag="Tola_0105"
FT   CDS_pept        126364..127080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0105"
FT                   /product="ribosomal protein S3"
FT                   /note="KEGG: aha:AHA_0315 ribosomal protein S3; TIGRFAM:
FT                   ribosomal protein S3; PFAM: ribosomal protein S3- domain
FT                   protein; KH type 2 domain protein; Ribosomal protein S3
FT                   domain; SMART: KH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91735"
FT                   /db_xref="GOA:C4L7T6"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7T6"
FT                   /inference="protein motif:TFAM:TIGR01009"
FT                   /protein_id="ACQ91735.1"
FT                   /translation="MGQKVHPNGIRLGITKPFNSTWYANTKEFADNLHGDFQVRQYLTK
FT                   ELKAASLSRIVIERPAKSIRVTIHTARPGVVIGKKGEDVEKLRKQIASIAGVPAQINIA
FT                   EVRKPELDSQLVADSISSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIA
FT                   RTEWYREGRVPLHTLRADIDYATSEAHTTYGVIGVKVWIFKGEVLGGLAAVTAAAAAAQ
FT                   QEPAPAKPKRKPRGAK"
FT   gene            127094..127507
FT                   /locus_tag="Tola_0106"
FT   CDS_pept        127094..127507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0106"
FT                   /product="ribosomal protein L16"
FT                   /note="TIGRFAM: ribosomal protein L16; PFAM: ribosomal
FT                   protein L16; KEGG: pmr:PMI3262 50S ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91736"
FT                   /db_xref="GOA:C4L7T7"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4L7T7"
FT                   /inference="protein motif:TFAM:TIGR01164"
FT                   /protein_id="ACQ91736.1"
FT                   /translation="MLQPKRTKFRKVHKGRNRGLANAGSDVSFGTYGLKAVTRGQLTAR
FT                   QIEAARRAMTRAVKRQGKIWIRVFPDKPITEKPLEVRMGKGKGNVEYWVALIQPGKVLY
FT                   EMDGVPEETAREAFALAAAKLSVKTTFVIRTAM"
FT   gene            127507..127698
FT                   /locus_tag="Tola_0107"
FT   CDS_pept        127507..127698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0107"
FT                   /product="ribosomal protein L29"
FT                   /note="TIGRFAM: ribosomal protein L29; PFAM: ribosomal
FT                   protein L29; KEGG: aha:AHA_0317 ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91737"
FT                   /db_xref="GOA:C4L7T8"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4L7T8"
FT                   /inference="protein motif:TFAM:TIGR00012"
FT                   /protein_id="ACQ91737.1"
FT                   /translation="MKAQDLRQKSVEELKTELLGLLRAQFNLRIQKSTGQLNQTHTIKQ
FT                   VRRDIARVKTVLNEKAGA"
FT   gene            127698..127946
FT                   /locus_tag="Tola_0108"
FT   CDS_pept        127698..127946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0108"
FT                   /product="ribosomal protein S17"
FT                   /note="PFAM: ribosomal protein S17; KEGG: aha:AHA_0318
FT                   ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91738"
FT                   /db_xref="GOA:C4L7T9"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4L7T9"
FT                   /inference="protein motif:PFAM:PF00366"
FT                   /protein_id="ACQ91738.1"
FT                   /translation="MTDQIRTLQGRVVSDKMDKSITVAIERKVKHPMLGKIIVRTTKLH
FT                   VHDENNECKTGDLVEIRECRPLSKTKCWTLVSVVEKA"
FT   gene            128101..128469
FT                   /locus_tag="Tola_0109"
FT   CDS_pept        128101..128469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0109"
FT                   /product="ribosomal protein L14"
FT                   /note="TIGRFAM: ribosomal protein L14; PFAM: ribosomal
FT                   protein L14b/L23e; KEGG: asa:ASA_4077 ribosomal protein
FT                   L14"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91739"
FT                   /db_xref="GOA:C4L7U0"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4L7U0"
FT                   /inference="protein motif:TFAM:TIGR01067"
FT                   /protein_id="ACQ91739.1"
FT                   /translation="MIQMQSMLDVADNSGARSVMCIKVLGGSHRRYAGVGDIIKVSIKE
FT                   AIPRGKVKKGDVYNAVVVRTRKGVRRQDGSLIRFDRNAAVLLNNQHQPIGTRIFGPVTR
FT                   ELRNDKFMKIVSLAPEVL"
FT   gene            128482..128799
FT                   /locus_tag="Tola_0110"
FT   CDS_pept        128482..128799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0110"
FT                   /product="ribosomal protein L24"
FT                   /note="TIGRFAM: ribosomal protein L24; PFAM: KOW domain
FT                   protein; KEGG: aha:AHA_0320 ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91740"
FT                   /db_xref="GOA:C4L7U1"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4L7U1"
FT                   /inference="protein motif:TFAM:TIGR01079"
FT                   /protein_id="ACQ91740.1"
FT                   /translation="MAAKIRREDEVIVLTGKDKGKRGKVTKVLVEQGKVIVEGINVKKK
FT                   HQKPVPALGVAGGIVSKEAAVDVSNVALFNPATGKGDRVGFRFEDGNKVRFFKSNGELV
FT                   K"
FT   gene            128813..129352
FT                   /locus_tag="Tola_0111"
FT   CDS_pept        128813..129352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0111"
FT                   /product="ribosomal protein L5"
FT                   /note="PFAM: ribosomal protein L5; KEGG: plu:plu4714 50S
FT                   ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91741"
FT                   /db_xref="GOA:C4L7U2"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4L7U2"
FT                   /inference="protein motif:PFAM:PF00281"
FT                   /protein_id="ACQ91741.1"
FT                   /translation="MAKLHDTYRQTVVQELMNQFGYNSVMQVPRIEKITLNMGVGEALA
FT                   DKKVLENAAGDLAAISGQKPLITKARKSVAGFKIREGYPIGCKVTLRGERMWEFLERLI
FT                   CISMPRIRDFRGVSAKSFDGRGNYSMGVREQIIFPEIDYDKVDKVRGLDITITTTAKTD
FT                   EEGRALLAAFSFPFRK"
FT   gene            129364..129669
FT                   /locus_tag="Tola_0112"
FT   CDS_pept        129364..129669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0112"
FT                   /product="ribosomal protein S14"
FT                   /note="PFAM: ribosomal protein S14; KEGG: aha:AHA_0322 30S
FT                   ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91742"
FT                   /db_xref="GOA:C4L7U3"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7U3"
FT                   /inference="protein motif:PFAM:PF00253"
FT                   /protein_id="ACQ91742.1"
FT                   /translation="MAKLSMIAREDKRAKLIAKHFEKRVALKAIIADVNASDEARWDAV
FT                   LKLQQLPRDSSPSRQRNRCNITGRPHGYLRKFGLCRIKVREHMMKGEIPGLKKASW"
FT   gene            129692..130084
FT                   /locus_tag="Tola_0113"
FT   CDS_pept        129692..130084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0113"
FT                   /product="ribosomal protein S8"
FT                   /note="PFAM: ribosomal protein S8; KEGG: asa:ASA_4073
FT                   ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91743"
FT                   /db_xref="GOA:C4L7U4"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4L7U4"
FT                   /inference="protein motif:PFAM:PF00410"
FT                   /protein_id="ACQ91743.1"
FT                   /translation="MSMQDPIADMLTRIRNGQAAHKVSVSMPSSKLKVAIANLLKEEGY
FT                   IADIKVSGDVKPELEIELKYFQGKPVVELIQRVSRPGLRIYKKRGDLPKIMNGLGIAVV
FT                   STSKGVMTDRAARKAGMGGEIICYVA"
FT   gene            130096..130629
FT                   /locus_tag="Tola_0114"
FT   CDS_pept        130096..130629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0114"
FT                   /product="ribosomal protein L6"
FT                   /note="PFAM: ribosomal protein L6; KEGG: aha:AHA_0324 50S
FT                   ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91744"
FT                   /db_xref="GOA:C4L7U5"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4L7U5"
FT                   /inference="protein motif:PFAM:PF00347"
FT                   /protein_id="ACQ91744.1"
FT                   /translation="MSRVAKAPVTIPAGVEVTLNGQEIAVKGKNGTLKRILNAAVIVTK
FT                   EENVLKFAPQEGVTGADAQAGTARALVNNMVIGVTTGFERKLVLVGVGYRAQAKGKSVG
FT                   LALGFSHPIDHELPEGVTAECPTQTEIVLKSADKAMLGQVAADIRAYRSPEPYKGKGVR
FT                   YSDEVVRTKEAKKK"
FT   gene            130639..130992
FT                   /locus_tag="Tola_0115"
FT   CDS_pept        130639..130992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0115"
FT                   /product="ribosomal protein L18"
FT                   /note="TIGRFAM: ribosomal protein L18; PFAM: ribosomal
FT                   protein L18P/L5E; KEGG: vha:VIBHAR_00746 50S ribosomal
FT                   protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91745"
FT                   /db_xref="GOA:C4L7U6"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4L7U6"
FT                   /inference="protein motif:TFAM:TIGR00060"
FT                   /protein_id="ACQ91745.1"
FT                   /translation="MDKKAARIRRATKARRKMLELGATRLVVHRTPRHIYAQVIAASGA
FT                   EVLASASTVESTIREQVKYTGNADAAAAVGKAIAERALAKGVTTVAFDRSGFQYHGRVA
FT                   ALAAAAREAGLQF"
FT   gene            131007..131507
FT                   /locus_tag="Tola_0116"
FT   CDS_pept        131007..131507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0116"
FT                   /product="ribosomal protein S5"
FT                   /note="TIGRFAM: ribosomal protein S5; PFAM: Ribosomal
FT                   protein S5 ; ribosomal protein S5 domain protein; KEGG:
FT                   aha:AHA_0326 ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91746"
FT                   /db_xref="GOA:C4L7U7"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4L7U7"
FT                   /inference="protein motif:TFAM:TIGR01021"
FT                   /protein_id="ACQ91746.1"
FT                   /translation="MSKIESQAGELQEKLVAVNRVSKVVKGGRIFSFTALTVVGDGSGR
FT                   VGFGYGKAREVPAAIQKAMEQARRNMVKVELIEGTLHHHVKGTHAGSTVFMQPASQGTG
FT                   IIAGGAMRAVLEVAGVHNVLAKTYGSTNPMNVVRATIEALADIKSPEQVAAKRGLRVEE
FT                   ILG"
FT   gene            131515..131697
FT                   /locus_tag="Tola_0117"
FT   CDS_pept        131515..131697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0117"
FT                   /product="ribosomal protein L30"
FT                   /note="TIGRFAM: ribosomal protein L30; PFAM: ribosomal
FT                   protein L30; KEGG: asa:ASA_4069 ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91747"
FT                   /db_xref="GOA:C4L7U8"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7U8"
FT                   /inference="protein motif:TFAM:TIGR01308"
FT                   /protein_id="ACQ91747.1"
FT                   /translation="MANKTVKVTQTRSSIGRLPKHKASLLGLGLRRIGHTVEVEDTPCV
FT                   RGMINQVYYMVKVEE"
FT   gene            131700..132134
FT                   /locus_tag="Tola_0118"
FT   CDS_pept        131700..132134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0118"
FT                   /product="ribosomal protein L15"
FT                   /note="TIGRFAM: ribosomal protein L15; PFAM: ribosomal
FT                   protein L15; KEGG: asa:ASA_4068 ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91748"
FT                   /db_xref="GOA:C4L7U9"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4L7U9"
FT                   /inference="protein motif:TFAM:TIGR01071"
FT                   /protein_id="ACQ91748.1"
FT                   /translation="MRLNTLSPAAGAKSAKKRVGRGIGSGLGKTGGRGVKGAGSRSGGG
FT                   VRAGFEGGQMPLKIRMPKFGFYSRKGAVTAEVRLSEVAKVEGDVVDLNTLKQAGVITKG
FT                   MQFAKIVLSGNIDRAVTVRGVSVTKGARAAIEAAGGKIEE"
FT   gene            132142..133473
FT                   /locus_tag="Tola_0119"
FT   CDS_pept        132142..133473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0119"
FT                   /product="preprotein translocase, SecY subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecY subunit; PFAM:
FT                   SecY protein; KEGG: aha:AHA_0329 preprotein translocase
FT                   subunit SecY"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91749"
FT                   /db_xref="GOA:C4L7V0"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7V0"
FT                   /inference="protein motif:TFAM:TIGR00967"
FT                   /protein_id="ACQ91749.1"
FT                   /translation="MAKKPGLVTRGSQGGLSELKSRLLFVLGAIIVFRAGAYVPIPGID
FT                   ATVLGQLFQQQKGTIIEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVISPYYAE
FT                   LKKEGESGRRVISKHTRWGTLVLATVQASGIATGLPNMMHGLVLNPGFGFYFTAVVSLV
FT                   TGTMFLMWLGEQITERGIGNGISLIIFAGIVAGLPQAIGATAEQARQGELHILLLLLLV
FT                   VIVFAVTYFVVFVERGQRRIVVNYAKRQQGNQIFAAQSTHLPLKLNMAGVIPAIFASSI
FT                   ILFPGTIASWFGQGDSWIANILQEISMSLQPGQPLYELLYAVAIIFFSFFYTALVFNPR
FT                   ETADNLKKSGAFIPGIRPGEQTARFIDKVMTRLTLAGALYITAICLVPQLLMTFWHVQF
FT                   YFGGTSLLIIVVVIMDFMAQVQTHMMSHQYGDVLKKANLKGVGR"
FT   gene            133501..133614
FT                   /locus_tag="Tola_0120"
FT   CDS_pept        133501..133614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0120"
FT                   /product="ribosomal protein L36"
FT                   /note="TIGRFAM: ribosomal protein L36; PFAM: ribosomal
FT                   protein L36; KEGG: asa:ASA_4066 ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91750"
FT                   /db_xref="GOA:C4L7V1"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7V1"
FT                   /inference="protein motif:TFAM:TIGR01022"
FT                   /protein_id="ACQ91750.1"
FT                   /translation="MKVRASVKAICRNCKIIKRHGVVRVICTEPKHKQRQG"
FT   gene            133755..134111
FT                   /locus_tag="Tola_0121"
FT   CDS_pept        133755..134111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0121"
FT                   /product="ribosomal protein S13"
FT                   /note="PFAM: ribosomal protein S13; KEGG: asa:ASA_4065 30S
FT                   ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91751"
FT                   /db_xref="GOA:C4L7V2"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4L7V2"
FT                   /inference="protein motif:PFAM:PF00416"
FT                   /protein_id="ACQ91751.1"
FT                   /translation="MARIAGINIPDHKHAVIALTAIYGVGDTRAKSICAAAGIAEDVKV
FT                   KDLDEAQIEALRTEVGKFTVEGDLRREVSMNIKRLMDLGCYRGLRHRRGLPVRGQRTKT
FT                   NARTRKGPRKPIKK"
FT   gene            134127..134516
FT                   /locus_tag="Tola_0122"
FT   CDS_pept        134127..134516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0122"
FT                   /product="ribosomal protein S11"
FT                   /note="PFAM: ribosomal protein S11; KEGG: asa:ASA_4064 30S
FT                   ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91752"
FT                   /db_xref="GOA:C4L7V3"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4L7V3"
FT                   /inference="protein motif:PFAM:PF00411"
FT                   /protein_id="ACQ91752.1"
FT                   /translation="MAKAPTRARKRVRKQVSDGIAHVHASFNNTIVTITDRQGNALSWA
FT                   TAGGSGFRGSRKSTPFAAQVAAERAGEIAKEYGVKNLEVMVKGPGPGRESSIRALNAAG
FT                   FRITNITDVTPIPHNGCRPPKKRRV"
FT   gene            134548..135168
FT                   /locus_tag="Tola_0123"
FT   CDS_pept        134548..135168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0123"
FT                   /product="ribosomal protein S4"
FT                   /note="KEGG: asa:ASA_4063 ribosomal protein S4; TIGRFAM:
FT                   ribosomal protein S4; PFAM: ribosomal protein S4;
FT                   RNA-binding S4 domain protein; SMART: RNA-binding S4 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91753"
FT                   /db_xref="GOA:C4L7V4"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4L7V4"
FT                   /inference="protein motif:TFAM:TIGR01017"
FT                   /protein_id="ACQ91753.1"
FT                   /translation="MARYLGPKLKLSRREGTDLFLKSGVRAIDSKCKIDTAPGQHGARK
FT                   PRLSDYGVQLREKQKVRRIYGILEKQFRNYYREATRLKGNTGENLLQLLEGRLDNVVYR
FT                   MGFATTRAEARQLVSHKAIVVNGKVVNIPSSQVSPEDVVTVREKAKKQARIKAALDLAA
FT                   QREKPTWIEINADKMEGVYKRLPERSDLSADINEQLIVELYSK"
FT   gene            135194..136183
FT                   /locus_tag="Tola_0124"
FT   CDS_pept        135194..136183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0124"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /note="KEGG: asa:ASA_4062 DNA-directed RNA polymerase
FT                   subunit alpha; TIGRFAM: DNA-directed RNA polymerase, alpha
FT                   subunit; PFAM: RNA polymerase insert; RNA polymerase alpha
FT                   subunit domain protein; RNA polymerase dimerisation; SMART:
FT                   RNA polymerase RpoA/D/Rpb3-type"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91754"
FT                   /db_xref="GOA:C4L7V5"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4L7V5"
FT                   /inference="protein motif:TFAM:TIGR02027"
FT                   /protein_id="ACQ91754.1"
FT                   /translation="MLGSVTDFLKPRLVDIEQLSPTHAKVTLEPLERGFGHTLGNALRR
FT                   ILLSSMPGCAVAEVEIDGVLHEYSSKEGVQEDILEILLNLKGIAVKLEGKDEVILSLTK
FT                   SGAGPVTAGDIIHGDDVVIVNPEHVICHLTGANAEISMRLRVQRGRGYVPASARLHTDD
FT                   EDRPIGRLLLDAAFSPVVRIAYNVEAARVEQRTDLDKLVIDMETNGTLDPEEAIRRAAT
FT                   ILAEQLDAFVDLRDVSVPEKKEDKPEFDPILLRPVDDLELTVRSANCLKAEAIHYIGDL
FT                   VQRTEVELLKTPNLGKKSLTEIKDVLASRGLSLGMRLENWPPASLADN"
FT   gene            136227..136613
FT                   /locus_tag="Tola_0125"
FT   CDS_pept        136227..136613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0125"
FT                   /product="ribosomal protein L17"
FT                   /note="TIGRFAM: ribosomal protein L17; PFAM: ribosomal
FT                   protein L17; KEGG: shw:Sputw3181_0182 50S ribosomal protein
FT                   L17"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91755"
FT                   /db_xref="GOA:C4L7V6"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4L7V6"
FT                   /inference="protein motif:TFAM:TIGR00059"
FT                   /protein_id="ACQ91755.1"
FT                   /translation="MRHRLSGRQLNRNASHRQAMFRNMASSLVRHEIIKTTLPKAKELR
FT                   RVVEPLITLAKSDSVANRRLAFARTRDRDVVGKLFTELGPRFQGRPGGYTRILKCGFRA
FT                   GDNAPMAYIELVGRPVDAEAVTEE"
FT   gene            136810..137397
FT                   /locus_tag="Tola_0126"
FT   CDS_pept        136810..137397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0126"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   ppr:PBPRB1654 putative ribosomal protein
FT                   N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91756"
FT                   /db_xref="GOA:C4L7V7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7V7"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACQ91756.1"
FT                   /translation="MLISSRIELKPPSLEWVEPLRLALSESYELHQLFLDWAEPDPSLL
FT                   TVTATMNVAKEQFERKEHELRFMIVRREDQALVGSISLHVRDVSVPYYEIGYWVRQSAT
FT                   GKGYITEAVLLLADYAFIHLHATRLEIRTAASNDKSRAVAERAGFRLEATLQNACRTQG
FT                   HLDDMLVYSRIGHEDMIPEIDLVDISPEELDY"
FT   gene            complement(137412..137732)
FT                   /locus_tag="Tola_0127"
FT   CDS_pept        complement(137412..137732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0127"
FT                   /product="methionine repressor, MetJ"
FT                   /note="PFAM: Methionine repressor MetJ; KEGG: vsp:VS_2895
FT                   methionine repressor MetJ"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91757"
FT                   /db_xref="GOA:C4L7V8"
FT                   /db_xref="InterPro:IPR002084"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR023453"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7V8"
FT                   /inference="protein motif:PFAM:PF01340"
FT                   /protein_id="ACQ91757.1"
FT                   /translation="MKTAWNGEYISPYAEHGKKSEQVKKITVSIPLKVLKILTDERTRR
FT                   QINNLRHATNSELLCEAFLHAYTGQPLPADDDLRKDYPDDIPLAVQQLMAEMGKPIEKY
FT                   DE"
FT   gene            137887..139047
FT                   /locus_tag="Tola_0128"
FT   CDS_pept        137887..139047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0128"
FT                   /product="O-succinylhomoserine (thiol)-lyase"
FT                   /EC_number="2.5.1.48"
FT                   /note="KEGG: aha:AHA_0589 O-succinylhomoserine
FT                   (thiol)-lyase; TIGRFAM: O-succinylhomoserine (thiol)-lyase;
FT                   PFAM: Cys/Met metabolism pyridoxal-phosphate-dependent
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91758"
FT                   /db_xref="GOA:C4L7V9"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR011821"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7V9"
FT                   /inference="protein motif:TFAM:TIGR02080"
FT                   /protein_id="ACQ91758.1"
FT                   /translation="MSDYQQETYAVKSGIAVDTQFGAVVPPIYLSTNYTFAGFGEKREF
FT                   DYSRSGNPTRSTLAGALAALEGGAGAVFTGSGMGAINLVTALLSADDLLVAPHDCYGGT
FT                   YRLFQHVAAKGSYRVLFVDQTDPEALAQALAQKPKLVWIETPSNPLLRVVDIAAICQQA
FT                   HAVGALVAVDNTFLSPLLQQPLALGADIVVHSTTKYINGHSDVVGGAVIAKETELHEKL
FT                   AWWGNCLGHTGGAFDAYLTLRGLRTLAPRMRAHQENAAAILAYLQQKPQVTKIYHPGLP
FT                   DHPGHEIAKRQQKGFGAMLSFEVDFDIEQLKQFLGGLQLFCLAESLGGVESLVAHPASM
FT                   THAGMDPEARRVAGISDQLLRLSVGIEHITDLLADLEQAFACVASK"
FT   gene            139100..141538
FT                   /locus_tag="Tola_0129"
FT   CDS_pept        139100..141538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0129"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /EC_number="1.1.1.3"
FT                   /note="KEGG: aha:AHA_0590 bifunctional aspartate kinase
FT                   II/homoserine dehydrogenase II; TIGRFAM: aspartate kinase;
FT                   PFAM: homoserine dehydrogenase; homoserine dehydrogenase
FT                   NAD-binding; aspartate/glutamate/uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91759"
FT                   /db_xref="GOA:C4L7W0"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR011147"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7W0"
FT                   /inference="protein motif:TFAM:TIGR00657"
FT                   /protein_id="ACQ91759.1"
FT                   /translation="MPHTATGHLPGRQVHKFGGSSLADPNCYRRVAGLIEQESDPRALI
FT                   VVSAAGKTTNRLLQVLELSEAGDDAVVAALNGLRSYQLSLIEDVLDGPARQALSLQLME
FT                   DIDTITGVLKRSYDRYERNGILANGEVWSARLLAALLTERGNPAAWLDARRFLSAEEGA
FT                   LARVNELLSREKLREVLAGTGEQRVVVTGFIAADSEGRTLLLGRNGSDYSATLLGALAD
FT                   AESTAIWSDVAGVYSADPRCVKDAKLLERLSLTEANELARLGAPVLHSRTLQPLLHSQQ
FT                   KLVLRSSYAPNGGASHILRRKSQVKGARIVTSLDQIALIELRIQPGCDYVDAVAHLEEL
FT                   LAARQLSPLVSKCQEDRRIVRLAYTLEMVSDAYQFMLQQQEHANVKEVIRRDGFSLIGL
FT                   VGTGVCDNAEQCHRFYRLLVDQPLEFIYTSPEGLSLVAVVREITLEPLLIALHHAMFLQ
FT                   TKRVGLVVLGKGNIGSQWLKLLAKEKHHVEQAHQLTLTLYGLFDSRGGILSDDGLDPLQ
FT                   VLDSFDPQPVIWAELLVQLEQHPFDELIILDLTASETVSSYYPEFAQIGAHLITANKLA
FT                   GAAESAFYQRVRQSFAEHQVQWRYNATVGAGLPVQACIRMMLESGDRVHGISGIFSGTL
FT                   SWLFQQYDGSVPFSELVDQAWQHGLTEPDPREDLSGHDVRRKLLILAREAGLELEPDHI
FT                   SLQSLVPVELADIPLEAFFERLTELDKTIVAAFDEAKARGKVLRYVARLDRDGSARVGL
FT                   DMLSAEHPFANLRPCDNIFSIETDFYRTNPLILQGPGAGREVTAAAVQADLWKICATLR
FT                   "
FT   gene            complement(141541..141822)
FT                   /locus_tag="Tola_0130"
FT   CDS_pept        complement(141541..141822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0130"
FT                   /product="acylphosphatase"
FT                   /note="PFAM: acylphosphatase; KEGG: stm:STM1083 putative
FT                   phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91760"
FT                   /db_xref="GOA:C4L7W1"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="InterPro:IPR020456"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7W1"
FT                   /inference="protein motif:PFAM:PF00708"
FT                   /protein_id="ACQ91760.1"
FT                   /translation="MTPPRSVRIQVYGIVQGVGFRYFTQQEASRLGLCGRATNLSDGSV
FT                   EVLAQGDAQAVEKLIHWLKTGPRTASVDYIEITELAAGAVNASSFRAY"
FT   gene            141994..142824
FT                   /locus_tag="Tola_0131"
FT   CDS_pept        141994..142824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0131"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /note="KEGG: aha:AHA_0164 formamidopyrimidine-DNA
FT                   glycosylase; TIGRFAM: formamidopyrimidine-DNA glycosylase;
FT                   PFAM: DNA glycosylase/AP lyase, H2TH DNA-binding;
FT                   Formamidopyrimidine-DNA glycosylase catalytic domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91761"
FT                   /db_xref="GOA:C4L7W2"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7W2"
FT                   /inference="protein motif:TFAM:TIGR00577"
FT                   /protein_id="ACQ91761.1"
FT                   /translation="MPELPEVEVSRLGITPWMEGIVVERVVIRHPRLRWPIPSEIRLLE
FT                   GQPLRQIERRAKYLLLRSTLGTAILHLGMSGRLRILPIGTPAEKHDHVDLELANGKLLR
FT                   FHDPRRFGALLWTAEDPYQHPLLKTLGPEPLTDAFTADYLWQRSRKPRSAIKPWLMDNR
FT                   VVVGVGNIYANEALFMAHIHPKRAVNSLTPEESQALVAAVKKVLARAITQGGTTLRDFM
FT                   RTDGKPGYFVQELLVYGRAGQPCTVCAHPLEELRLGQRSSVYCPICQPFAGGYD"
FT   gene            complement(142815..143309)
FT                   /locus_tag="Tola_0132"
FT   CDS_pept        complement(142815..143309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0132"
FT                   /product="pantetheine-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /note="KEGG: aha:AHA_0166 phosphopantetheine
FT                   adenylyltransferase; TIGRFAM: pantetheine-phosphate
FT                   adenylyltransferase; cytidyltransferase-related domain
FT                   protein; PFAM: cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91762"
FT                   /db_xref="GOA:C4L7W3"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4L7W3"
FT                   /inference="protein motif:TFAM:TIGR01510"
FT                   /protein_id="ACQ91762.1"
FT                   /translation="MRQKVVFPGTFDPLTSGHFDLINRASILFDEVILAVAASPGKRPL
FT                   FSLEERLALAKEVCQSLPNVTITGFSNLLIDFMKEQQATILLRGIRTGSDFEYESQLAA
FT                   MYRRMMPEMEIIFLPPAEQYAFVSSTLVREIALHGGDAGQFVTPNVAEAIKAKQLQLAQ
FT                   S"
FT   gene            143453..143836
FT                   /locus_tag="Tola_0133"
FT   CDS_pept        143453..143836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0133"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_2525 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91763"
FT                   /db_xref="GOA:C4L7W4"
FT                   /db_xref="InterPro:IPR016924"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7W4"
FT                   /inference="similar to AA sequence:KEGG:Rfer_2525"
FT                   /protein_id="ACQ91763.1"
FT                   /translation="MSAFWGVMARLLVVSLLALSLPAKASMMSAQETMSVHQTSERTQV
FT                   MQFLAREDVAKHIAAQGVDIALVQQRVAAMSDDEINQLSDKIDQLPAAGNAVLGAVVFV
FT                   FVLLLVTDILGLTKVFPFTRSVR"
FT   sig_peptide     143453..143530
FT                   /locus_tag="Tola_0133"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.987 at
FT                   residue 26"
FT   gene            143840..144766
FT                   /locus_tag="Tola_0134"
FT   CDS_pept        143840..144766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0134"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: azo:azo0531 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91764"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR039563"
FT                   /db_xref="InterPro:IPR039564"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7W5"
FT                   /inference="similar to AA sequence:KEGG:azo0531"
FT                   /protein_id="ACQ91764.1"
FT                   /translation="MRLIIQALLLVGFLFLSACAQRPVISASAVSSSYKQLSVPFIQQD
FT                   DAYCGPSALAMVLAEQNKTVSVSDLAQEMLLPARGGSLQAELKASVRRQGYLAYEIKPE
FT                   LPALLAEIDEGRPVIVLLNLAFNWYPKWHYAVVTGYDLSHQEIILHSGSLANQRWTFTQ
FT                   FDNLWQRGGRWGLLALSPVQLPPASAQEDRYLQAVLDLEKTSGSAIAQSAYQTALQRWP
FT                   DNLTALIGLGLAAYQQQDLLLARQWFQRAAIQHPSSAVAANNLAQTLLESGEPAEAFVW
FT                   AQKAVLADGGAPARDTLQQVLRALHAE"
FT   sig_peptide     143840..143902
FT                   /locus_tag="Tola_0134"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.725 at
FT                   residue 21"
FT   gene            144835..145554
FT                   /locus_tag="Tola_0135"
FT   CDS_pept        144835..145554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0135"
FT                   /product="lipopolysaccharide kinase"
FT                   /note="PFAM: lipopolysaccharide kinase; KEGG: asa:ASA_0038
FT                   3-deoxy-D-manno-octulosonic-acid kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91765"
FT                   /db_xref="GOA:C4L7W6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR022826"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7W6"
FT                   /inference="protein motif:PFAM:PF06293"
FT                   /protein_id="ACQ91765.1"
FT                   /translation="MTASRILKSAGQICCFDPLLAPDFTPDYFSAEYWQQQNAITGKSH
FT                   GRGVTWFLQHHSAHWVLRHYWRGGLIGRYIPDQFFYTGLSSSRAFAEFNLLQRLVEDEL
FT                   PVPRPVAARMVRQRWYYQADILIERIPEAEDLVQILKREALSRETWQQIGQVLAQFHQA
FT                   GVYHSDLNAHNILRDANGKIWLIDFDKGAIRRPGRWQTKNLARLLRSLQKESALHPLFH
FT                   WQTDDWQNLLVAYHSYR"
FT   gene            complement(145557..146864)
FT                   /locus_tag="Tola_0136"
FT   CDS_pept        complement(145557..146864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0136"
FT                   /product="Three-deoxy-D-manno-octulosonic-acid transferase
FT                   domain protein"
FT                   /note="PFAM: Three-deoxy-D-manno-octulosonic-acid
FT                   transferase domain protein; glycosyl transferase group 1;
FT                   KEGG: aha:AHA_0170 3-deoxy-D-manno-octulosonic-acid
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91766"
FT                   /db_xref="GOA:C4L7W7"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7W7"
FT                   /inference="protein motif:PFAM:PF04413"
FT                   /protein_id="ACQ91766.1"
FT                   /translation="MIGFSDTVAQTLCRSLSMRLLYTFLIYLLLPVILFLLYRPQRGKP
FT                   GFGSRWKEHFGFVTAPNARFPLWIHAVSVGETIAVTPLIKALKQQHPDLPILLTTTTRT
FT                   GADQAARLGDLVEHRYAPLDYPGAVARFLQQIKPRALLIMETELWPNLLASCGHRKIPV
FT                   VILNARLSERSCQRYQHIRHFFQQMSHSLTLLLCQHHEDAARFKRLGVAEQQIAVTGSI
FT                   KFDIQLDQKQIEAGEQYRQELNHRPVWIAASTHKGEDELILRAHRQILQQIPDTLLLLV
FT                   PRHPERFTDVAQLCQNQGFTLCRRSEQRTATSDENILLGDSMGEMAYYFQIADLAFMGG
FT                   SLVPVGGHNLLEPAALAKPTLIGPHFFNFNDITRQLVEKKACYIIQNDDELARNVITLL
FT                   RSEEQRLEMGMVGFDVVAANQGAIAKSLAAISKIVQ"
FT   gene            147246..148361
FT                   /locus_tag="Tola_0137"
FT   CDS_pept        147246..148361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0137"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   asa:ASA_4279 ABC-type branched-chain amino acid
FT                   transporter, periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91767"
FT                   /db_xref="GOA:C4L7W8"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7W8"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ACQ91767.1"
FT                   /translation="MKKMSKLIVAAAVSTALFGTASAMAEETIKVGIAGPVTGPVAQYG
FT                   DMEFTGGLMAVEQINAAGGIKGKKLEAIKYDDACDPKQAVAVANKVVNDGVKYVIGHLC
FT                   SDSTLPSSDVYEDEGILMITPAATAPKITQRDYQLVLRTTGLDSDQGPTAANYITSVIK
FT                   PKTIAVIHDKKQYGEGIATSVYETLKKNGANVVDFEGVTAGDKDFSALIAKLKKLNVDF
FT                   VYYGGYHPELGLILRQSAEKGFTAKYMGPEGVGNKDISAIAGKASEGMYVTMLKKYDED
FT                   PANAKIVEAFKAKKQDYSGPFVWTTYAAVQSLAAGLNAAGEEPADIADYLRANKVDTVM
FT                   GPLEWSASGDLKNFKFGVYQWHADGTSSVLQ"
FT   sig_peptide     147246..147323
FT                   /locus_tag="Tola_0137"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 26"
FT   gene            148482..149402
FT                   /locus_tag="Tola_0138"
FT   CDS_pept        148482..149402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0138"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   asa:ASA_4280 ABC-type branched-chain amino acid
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91768"
FT                   /db_xref="GOA:C4L7W9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7W9"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACQ91768.1"
FT                   /translation="MSEQIFYFIQQLLNGLTIGSTYALIAIGYTMVYGIIGMINFAHGE
FT                   VYMIGSYIGFMVITALMMMGIDSSVLLMGAAFIVSILITSCYGWSIERVAYRPLRGSNR
FT                   LIPLISAIGMSIFLQNLVRFAQGSRDIAMPSLVQGGIEFGPGNAASLSYMQIIIFVVTF
FT                   ISMYGLSKFISRSRMGRACRACAEDIKMANLLGIDTNSVIALTFVIGAALASIAGILLG
FT                   LYYGVINPSLGFMAGLKAFTAAVLGGIGSIPGAMIGGLILGVTEALTSAYLSSEYKDVV
FT                   AFGLLIAILLLMPTGILGRPEVEKV"
FT   gene            149399..150646
FT                   /locus_tag="Tola_0139"
FT   CDS_pept        149399..150646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0139"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   aha:AHA_0111 leucine/isoleucine/valine transporter permease
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91769"
FT                   /db_xref="GOA:C4L7X0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR021807"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7X0"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACQ91769.1"
FT                   /translation="MKHLKQASVAGLLTLILTLWLFCYQLQTEGVGITVVSRLQENGPL
FT                   IALAVVVVFLFQLFRDQISGGFSALKESVPVLSLPTTTGNPRLYRILQLLLLAGVLLIA
FT                   CFASRNLLDLGTLILIYVMLGLGLNIQVGLAGLLDLGYVGFYAIGAYTYALLNQYLGLS
FT                   FWICLPLAGGMAALFGFLLGFPVLRLRGDYLAIVTLGFGEIIRIMLNNLTTITGGPNGI
FT                   SGIPKPTLFGLEFSRRAEDGGRTFHEFFGISYDANYKIIFLYVMAVLLVLLTLLVIKRL
FT                   LRMPLGRAWEALRDDEIACRSLGLNPTIIKLTAFSIGAAFAGFAGSFFAARQGFISPES
FT                   FTFIESAIILAIVVLGGMGSLAGVVLAAIIMTVLPELRAFNEYRMLMFGLLMVVMMLWR
FT                   PQGLVPMTRHHVELPK"
FT   sig_peptide     149399..149485
FT                   /locus_tag="Tola_0139"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.842) with cleavage site probability 0.401 at
FT                   residue 29"
FT   gene            150643..151407
FT                   /locus_tag="Tola_0140"
FT   CDS_pept        150643..151407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0140"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: aha:AHA_0110 leucine/isoleucine/valine transporter
FT                   ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91770"
FT                   /db_xref="GOA:C4L7X1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7X1"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACQ91770.1"
FT                   /translation="MSKLLEVSDLSMRFGGLLAVNGVKLQLKEKEIVSIIGPNGAGKTT
FT                   VFNCLTGFYKPTNGIIRFRGEEIQGLPGHEIARKGVVRTFQHVRLFKEMTVLENLLVAQ
FT                   HRHMNTNFIAGLLKTPAFRRSEREALERAKFWLDTIGLTDLSNRSAGNLAYGQQRRLEI
FT                   ARCMCTQPKILMLDEPAAGLNPKETEDLNNLIRQLRDQFDVSVLLIEHDMKLVMDISDH
FT                   IFVVNQGTPLADGKPAEVRDNPAVIKAYLGES"
FT   gene            151418..152125
FT                   /locus_tag="Tola_0141"
FT   CDS_pept        151418..152125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0141"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: aha:AHA_0109 high-affinity branched-chain amino acid
FT                   ABC transporter, ATP-binding protein LivF"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91771"
FT                   /db_xref="GOA:C4L7X2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030660"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7X2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACQ91771.1"
FT                   /translation="MLEVKNVSTFYGKIAALTDVSVHIKKGEIVSLIGANGAGKTTLLM
FT                   TICGDPKPSQGQIIFEGRDITQDSTSTIMRGDIAIVPEGRRIFSRLTVEENLSMGAFFI
FT                   NDKAEKVALMDEVFNLFPRLKERINQRAGTMSGGEQQMLAIGRALMSKPRLLFLDEPSL
FT                   GLAPLVIQQIFDIVQQLREERGMTIFLVEQNANQALKLADRGYVLETGRIVLEDTGAAL
FT                   LANPAVRNAYLGG"
FT   gene            152195..152515
FT                   /locus_tag="Tola_0142"
FT   CDS_pept        152195..152515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0142"
FT                   /product="Thiosulfate sulfurtransferase"
FT                   /EC_number="2.8.1.1"
FT                   /note="KEGG: aha:AHA_0106 thiosulfate sulfurtransferase
FT                   GlpE; PFAM: Rhodanese domain protein; SMART: Rhodanese
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91772"
FT                   /db_xref="GOA:C4L7X3"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR023695"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4L7X3"
FT                   /inference="protein motif:PRIAM:2.8.1.1"
FT                   /protein_id="ACQ91772.1"
FT                   /translation="MSQFTRISIQQAAALLQLPSVCLADIRDPSSFNAAHVTGAFHLTN
FT                   DTLPQFTQQITKETPVLVMCYHGNSSQGVANYLTSIGYEKVYSIDGGFEGWRHVYPYTA
FT                   TV"
FT   gene            152512..153342
FT                   /locus_tag="Tola_0143"
FT   CDS_pept        152512..153342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0143"
FT                   /product="Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family protein; KEGG: asa:ASA_4287
FT                   GlpG protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91773"
FT                   /db_xref="GOA:C4L7X4"
FT                   /db_xref="InterPro:IPR022732"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR023662"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="InterPro:IPR038236"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7X4"
FT                   /inference="protein motif:PFAM:PF01694"
FT                   /protein_id="ACQ91773.1"
FT                   /translation="MIQLIQLNDPHLAQMLADYLQTQNMPCQVQSSETGISVWLLDETK
FT                   TSAAEREVQRFILEPHHPRYREAAWQQEKPATWRSATDSSLMTELMLQAQPLMLVVSFL
FT                   MIAVFLLYWLTIPVESLLTFEWPWQRGQIWRLFTPVFLHFSVLHLVFNLAWWWYLGGRT
FT                   EQRYGVIKLAIVLISGALIPNVLQAMVSGSLFGGMSGVTYALLGYLWLRERNSEDPSQV
FT                   TVSNGLFIFMLVWLVLGFTNLLGFNTANLAHLGGLLVGLIQGWRDSHRTISGPA"
FT   gene            153538..154059
FT                   /locus_tag="Tola_0144"
FT   CDS_pept        153538..154059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0144"
FT                   /product="Chorismate lyase"
FT                   /note="PFAM: Chorismate lyase; KEGG: amc:MADE_00071
FT                   hypothetical chorismate pyruvate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91774"
FT                   /db_xref="GOA:C4L7X5"
FT                   /db_xref="InterPro:IPR007440"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7X5"
FT                   /inference="protein motif:PFAM:PF04345"
FT                   /protein_id="ACQ91774.1"
FT                   /translation="MLHVSSLDDLGWSSASALMLEKKQTDWLLDPGSLTARLQQHTNTL
FT                   SLQLLTAGWQSKDQDTSQLVRQVLLSDGERPWIWGLTQVDACQLQKESELLNWSTQPLG
FT                   QLLFAEEQSNVRCFDIADFATSAEFCQMLPRWGCIQTRPLWGRRCELQFRSCRLLLTEV
FT                   FLPEHPMYGV"
FT   gene            154062..154922
FT                   /locus_tag="Tola_0145"
FT   CDS_pept        154062..154922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0145"
FT                   /product="4-hydroxybenzoate polyprenyl transferase"
FT                   /note="TIGRFAM: 4-hydroxybenzoate polyprenyl transferase;
FT                   PFAM: UbiA prenyltransferase; KEGG: yen:YE3858
FT                   4-hydroxybenzoate octaprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91775"
FT                   /db_xref="GOA:C4L7X6"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4L7X6"
FT                   /inference="protein motif:TFAM:TIGR01474"
FT                   /protein_id="ACQ91775.1"
FT                   /translation="MMSVIPAQWQPYWQLARLDKPIGTLLLLWPTLWALWLASAGVPSF
FT                   SLLLIFTAGVFVMRSAGCVINDYADRKFDGYVKRTASRPLPAGRLTAVRALLFFLLLVL
FT                   IAFVLVWQLNQFTIYLSVGGLLLAAIYPFMKRVTSLPQVVLGMAFSWAIPMAYGAVVGQ
FT                   LTVTTWLLFLANLVWTIAYDTMYAMVDRDDDLKIGVKSTAILFGQNDRLYIALLQLGTL
FT                   TLLAIIGWLEQLTVSYYFSLLLAAGLFIYQQWLIRHRQRDACFRAFLNNNWVGMLIFAG
FT                   IMLAC"
FT   gene            155009..155629
FT                   /locus_tag="Tola_0146"
FT   CDS_pept        155009..155629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0146"
FT                   /product="SOS-response transcriptional repressor, LexA"
FT                   /EC_number="3.4.21.88"
FT                   /note="KEGG: aha:AHA_0183 LexA repressor; TIGRFAM: LexA
FT                   repressor; PFAM: LexA DNA-binding domain protein; peptidase
FT                   S24 and S26 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91776"
FT                   /db_xref="GOA:C4L7X7"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR006199"
FT                   /db_xref="InterPro:IPR006200"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4L7X7"
FT                   /inference="protein motif:TFAM:TIGR00498"
FT                   /protein_id="ACQ91776.1"
FT                   /translation="MKQLTPRQAEVLALIRSAVQQTGMPPTRAEIASELGFKSANAAEE
FT                   HLKALARKGVIRMMPGTSRGIQLLTDEPEEDEGLPLIGRVAAGEPILAQQHIETHYQID
FT                   GSLFHPRADFLLRVHGMSMKNIGILDGDLLAVHKTTQANNGQVVVARVGDDEVTVKRFE
FT                   RKGHIVQLLPENEELQPIVVDLTQENLSIEGLAVGVIRNGNWL"
FT   gene            complement(155678..156142)
FT                   /locus_tag="Tola_0147"
FT   CDS_pept        complement(155678..156142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0147"
FT                   /product="RNA methyltransferase, TrmH family, group 2"
FT                   /note="TIGRFAM: RNA methyltransferase, TrmH family, group
FT                   2; PFAM: tRNA/rRNA methyltransferase (SpoU); KEGG:
FT                   aha:AHA_0188 RNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91777"
FT                   /db_xref="GOA:C4L7X8"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7X8"
FT                   /inference="protein motif:TFAM:TIGR00185"
FT                   /protein_id="ACQ91777.1"
FT                   /translation="MLHIALYEPEIPPNTGNIIRLCANTGYFLHLIEPMGFAWDDKRLR
FT                   RAGLDYHEFAEIKRHANFENFLSTIGNARIFACTTKGKAYPSEAGFIAGDVLLFGPETR
FT                   GLPMSIIESLPEAQRLRIPMLPQSRSMNLSNAVSVFVYESWRQLGFPGAV"
FT   gene            156358..156813
FT                   /locus_tag="Tola_0148"
FT   CDS_pept        156358..156813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0148"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="TIGRFAM: transcriptional regulator, Rrf2 family;
FT                   PFAM: protein of unknown function UPF0074; KEGG:
FT                   asa:ASA_4148 rrf2 family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91778"
FT                   /db_xref="GOA:C4L7X9"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7X9"
FT                   /inference="protein motif:TFAM:TIGR00738"
FT                   /protein_id="ACQ91778.1"
FT                   /translation="MQLTLFTDYALRTLVFLALQPDQQLSTITEVADRFSISRNHVVKI
FT                   VHQLGMKGYIDTIRGKHGGIRLARSARDINLGNLIADMENVSCLLDCQREGCRLAPGCR
FT                   FQAIMRKAMRAFMGVLSEFTLADLVRDEEQMCGLLGLEIPVTTVRTE"
FT   gene            complement(156874..158316)
FT                   /locus_tag="Tola_0149"
FT   CDS_pept        complement(156874..158316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0149"
FT                   /product="potassium uptake protein, TrkH family"
FT                   /note="TIGRFAM: potassium uptake protein, TrkH family;
FT                   PFAM: cation transporter; KEGG: aha:AHA_0254 TrkH"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91779"
FT                   /db_xref="GOA:C4L7Y0"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7Y0"
FT                   /inference="protein motif:TFAM:TIGR00933"
FT                   /protein_id="ACQ91779.1"
FT                   /translation="MINFKSITFVIGLTLSKLALFMWLPLLMAFFSGTAGTAEFLAAAV
FT                   LTHIVSLLFIRLGYQQAFRLSVRDMFVMTSLIWLVSCAFATLPFIFLSKLSFTDAYFEA
FT                   MSGLTTTGSTVMQGLDKMPPAILLWRSLLQWLGGIGFIVLAVAVLPYLNVGGMKLFQME
FT                   SSDRSEKDSPRMSNVARNILIVYLMLSLICCLGYWFSGMSLFDAINHAMTTLSTGGFST
FT                   RDASMSAFSPQAQWIASGFMFLGGLPFILYVQSLRRREGLIFRDAQVRGFFWLVITASL
FT                   IMSIWLWHSDVFSFEDALRITTFNVISVLTTTGYGLTDFGTWSYMTSVLFVFLMLFGAC
FT                   SGSTAGGLKLFRIQIAGALFQKQARQLMHPAGVFPQKYNGRPVNDAIVRSIVAFVLGYL
FT                   TVIIVSAILLGMLNLPPLEAISGAITAVGNVGPGFGSTIGPLGNFTSLPDAAKWILSAG
FT                   MMMGRLEILTVAVLLFPSFWKD"
FT   sig_peptide     complement(158203..158316)
FT                   /locus_tag="Tola_0149"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.868 at
FT                   residue 38"
FT   gene            complement(158322..159698)
FT                   /locus_tag="Tola_0150"
FT   CDS_pept        complement(158322..159698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0150"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; TrkA-C domain protein;
FT                   KEGG: aha:AHA_0255 potassium transporter peripheral
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91780"
FT                   /db_xref="GOA:C4L7Y1"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7Y1"
FT                   /inference="protein motif:PFAM:PF02254"
FT                   /protein_id="ACQ91780.1"
FT                   /translation="MKIIIVGAGQVGGTLAENLVGENNEITLVDTDAVRLRELQDKYDL
FT                   RVICGPGSYPSVLREAGADDADMLVAVTSSDECNMVACQIAYSLFNVPNKVARIRSHAY
FT                   LSARETLFKGEVFHIDHLISPEQLVIEYMRRLIEYPGALQVADFAGGRLGLVAVKAYYG
FT                   GPLVGNALATLKEHMPNIDTRVAAIFRQGRSIRPQGTTIIEADDEVFFVAASGHIRAVM
FT                   SELQRLESPYRRIMIVGGGNVGAGLARQLEGRYSVKLIERNAERAEVLSEMLEETIVFC
FT                   GDSADQELLLEEHIEQIDVFIAVTNDDEANIMSAMLAKKLGARKAIVLIQRSAYVDLVQ
FT                   GGTIDIAVSPQQATISALLTHVRRADIANVYSLRRGVAEAIEAIAHGDEHTSKVVGRSI
FT                   GELKLPPGATIGAIVRGDDVLIAHDSTVIQQDDHVVMFLVDKKHIPEVERLFQPSPFFL
FT                   "
FT   gene            complement(159695..160996)
FT                   /locus_tag="Tola_0151"
FT   CDS_pept        complement(159695..160996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0151"
FT                   /product="sun protein"
FT                   /note="TIGRFAM: sun protein; PFAM: Fmu (Sun) domain
FT                   protein; NusB/RsmB/TIM44; KEGG: asa:ASA_4142 ribosomal RNA
FT                   small subunit methyltransferase B"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91781"
FT                   /db_xref="GOA:C4L7Y2"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7Y2"
FT                   /inference="protein motif:TFAM:TIGR00563"
FT                   /protein_id="ACQ91781.1"
FT                   /translation="MKIRATAAKVIFQVVEQGQSLSSALPVAQQLIAAKDRALLQEICY
FT                   GTLRWLNRLEFIADQLLDRQLKGKHRSLHYLILAGLYQLFYTRIPPHAVLAETVNASGL
FT                   LNGDSFRKLINGVLRNAQRQQEELLQAADKNEPTRFSYPRWLLKKIKQSCQYGYVSVLQ
FT                   AGNEYPPMWLRVNLSKQSRDEYQRQLAAVEIQSTPHASCESALLLEKACDVSKLPGFAD
FT                   GACSVQDAAAQHAAWLLDPQPNELILDACAAPGGKTAHILERQPALKQLVAVDSDANRL
FT                   SRVAENLQRIQLEATLINGDASHPEQWWQGPQFDRILLDAPCSATGVIRRHPDIKWLRR
FT                   PEDIAELAHLQHDILNAMWQQLKPGGTLLYATCSILSDENSSQIKSFLERTADAIHVPL
FT                   NEKDTALQPGWQIHPGEQHMDGFFYAKLTKQVTV"
FT   gene            complement(161018..161962)
FT                   /locus_tag="Tola_0152"
FT   CDS_pept        complement(161018..161962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0152"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /note="TIGRFAM: methionyl-tRNA formyltransferase; PFAM:
FT                   formyl transferase domain protein; KEGG: vha:VIBHAR_00392
FT                   methionyl-tRNA formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91782"
FT                   /db_xref="GOA:C4L7Y3"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4L7Y3"
FT                   /inference="protein motif:TFAM:TIGR00460"
FT                   /protein_id="ACQ91782.1"
FT                   /translation="MHNLRIVFAGTPDFAAKHLQALLNANLQVVAVYTQPDRPAGRGNK
FT                   LTPSPVKILAVEHNIPVFQPENFKSAEAQQELAALKPDLMVVVAYGLLLPQQVLDTPRL
FT                   GCINVHGSLLPGWRGAAPIQRAIWAGDPETGITIMQMDAGLDTGDMLHKMVCPITPEDT
FT                   SASLYEKLAIDGPEGMLFTIQQIADGTAKPEKQNNELATYAKKLSKEEACINWQQDAAF
FT                   IERCIRAFNPWPVSYFKLADLNIKVWKAEVLPNTAQQSPGMIIQASKAGLDIATGNGML
FT                   RIKQLQLPGKKAMSFADVLNARQDLFLQGNILP"
FT   gene            complement(161980..162483)
FT                   /locus_tag="Tola_0153"
FT   CDS_pept        complement(161980..162483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0153"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="KEGG: asa:ASA_4140 polypeptide deformylase; TIGRFAM:
FT                   peptide deformylase; PFAM: formylmethionine deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91783"
FT                   /db_xref="GOA:C4L7Y4"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4L7Y4"
FT                   /inference="protein motif:TFAM:TIGR00079"
FT                   /protein_id="ACQ91783.1"
FT                   /translation="MATLDVLRFPDERLRKIATPIEKITSDLEHIIEDMFETMYLEEGI
FT                   GLAATQVNIHKRLVVVDTSENRDQPMVFINPELIEKRGETGIEEGCLSVPECRAFVPRA
FT                   EWIKVRALDRHGEPFEIEADGLLAICLQHEMDHLVGKLFVDYLSPLKRQRIRQKLEKLA
FT                   RNER"
FT   gene            162578..163678
FT                   /locus_tag="Tola_0154"
FT   CDS_pept        162578..163678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0154"
FT                   /product="Peptidoglycan-binding LysM"
FT                   /note="PFAM: Peptidoglycan-binding LysM; SMART:
FT                   Peptidoglycan-binding LysM; KEGG: asa:ASA_4139 LysM
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91784"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7Y5"
FT                   /inference="protein motif:PFAM:PF01476"
FT                   /protein_id="ACQ91784.1"
FT                   /translation="MIMKPRYISIFLMSALFAFQVSADTLALKKDHPDRYVVQKGDTLW
FT                   DISGRFLTKPWLWPRLWDMNKQIKNPHWIYPGDRLRLTWVNGQPKLVLDSSDARSGKKV
FT                   ITLTPKMRIEEKQGPVSTVEYSDISQFLRADMVADSNVDLEHMPYVLGENDDTSIFMSQ
FT                   GQTLHVRGKPDLNTNYGVYRIGNVYKDEQTGEELGRQLELVGVVQPKELYDTDITSVEV
FT                   LSSFSEIRRGDRLLPMLSESSIDAFFVPQAGNLSKPAHVIDIPMKSTYVGRYDTVIIDK
FT                   GARENLKPGDVFGIVRPGAEVVDNGPDNVIYEQDGTAGEKLQKKTTLRADHIGEVMIVK
FT                   VYQKTSLAIVMNSRAIVRAGYAVENP"
FT   sig_peptide     162578..162649
FT                   /locus_tag="Tola_0154"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            163659..164783
FT                   /locus_tag="Tola_0155"
FT   CDS_pept        163659..164783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0155"
FT                   /product="DNA protecting protein DprA"
FT                   /note="TIGRFAM: DNA protecting protein DprA; PFAM: SMF
FT                   family protein; KEGG: aha:AHA_0260 DNA protecting protein
FT                   DprA"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91785"
FT                   /db_xref="GOA:C4L7Y6"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7Y6"
FT                   /inference="protein motif:TFAM:TIGR00732"
FT                   /protein_id="ACQ91785.1"
FT                   /translation="MRWKIPEQSLSQNELALWLHLTNIPGIGPVKGAKLLQQFPITALS
FT                   QSQLSDCGWNQQQIERWFDFSPETYKPIIDWADETSRYILHFDHPSYPALLRNVVGAPL
FT                   VLFVAGDLAVLNQQQLAVVGSRRPTQDGRDAAQSFTSELVRQGFAITSGLASGIDAVSH
FT                   QTALQQGGRTIAVQGCGLRHVYPAKHKRLASQILEQGGALISEFFPETLPRAEYFPRRN
FT                   RIISGLTVGTLVIEAAEKSGSLITARCALEQNREVFAVPGRSNNLNARGCHRLIQQGAK
FT                   LVCDVADIIEEIGIFPRMVEHYGETGPIAEEPLSDLPFYRLLDNVRSDEVTSIDVIAAT
FT                   SRLPVQEVMTELITLELEGLILSVPGGYVRTRSA"
FT   gene            164786..165259
FT                   /locus_tag="Tola_0156"
FT   CDS_pept        164786..165259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0156"
FT                   /product="protein of unknown function DUF494"
FT                   /note="PFAM: protein of unknown function DUF494; KEGG:
FT                   aha:AHA_0261 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91786"
FT                   /db_xref="InterPro:IPR007456"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4L7Y7"
FT                   /inference="protein motif:PFAM:PF04361"
FT                   /protein_id="ACQ91786.1"
FT                   /translation="MFDVLMYLFETYVQSELDFMVDQDALTDELTRAGFQKPEIYKALS
FT                   WLEQLAALHDSEDAPEYTACASDSFRIYASEEMLKLSTECRGFLLFLEQIRVLNCDTRE
FT                   IVIERLMELDSPEIELDDLKWVVMMVLFNLPGGENACHQMEELMFEPEAITIQ"
FT   gene            165282..165854
FT                   /locus_tag="Tola_0157"
FT   CDS_pept        165282..165854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0157"
FT                   /product="DNA topoisomerase type IA zn finger domain
FT                   protein"
FT                   /note="PFAM: DNA topoisomerase type IA zn finger domain
FT                   protein; KEGG: swd:Swoo_0043 DNA topoisomerase type IA Zn
FT                   finger domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91787"
FT                   /db_xref="GOA:C4L7Y8"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7Y8"
FT                   /inference="protein motif:PFAM:PF01396"
FT                   /protein_id="ACQ91787.1"
FT                   /translation="MSKIDTTLFTAQEHALDKEYRLCPECGGALSLRRSKHGLFLGCEN
FT                   YPDCQFMRPLQQQNVLIEKILEDSSCPECGKLLAIKKGRFGLFIGCTGYPECSHIETNN
FT                   TTLADTSLLPDCPVCQQGQLQAKTSRYGKTFYACSNYPKCKYAINDKPIAKACPQCGFS
FT                   LLVEKRTRQGIRFCCPQKDCNYSAESL"
FT   gene            165901..166404
FT                   /locus_tag="Tola_0158"
FT   CDS_pept        165901..166404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0158"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="KEGG: asa:ASA_4135 phosphoribosylaminoimidazole
FT                   carboxylase, catalytic subunit; TIGRFAM:
FT                   phosphoribosylaminoimidazole carboxylase, catalytic
FT                   subunit; PFAM:
FT                   1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR)
FT                   carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91788"
FT                   /db_xref="GOA:C4L7Y9"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7Y9"
FT                   /inference="protein motif:TFAM:TIGR01162"
FT                   /protein_id="ACQ91788.1"
FT                   /translation="MSNPFVAILMGSDSDFPVMQSTLEVLKSFDIRYEVKVTSAHRTPA
FT                   ATHAYVTDAEARGCKVFICAAGLAAHLAGAVAGITTRTVIGVPIDGGPLKGMDALLSTV
FT                   QMPGGVPVATVAIGKAGAKNAGYLAAQILAVADDALAAKVKAERQKNAEEVMAKDAALQ
FT                   AQLK"
FT   gene            166442..167002
FT                   /locus_tag="Tola_0159"
FT   CDS_pept        166442..167002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0159"
FT                   /product="Sua5/YciO/YrdC/YwlC family protein"
FT                   /note="TIGRFAM: Sua5/YciO/YrdC/YwlC family protein; PFAM:
FT                   SUA5/yciO/yrdC domain; KEGG: aha:AHA_0264 SUA5/YciO/YrdC
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91789"
FT                   /db_xref="GOA:C4L7Z0"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR023535"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7Z0"
FT                   /inference="protein motif:TFAM:TIGR00057"
FT                   /protein_id="ACQ91789.1"
FT                   /translation="MTENLQQACQILRSGGVIAYATEAVFGLGCDPDNETAVHKLLQIK
FT                   QRPIEKGLILIAASWEQLAPYLDVSLLTEEQLQRAQKSWPGPYTWVFPAKISTPKWLTG
FT                   QFSSLAVRISAHPQVQALCLMYGKPMVSTSANLTSLPPCRTVEDVRSQLTGRIDYILPG
FT                   DVGKQTNPSEIRDVITNQLIRAG"
FT   gene            167047..167868
FT                   /locus_tag="Tola_0160"
FT   CDS_pept        167047..167868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0160"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /note="TIGRFAM: shikimate 5-dehydrogenase; PFAM: Shikimate
FT                   dehydrogenase substrate binding domain protein;
FT                   Shikimate/quinate 5-dehydrogenase; KEGG: asa:ASA_4132
FT                   shikimate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91790"
FT                   /db_xref="GOA:C4L7Z1"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4L7Z1"
FT                   /inference="protein motif:TFAM:TIGR00507"
FT                   /protein_id="ACQ91790.1"
FT                   /translation="MDRYAVFGNPINHSKSPFIHTLFARQTQQLLTYEKIEAPVDDFVG
FT                   SIRRFFAEGGKGANVTVPFKEQAFQLVDQLSPRAKLAGAVNTLKLTDDGLLLGDNTDGA
FT                   GLVQDLKYHLEELAGKKILLLGAGGACRGVIGPLLEQRPSEIVIANRTVAKAEQLAQEF
FT                   AAMGKVRVSQFAELNESFDLIINGTSASLAGAMPDIPDAVIGSATVTYDMMYGSKETVF
FT                   NLWAKEHGAIKTIDGLGMLVCQAAESFAVWRGIRPGTRQVIRELRRNITGA"
FT   gene            complement(167872..168414)
FT                   /locus_tag="Tola_0161"
FT   CDS_pept        complement(167872..168414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0161"
FT                   /product="carbonic anhydrase"
FT                   /note="KEGG: vvy:VV3213 carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91791"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7Z2"
FT                   /inference="similar to AA sequence:KEGG:VV3213"
FT                   /protein_id="ACQ91791.1"
FT                   /translation="MSSIRSYRGIKPQLGHAVYIDPQSCVIGDVRLSDDSSVWPMAVVR
FT                   GDVNYITIGARSNVQDGSVLHVNRVTEKNPDGCPLIIGNDVTIGHKAVLHGCIIHDRVL
FT                   VGMGAVILDGAIIESDVIVAAGAVVPPRKRLVSGYVYVGNPVKQGRALTEDEQEFFVQS
FT                   SANYVLLKNEFLSELNN"
FT   gene            168795..170328
FT                   /locus_tag="Tola_R0007"
FT   rRNA            168795..170328
FT                   /locus_tag="Tola_R0007"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            170398..170474
FT                   /locus_tag="Tola_R0008"
FT                   /note="tRNA-Ile2"
FT   tRNA            170398..170474
FT                   /locus_tag="Tola_R0008"
FT                   /product="tRNA-Ile"
FT   gene            170486..170561
FT                   /locus_tag="Tola_R0009"
FT                   /note="tRNA-Ala2"
FT   tRNA            170486..170561
FT                   /locus_tag="Tola_R0009"
FT                   /product="tRNA-Ala"
FT   gene            170768..173654
FT                   /locus_tag="Tola_R0010"
FT   rRNA            170768..173654
FT                   /locus_tag="Tola_R0010"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            173783..173896
FT                   /locus_tag="Tola_R0011"
FT   rRNA            173783..173896
FT                   /locus_tag="Tola_R0011"
FT                   /product="5S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            173959..174035
FT                   /locus_tag="Tola_R0012"
FT                   /note="tRNA-Asp2"
FT   tRNA            173959..174035
FT                   /locus_tag="Tola_R0012"
FT                   /product="tRNA-Asp"
FT   gene            174093..174206
FT                   /locus_tag="Tola_R0013"
FT   rRNA            174093..174206
FT                   /locus_tag="Tola_R0013"
FT                   /product="5S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            complement(174255..176429)
FT                   /locus_tag="Tola_0162"
FT   CDS_pept        complement(174255..176429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0162"
FT                   /product="protein of unknown function DUF323"
FT                   /note="PFAM: protein of unknown function DUF323;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   aha:AHA_0211 generic methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91792"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR027577"
FT                   /db_xref="InterPro:IPR027625"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7Z3"
FT                   /inference="protein motif:PFAM:PF03781"
FT                   /protein_id="ACQ91792.1"
FT                   /translation="MDTPNQFSLSDTQIASASALPAPTHTLWLHGTDVAAKRQELLNYF
FT                   IQTYDLYDSLFDCLACDDAWYKKAIPLRHPLIFYYGHTAAFFINKLLAGQFIQQRIDAD
FT                   IEATVAIGVDEMSWDDLDEKHYRWPTIQRLREYRQQVRSRVIQFIQDMPLELPITWENP
FT                   AWAILMGIEHERIHLETSSVLIRQLPLERVQPQPRWQYCPTQRNNIADVPQNALITVAG
FT                   TTIQLGKPESDTTYGWDNEYGQRSITLESFQASKYLVSNAEYLEFIQDGGYQQPQWWSE
FT                   EGLGWLNFTKADKPTFWCGDPTQTTSLRLRLMCEEIPMPWDWPVETNQLESAAFCRWKA
FT                   AKTGLPIQLPSEAEWMALRENITADQPDWIKAPGNINLEYWSSSCPIDQFLHGKFYDVI
FT                   GNVWQWTSTAIDGFNGFRVHPLYDDFSTPTFDGKHNLIKGGSWISTGNLAIKNARYAFR
FT                   RHFFQHAGFRYVVSRYQEPMLVNPYETDPLIAQYLDSHYGAERFGVPNHCKTLAEIANQ
FT                   FCQNKIRALDIGCSVGRASFELAKYFQHVDAVDYSARFIDIAQILAQQNSFRYAMTNEG
FT                   ELVDYREAKLTDCQLSPELANHIHFTQGDACNLKNKYRHYDLILAANMLDRLREPARFL
FT                   KDLAHRLRDDGILMICSPHTWQEDSTVKSYWLGGIRENGEALTTYQALQRILSKEFEEI
FT                   TKPQDIPFVLQETARKYQYLLSQLTVWRKK"
FT   gene            complement(176513..176920)
FT                   /locus_tag="Tola_0163"
FT   CDS_pept        complement(176513..176920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0163"
FT                   /product="cytidine deaminase"
FT                   /note="TIGRFAM: cytidine deaminase; PFAM: CMP/dCMP
FT                   deaminase zinc-binding; KEGG: pcd1; cytidine deaminase
FT                   Pcd1; K01489 cytidine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91793"
FT                   /db_xref="GOA:C4L7Z4"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR006262"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7Z4"
FT                   /inference="protein motif:TFAM:TIGR01354"
FT                   /protein_id="ACQ91793.1"
FT                   /translation="MPQIDDTQLMQLMDAAKASIRHAYMPYSNYPVGAAVLTADNRIIA
FT                   GVNIENAAYPAGMCAERVALGNAISQGYTQFKAIAVFSPKGEISPCGVCRQFISEFGPD
FT                   IQILFHWQGQLQQMPIKDLLPFSFSQTQLNA"
FT   gene            complement(177017..178681)
FT                   /locus_tag="Tola_0164"
FT   CDS_pept        complement(177017..178681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0164"
FT                   /product="alpha,alpha-phosphotrehalase"
FT                   /note="KEGG: asa:ASA_0485 trehalose-6-phosphate hydrolase;
FT                   TIGRFAM: alpha,alpha-phosphotrehalase; PFAM: alpha amylase
FT                   catalytic region; SMART: alpha amylase catalytic sub
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91794"
FT                   /db_xref="GOA:C4L7Z5"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012769"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022567"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7Z5"
FT                   /inference="protein motif:TFAM:TIGR02403"
FT                   /protein_id="ACQ91794.1"
FT                   /translation="MSYPQHDWWRQAVVYQIYPKSFQDSGDKGTGDLQGIIRRLDYLQQ
FT                   LGVDALWITPIYCSPQVDNGYDIADYYAIDPAFGGMTDFEQLVAACKQRNMHIIMDMVF
FT                   NHTSTEHVWFKTALSDPQSRFRDFYIWRDPVNGKAPNNWQSKFGGNAWAFDQQSGQYYL
FT                   HLFSEQQADLNWENPEVREEIKKVLHFWADKGVDGFRLDVINLISKQQDFCDDFTGDGR
FT                   RFYTDGPRVHEYLQELSRDVFQPRGCMTVGEMSSTTLEHCQQYSQQDGRELSMVFNFHH
FT                   LKVDYPNGEKWQLAEPDFIELKQIFAKWQNGLHQQGWSALFWCNHDQPRIVSRFGHEGQ
FT                   YREKSAKMLATVLHMLQGTPYIYQGEEIGMTNPHFSRIDDYRDVESLNVYLAHQQQKIP
FT                   AEETLQILAARSRDNSRTPMPWDTSAGAGFSQATPWIQLGDNAGEVNVAKALADKNSVF
FT                   YYYQRLIQLRKQQPVIVNGNYQDLQPDNPDLWCYQRDDGQHKLLIVANLRITATPFVLP
FT                   EQWRQTTSECLIHNSETTPALCSRELQPYEVMVWLNK"
FT   gene            complement(178750..180186)
FT                   /locus_tag="Tola_0165"
FT   CDS_pept        complement(178750..180186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0165"
FT                   /product="PTS system, trehalose-specific IIBC subunit"
FT                   /note="TIGRFAM: PTS system, trehalose-specific IIBC
FT                   subunit; PTS system, glucose-like IIB subunint; PFAM:
FT                   phosphotransferase system EIIC; phosphotransferase system
FT                   PTS EIIB protein; KEGG: asa:ASA_0484
FT                   trehalose(maltose)-specific PTS system components IIBC"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91795"
FT                   /db_xref="GOA:C4L7Z6"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011296"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7Z6"
FT                   /inference="protein motif:TFAM:TIGR01992"
FT                   /protein_id="ACQ91795.1"
FT                   /translation="MSKSFSQDVTRLISLVGGKDNIATVSHCLTRLRFVLKNTAQADIK
FT                   GIEKLASVKGCFTNAGQFQVVIGTEVDQFYKLLIAETGVDGASKEAAKVAARQNMNVLE
FT                   RAISHLAEIFVPLLPAIITGGLILGFRNVIGDIKMFDGKSLTEISQFWAMVHSFLWLVG
FT                   EAIFHFLPVGVCWATVRKMGGSEILGIVLGITLVSPQLMNAYLIGQQAPEAWDFGLFAI
FT                   QKVGYQAQVIPAILAGALLALIETRLKQIIPAYLYLVIVPFVSLLLAVILAHSLIGPFG
FT                   RWIGDGVAFAAKAVMTGGFAPIGAALFGFLYAPLVITGVHHTTNAVDLQLVQSMGGTPI
FT                   WPLIALSNIAQASAVLGIILISRKENEREISVPAAISAYLGVTEPAMYGINLRYKFPML
FT                   CAMVGSALAALVCGFSGVLANGIGVGGLPGILSIQPQFWGIYAVAMLIAIAVPLTLTMA
FT                   VYKHKFRNQTQAELSATEVA"
FT   gene            complement(180388..181335)
FT                   /locus_tag="Tola_0166"
FT   CDS_pept        complement(180388..181335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0166"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="KEGG: aha:AHA_3825 trehalose repressor; TIGRFAM:
FT                   trehalose operon repressor; PFAM: regulatory protein LacI;
FT                   periplasmic binding protein/LacI transcriptional regulator;
FT                   SMART: regulatory protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91796"
FT                   /db_xref="GOA:C4L7Z7"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR012771"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7Z7"
FT                   /inference="protein motif:TFAM:TIGR02405"
FT                   /protein_id="ACQ91796.1"
FT                   /translation="MTKRLTILDIARLSGVGKSTVSRVLNQDPNVNPQTRDRVEAVIRE
FT                   HGFEPSKSARAMRTNSARLVGIIVSRLDSASENRAVRGMLEVLYARGYDAMLMESEFDP
FT                   AKVDEHLALLARRGVDGVILFAFSALDLERLRSWQDNLILMARAWPDMSSVCYDDEGAI
FT                   QQILEKLYAAGRHQIDFIGVDQSDATTGALRLQAYQQFCTAHQLPCRYLTGSLDVQSGY
FT                   DLTARLLTPATDAVVCATDTLAMGAAKYLQEQQRHDIQLTGVGNNPLLHFLFPQVLSVD
FT                   PGYKQAGRLAAEQLLLQLEQQAEPCAQIAPSHDL"
FT   gene            181552..182058
FT                   /locus_tag="Tola_0167"
FT   CDS_pept        181552..182058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0167"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   asa:ASA_3550 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91797"
FT                   /db_xref="InterPro:IPR004375"
FT                   /db_xref="InterPro:IPR037012"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7Z8"
FT                   /inference="protein motif:PFAM:PF04074"
FT                   /protein_id="ACQ91797.1"
FT                   /translation="MFIGNLQELDDVLLHPLIAAVLRDFVATNADVLELPKGKIDLTVP
FT                   AQFAPADMPKDPLFMIVSMDTSQLVTERRAEFHDTYLDIQLLLSGEEWIGIGPHTVELD
FT                   RADNPHPDLYFMDEPSTTYVGLQPGDFVVIAPGELHTPLCTLTEPGQLRKIVFKVHKAL
FT                   LAPSA"
FT   gene            182074..182736
FT                   /locus_tag="Tola_0168"
FT   CDS_pept        182074..182736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0168"
FT                   /product="Glutathione S-transferase domain protein"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   hch:HCH_06697 glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91798"
FT                   /db_xref="GOA:C4L7Z9"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:C4L7Z9"
FT                   /inference="protein motif:PFAM:PF02798"
FT                   /protein_id="ACQ91798.1"
FT                   /translation="MPEFQLIIGNKNYSSWSLRPWLLLRKLGVSFEETQVLLQSEDFKT
FT                   QAMQYSPAAKVPVLLDGGLAIWDSLAIAEYLAEQFPQAWPKDKAARAFARSICAEIHSG
FT                   FMTLRSKMPMNCRATGREVVGDDALQKDIERIQAIWNECRQRYGHAGPWLFGEFTIADA
FT                   MFAPVVFRFNTYGINVQGLADEYLQTVLQDADVQAWLHAAQQEQAVIMGYEVGLTAQ"
FT   gene            complement(182806..184074)
FT                   /locus_tag="Tola_0169"
FT   CDS_pept        complement(182806..184074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0169"
FT                   /product="O-acetylhomoserine/O-acetylserine sulfhydrylase"
FT                   /EC_number="2.5.1.49"
FT                   /note="KEGG: aha:AHA_0506 O-acetylhomoserine sulfhydrylase
FT                   MetY; TIGRFAM: O-acetylhomoserine/O-acetylserine
FT                   sulfhydrylase; PFAM: Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent protein; aromatic amino acid
FT                   beta-eliminating lyase/threonine aldolase;
FT                   DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91799"
FT                   /db_xref="GOA:C4L800"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C4L800"
FT                   /inference="protein motif:TFAM:TIGR01326"
FT                   /protein_id="ACQ91799.1"
FT                   /translation="MKDATLALHHGFQNDPTTKSVAVPIYQTVAYEFDNAQHGADLFNL
FT                   EVPGNIYTRIMNPTNDVLEKRLAALEGGIAGLVVSAGSAAINYAIQTLTRAGDNIVSTP
FT                   QLYGGTYTLFAHMFPSFGVDVRFARDDSPEAIAELIDDKTKAVYCESIGNPAGNIVDLE
FT                   GLARVAHAKGVPLVVDNTVASPVLCKPIQFGADIVVHSITKYVGGHGNSLGGVIVDSGK
FT                   FPWAEHAERFPQFSKPEASYHGVVYTETFGPAAFIARARTVPLRNTGSTLSPMNAFLLL
FT                   QGLETLSLRMERHVENARKVAEFLQNHAKVAWVSYAGLPNHPHHALAQKYMNGTPSAIL
FT                   SFGLKEGYEAGVRFYDALKIFKRLVNIGDAKSLACHPASTTHRQMTLEEQAKAGVKPEM
FT                   IRLSVGIEAIEDILEDLDQALKA"
FT   gene            complement(184256..185704)
FT                   /locus_tag="Tola_0170"
FT   CDS_pept        complement(184256..185704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0170"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   asa:ASA_0435 EmrB/QacA family drug resistance transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91800"
FT                   /db_xref="GOA:C4L801"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4L801"
FT                   /inference="protein motif:TFAM:TIGR00711"
FT                   /protein_id="ACQ91800.1"
FT                   /translation="MTKYQVTAKEKRILPWLAAVGFFMQALDGTILNTALPAIAADFHE
FT                   SPLQMQAAIISYMLTVAMLIPASGWLADRFGTRHVFLFSIFLFTAGSLFCAESTSLSQM
FT                   VIARIIQGVGGALLVPVGRLTILRVFPKEEFLSAMSMVVIPGLIGPLIGPLLGGLLVEH
FT                   ATWQWIFLINLPIGLIGCVLAFFFMPNIREKTASFDWKGYLFFSSGVVLLSIAIQRLGE
FT                   PDASVTSFLLLAIPGALGLYTYFWHSQRHPHALFSRALFKITSFRIGILGNLIARLGSG
FT                   AIPFLTPLFLQVALGFNPTHAGLTMVPIALGAMSTKLLANWVVRRLGFRPVLMLNTLLL
FT                   GALIAGFSSVSNETPYALLLLYLALLGVFNSMQFTAMNTLTLSELEREEASSGNSLLSV
FT                   VMQLSMSLGVAISATLFALFYGSGTVLKGLQANSSQQAEILSAFHDTYITVGCLSMLAT
FT                   LIFRRLPQKNHSLSSAEEEPVIRR"
FT   gene            complement(185732..186520)
FT                   /locus_tag="Tola_0171"
FT   CDS_pept        complement(185732..186520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0171"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: ppf:Pput_0690 polar
FT                   amino acid ABC transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91801"
FT                   /db_xref="GOA:C4L802"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C4L802"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ACQ91801.1"
FT                   /translation="MNRNTIMTSKFKWQVTLVWLALMIGFIWFIAKFDLDMAYVWEKLP
FT                   FLAGLHLSPDGFIQGVPLTIYVCVIAMLASVILGLLAALGRLSLNPLAYGISTFYTSFF
FT                   RGTPLLLQVLLIYQGLPQIGPIPTAIPSGIIALALCYGAYLSEIFRSAIVAIPRGQWEA
FT                   AMALGLKKHQTFLKVILPQSMKVAIPPGMAMFIAMLKDSSLVSVMGLWEIMFLAQSYGR
FT                   SAYRYMEMLITAAVIYWILSFLLELIQARLEKVFHGGKTR"
FT   gene            complement(186652..187485)
FT                   /locus_tag="Tola_0172"
FT   CDS_pept        complement(186652..187485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0172"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   SMART: extracellular solute-binding protein family 3; KEGG:
FT                   pfo:Pfl01_2802 extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91802"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:C4L803"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ACQ91802.1"
FT                   /translation="MMQYKTLQTLLLLAGSVTISHASVAGETLDRIKERGELIGVMDQA
FT                   YPPYSFLNDKNEMDGMDVDLTKEFARRLGVKAKIETPAWEVTTAGNWRGRWDICICSMT
FT                   PDAQRARSLDFVTHYYSSPAVLVTSVNGNPLTKLADMEGKKIAAQQGGSYERYLNQTLK
FT                   MEGYGAKPVTYPFKAVQVMPYGSEDLEYQDLSLGAGKRIDGLVSNLVTANERISKMPGK
FT                   FKIVGEPLFEDPNWVAIDKGDKEWRDTVVKIFDDMRKDGTLQKITVKWIGTDISR"
FT   sig_peptide     complement(187408..187485)
FT                   /locus_tag="Tola_0172"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.966 at
FT                   residue 26"
FT   gene            187696..189267
FT                   /locus_tag="Tola_0173"
FT   CDS_pept        187696..189267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0173"
FT                   /product="Na+/H+ antiporter NhaB"
FT                   /note="TIGRFAM: Na+/H+ antiporter NhaB; PFAM: Na+H+
FT                   antiporter NhaB; Citrate transporter; KEGG: asa:ASA_2302
FT                   sodium/proton antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91803"
FT                   /db_xref="GOA:C4L804"
FT                   /db_xref="InterPro:IPR004671"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4L804"
FT                   /inference="protein motif:TFAM:TIGR00774"
FT                   /protein_id="ACQ91803.1"
FT                   /translation="MVASMASALARNFLGSTPRWYKMTIVMFLIINPFIVALNPFVAGW
FT                   LLVAEFIFTLSMALKCYPLLPGGLLALEAVFSGLTSAEQVKHELSANLEVLLLLMFMVA
FT                   GIYFVRQLLLYVFTKLLISVRSKIALSLAFSVMAAFLSAFLDALTVVAVVISISVGFYS
FT                   VYHKYVSTHPEHDINNDDSIHKQHHADLEQFRAFLRSLLMHAAVGTALGGVCTLVGEPQ
FT                   NLIIGEMAGWNFSEFFIRMSAVSIPVLICGLATCVLMEKLKWFGYGTVIPESVYLILKQ
FT                   SADHDDAHRTTQERLKLVCQAIICVWLIVGLAFHLAAVGLIGLSVIILATTFTGVSDEH
FT                   AIGRAFTESLPFTALLSVFFVVVAVIIDQELFRPLIQMVLSAPQEMQLTLFYIANGVLS
FT                   MVSDNVFVGTVYINEAHTALVNNVISRDHFDLLAVAINTGTNLPSVATPNGQAAFLFLL
FT                   TSTLAPLVRMSYGRMMWMALPYTIVLAGVGLLSTMYLLPDMTQWFYESGWLQHKAAIPV
FT                   ITPASH"
FT   gene            189337..190230
FT                   /locus_tag="Tola_0174"
FT   CDS_pept        189337..190230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0174"
FT                   /product="homocysteine S-methyltransferase"
FT                   /note="PFAM: homocysteine S-methyltransferase; KEGG:
FT                   pfo:Pfl01_2779 homocysteine S-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91804"
FT                   /db_xref="GOA:C4L805"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR017226"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="UniProtKB/TrEMBL:C4L805"
FT                   /inference="protein motif:PFAM:PF02574"
FT                   /protein_id="ACQ91804.1"
FT                   /translation="MSKVQILDGGMGRELKRIGAPFQQPEWSALALLDAPEYVTMAHNA
FT                   FIGSGADIITTNSYAVVPFHIGEVRFTERGHALAQLAAEIARACADKAAHPVTVAGSLS
FT                   PVLGSYRPDLFQMEAALRIYRVLIAAQEPFVDHWLAETQSSIAEVKAVRQALGDNSKPL
FT                   WVSFTLDDEPAGGQALLRSGETVTDAVAAAIGLNVSAILFNCSQPEVMTNAVHDAVAEI
FT                   QRQGKAIPVGVYANAFPAQSKEAEANAELDEIRADLNPDAYLNWAKKWIAAGATIIGGC
FT                   CGITPEHIAQLAKDLK"
FT   gene            complement(190279..190560)
FT                   /locus_tag="Tola_0175"
FT   CDS_pept        complement(190279..190560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0175"
FT                   /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
FT                   /note="PFAM: PpiC-type peptidyl-prolyl cis-trans isomerase;
FT                   KEGG: eca:ECA4216 peptidyl-prolyl cis-trans isomerase C"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91805"
FT                   /db_xref="GOA:C4L806"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="UniProtKB/TrEMBL:C4L806"
FT                   /inference="protein motif:PFAM:PF00639"
FT                   /protein_id="ACQ91805.1"
FT                   /translation="MARTASALHILVKTEAQALDIMKQLAAGADFQQLAKKYSTCPSKK
FT                   RGGDLGEFKKGDMVASFDNAVFSCELLQPVGPVKTRFGYHIIKVLYRS"
FT   gene            complement(190664..192367)
FT                   /locus_tag="Tola_0176"
FT   CDS_pept        complement(190664..192367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0176"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vsp:VS_3040 predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91806"
FT                   /db_xref="UniProtKB/TrEMBL:C4L807"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACQ91806.1"
FT                   /translation="MPLSRFVLSGLLIALVGCNTTSVPGKNTQTLVASDMSARLQQELS
FT                   PLFSGTIQRQAEQAVFTPCGSNQQWQLVMDDSFWQQWQQLGSPQTLQASLSGQLSPGAG
FT                   RGAPFSLEAKHVSRITTDQSICQNSSENYLLKAGNNQPFWSLIIDGQQASLTTPDGVDS
FT                   YQLTDVTRPAEKQLQLALDNQSGKQATLNLRPGYCQDADSQQWLGYVVTLELDDGQTLS
FT                   GCAEQGKSLTQQQPAHDWQGHDDTQKADISLVLESNYQAKMIHTRETGPEVIYDGAWQP
FT                   QNDQTIRVMFNQRMGLPINESITFHWKDNTLTADYRELEAGKAYFDKPLVLTTKDGREN
FT                   TVTTDSATLPTGSAAVVVAPPATQEIPAGESSFAQNETVLNGAAAIAATSMTSGMANNS
FT                   SAVMSGTATAATLASFSAGILQASVQADNTIEQALRQFLESSGSQASGTQYRYVKADLN
FT                   GDGSLDALAEMNWCDKSGCVWLVLQGNNGQYQQVGRLEGFSGTVMVAPSAHNGWFDLLI
FT                   PSAEQANTYLTLEHDGSAYPSRPAVSNQPQPDPNTLLQLRFEGDNWLTIP"
FT   sig_peptide     complement(192299..192367)
FT                   /locus_tag="Tola_0176"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.669) with cleavage site probability 0.473 at
FT                   residue 23"
FT   gene            complement(192434..193234)
FT                   /locus_tag="Tola_0177"
FT   CDS_pept        complement(192434..193234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0177"
FT                   /product="Cof-like hydrolase"
FT                   /note="TIGRFAM: Cof-like hydrolase; HAD-superfamily
FT                   hydrolase, subfamily IIB; PFAM: Haloacid dehalogenase
FT                   domain protein hydrolase type 3; sucrose-6F-phosphate
FT                   phosphohydrolase; Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: aha:AHA_0035 Cof family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91807"
FT                   /db_xref="GOA:C4L808"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C4L808"
FT                   /inference="protein motif:TFAM:TIGR00099"
FT                   /protein_id="ACQ91807.1"
FT                   /translation="MYKVVISDLDGTLLNNQHHVSTHTRKVLKQLVAEGTKFIVATGRH
FT                   HIDVKAIRTALGLDIYLVTSNGAVVTDKQDEMIFNRTLPADIAQELSEMPLPDPEIAVN
FT                   IYTPDAWFTNKEMPEYLEYHKDTGFCYTKTDLVVLDKSSINKFFFIAEHEPLLELENTL
FT                   LERYAGQLSIAFSQPDCLEVMALGVNKGAAITSILEQHDIPLSSAIAFGDGMNDYEMLS
FT                   VVGHGVVMGNAHDRLKMALPDLPRAGINDEDGVAEYLQQLLLAE"
FT   gene            complement(193450..195597)
FT                   /locus_tag="Tola_0178"
FT   CDS_pept        complement(193450..195597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0178"
FT                   /product="(p)ppGpp synthetase I, SpoT/RelA"
FT                   /EC_number="2.7.6.5"
FT                   /note="KEGG: aha:AHA_0039 guanosine-3',5'-bis(diphosphate)
FT                   3'-pyrophosphohydrolase ((ppGpp)ase); TIGRFAM: RelA/SpoT
FT                   family protein; PFAM: RelA/SpoT domain protein; TGS domain
FT                   protein; amino acid-binding ACT domain protein;
FT                   metal-dependent phosphohydrolase HD sub domain; SMART:
FT                   metal-dependent phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91808"
FT                   /db_xref="GOA:C4L809"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:C4L809"
FT                   /inference="protein motif:TFAM:TIGR00691"
FT                   /protein_id="ACQ91808.1"
FT                   /translation="MYLFEDLKTLLGSYLPEEQVTRIQDAFLVARDAHEGQTRSSGEPY
FT                   ITHPVAVATILAEMHLDYETISAALMHDVIEDTPVTKEQLALQFGPAVAELVSGVSKLD
FT                   KLKFRDHKEAQAENFRKMVMAMVQDIRVILIKLADRTHNMRTLGSLRPDKRRRIARETL
FT                   EIFSPIANRLGIHTFKSELEELGFEALYPMRARILRESVKRARGNRKEVIDSVYKEIAG
FT                   RLQDAGIKAEVCGREKNLYSIYNKMVKKELRFYEVMDIYAFRVIVDDIDTCYRVLGQMH
FT                   SLYKPRPGRFKDYIAIPKTNGYQSLHTSLVGPHGVPVEIQIRTEYMDQMADKGVAAHWA
FT                   YKSNGDITGSTAQIRAQRWMKNLLELQQSAGSSFEFIESVKTDLFPDEIYVFTPEGRIL
FT                   ELPAGATPVDFAYAVHTDIGNSCVGARVERQPFPLSRPLTSGQTIEIITAPGARPNAAW
FT                   LNFVVTSRARTKIRQFLKNLRAEESIILGRRLLSHSLGGKKFEEIPAENLQQVLQDTRH
FT                   ESLDGLLADIGLGNQMSVVIARRLLGQHEQEPEKKTSPAYRKLPIRGASGMLVSFAKCC
FT                   RPIPGDAIVAHISPGKGLVVHQEGCPNIRGYNREPDKYQPVQWDMEHLGEQEFKTGIQV
FT                   EVVNHQGVLAQLANVISATGANIHSISTEEKDARVYQVNLLITAKHRVHLADIMRKIRV
FT                   MPDVLRVNRTTSRLRTKEADA"
FT   gene            complement(195728..196012)
FT                   /locus_tag="Tola_0179"
FT   CDS_pept        complement(195728..196012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0179"
FT                   /product="DNA-directed RNA polymerase, omega subunit"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, omega subunit;
FT                   PFAM: RNA polymerase Rpb6; KEGG: asa:ASA_0035 DNA-directed
FT                   RNA polymerase, omega subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91809"
FT                   /db_xref="GOA:C4L810"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4L810"
FT                   /inference="protein motif:TFAM:TIGR00690"
FT                   /protein_id="ACQ91809.1"
FT                   /translation="MARVTVEDAVKQVGNRFDLVLVAARRARQLAVQGKEPLVDEENDK
FT                   PTVIALREIEEGLISNQFMDAQERIEQQQQEASELAAVAALTQDRDYGF"
FT   gene            complement(196061..196690)
FT                   /locus_tag="Tola_0180"
FT   CDS_pept        complement(196061..196690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0180"
FT                   /product="guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /note="KEGG: aha:AHA_0041 guanylate kinase; TIGRFAM:
FT                   guanylate kinase; PFAM: guanylate kinase; SMART: guanylate
FT                   kinase/L-type calcium channel region"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91810"
FT                   /db_xref="GOA:C4L811"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4L811"
FT                   /inference="protein motif:TFAM:TIGR03263"
FT                   /protein_id="ACQ91810.1"
FT                   /translation="MAAAGTLFIISSPSGAGKSSLLTALLSRYNSDGRMALSVSHTTRA
FT                   MRPGEENGVHYHFVSKEEFQALIARDAFFEWAEVFGNYYGTSKELIEQALAKGIDVFLD
FT                   IDWQGARQIRELYSATQSIFVLPPSLPILEQRLIGRGQDSTEVIAKRMAQAVSEMSHYP
FT                   EYDYLIINDDFEQALQQLHAIVLAGRAKLRPQAICHAELLNQLLAG"
FT   gene            complement(196801..196968)
FT                   /locus_tag="Tola_0181"
FT   CDS_pept        complement(196801..196968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0181"
FT                   /product="ribosomal protein L33"
FT                   /note="TIGRFAM: ribosomal protein L33; PFAM: ribosomal
FT                   protein L33; KEGG: asa:ASA_4227 50S ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91811"
FT                   /db_xref="GOA:C4L812"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4L812"
FT                   /inference="protein motif:TFAM:TIGR01023"
FT                   /protein_id="ACQ91811.1"
FT                   /translation="MAKGAREKIRLNSSAGTGHFYTTTKNKRTMPEKMEIKKFDPVVRQ
FT                   HVIYKEGKIK"
FT   gene            complement(196980..197216)
FT                   /locus_tag="Tola_0182"
FT   CDS_pept        complement(196980..197216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0182"
FT                   /product="ribosomal protein L28"
FT                   /note="TIGRFAM: ribosomal protein L28; PFAM: ribosomal
FT                   protein L28; KEGG: cja:CJA_3515 ribosomal protein
FT                   L28-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91812"
FT                   /db_xref="GOA:C4L813"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4L813"
FT                   /inference="protein motif:TFAM:TIGR00009"
FT                   /protein_id="ACQ91812.1"
FT                   /translation="MSRVCQVTGKRPTVGNNRSHAKNATRRRFLPNLQSHRFWVEGEKR
FT                   FVTLRLTPKGMRIIDKLGIEAVLADIRARGEKV"
FT   gene            complement(197357..198031)
FT                   /locus_tag="Tola_0183"
FT   CDS_pept        complement(197357..198031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0183"
FT                   /product="DNA repair protein RadC"
FT                   /note="TIGRFAM: DNA repair protein RadC; PFAM: DNA repair
FT                   protein RadC; KEGG: aha:AHA_0160 DNA repair protein RadC"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91813"
FT                   /db_xref="GOA:C4L814"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4L814"
FT                   /inference="protein motif:TFAM:TIGR00608"
FT                   /protein_id="ACQ91813.1"
FT                   /translation="MAICDWPEDERPREKLLQRGASALSDAELLAIFLRTGVAGCNAIE
FT                   LARNLLQEFGSLRALLGAEQAQFCQAHGLGPAKYVQLQAVLEMSNRYLSECLQRGDSLT
FT                   SPQLVRRYLQAQLRDRPREVFAMLLLDNQHRVLRFCELFFGTIDAASVYPREIVQTVLK
FT                   HNAAAVILCHNHPSGVAEPSHADRHITERICDALRLIDVRVLDHFVIGDGDPVSFAERG
FT                   WL"
FT   gene            198137..199366
FT                   /locus_tag="Tola_0184"
FT   CDS_pept        198137..199366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0184"
FT                   /product="phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate/cysteine ligase"
FT                   /EC_number="6.3.2.5"
FT                   /note="KEGG: asa:ASA_4230 phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase;
FT                   TIGRFAM: phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate/cysteine ligase; PFAM:
FT                   DNA/pantothenate metabolism flavoprotein domain protein;
FT                   flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91814"
FT                   /db_xref="GOA:C4L815"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:C4L815"
FT                   /inference="protein motif:TFAM:TIGR00521"
FT                   /protein_id="ACQ91814.1"
FT                   /translation="MDLGCILMQLQNKRILLGVTGGIAAYKAAEIIRRLREHGAEVRVV
FT                   MTDAAKEFITPLTLQAVSGHIVANSMFDPQAEAGMGHIELAKWADLVLVAPATANVISR
FT                   LTTGMGDELLTTLCLASPAPLAIAPAMNMQMYLHAATQNNLKVLAERGVQIWGPGIGSQ
FT                   ACGDVGPGRMLDPLDIVEEVIRFFQPAPHSELSFLITAGPTREAIDPVRYISNHSSGKM
FT                   GFALAEAAAALGAKVTLVAGPVNLPTPKGVNRVDVESALDMQAAVDAEVSRHQIFIGCA
FT                   AVADYRTESVAPQKMKKQADSDTLTLQLVKNPDIIAGVAARADKPFVVGFAAETQDVAR
FT                   YALDKLQRKGLDMIAANDVSRTEQGFNSDQNALTVFWQNEQQELPLASKQQVAQQLISL
FT                   IIQRYQHETD"
FT   gene            199353..199808
FT                   /locus_tag="Tola_0185"
FT   CDS_pept        199353..199808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0185"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase
FT                   Dut"
FT                   /note="TIGRFAM: deoxyuridine 5'-triphosphate
FT                   nucleotidohydrolase Dut; PFAM: deoxyUTP pyrophosphatase;
FT                   KEGG: asa:ASA_4231 deoxyuridine 5'-triphosphate
FT                   nucleotidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91815"
FT                   /db_xref="GOA:C4L816"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4L816"
FT                   /inference="protein motif:TFAM:TIGR00576"
FT                   /protein_id="ACQ91815.1"
FT                   /translation="MKQIELKILDARIGNEFPLPEYATPGSAGLDLRACLDAAVVLAPG
FT                   ETQLIPTGLAIHIADPGLCATILPRSGLGHKHGIVLGNLVGLIDSDYQGQLMVSVWNRG
FT                   NTTFTIQPGERIAQLVFMPVVQASFNIVDDFDTSERGEGGFGSSGRH"
FT   gene            complement(199883..200524)
FT                   /locus_tag="Tola_0186"
FT   CDS_pept        complement(199883..200524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0186"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="KEGG: asa:ASA_0102 orotate
FT                   phosphoribosyltransferase; TIGRFAM: orotate
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91816"
FT                   /db_xref="GOA:C4L817"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:C4L817"
FT                   /inference="protein motif:TFAM:TIGR00336"
FT                   /protein_id="ACQ91816.1"
FT                   /translation="MKAYQREFIEFALEKQVLKFGEFTLKSGRKSPYFFNAGLFNSGRD
FT                   LAKLGRYYAAALVDSGIAYDVLFGPAYKGIPIASATAVQLAELHDQDVPWCFNRKEAKD
FT                   HGEGGNLVGSPLKGRIMLVDDVITAGTAIRESMDLIQANGAELAGVLIALDRQEKGKGE
FT                   LSAIQEVQRDYNAPVIAIITLGDLIRYLETQPEMTEYLEKVKAYRASYGV"
FT   gene            complement(200558..201271)
FT                   /locus_tag="Tola_0187"
FT   CDS_pept        complement(200558..201271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0187"
FT                   /product="ribonuclease PH"
FT                   /EC_number="2.7.7.56"
FT                   /note="KEGG: swd:Swoo_4568 ribonuclease PH; TIGRFAM:
FT                   ribonuclease PH; PFAM: 3' exoribonuclease; Exoribonuclease,
FT                   phosphorolytic domain 2"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91817"
FT                   /db_xref="GOA:C4L818"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4L818"
FT                   /inference="protein motif:TFAM:TIGR01966"
FT                   /protein_id="ACQ91817.1"
FT                   /translation="MRPSGRTPEQLRPITITRQYTCHAEGSVLVEFGRTKVLCTATVTE
FT                   GVPRFLKGKGQGWVTAEYGMLPRSTHSRMHREAASGKQGGRTLEIQRLIARSLRAAVDL
FT                   TKLGENTITVDCDVLQADGGTRTASITGACVALADALNWMLAKGSLKTNPLNFMVAAVS
FT                   VGIYEGAPVCDLDYDEDSSAETDMNLVMTETGKMIEIQGTAEGEPFSQEELMQLLELGK
FT                   QGIQQIIQHQRQALA"
FT   gene            201398..202258
FT                   /locus_tag="Tola_0188"
FT   CDS_pept        201398..202258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0188"
FT                   /product="YicC domain protein"
FT                   /note="PFAM: YicC domain protein; domain of unknown
FT                   function DUF1732; KEGG: aha:AHA_4225 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91818"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniProtKB/TrEMBL:C4L819"
FT                   /inference="protein motif:PFAM:PF03755"
FT                   /protein_id="ACQ91818.1"
FT                   /translation="MIHSMTGYARKEFKGDWGTAVWEIRSVNQRYLETYFRLPESFRNL
FT                   EAVLRERFRQGLERGKIECNLRFESQVSQGQLQINEALAEQLIDNALWVIDRAGQGQLN
FT                   PVDILRWPGVMEGEEQDMDALNVILLTAFDEVFKEFIAARRSEGDKLKALLEQRLEGVA
FT                   VEAAKVREHMPAILNWQRQRLLDRLAEAKVELEPTRIEQEIVLLAQKIDVAEELDRLDM
FT                   HVTETRKIIGKGGACGRRLDFMMQEFNRESNTLASKSINAEVTQAAVELKVLIEQMREQ
FT                   IQNVE"
FT   gene            complement(202310..203602)
FT                   /locus_tag="Tola_0189"
FT   CDS_pept        complement(202310..203602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0189"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="PFAM: sodium:dicarboxylate symporter; KEGG:
FT                   asa:ASA_1706 sodium:dicarboxylate symporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91819"
FT                   /db_xref="GOA:C4L820"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:C4L820"
FT                   /inference="protein motif:PFAM:PF00375"
FT                   /protein_id="ACQ91819.1"
FT                   /translation="MKMNKLTAMILISMLVGILTGHLYRSNVTDPASIAAFASNISILT
FT                   DIFLRLIKMIIAPLVFSTLVVGIAKMGDSQTVGRVGIKAMAWFMTASLVSLALGLIMVN
FT                   LLQPGVGLNLPLPDVTAKSGISATAITLKDFVTHAIPRSVVEAMATNEILQLVIFSLFF
FT                   GVAASGMGEKAKPVVNVMESIANIMLKVTGYVMNFAPFAVFGAITALIAKQGLGILLTY
FT                   GTFVGEVYGSILVLWCLLLLMGSLFLGRRVLSLPKFIREPILLAFSTASSEAAYPKTLQ
FT                   GLKRFGCSEKISSFVLPVGYSFNLDGSMMYCTFATMFIAQAYGMEISIAQQITMLLLLM
FT                   VTSKGMAGVPRASLVVIAAAMAQFNIPEAGLLLLLGVDHFLDMARSATNVMGNAIASSV
FT                   VAKLEGELTESIEDDDDLLGDSVLVEEQATG"
FT   sig_peptide     complement(203537..203602)
FT                   /locus_tag="Tola_0189"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.896) with cleavage site probability 0.439 at
FT                   residue 22"
FT   gene            complement(203927..205036)
FT                   /locus_tag="Tola_0190"
FT   CDS_pept        complement(203927..205036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0190"
FT                   /product="diguanylate cyclase"
FT                   /note="KEGG: aav:Aave_3646 diguanylate cyclase; TIGRFAM:
FT                   diguanylate cyclase; PFAM: GGDEF domain containing protein;
FT                   SMART: GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91820"
FT                   /db_xref="GOA:C4L821"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C4L821"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACQ91820.1"
FT                   /translation="MPFLKYIYVVFMGHIVMRQLIVESPCFQLFVRQAILAAISVHVLF
FT                   LLVFVYFSIPVLIVTNIGSLLLYIIALWLLRARSFKSIAALIWIDLIGHSLISSEVLGW
FT                   QSGFHFYLLLLVPMSFLYAFKSQAKRIFFIEAVLVIYLLLDYHSYGSPVMFELPSFYSM
FT                   LVRYINLVIFFIGLSYQLYVYNFLLQEDESPIPESATTDQLTGLDNRCAILSRIDEIFA
FT                   TSPYARQPMALIIAEVDHFKSMHERYGQSISDTALIHVAQILHDSIRHNDRASRWGGGE
FT                   FLLLLPGGSLTSAEQIAKRVQEKLLAAPLRKEGISLPVSLTFSVAELLPDESFDQCLIR
FT                   ADTALQHGKQSGGNRIELASVDFATTSPA"
FT   gene            205472..207005
FT                   /locus_tag="Tola_R0014"
FT   rRNA            205472..207005
FT                   /locus_tag="Tola_R0014"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            207055..207130
FT                   /locus_tag="Tola_R0015"
FT                   /note="tRNA-Glu1"
FT   tRNA            207055..207130
FT                   /locus_tag="Tola_R0015"
FT                   /product="tRNA-Glu"
FT   gene            207268..210154
FT                   /locus_tag="Tola_R0016"
FT   rRNA            207268..210154
FT                   /locus_tag="Tola_R0016"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            210283..210396
FT                   /locus_tag="Tola_R0017"
FT   rRNA            210283..210396
FT                   /locus_tag="Tola_R0017"
FT                   /product="5S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            complement(210792..211256)
FT                   /locus_tag="Tola_0191"
FT   CDS_pept        complement(210792..211256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0191"
FT                   /product="YbaK/prolyl-tRNA synthetase associated region"
FT                   /note="PFAM: YbaK/prolyl-tRNA synthetase associated region;
FT                   KEGG: asa:ASA_3807 YbaK/EbsC protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91821"
FT                   /db_xref="GOA:C4L822"
FT                   /db_xref="InterPro:IPR004369"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:C4L822"
FT                   /inference="protein motif:PFAM:PF04073"
FT                   /protein_id="ACQ91821.1"
FT                   /translation="MTPAIRFLKHIGSEFKVHTYECNVSDDFGKHCAEQLRMEKGKVFK
FT                   TLLIQHGTQAVTAIIPVNMHLNLKASAKAAHLKHAIMMNPKDAERVTGYKLGGISPFAQ
FT                   KKVLPTLLDESAFLYPSILVSGGKRGVSVEISPQALVQLLDASVAAISDK"
FT   gene            complement(211572..211853)
FT                   /locus_tag="Tola_0192"
FT   CDS_pept        complement(211572..211853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0192"
FT                   /product="protein of unknown function DUF1255"
FT                   /note="PFAM: protein of unknown function DUF1255; KEGG:
FT                   pmy:Pmen_2513 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91822"
FT                   /db_xref="GOA:C4L823"
FT                   /db_xref="InterPro:IPR009664"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4L823"
FT                   /inference="protein motif:PFAM:PF06865"
FT                   /protein_id="ACQ91822.1"
FT                   /translation="MLQVNEYFSGNVKSIGFDLADQRATVGVMAPGEYEFGTGAPELMV
FT                   VIRGALTVQLPGATEWQTFSAGQEFNVPGNSKFQLKVATDTAYLCEYK"
FT   gene            212136..213677
FT                   /locus_tag="Tola_0193"
FT   CDS_pept        212136..213677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0193"
FT                   /product="type VI secretion-associated protein, VC_A0119
FT                   family"
FT                   /note="TIGRFAM: type VI secretion-associated protein,
FT                   VC_A0119 family; PFAM: ImpA domain protein; KEGG:
FT                   pau:PA14_43050 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91823"
FT                   /db_xref="InterPro:IPR010657"
FT                   /db_xref="InterPro:IPR017739"
FT                   /db_xref="UniProtKB/TrEMBL:C4L824"
FT                   /inference="protein motif:TFAM:TIGR03362"
FT                   /protein_id="ACQ91823.1"
FT                   /translation="MKLNDTEMVNAIIAPVIGHAFPQGEDVRYDSDFEMVEAELAKLTS
FT                   VYKDHKTDWKLVLQLSYELLTTRSKDLRIVCWYAYAQLKVNGLVRLPAVLFMLQKVIEQ
FT                   YWEQCFPVKIRARLAALIWLFDRIDYNENKYAENLSSDELNLLILSLESCDEILNGKFD
FT                   GEISFLQPKLQLLRDIRRRQNMSKIEPVLANPVSPNHTSVIDVLVPVLSTITEDNDSIR
FT                   IARYIQEQSRLLTIWFLSKDLADPRAYLLTRSSAWLQVVSAPLADAQGLTKLKPLTANK
FT                   LQEYQQKLSAKEFAVLIPELEVSLSKAPFWLDGHHWCAQALDGLGHHQMANHLRDYLCS
FT                   FLSKHPSLLELSFDDGSPFASETTKLWLSTASSEQMTNCAVFNNSADEQQPWLMALAMA
FT                   QENINHDISCLKQEIRSLQTLANTATSGRDKTMWLLALAKLCQQYQRHDLAVFILEDIH
FT                   QYIYQFRLNQWEPLLEKNVLQQLLFSLEKVNAKQHQEKIKEIKTNLYRMDISIAF"
FT   gene            213691..214185
FT                   /locus_tag="Tola_0194"
FT   CDS_pept        213691..214185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0194"
FT                   /product="type VI secretion protein, VC_A0107 family"
FT                   /note="TIGRFAM: type VI secretion protein, VC_A0107 family;
FT                   PFAM: conserved hypothetical protein; KEGG: pmy:Pmen_0090
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91824"
FT                   /db_xref="InterPro:IPR008312"
FT                   /db_xref="UniProtKB/TrEMBL:C4L825"
FT                   /inference="protein motif:TFAM:TIGR03358"
FT                   /protein_id="ACQ91824.1"
FT                   /translation="MSGKEGSVAPKERINVTFKPSTGEGMEELELPLKLMMIGDYTLTK
FT                   DDRKLEDRKAININKNNFNEVLENQNIGLDLQVPNRLSNHDVNEEIALSLRFKTLKDFD
FT                   PANLVQQVPEMKALMELRDALVALKGPLGNVPSFRKAIEEVLTNQDAREKVLAELGMVE
FT                   K"
FT   gene            214204..215679
FT                   /locus_tag="Tola_0195"
FT   CDS_pept        214204..215679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0195"
FT                   /product="type VI secretion protein, EvpB/VC_A0108 family"
FT                   /note="TIGRFAM: type VI secretion protein, EvpB/VC_A0108
FT                   family; PFAM: protein of unknown function DUF877; KEGG:
FT                   pmy:Pmen_0091 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91825"
FT                   /db_xref="InterPro:IPR010269"
FT                   /db_xref="UniProtKB/TrEMBL:C4L826"
FT                   /inference="protein motif:TFAM:TIGR03355"
FT                   /protein_id="ACQ91825.1"
FT                   /translation="MKQRLGEQVTATLEPVNILDRIIAETKLTPQDEAYDIAKRGVSAF
FT                   IEELLKSKSSAEPVKKALVDKMIAAIDEKLSRQVDEILHNTKFQQMESAWCGLKMVVDR
FT                   TDFDQNIKLEILNVSKEDLLDDFEDASDITHSGLYKHIYTSEYGQFGGQPVGAIIANYA
FT                   FGPSAPDVKILQYASSVAAMSHAPFISAAGPKFFGLESYEGLPNIKDLNDHFDGPQYTK
FT                   WQSFRETEDSRYVGLTLPRFLLRQPYSPEDNPVKTFVYQEDVSATHEHYLWGNSAYAFA
FT                   TRLTESFAKYRWCPNIIGPRSGGAVNDLPLHHFESMGEIETKIPTEVLVSDRREYQLAE
FT                   QGFISLTMRKGSDNAAFFSANSAQKPKFFGNSEEGKKAELNYKLGTQLPYMFVICRLAH
FT                   YIKVLQREQIGSWKERTQLETELNKWLRQYIADQENPPAEVRSRRPLRAAQITVEDVDG
FT                   EPGWYRVGIAVRPHFKFMGADFTLSLVGKLDKE"
FT   gene            215682..216095
FT                   /locus_tag="Tola_0196"
FT   CDS_pept        215682..216095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0196"
FT                   /product="type VI secretion system lysozyme-related
FT                   protein"
FT                   /note="TIGRFAM: type VI secretion system lysozyme-related
FT                   protein; PFAM: GPW/gp25 family protein; KEGG: pen:PSEEN0525
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91826"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR017737"
FT                   /db_xref="UniProtKB/TrEMBL:C4L827"
FT                   /inference="protein motif:TFAM:TIGR03357"
FT                   /protein_id="ACQ91826.1"
FT                   /translation="MGYGSLFERLNGETVGRNSQLTEESLAASILNHLNKLLQTRQGTV
FT                   LCLPDYGLPDLNDGNASIYDSINRIRRHVGWIISRYEPRLSGIRVIYVPDAGSLLALRF
FT                   RITGTMQKDGLVAPLTVGVDVYSGSELRLQRVV"
FT   gene            216085..217842
FT                   /locus_tag="Tola_0197"
FT   CDS_pept        216085..217842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0197"
FT                   /product="type VI secretion protein, VC_A0110 family"
FT                   /note="TIGRFAM: type VI secretion protein, VC_A0110 family;
FT                   PFAM: protein of unknown function DUF879; KEGG:
FT                   pmy:Pmen_0095 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91827"
FT                   /db_xref="InterPro:IPR010272"
FT                   /db_xref="UniProtKB/TrEMBL:C4L828"
FT                   /inference="protein motif:TFAM:TIGR03359"
FT                   /protein_id="ACQ91827.1"
FT                   /translation="MSFNQYFQSELLALKELGQDFSRKNPALAPFLSQDGRDPDVERLF
FT                   EGFAFISGRLRQKLDDELPELSHSLLQLLWPNYLRPVPSFGMLEFKPVHQANQIPVVPK
FT                   GACMSSTAGKSANGQFQTCFDTALQPLQIEGVSFYPQGDAGVIQLELTPIADVSIADLF
FT                   LSSLRLHFAGERAVTTSLYFSLLQLTQRVLLLLKDEQGQVLEQLTLEHSQIRPVGFSKD
FT                   ERLLDYPLNCFDGYVLLQEYFSFPQKFLFVEVGGLSMLQFCKQQAQARSIELQFELSRT
FT                   PMMHFQPKKENVHLYCSPVANVFNTHAIPIRYDQRQTEYKVIPADIGLDTSSIISINTV
FT                   TGWLPGNIGMREFNQFESFRNHDCDDGNAYFRARYKPGIGNHGTETWLSFNNTQAGEQM
FT                   AETISVDLTCCDHSLAHHINVGDITVAGDGMPQFASFRNITPLSATYPPPMSGDILWRI
FT                   ISNMSLNYQSLADVQALRVVLETYDFPGFYDDKKARRTRKMLDGIKRITQKAGDRIWQG
FT                   LPVRGMRTEIEMDVSHFLCEGDMFLFAAILNEFFCSFTSLNTFHQLQVKSSDGVIYSWA
FT                   PRMGQQVLS"
FT   gene            217806..218825
FT                   /locus_tag="Tola_0198"
FT   CDS_pept        217806..218825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0198"
FT                   /product="type VI secretion protein, VC_A0111 family"
FT                   /note="TIGRFAM: type VI secretion protein, VC_A0111 family;
FT                   PFAM: protein of unknown function DUF1305; KEGG:
FT                   pag:PLES_36661 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91828"
FT                   /db_xref="InterPro:IPR010732"
FT                   /db_xref="UniProtKB/TrEMBL:C4L829"
FT                   /inference="protein motif:TFAM:TIGR03347"
FT                   /protein_id="ACQ91828.1"
FT                   /translation="MGTAYGSASTELMAGPFAGSVRRYNLFQAIDLSCKWLSQVNQIDE
FT                   EQAYGLIAFAGNSSLAFPKSEIEEVFFYLEQGVVRAKFIINSINLFGAGSPLPAHYYEP
FT                   IAYDDEQGRVVRDFIDLFNQRLQALIYPIWKKYRYYMQFEPAAKDAFSERMFALIGLGY
FT                   QELRRSSHIEWPRLLPYLGLLSIKVQSAAVLESVLRYYFNHKALFIEQCVVRRVTIPAE
FT                   QWNQLGLVNHRLGQSLVLGESILDRHTTFRIHIRELDWDTFHFFLPIGEGYAVLRELVG
FT                   FILREPLEYDIRLSMPDRSSQPLMLSGNNKCRLGWTTWFGLEADEGTITVAGNINDNN"
FT   gene            218812..221421
FT                   /locus_tag="Tola_0199"
FT   CDS_pept        218812..221421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0199"
FT                   /product="type VI secretion ATPase, ClpV1 family"
FT                   /note="KEGG: pau:PA14_42980 putative ClpA/B-type protease;
FT                   TIGRFAM: type VI secretion ATPase, ClpV1 family; PFAM:
FT                   ATPase AAA-2 domain protein; AAA ATPase central domain
FT                   protein; Clp domain protein; ATPase associated with various
FT                   cellular activities AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91829"
FT                   /db_xref="GOA:C4L830"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR017729"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:C4L830"
FT                   /inference="protein motif:TFAM:TIGR03345"
FT                   /protein_id="ACQ91829.1"
FT                   /translation="MITIKLDELISALAPAEKQALEQAANYCVARAGSEILVEDYLLAL
FT                   LDGSDSFLNKVLLQFSLSADTLRTILLESVGYQKTESRNPVFSTLLVNWLEEAFLITKL
FT                   QLQQSSIACLALLLAIQDRPEKYARTRYGQFFSDIPREKLMALMDGLQAEVLSAMSVSG
FT                   AGSALQQFTKSYTQLARDGKLDPVLCRDEEIRQIVDILSRRRKNNPILVGEAGVGKTAV
FT                   VEGLAQHVIAGLVPPALTGIELLELDMGLLQAGASVKGEFERRLKAVIDEVNASPKPIV
FT                   LFIDEAHTLIGAGGQAGGGDAANLLKPALARGTLRTLAATTWSEYKKYFEKDPALARRF
FT                   QPVQVLEPTITQATTILRGLVSRYEVAHDVYLRDDAVVTAAELSARYLSGRQLPDKAID
FT                   LLDTACARVKNSQHATPIRLQAIATSLAEKQRLQTALLRDQQHGLPVEPGQLAALERQI
FT                   PQLEQEHAELSAHWQEQKTLVAQLVASRNPEVSSLLSAADNQSEITAELVDVDVEAPET
FT                   VLAALAELQQSQGILIHHEVTPQVVAEVISSWTAIPVENLIEAPSARVVEFADRLRARI
FT                   RGQAHAVSLIERAVKATAAGLGNPLAPTGVFLLAGPSGVGKTETAVAVAELLYGGERFL
FT                   TTINMSEFQEKHSLSRLIGSPPGYVGYGEGGILTEAVRQRPYSVILLDEVEKADPDILN
FT                   LFYQIFDKGIANDGEGRVINFRNTLIFMTSNLASAEISSLAAGETPVMTDSITETIRPV
FT                   LAKHFKPALLARMNIIPYLPIANDVMHELVLLRLQKLSQRIASRGIALTFDAAVVTAIA
FT                   ESCTRTDTGARNIDFLVNNYLLPAISDRILKALTQQENIRGIRVVQDEYGNFELIIG"
FT   gene            221430..222434
FT                   /locus_tag="Tola_0200"
FT   CDS_pept        221430..222434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0200"
FT                   /product="sigma54 specific transcriptional regulator, Fis
FT                   family"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; ATPase associated with
FT                   various cellular activities AAA_5; SMART: AAA ATPase; KEGG:
FT                   pmy:Pmen_0098 fis family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91830"
FT                   /db_xref="GOA:C4L831"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4L831"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ACQ91830.1"
FT                   /translation="MTITNNKAAQRQEPDNPYALIGSSQLMKQVYRLISKVLHSEANIL
FT                   LTGETGTGKELVARAIHEYGHRRTQPFVVQNCASLPDGLLESELFGYKKGAFTGADRNH
FT                   LGMFDAAHNGILFLDEIGDLPLILQAKLLRVLQEQEIRPLGDTQYHKINVRVIAATHRN
FT                   LEEMVALGEFRSDLYYRLAHFPIELPPLREREGDIKKLAYSFLREIAMRERRGEMRLSA
FT                   AAEKALQNYDFPGNVRELKSMIERAILLADDTDTIECHHFPNIQGVISPESSPVHGGML
FT                   KELVDHYERQVLIESLKKHHGNQKNTAIALGVARRTLLYKLSKHNINSRNWRA"
FT   gene            222434..222571
FT                   /locus_tag="Tola_0201"
FT   CDS_pept        222434..222571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0201"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91831"
FT                   /db_xref="UniProtKB/TrEMBL:C4L832"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACQ91831.1"
FT                   /translation="MRLVISFCLVCLLVTACSKREGYRYLGDTAPNQAITQQNQQDEQE
FT                   "
FT   sig_peptide     222434..222493
FT                   /locus_tag="Tola_0201"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.657) with cleavage site probability 0.277 at
FT                   residue 20"
FT   gene            222575..223870
FT                   /locus_tag="Tola_0202"
FT   CDS_pept        222575..223870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0202"
FT                   /product="FHA domain containing protein"
FT                   /note="TIGRFAM: type VI secretion system FHA domain
FT                   protein; PFAM: Forkhead-associated protein; KEGG:
FT                   pst:PSPTO_5422 FHA domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91832"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR017735"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8G2"
FT                   /inference="protein motif:TFAM:TIGR03354"
FT                   /protein_id="ACQ91832.1"
FT                   /translation="MPLILDLVNAEGQSSAQKSSVTFRNAGGTIGRADSATWMLADRSR
FT                   HISGVHAEISYEEGVYYLTDRSTNGIYDVAKNARLQKNEDYPIAHGDRFRMGSFVFKAR
FT                   VLQDADHFEHQIMGEPSSVSALIPDDEFLDTDPLAMLNAPEIPSEDFELGEFSVRRDDN
FT                   FALNESFDDLDEPFLSPTLASVPLAKEEQAMLAALDISNPIPVRPVPLKPEKTGSPVAG
FT                   SPASAHAPDSAQRVLQVLGSAMDFDFGKLTQDELDSVLQNLGVLTKHAVQGLQQVLRTR
FT                   ADIKNKLRLGSTMVQESGNNPLKLPGNYTQTLNCMLLGQIGYLSGPQAVRQALKDIQAH
FT                   QVSSFAASRTILDSVFEQFSPTQLVYRFETAGKPGKWGSKDAYYWQQYQLHHQKMSGDQ
FT                   EWRQSQFIKDYARVYEEQAQYINAAWSELDAR"
FT   gene            223876..224427
FT                   /locus_tag="Tola_0203"
FT   CDS_pept        223876..224427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0203"
FT                   /product="type VI secretion lipoprotein, VC_A0113 family"
FT                   /note="TIGRFAM: type VI secretion lipoprotein, VC_A0113
FT                   family; KEGG: vsa:VSAL_I1116 putative type VI secretion
FT                   protein VasD"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91833"
FT                   /db_xref="InterPro:IPR017734"
FT                   /db_xref="InterPro:IPR038706"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8G3"
FT                   /inference="protein motif:TFAM:TIGR03352"
FT                   /protein_id="ACQ91833.1"
FT                   /translation="MKNKFFMAACGVFLSACSSTPDPTLLDLTMTADADLNPDLTSRPS
FT                   PMIVKLVELKSHTAFGNADYFALAGNTKNTLGPDYVAEEVLPVRPGESKTLKLRLHPGS
FT                   RFIGVIAEYRALDKAVWRYVIQPEKEDFSAIRLALTRDAIRPLTPAQYEDKQGSATALN
FT                   VSQIEQKTTGVASNSAVNLQ"
FT   sig_peptide     223876..223932
FT                   /locus_tag="Tola_0203"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.705 at
FT                   residue 19"
FT   gene            224501..225844
FT                   /locus_tag="Tola_0204"
FT   CDS_pept        224501..225844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0204"
FT                   /product="type VI secretion protein, VC_A0114 family"
FT                   /note="TIGRFAM: type VI secretion protein, VC_A0114 family;
FT                   PFAM: protein of unknown function DUF876; KEGG:
FT                   pag:PLES_36601 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91834"
FT                   /db_xref="InterPro:IPR010263"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8G4"
FT                   /inference="protein motif:TFAM:TIGR03353"
FT                   /protein_id="ACQ91834.1"
FT                   /translation="MERIVWREGMLLRPQHLQQQDHYYQHQFRELLQMTSPCNWGFFEA
FT                   EIDKQYLMMGKVVVSRAAGILPDGALFRIGENDHPAVEVKKDLYDAVVYLALPLVTGNA
FT                   VENRLAEEHQVVTPFVSFEKLAYDTNYGERNSCAVLCCRHDFRLLVEPAGGNNELPDEA
FT                   SWIKMPLCRISDVSADGFVTLDEHFQPSFLHFGECAPYQGYLRELVNLLAHRGDTLAGR
FT                   IRNTGRFGTSEVGDFLMLALINRNETRLRHLMQFRQIHPERVFMEMVSLHSELASFNGD
FT                   SRRPLNELSYIHTAQYACFHRVMNELRLHLSQVIEQHAVELPLQSRKYGILVSPLQDRT
FT                   LLDNSQFVLTAQADCEQEQLRNRLPAQMKVGPVEQIRQMVNLHLPGINLRPLAAAPRQL
FT                   PFHARHIYFSLELDAAMRAQLESSGGFALHVAGEFPELQLSLWAIRNN"
FT   gene            225846..226712
FT                   /locus_tag="Tola_0205"
FT   CDS_pept        225846..226712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0205"
FT                   /product="type IV / VI secretion system protein, DotU
FT                   family"
FT                   /note="TIGRFAM: type IV / VI secretion system protein, DotU
FT                   family; KEGG: pau:PA14_42910 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91835"
FT                   /db_xref="GOA:C4L8G5"
FT                   /db_xref="InterPro:IPR017732"
FT                   /db_xref="InterPro:IPR038522"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8G5"
FT                   /inference="protein motif:TFAM:TIGR03349"
FT                   /protein_id="ACQ91835.1"
FT                   /translation="MAMANSEHTVFLGHRETDDEEIIVPLPKTKSNAAVRYQQLDDRMI
FT                   YAARLRDEKMLNVGTNPLLAAASPLFQAIADVSSEGYAAPAGLKEELVKRIKDFEFMAL
FT                   SQGCDNTEIIASRYVLCTALDEAITTKPWSTRLEWTKNSLLIIFHNEANGGEKLFQLLD
FT                   KLSRNPTRHINVLELIYVFLSLGYEGKYRVLQRGLSELDAIRNSLYRQIRMIRGEQQKD
FT                   LAINWQPVVSGRQKLPVYIPVWLIVVMALCCLGLVYAGFDYVLEQQTHVITNMYQDAGQ
FT                   KQGHNAQ"
FT   gene            226709..230230
FT                   /locus_tag="Tola_0206"
FT   CDS_pept        226709..230230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0206"
FT                   /product="type VI secretion protein IcmF"
FT                   /note="TIGRFAM: type VI secretion protein IcmF; PFAM: ImcF
FT                   domain protein; protein of unknown function DUF1215; KEGG:
FT                   vfm:VFMJ11_1075 type VI secretion protein IcmF"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91836"
FT                   /db_xref="GOA:C4L8G6"
FT                   /db_xref="InterPro:IPR009612"
FT                   /db_xref="InterPro:IPR010623"
FT                   /db_xref="InterPro:IPR017731"
FT                   /db_xref="InterPro:IPR025743"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8G6"
FT                   /inference="protein motif:TFAM:TIGR03348"
FT                   /protein_id="ACQ91836.1"
FT                   /translation="MKNLFRRLIHTLKQTWCWTLLLTFVGGALVFFIGPLIAIAGRTIL
FT                   AALETRIVVMILLLAFWLVALLVAQPLRKRRRRRMLNAEQLKTELENDEQIDDELHILK
FT                   ERLNNAIHVIKHASFYGKRRASRYELPWYLLMGDQNSGKTALLENSGVDFPLNKTDERM
FT                   TRDIGHTRYCDWYFANQAVMIDAGGRYMVQEENSVAERVWPQFLQMLYQKRRRRPLNGI
FT                   VFTLDVGQLLNQDEGALEQYARTVRGRMQQIQSQLSSDIPVYLVLSKGDYLEGFNAFFE
FT                   HLTKEEREQIVGVTFKENSDGTQVDVLRTEFEELIRRINDMVLSRIHHERDVKRRGDII
FT                   RFPLQFAAIVEPLALFVEIAFGRNRYHLPTRLRGIYLTSAPHIDVNQPLNETTVSIGRN
FT                   IGLQRDLLPFTSPNRGFFIRRVLEDIVFNEGDLATIDTRYDRGMRWTNRFACLCAFVVV
FT                   LGIGSTWMRVFHDNSSRQQILRDLHMKVEHEQQKIPPVSDTPAVLPVLSTLRQATEIYP
FT                   QSNRADWINKLSLHQGNRINPVVDKAYEQQLRQLMLPKIKLLLEEQLRAGTDDRDYLLK
FT                   ALRAYLMLHDKPHLDNNYLRQWISLSWADLYSGQATLQKSLLDHFDKLLSIGFEPLDID
FT                   YRLVEDTQHLLKQESPARLVYRMIKEDPLAVTLPAVHFDDVQGLQYHSFTGGDYGIPGL
FT                   YTQRGYQDVFLRKGLALIKDIMRDNWVLGTSDDMSEREFQKIYADVENLYFQDYISYWN
FT                   EAIGQLQLKAMSDITDASNTLNNLNNNQPVQRVLALIRDNTLFKLSESIADEAENAVLK
FT                   KTGKGKLAKALVAQAGSALEEAQNKGPKQALALKFAPFHQLVQENGTPNPALQDAFTAL
FT                   NAIQSMFTALAHAPDQDAAAYQLASNRMSGQPDELTRIRIAADRLPEPIRTWFIDIGDQ
FT                   TWRMTLDKAADYVQMQYRTDVLTVYDNTIKGRYPFADSDKDVTLGDFNEFFKKDGVLDQ
FT                   FVSGPLKPFFLVRGGELLSRSIDGQSIRMSRSSLQQFQRAAQIQKAFFTEAGGQAGMNF
FT                   KVQPLELDPGALKSEFAYSGQSLIYQHGPIVPIDLRWPVAQGNGTANISMQDLNGRETL
FT                   LTKQSGAWSLFRLLDHCVVRTHDGEDQLVVIIDNQGVQAQYLFSGDHSPNPLKRTLLTG
FT                   FALSDRL"
FT   sig_peptide     226709..226831
FT                   /locus_tag="Tola_0206"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.623 at
FT                   residue 41"
FT   gene            230238..230972
FT                   /locus_tag="Tola_0207"
FT   CDS_pept        230238..230972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0207"
FT                   /product="protein serine/threonine phosphatase"
FT                   /EC_number="3.1.3.16"
FT                   /note="KEGG: pfo:Pfl01_5576 protein serine/threonine
FT                   phosphatase; PFAM: Protein phosphatase 2C-like; Stage II
FT                   sporulation E family protein; SMART: protein phosphatase 2C
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91837"
FT                   /db_xref="GOA:C4L8G7"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8G7"
FT                   /inference="protein motif:PRIAM:3.1.3.16"
FT                   /protein_id="ACQ91837.1"
FT                   /translation="MLRRSSGKCWSSAAATSAGNVRTDNEDTYLIHAENGIWAVADGMG
FT                   GHQLGGLASQLVAESLLDIPAGGDLDRRLEHVATALQWVNFHLSCERTLVDPQQIMGST
FT                   VMTLVAQSGRAACIWAGDCRCYLLRCGVLFQISEDHSLVQQWVDAKRLTAEEAIQHPHS
FT                   NIVTRAIGVSRELVLESVEFELYSGDMLLLCTDGLYRGLSAGIIIRCLSFAEPEKAVQA
FT                   LMQHALAGAAKDNVTAVVVRNN"
FT   sig_peptide     230238..230309
FT                   /locus_tag="Tola_0207"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.880) with cleavage site probability 0.862 at
FT                   residue 24"
FT   gene            231013..231915
FT                   /locus_tag="Tola_0208"
FT   CDS_pept        231013..231915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0208"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; protein of unknown function RIO1;
FT                   SMART: serine/threonine protein kinase; tyrosine protein
FT                   kinase; KEGG: vfm:VFMJ11_1073 serine/threonine protein
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91838"
FT                   /db_xref="GOA:C4L8G8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8G8"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ACQ91838.1"
FT                   /translation="MNIALLSEVTTDVTTPQLSAGYSMLAGRYKLGNILGVGGMGVVYR
FT                   GVDTMLQTFGAASHFIAVKMTSTALADHVHADKLLFTEYELGSCLKHPNLVAIRHFDVC
FT                   RQQQKAFLVMDWIEGLQLEELLYRQRIPAVVALKLARQLVNGVRYCHEQGVVHGDIKPT
FT                   NIIISPDNHLTLFDFGISRWLSRPAANHREVIRACSCRYAAPELFDVHIPSIATDVFSV
FT                   CCVIYRLFSGEHPFKDTTDEAAARNDVITPVFHRRHALDKALQQGLMWSHHKRSCNLDW
FT                   LHKVLSGLTENDFKNNWFI"
FT   gene            231934..234045
FT                   /locus_tag="Tola_0209"
FT   CDS_pept        231934..234045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0209"
FT                   /product="type VI secretion system Vgr family protein"
FT                   /note="TIGRFAM: type VI secretion system Vgr family
FT                   protein; Rhs element Vgr protein; PFAM: Rhs element Vgr
FT                   protein; KEGG: pmy:Pmen_0820 rhs element Vgr protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91839"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8G9"
FT                   /inference="protein motif:TFAM:TIGR03361"
FT                   /protein_id="ACQ91839.1"
FT                   /translation="MFVSDSPDDALSSLGSSVRGLFSANESRFFLTLSGHDEDVQVLRF
FT                   TAQESLNCPWELDITLVSEAENISPEKMVGSAATLTLSGCAGRSYYHGQVWQFRRQTQG
FT                   KRLTQYQLVMRPSLSWLGLGRNQRIFQQKSVPDIIRLLLQEQHVASDQVQWKLSGTYTA
FT                   RDYCVQYGESDLQFITRLLGEEGIHYHFAHDEGGSKLIFADHPSGWSTGLAAVPYKPGT
FT                   GQAADEDTLQSFQVRHAVSVNMISRRYFDLHKPLQLTDAEQKTSPAAGSPSLKRNDSAW
FT                   RDHLNHYDYRSAEQQSISSAQQIAERHLESLQRTRITAQGRGNLSQLRTGWLLPIRGHG
FT                   RAEFNSQWLLTEVSLSGEQPQVLEEFSGGQSSLSCQFSAVPWDTPWRPDFAPEKPLLCG
FT                   IQTACVTGPAGEEIHTDELGRIKVQFHWDREGKEDERTSCWIRVMHDWAGNGYGVVRLP
FT                   RIGQEVQVSFEDGNPDKPLITGCLHNGEQQTAWELPVHMTRSGIRTCSSPGGGGSNELR
FT                   FEDKKGKEELRWQAEKDWDAKILSCSHTQINGAHESAIGGNDYREIEGEQHITLEADTQ
FT                   KEVGLNQHCTIHGSQEQHIEQKCLIQAGQNVVWQSKNQAIYHAGTELTLQAGGSFIKLD
FT                   PCGITLSGPMVTMNQGGSALSAGSESAALPHKPAGAHSAGIGKVPQAKAPEKVIKVAPE
FT                   KDYRIVYSD"
FT   gene            234171..235781
FT                   /locus_tag="Tola_0210"
FT   CDS_pept        234171..235781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0210"
FT                   /product="glutamate/cysteine ligase"
FT                   /EC_number="6.3.2.2"
FT                   /note="KEGG: asa:ASA_0717 glutamate-cysteine ligase;
FT                   TIGRFAM: glutamate/cysteine ligase; PFAM:
FT                   glutamate--cysteine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91840"
FT                   /db_xref="GOA:C4L8H0"
FT                   /db_xref="InterPro:IPR006334"
FT                   /db_xref="InterPro:IPR007370"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8H0"
FT                   /inference="protein motif:TFAM:TIGR01434"
FT                   /protein_id="ACQ91840.1"
FT                   /translation="MSLSPSLSEIIEQLSTPERVFAVRGIRRGIERESLRITPEGRLSP
FT                   LDHPRQLGAALTNANITTDYSESLMEFITPVSDSLDVLLAQLGDIHRFTQQNIGDERLW
FT                   PLSMPCFIGGEESIRLAQYGRSNTGRMKTLYRQGLHHRYGSMMQVIAGVHFNFSMPDSF
FT                   WNEWLSLQQPECCQCKLISDSYMGLIRNVYRFGWLIPYLFGASPALCSSFLQGRDTGLP
FT                   FERVGKGTLYLPYATSLRLSDLGYTNKSQASLNISHNNLPDYLTSVRRALDTKDEAFAA
FT                   MGIKVGDEYRQLNDHVLQLENELYAPIRPKRTPRSGERAVVALERRGIDYIELRTLDIN
FT                   PFTPFGVELQQLRFLDLFLVWCLLRPSPVLDAAEIERNRHNMSHVALEGRRPGLQLMTA
FT                   EGELPLRVWGEQLFDELQLVAQLLDRANGRIHYQLALQAQRDKLIDPDKTLSAQVLTHL
FT                   LQHDLDNAEFGRQQAELFHQQLQHAPLQYWEANYFTDEAQASLLKQAELEADDHQSFDD
FT                   FLRQYLQLPQAGYAPCGVE"
FT   gene            complement(235816..236493)
FT                   /locus_tag="Tola_0211"
FT   CDS_pept        complement(235816..236493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0211"
FT                   /product="Glutathione S-transferase domain protein"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   bid:Bind_2356 glutathione S-transferase domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91841"
FT                   /db_xref="GOA:C4L8H1"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8H1"
FT                   /inference="protein motif:PFAM:PF00043"
FT                   /protein_id="ACQ91841.1"
FT                   /translation="MYTLFYAPTPNGKKVTLMLEALNVPYQVIPINIRKGDQFLPSFLA
FT                   ISPNNRIPALIDHDTGIEIFESGAILTYLAEKHGQFLPANGSDRYAVLQWLHWQIGGLG
FT                   PMAGQNHHFNHYAAEIVPYGIKRYTEETARLYGVLNKQLANKTYVASDEYSIADMAIYP
FT                   WITLYEHQKQDIWQFPHIARYLETMAARDDVQRGMHKYADFDWETSLTEAQLRELLEQH
FT                   LQG"
FT   gene            236831..238168
FT                   /locus_tag="Tola_0212"
FT   CDS_pept        236831..238168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0212"
FT                   /product="Citrate carrier protein"
FT                   /note="PFAM: Citrate carrier protein; KEGG:
FT                   bcb:BCB4264_A0616 citrate cation symporter family"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91842"
FT                   /db_xref="GOA:C4L8H2"
FT                   /db_xref="InterPro:IPR004679"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8H2"
FT                   /inference="protein motif:PFAM:PF03390"
FT                   /protein_id="ACQ91842.1"
FT                   /translation="MSETNPSSVLEGSGQIREPGVFGKLMDIKVGVISLPVYLVLSFIV
FT                   LMAAKTGNLPNDLIGGFAVIMVLGLILSELGMKLPILKNIGGPAILALMVPSFLVYWQV
FT                   LPSGVLDSVTTLMKKANFLYLYISILVCGSMLGMHRQTLVNGLARIFIPMIIGTVVAIA
FT                   TGLLVGVALGYSVHHTIFYIIVPIICGGVGEGILPLSIAYSGILGPEAGTFVAQMIPAA
FT                   VIGNIVAIIAAGLLKRIGDRNPAYSGDGVLVKSSENLANMPSAADKPIDFSIMGAGLLM
FT                   ACSFFIVGTVLAHFIGIPGPIIMILAAASAKALKLIPEKLETGAFQLYKFIAGNLTWPL
FT                   MVGLGMLYVPLKDVAAIISLPYVLTCIAIVVSMIISGFYVGMKINMYPVEAAIVTGCRG
FT                   GLGGTGDVAILSAANRMSLMPFAQISTRIGGAATVIGATILLQMWH"
FT   gene            238233..239666
FT                   /locus_tag="Tola_0213"
FT   CDS_pept        238233..239666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0213"
FT                   /product="Malate dehydrogenase
FT                   (oxaloacetate-decarboxylating)"
FT                   /EC_number="1.1.1.38"
FT                   /note="PFAM: malic protein NAD-binding; malic protein
FT                   domain protein; KEGG: sat:SYN_00517 NAD-dependent malic
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91843"
FT                   /db_xref="GOA:C4L8H3"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8H3"
FT                   /inference="protein motif:PRIAM:1.1.1.38"
FT                   /protein_id="ACQ91843.1"
FT                   /translation="MTINAAKHHNYIVRAIGGEKIKYVNEIIQGIESNKGEIKKIEAAY
FT                   KENKDKSVLVHFHVNDLTSIAQIKDNLENRFGEADIQFMDEITHLHLGGKLETTLKHSI
FT                   DTMADLAKVYTPGVAQVCMEIAHNPERAYDLTVKKNTVAVVSDGTAVLGLGDIGPEAAM
FT                   PVMEGKAALFKQFAGVDAFPICLDTKDTEEIIMIVKALAPTFGGINLEDISAPRCFEIE
FT                   ERLKQELDIPVFHDDQHGTAVTVLAGFLNALKVCEKNIADVKVVLVGIGAAGIAVSKML
FT                   LNAGVKNLIGVDRNGAIHRGEPYSNESWNEYARLTNPDNLQGPLSDVIEGADVFIGLSG
FT                   PGVLKVDYLKTMAKDPIVFAMANPAPEISPEEAAPYVRVMATGRSDYPNQLNNVLCFPG
FT                   IFRGALDCGARQITEEMKLEVAKAIASAVSDEELSETYIIPDIFNKEVVKRVRDAVVET
FT                   AHRTGMARIRNNKLESLTV"
FT   gene            239797..241407
FT                   /locus_tag="Tola_0214"
FT   CDS_pept        239797..241407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0214"
FT                   /product="signal transduction histidine kinase regulating
FT                   citrate/malate metabolism"
FT                   /note="PFAM: ATP-binding region ATPase domain protein; PAS
FT                   fold domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; KEGG: spe:Spro_1959 sensory histidine
FT                   kinase DcuS"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91844"
FT                   /db_xref="GOA:C4L8H4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR016120"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039506"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8H4"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACQ91844.1"
FT                   /translation="MLKQTPPLKLRTTITLLVCSVIALVLFVVHSVYLTQSTEQTRFSL
FT                   EDKAKAVLHTLTAAPFIASALSNGGDKAALQDYIEQVRQQNELLFIVVMDMQGIRHTHP
FT                   DPSLIGKHFIGGDEVKALHGQESISEAKGTLGPSLRIISPLFDARHQQIGAIAVGISTE
FT                   KIQEIIAANRWFAYWAIAFGGLVGSFGAFFLARKIKKIMFGMEPSEIASLLEERNAMLQ
FT                   SIREGIIAVNADEKITLINDEAKRLLRQNGELENLLLTESSKHWPALLHLRQVLATGQA
FT                   RQDEEIEFNGSTLLTNSVPVRVNGKVTGAVVTFRDKTEISQLLQRLSGISHYAEALRVQ
FT                   AHEFMNKLHVILGMVNIRAYDQLENYIMDTANYYHAEVGSLIRQIKDPVIAGFILGKMN
FT                   RGREIGIDVNVTPTSYLPESAESEVTHELVTVLGNLLENAMDALEGSDSAAIVLTFDHD
FT                   DGHLRCTVSDNGQGIEPAVAAHIFEHGFSTKGTRRGIGLFLVRQSLEKLGGTIECQSKP
FT                   GEGTRFIVSLPYASKECGL"
FT   sig_peptide     239797..239892
FT                   /locus_tag="Tola_0214"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.486 at
FT                   residue 32"
FT   gene            241404..242126
FT                   /locus_tag="Tola_0215"
FT   CDS_pept        241404..242126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0215"
FT                   /product="response regulator receiver and unknown domain
FT                   protein"
FT                   /note="PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; KEGG: eca:ECA4398 DNA-binding
FT                   transcriptional activator DcuR"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91845"
FT                   /db_xref="GOA:C4L8H5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR024187"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8H5"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACQ91845.1"
FT                   /translation="MINVLIVDDDPMVAELNRRYLEQVDGFRWLGSVSTIQAAKQKLLE
FT                   SEPPIDLVLLDIYMQKDNGLDLLPVIRQMPNNIDVIMISSASDMPAIKKALRYGVVDYL
FT                   IKPFQFARFQEALSAYREERQMLAQREELNQSELDNLIRRSNSRPASEKLRLPKGLTRL
FT                   TLQAVWEWIKQGHRQGFSTEEMANEIGISRVSCRKYLVYMAEIGVLDTDIFYGSVGRPV
FT                   YLYKLVPAKVEIMDTLLR"
FT   gene            242313..244607
FT                   /locus_tag="Tola_0216"
FT   CDS_pept        242313..244607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0216"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   extracellular sensor"
FT                   /note="KEGG: sdn:Sden_0572 GGDEF domain-containing protein;
FT                   TIGRFAM: diguanylate cyclase; PFAM: EAL domain protein;
FT                   GGDEF domain containing protein; CHASE4 domain protein;
FT                   histidine kinase HAMP region domain protein; SMART: EAL
FT                   domain protein; GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91846"
FT                   /db_xref="GOA:C4L8H6"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR007892"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8H6"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACQ91846.1"
FT                   /translation="MHMTRLHKQIVNRVGLIVIALAFLVTASCIGIISWLYLKTDAEQV
FT                   AAELTKVELLLQNERDGLSRAVNDYAVWDDAYDYVSKPNRKFETDNFTQQSLNVMQLDF
FT                   VAIMAAPGKTLFSSEINPAYSNITATPAIHTPLLWSLLAKLPDWQQRNGEKMQSTYLTA
FT                   ANGRPLLLAVSGIFDSSLEQPHSGLMIFGRYLDGTYLQRLQQLAESQLQISAQMPVQKI
FT                   TAPLYHTEQTASKRLTSWQTPDIWLQVSKDVNWQQRYLMMALFALGLLLVLLFTSWVLQ
FT                   RLLNRLVVERIETFAELASRRTQGERIYWPVEGQNELDLLARTFNELMDEVQAAQKNMH
FT                   DLSITDTLTALGNRRGMEEQVSKMMKTCQLGTPLSMLLMDLDGFKLINDSLGHAAGDLL
FT                   LQEVAQRMRQVMRRQDKLFRMGGDEFAVLMPHTTAEQGHLLAERLIETLVAPIHFGQHR
FT                   LSVSGSVGVAQWDGETDGLELMRHADLAMYVAKRDGKSCVRLFEKGMSGVASERMTLEQ
FT                   ELRRAIAEQSIEPHFQPVIDTGSGNVVAVEMLARWRRNNESVPPLGFIRLAEDLGLINQ
FT                   LSMQLLEKGLTALRHFRQHYPELKLQINISPLQFADRHLALTMLQTIAAYDLPSTALAV
FT                   ELTEGAMLLYPEQVEQTMRQFVEAGVSLHLDDFGTGYSSLARLRDLPFDTVKLDRSFVV
FT                   MLGEGDTTLSQAVFDMATSMHMDLIAEGVENQTEYEELQAIGYRQMQGYMFARPMPETA
FT                   LIQWLQAHAAA"
FT   sig_peptide     242313..242408
FT                   /locus_tag="Tola_0216"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.705) with cleavage site probability 0.467 at
FT                   residue 32"
FT   gene            complement(244649..245449)
FT                   /locus_tag="Tola_0217"
FT   CDS_pept        complement(244649..245449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0217"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /note="TIGRFAM: phosphomethylpyrimidine kinase; PFAM:
FT                   Phosphomethylpyrimidine kinase type-1; KEGG: kpe:KPK_1619
FT                   phosphomethylpyrimidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91847"
FT                   /db_xref="GOA:C4L8H7"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8H7"
FT                   /inference="protein motif:TFAM:TIGR00097"
FT                   /protein_id="ACQ91847.1"
FT                   /translation="MIPHTLTIAGSDCSGGAGIQADLKTFSALGTYGMSVITALTAQNT
FT                   QGVQAVHAVPAAFVTAQCQAVFSDIRVDAVKIGMLADTAIIAAVAEALREWRPACVVLD
FT                   PVMVSKNGHRLLADSAIDALRRHLLPQASIVTPNLPEAAALLGCDEATTETEMVEQGRN
FT                   LLKAGCQAVLMKGGHLSGSNSPDWLITPQEAIPFTAPRIQTKNTHGTGCTLSSAIAALY
FT                   PRYKNWPETISHAKTWLSGALAQADQLDVGHGIGPVHHFYQWWQ"
FT   gene            complement(245446..246081)
FT                   /locus_tag="Tola_0218"
FT   CDS_pept        complement(245446..246081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0218"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /note="KEGG: sfu:Sfum_3508 thiamine-phosphate
FT                   pyrophosphorylase; TIGRFAM: thiamine-phosphate
FT                   pyrophosphorylase; PFAM: thiamine monophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91848"
FT                   /db_xref="GOA:C4L8H8"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8H8"
FT                   /inference="protein motif:TFAM:TIGR00693"
FT                   /protein_id="ACQ91848.1"
FT                   /translation="MKLDLSLYLVLDPVMCGGFDATIKLTQQVLDAGVTVIQLRAPQWK
FT                   KRDWLRLSQQILPMSREARVPFLINDHIDIALACDADGVHLGQGDLPLAMARQLLGPDK
FT                   ILGLSISKAHHLQGDDCLLADYLGIGPVFPTGTKQDADPAIGLATFRDWMTQIHQPVVA
FT                   IGGIGASETSDIIRAGADGIAVVSAICAVADPALATRTLGQLIHEARP"
FT   gene            complement(246078..246881)
FT                   /locus_tag="Tola_0219"
FT   CDS_pept        complement(246078..246881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0219"
FT                   /product="hydroxyethylthiazole kinase"
FT                   /EC_number="2.7.1.50"
FT                   /note="KEGG: eca:ECA3197 hydroxyethylthiazole kinase;
FT                   TIGRFAM: hydroxyethylthiazole kinase; PFAM:
FT                   hydroxyethylthiazole kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91849"
FT                   /db_xref="GOA:C4L8H9"
FT                   /db_xref="InterPro:IPR000417"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4L8H9"
FT                   /inference="protein motif:TFAM:TIGR00694"
FT                   /protein_id="ACQ91849.1"
FT                   /translation="MPQALPATIVATHLERIRRSVPLTHVITNDVVTGFTANVLLALGA
FT                   APAMITAPEEAGSFAAIASVLSVNVGTLTSAQAATIRIAVQSANQAGTPWVLDPVAAGV
FT                   LPYRTELCRELLQQHPAAIRGNASEIMALAGQAAAGKGVDSANQSDQAIEAAQVLAKSS
FT                   GAIVAVTGEIDYITDGERVVSIKAGDPLMTRVTGTGCALSSVVAAFIAGCEEKDRLDAV
FT                   ASACAVMAIAGQRAAAKAKGPGSFVPAFLDNLYLLDAVTIAEALA"
FT   misc_binding    complement(246930..247022)
FT                   /bound_moiety="thiamin/thiaminpyrophosphate"
FT                   /note="TPP riboswitch (THI element) as predicted by Rfam(RF
FT                   00059), score 62.11"
FT   gene            complement(247076..247534)
FT                   /locus_tag="Tola_0220"
FT   CDS_pept        complement(247076..247534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0220"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aha:AHA_2860 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91850"
FT                   /db_xref="InterPro:IPR021284"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8I0"
FT                   /inference="similar to AA sequence:KEGG:AHA_2860"
FT                   /protein_id="ACQ91850.1"
FT                   /translation="MLLEILGLKFLTSNIREMIMTYPLSPEEFQTTLAQDAEQRYHHFL
FT                   QQAVLHNEVWILKDDEGCVSLSTDDEECIPVWPHPDYAKAWAGNDFAACEPYAVPLKTW
FT                   LDRWVKGMSEDGVAVAVFPLADADGVVEDPATMADDLLRKMAKLNRKK"
FT   gene            247605..248774
FT                   /locus_tag="Tola_0221"
FT   CDS_pept        247605..248774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0221"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: mes:Meso_3115 ROK
FT                   domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91851"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8I1"
FT                   /inference="protein motif:PFAM:PF00480"
FT                   /protein_id="ACQ91851.1"
FT                   /translation="MDINGKNRVVNLLRQHSHSRVELAKKTGLVKSSLTKITQQLLNDG
FT                   IIEEIDVLQPKSRHRSDGRPQTLLQLKPRVNHSICFYVSTENICGNLIDQTNTIIDNYQ
FT                   QIWDLTRPESALSVEFFVDLIKKISIRLCEQNQLSLTEIKIITVATQGKLAQASGTVFY
FT                   SQLFKDKHFNLTAAITAATGIESKIFNIAYCSSHRIQQLYPQHDSFITVLLGYGVGVGI
FT                   VIDKQIILGPQGTAPEISHVTYSEHGPLCYCGARGCAETYLTYHAIIGKINKSDPQNFP
FT                   RDTIAKQLEHINQELSRHNILCEQIIREVGRVLGHVLSQLITIFNIKTVILNGEISVFY
FT                   PLLKEEIDTYLAGHSDYRYGAGSTHILREPDDNVAFQGLIELTNESYLV"
FT   gene            complement(248832..250367)
FT                   /locus_tag="Tola_0222"
FT   CDS_pept        complement(248832..250367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0222"
FT                   /product="protein of unknown function DUF1593"
FT                   /note="PFAM: protein of unknown function DUF1593; KEGG:
FT                   sde:Sde_0565 signal peptide and transmembrane prediction"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91852"
FT                   /db_xref="InterPro:IPR011483"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8I2"
FT                   /inference="protein motif:PFAM:PF07632"
FT                   /protein_id="ACQ91852.1"
FT                   /translation="MAKKQQKKSYKHKYLAGSLILGMMSASIISSSVSAAENIDMYSGH
FT                   PRMFVLTDMGNEPDDQMSMVRLLTYSNEIDLEGLVATTSTWQRSKRETGTIKGIISAYD
FT                   EVRPNLMKHAANWPTKSYLESLVTNGQPGYGMADVGKGKSSPGSQALIAAVDKADERPV
FT                   WVTVWGGANTLAQALYDVKATRSAEQLKQFEAKLRVYSISDQDDAGPWIRKEFPNVSYI
FT                   VKPSSPDGGEYASATWTGIAGDEYYKNGAGADFSKVANEWLDVNIRSKGPLGKHYLKYA
FT                   FIMEGDTPAYLGLTDNGLNSFRSPSWGGWGGRYIYRQPYGESRSIWTQGGDWFPRVTSA
FT                   DTVVGADGKEYTSDQATIWRWRDQFQNDFAARMDWTIKSFDDANHHPVLSVNGNEGKEV
FT                   IYINAKPGDSISLDASASHDPDKNALTYSWFHYKEAGYSGEVGKPGLADITVLSADQSK
FT                   TTVKVNKTCRDVWLPDAKAPCDEGGEAHVILAVTDNGQPALTSYRRVVIKVKN"
FT   sig_peptide     complement(250260..250367)
FT                   /locus_tag="Tola_0222"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.978 at
FT                   residue 36"
FT   gene            251260..252396
FT                   /locus_tag="Tola_0223"
FT   CDS_pept        251260..252396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0223"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   Alcohol dehydrogenase zinc-binding domain protein; KEGG:
FT                   eci:UTI89_C4874 L-idonate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91853"
FT                   /db_xref="GOA:C4L8I3"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8I3"
FT                   /inference="protein motif:PFAM:PF08240"
FT                   /protein_id="ACQ91853.1"
FT                   /translation="MLRNTNFSDSSHKNESNFIVIWHHFLDVSGALKMLKTNSCVVNGK
FT                   KNVSVVSQDVIYEKDGTLVEVTRGGICGSDLHYYHNGKVGNFEVKQPMILGHEVIGIIK
FT                   ETDSNGLKLNQRVAINPSKPCGKCKYCKEHNENQCVNMRFFGSAMYFPHVNGGFTQYKI
FT                   VDSSQCVPFGEKSDERRMAFAEPLAVAIHAAKQAGNVENKNIIVSGVGPIGCLLVSALK
FT                   VLGAKEIVCVDVSEKSLSLAKKMGGTKFINTVNSNLDEYKNEKGFFDIAFEVSGHPDSL
FT                   KNCLSVTRAKGTIVQVGMGGDIPEFPIMQLIAKEIKLVGAFRFNEEFYTSVSWLDSNKI
FT                   NPLPLLSGEFPFQELETALDFASNKSLAAKVQLIFKGA"
FT   gene            252398..253162
FT                   /locus_tag="Tola_0224"
FT   CDS_pept        252398..253162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0224"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   ect:ECIAI39_4739 5-keto-D-gluconate-5-reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91854"
FT                   /db_xref="GOA:C4L8I4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8I4"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACQ91854.1"
FT                   /translation="MKNLFSLSNKKVLITGSAQGIGFLLATGLADQGAEIIVNDVTHEK
FT                   AETAVSKLRDLGYTAYPMAFDVTKKNEVDKAIDKIESDIGAIDVLINNAGIQRRHPFTE
FT                   FPEQEWNDVISVNQTAVFLVSQAVAKKMINRKEGKIINICSMQSELGRDTITPYAASKG
FT                   AVKMLTRGMCVELARYNIQINGIAPGYFKTEMTKALVENEEFTSWLTKRTPAARWGDPE
FT                   ELIGAAVFLSSKASDFVNGHLLFVDGGMLVAV"
FT   sig_peptide     252398..252490
FT                   /locus_tag="Tola_0224"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.879) with cleavage site probability 0.408 at
FT                   residue 31"
FT   gene            253210..254529
FT                   /locus_tag="Tola_0225"
FT   CDS_pept        253210..254529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0225"
FT                   /product="gluconate transporter"
FT                   /note="TIGRFAM: gluconate transporter; PFAM: Gluconate
FT                   transporter; Citrate transporter; KEGG: stm:STM4482
FT                   L-idonate transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91855"
FT                   /db_xref="GOA:C4L8I5"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8I5"
FT                   /inference="protein motif:TFAM:TIGR00791"
FT                   /protein_id="ACQ91855.1"
FT                   /translation="MPLVVIGIGVCLLLLLMIKFKVNGFIALILVAGLVGIGEGMTPLT
FT                   VVKSIQTGIGGTLGGLAMILGFGAMVGRLISDTGAAQRIATTLIETFGEKYVQWALVIT
FT                   GLAVGLAMFYEVGFVLLLPLVFTIVAAAGMPLLYVGIPMVAALSVTHCFLPPHPGPTAI
FT                   ATIFGANLGTTLLYGLIITIPTVIIAGPLFSKFLKNFEKEPPKGLFNPRVFTEEEMPSF
FT                   GISLLVAIIPVVLMGAAAICEMTLPKDNLLRQSLEFVGHPAVALFVAIILAIFFLGMRN
FT                   GKKIDSVMDIISDSIGAISMIMFIIAGGGAFKQVLVDSGVGTYIADIMRGSSLSPLLMC
FT                   WCVAAMLRIALGSATVAAITTAGIVLPLIPLTHADPALMVLATGAGSVIASHVNDPGFW
FT                   LFKGYFNLSVGETIRVWTVMETLISVLGLIGVLSLNSFLH"
FT   gene            254580..255578
FT                   /locus_tag="Tola_0226"
FT   CDS_pept        254580..255578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0226"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; SMART: regulatory
FT                   protein LacI; KEGG: see:SNSL254_A4829 HTH-type
FT                   transcriptional regulator IdnR"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91856"
FT                   /db_xref="GOA:C4L8I6"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8I6"
FT                   /inference="protein motif:PFAM:PF00356"
FT                   /protein_id="ACQ91856.1"
FT                   /translation="MKNHRITLQDIANLADVTKMTVSRYIKSPNLVAPETRKRISEIME
FT                   EINYIPNRAPSMLLNTKSYTIGVLIPSFRNHLFSDLLAGIESVTTPKQYQTLIANYNYS
FT                   PEEEEEKIINLLSYNIDGIILCEKNHSIKAVKYLRSSNIPIVEVMDSEGPCLDMEVGYD
FT                   NKKASFDMTKTMIENKKRKQVVYFGSQDDRRDELRFQGYTLGVREYGLKPYIISPKTIS
FT                   SIEIGEYLCKEAFEKYPGMDGAICTNDDIAVGVLLYCKKNKISVPDEFSIAGFNGLEIG
FT                   RRMIPSIASVVTPRFQVGKTAAEILLNKITNENFNSHSIELGYQIYLGETI"
FT   gene            255595..256122
FT                   /locus_tag="Tola_0227"
FT   CDS_pept        255595..256122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0227"
FT                   /product="carbohydrate kinase, thermoresistant glucokinase
FT                   family"
FT                   /EC_number="2.7.1.12"
FT                   /note="KEGG: msu:MS0957 GntK protein; TIGRFAM: carbohydrate
FT                   kinase, thermoresistant glucokinase family; PFAM: shikimate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91857"
FT                   /db_xref="GOA:C4L8I7"
FT                   /db_xref="InterPro:IPR006001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8I7"
FT                   /inference="protein motif:TFAM:TIGR01313"
FT                   /protein_id="ACQ91857.1"
FT                   /translation="MNDFFKANGIILMGVSSTGKSSVGAALAKVIGAKFIDGDDLHPRN
FT                   NILKMSNKQPLNDDDRSPWLERIRDAAFSLEKKNETGIIVCSALKKKYRDLIREGNEHV
FT                   AFLHLAGDFELVLARMQARKGHFMPVELLKNQFETLESPDASEPDVIHIDIDGNFDEVV
FT                   DRCVTAIHQRGE"
FT   gene            256141..257943
FT                   /locus_tag="Tola_0228"
FT   CDS_pept        256141..257943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0228"
FT                   /product="6-phosphogluconate dehydratase"
FT                   /EC_number="4.2.1.12"
FT                   /note="KEGG: aha:AHA_0288 phosphogluconate dehydratase;
FT                   TIGRFAM: 6-phosphogluconate dehydratase; PFAM:
FT                   dihydroxy-acid and 6-phosphogluconate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91858"
FT                   /db_xref="GOA:C4L8I8"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004786"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8I8"
FT                   /inference="protein motif:TFAM:TIGR01196"
FT                   /protein_id="ACQ91858.1"
FT                   /translation="MKNVIEQVTRRIAERSHETRSRYVARMKAQAENGKTRTHLSCGNL
FT                   AHTVAACSSMQKSTILDFTKVNVGIITAYNDMLSAHEPYDVYPQFIKDALRNVGHSAQV
FT                   AGGVPAMCDGVTQGQEGMDVSLFSREVIAQATAVSLSHNTFDATLLLGICDKIAPGQLM
FT                   GALSFGHLPTAFVPAGPMPTGISNDEKVKVRQKYAAGEVGKDALQKMECGAYHSSGTCT
FT                   FYGTANTNQLVFEAMGLMLPGSAFLPPSVELRAALTEQIVLHITSQADSGTLYRPLWQV
FT                   MDEKSIVNGLVVLLASGGSTNHSMHLVAVAAAAGYILTWDDIDTLSQVVPLLAKMYPNG
FT                   PADINDFQNAGGVPTLMKGLAERGLLNMDATPVFGCMEDYLKTPHLNGGAVVYRPATDS
FT                   KNPEVIALPGTFFSAQGGLKVVDGNLGRGVIKISAVAPEHHFIEAPARVFESQHDVEKA
FT                   YHAGEFTSDVVIVVRFNGPAANGMPELHKLMPVLGNLMKAGLKVALVTDGRLSGASGKV
FT                   PAVIHMSPEAQRGGPLAKIATGDVIRVDAANGKIDVLTDIQARAPAQVDLTREHFGSGR
FT                   ELFSVFRQVVSGAEQGATIFNYLG"
FT   gene            257959..258606
FT                   /locus_tag="Tola_0229"
FT   CDS_pept        257959..258606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0229"
FT                   /product="2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase"
FT                   /note="TIGRFAM: 2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase; PFAM: KDPG and
FT                   KHG aldolase; KEGG: pin:Ping_2930
FT                   2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91859"
FT                   /db_xref="GOA:C4L8I9"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031337"
FT                   /db_xref="InterPro:IPR031338"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8I9"
FT                   /inference="protein motif:TFAM:TIGR01182"
FT                   /protein_id="ACQ91859.1"
FT                   /translation="MSWQVEPAAVFAASPVVPVMVIKRVEDAVPMAKALAEGGITVFEI
FT                   TLRTPAALDAIRAIAAALPETQVGAGTVLTPEQYDAAVEAGAKFIISPGYTRTLMEHAK
FT                   KGPSPLIPGVATPSEIMTALELGYDHLKFFPAEANGGAAALKAIAAPLAQVKFCPTGGV
FT                   SPKNVADYVALGCVATVGGTWMLPADAINTGDWATITELTQKAVELVNSLRR"
FT   gene            complement(258798..259370)
FT                   /locus_tag="Tola_0230"
FT   CDS_pept        complement(258798..259370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0230"
FT                   /product="single-strand binding protein"
FT                   /note="TIGRFAM: single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n; KEGG: slo:Shew_0535 single-strand binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91860"
FT                   /db_xref="GOA:C4L8J0"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8J0"
FT                   /inference="protein motif:TFAM:TIGR00621"
FT                   /protein_id="ACQ91860.1"
FT                   /translation="MARGVNKVIIVGNLGQDPEVRYMPNGNAVANITVATSESWKDQQG
FT                   QMQERTEWHRIVLYRRLAEIAGEYLRKGSKVYLEGRLQTREWQDPQGQKRYTTEIIANE
FT                   MQMLDGRGAGAPQQGGNMGAPAQQPQQGNWGRPSAPAAAAPQGGATPGYAPQQAAPQGS
FT                   YTPAPAPAQQQPTYNEPPMDFDDDIPF"
FT   gene            259566..262400
FT                   /locus_tag="Tola_0231"
FT   CDS_pept        259566..262400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0231"
FT                   /product="excinuclease ABC, A subunit"
FT                   /note="TIGRFAM: excinuclease ABC, A subunit; PFAM: ABC
FT                   transporter related; KEGG: aha:AHA_3955 excinuclease ABC, A
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91861"
FT                   /db_xref="GOA:C4L8J1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8J1"
FT                   /inference="protein motif:TFAM:TIGR00630"
FT                   /protein_id="ACQ91861.1"
FT                   /translation="MDKIEIRGARTHNLKNINLTLPRDKLIVITGLSGSGKSSLAFDTL
FT                   YAEGQRRYVESLSAYARQFLSLMEKPDVDHIEGLSPAISIEQKSTSHNPRSTVGTITEI
FT                   YDYLRLLYARVGEPRCPEHDLPLAAQTISQMVDRVLAEPENRKMMILAPVVRNRKGEHK
FT                   QLLESLAAQGYIRARIDGEVCDLSDPPTLELQKKHTIEVVVDRFKVRPDLQLRLAESFE
FT                   TALHLSGGLVYVADMDDDKAQPLIFSANFACPECGYSLSELEPRLFSFNNPAGACPSCD
FT                   GLGVQQYFDPHKVVTNPELSLTGGAIRGWDKRSFYYFQMLKSVADHYKFDLDEPFDALS
FT                   PQAKKVVLHGSGHTAIEFRYMNDRGDVVVRNHPFEGVLHNMERRYRETESNSVREELAK
FT                   YIANQPCPSCQGSRLRQEARHVYVTGVTLPQVSEMSIGEALNFFRNLQLDGQRAQIAEK
FT                   ILKEIIERLGFLVNVGLNYLSLSRSAETLSGGEAQRIRLASQIGAGLVGVMYVLDEPSI
FT                   GLHQRDNERLLGTLFHLRNLGNTVIVVEHDEDAIRHADYVVDIGPGAGVHGGVIVAQGT
FT                   PAEVMANPDSVTGEYLSGRKKIAIPAERRPTGDKWLKLLGASGNNLKKVDLHIPVGVMT
FT                   CVTGVSGSGKSTLINDTLFRIAHRDLNGATVEKPAPYLDIQGMDYLDKVVDIDQSPIGR
FT                   TPRSNPATYTGLFTPIRELFAATQEARSRGYAPGRFSFNVKGGRCEACQGDGVIKVEMH
FT                   FLPDVYVPCDVCKGKRYNRETLEVTYKGKTIHEVLDMTVEDARAFFDAVPALARKLQTL
FT                   MEVGLSYIRLGQSATTLSGGEAQRVKLAKELSKRDTGQTLYILDEPTTGLHFHDIQQLL
FT                   NVLEKLRDNGNTIVIIEHNLDVIKTADWIVDLGPEGGSGGGMILTEGTPEQVAECAESH
FT                   TARFLKPLLERDRA"
FT   gene            complement(262466..263458)
FT                   /locus_tag="Tola_0232"
FT   CDS_pept        complement(262466..263458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0232"
FT                   /product="D-alanine/D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /note="KEGG: aha:AHA_2404 D-alanyl-alanine synthetase A;
FT                   TIGRFAM: D-alanine/D-alanine ligase; PFAM:
FT                   D-alanine--D-alanine ligase domain protein; ATP-dependent
FT                   carboxylate-amine ligase domain protein ATP-grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91862"
FT                   /db_xref="GOA:C4L8J2"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4L8J2"
FT                   /inference="protein motif:TFAM:TIGR01205"
FT                   /protein_id="ACQ91862.1"
FT                   /translation="MKHLHVLLLCGGGGSEHEISLLSANYLESQLKELAEVSVTRVELF
FT                   PDHWQTNDGRSCHLGMDRQLHFANEAKPVDFVVPCIHGFPGETGDIQSMLELIGLPYLG
FT                   CGSEGSKLCFNKVSTKLWLSALDIPNTPFLFLSDNNEAAHAQAHTAFRNWGAVFVKAAS
FT                   QGSSVGCYKVTDAAKLSEAVNAAFGYSDQVLVEKAVRPRELEVAVYRYNDQLVATRPGE
FT                   IATPSDSFYSYEEKYSSGSNSTTYLEAPGLSDAQISTIREYALKAFTQLGLKDLSRIDF
FT                   FLTEDNEILLNEINTFPGMTPISMFPKLLEHHGDNFKQFLEGIIRSTVK"
FT   gene            263592..264263
FT                   /locus_tag="Tola_0233"
FT   CDS_pept        263592..264263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0233"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: son:SO_A0180 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91863"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8J3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACQ91863.1"
FT                   /translation="MYYSLLAEQERIMWQKAGGLLLVSLLAGCAQEAASPVLQPQGEYR
FT                   LLPLETTRRQVDELLQGKPETVIAVQTKPNEVTPPVLFALAYQLYQQQHYHDAMFWFYT
FT                   AQLRARSDANKSLDPSVQQGVTKLSEQFGTGISAYALSHPAEMERAMVQALRWDKTAQR
FT                   RYNPRWVALHGSEVQTSREYAFLPMERWPQIDQLTHREYARGFAKLMVSLRGPSGFSLS
FT                   D"
FT   sig_peptide     263592..263690
FT                   /locus_tag="Tola_0233"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.697) with cleavage site probability 0.505 at
FT                   residue 33"
FT   gene            complement(264240..265127)
FT                   /locus_tag="Tola_0234"
FT   CDS_pept        complement(264240..265127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0234"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: bbr:BB1892 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91864"
FT                   /db_xref="GOA:C4L8J4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8J4"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACQ91864.1"
FT                   /translation="MNQSDYLTGLLLAILAATGFACKAIFVKLAYRYGVDGTTLVTIRL
FT                   LLVLPLIATMRLLRKSPATALSWHDRGMIILLGLLGYYLSSLLDFLGLETVSASIERLI
FT                   LCLYPTLTVLLSAWLMKTSISRRMWSAMALTYCGMVLVLTPDFAGARLDLLGIFFVVAS
FT                   TVTYAFYLTWSPAVIRRIGAMRFAELGLTISALAMFVHYLLTRPVETLLHQPLPVWGYG
FT                   MIMALVATVLPIYALAAAMARIGAGKTALIGSVGPILTIFLSIGILDEHLSPVQWAGVC
FT                   VVLTGIWLVGQRKT"
FT   sig_peptide     complement(265056..265127)
FT                   /locus_tag="Tola_0234"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.974) with cleavage site probability 0.492 at
FT                   residue 24"
FT   gene            complement(265131..265850)
FT                   /locus_tag="Tola_0235"
FT   CDS_pept        complement(265131..265850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0235"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 1; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: aha:AHA_0477 HAD-superfamily hydrolase,
FT                   subfamily IA, variant 1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91865"
FT                   /db_xref="GOA:C4L8J5"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8J5"
FT                   /inference="protein motif:TFAM:TIGR01549"
FT                   /protein_id="ACQ91865.1"
FT                   /translation="MQFFRRLQDIRAISFDLDDTLYDNRPVIENAEQWMVEHMRDQYLA
FT                   SAMYDRAWWLQLKHELQKADPSLHDDVSRCRLMMLEVGLQRGGMPIEEAQAEAKRCFAE
FT                   FLEVRSRVTVPDASIEVLKQLSRHFPLVVITNGNVLLERIGLDGHFKHVLKAGNGRKMK
FT                   PAPDMFRMMAAQLKLKPQQILHVGDDVTTDVFGAIRNGYQAAWVNAQGQDWRTLHTLPH
FT                   LMLQDIRDLLKLLPEAK"
FT   gene            complement(265917..266864)
FT                   /locus_tag="Tola_0236"
FT   CDS_pept        complement(265917..266864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0236"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: cti:RALTA_B1246 putative transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91866"
FT                   /db_xref="GOA:C4L8J6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8J6"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACQ91866.1"
FT                   /translation="MNVRFLETFLWVARLNSFRLTAEKLFTTQASISNRIAVLEEELDV
FT                   KLFVRDSKGVRLTPDGEKVREYAEQIVGKAHALRMSLSQANGYEGKVRIGAIDSVVHTW
FT                   FIELISWITEHYPHLEVEISVDGARGLANQLQKGYLDIAFQADQIRLESIRNLELARYP
FT                   MRWIVAANSPYNRQFTSLQELAKERLITFVANSRPHQDILSLLHVNGITSPRVSCVNSF
FT                   AAMIRLIEDGFGIGVIPPALVREQLANGSLIILNIDNTQPGSLSMLTQAASWRTGPGLD
FT                   HCEAIVRQAQHIVQRFCKIIGPERGIAANNSAPT"
FT   gene            267112..268413
FT                   /locus_tag="Tola_0237"
FT   CDS_pept        267112..268413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0237"
FT                   /product="drug resistance transporter, Bcr/CflA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, Bcr/CflA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1;
FT                   General substrate transporter; KEGG: ppr:PBPRA3006
FT                   multidrug resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91867"
FT                   /db_xref="GOA:C4L8J7"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8J7"
FT                   /inference="protein motif:TFAM:TIGR00710"
FT                   /protein_id="ACQ91867.1"
FT                   /translation="MSSDSSSSAYYKDTLTIQQPPIIQQKALSRREKWIPVIYACLLIA
FT                   VGQTGMSLLLPALPAMQQDLHVSSQMTQWLVSAYLLGFGPSQLFYGPLSDMYGRRPVLL
FT                   AGLMITFSGILLCLFAHESATLIILGRVLQGIGAGCTSVIARVSLRDRYEGAHLRQAMA
FT                   YFGIVMAFVPTITPLAGGYLTTHFSWISIFFTMAGYLGLLWVLLFYRFEETHAPEPAED
FT                   RAHAADFVHQYWLLLKSDHFRCYSGVVSIQYALNIFSISVMPFIMQIMVGMSADTYGRW
FT                   TLLPAVSLVLGGVLASKTRHYFSKESVLQAAAALQLISGLSMLLLPHTALLMMLGLSLF
FT                   AFGNGVAFPNALSSLLEPYKRTAGTATALAGASQMLIASFSSALLVSLGITSILGLGMV
FT                   ILLGSSVLLYLTRHARDTVPASDDWHSHHHPVHH"
FT   gene            268540..268980
FT                   /locus_tag="Tola_0238"
FT   CDS_pept        268540..268980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0238"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /note="TIGRFAM: D-tyrosyl-tRNA(Tyr) deacylase; PFAM:
FT                   D-tyrosyl-tRNA(Tyr) deacylase; KEGG: aha:AHA_0281
FT                   D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91868"
FT                   /db_xref="GOA:C4L8J8"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4L8J8"
FT                   /inference="protein motif:TFAM:TIGR00256"
FT                   /protein_id="ACQ91868.1"
FT                   /translation="MIALIQRVSEARVVVDGAVTGEISNGLLVLLGVERDDDVAKADKL
FT                   AHRVAGYRVFSDADGKMNLNVQQVNGSILVVSQFTLAADTRKGMRASFAERNADPAVAE
FT                   ALYEHFIAQIAGKEIPVASGRFAADMQVSLVNDGPVTFWLQV"
FT   gene            complement(268934..269641)
FT                   /locus_tag="Tola_0239"
FT   CDS_pept        complement(268934..269641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0239"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 12; Spermine synthase;
FT                   KEGG: aha:AHA_0280 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91869"
FT                   /db_xref="GOA:C4L8J9"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8J9"
FT                   /inference="protein motif:PFAM:PF08242"
FT                   /protein_id="ACQ91869.1"
FT                   /translation="MSNIPFEEFDVAAATSTGALIYWERNGEQLLEIRADRHFRWLLLD
FT                   GVVQSVLQQATPGELCLPHQRILQALMPAQAAQVLHLGLGGGDLLRWLHHRYPGVQQTA
FT                   IDLNAQVIDIYQRFFQQEEQPHLHCQDAFAWLGSGHQQYDLILIDLFSDDGSPAALFQS
FT                   ATYEHLQQHIAPDGRVIVNLLPRTEQEWQQVQHLLAGCGKVHSLRIANYRNYLIWTEPK
FT                   PAARKSPVRHSPD"
FT   gene            complement(269638..271677)
FT                   /locus_tag="Tola_0240"
FT   CDS_pept        complement(269638..271677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0240"
FT                   /product="AsmA family protein"
FT                   /note="PFAM: AsmA family protein; KEGG: asa:ASA_4114
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91870"
FT                   /db_xref="GOA:C4L8K0"
FT                   /db_xref="InterPro:IPR007844"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8K0"
FT                   /inference="protein motif:PFAM:PF05170"
FT                   /protein_id="ACQ91870.1"
FT                   /translation="MAFFMHRAFRWFLYTILALVAAIWLTLGLLKPEHLKGPFVAWVQQ
FT                   QTGLPLEIGKLNYNPLYPNIVLAENVTLGPDIKIGKIYLEIAGGSWWQRQLHIAHLDII
FT                   NPQITWRPGLTLPQPLRQLQVDDLTIDKLQFSWPNGSLEGGSLHLTNWQPIRNGVVIPL
FT                   TEVNFDARADRLQYASLSLGKTRIEGTLTAEKLSVSDLQSDLFHGGMAAELTWDLKNNR
FT                   IDFQQLALANWQLDLQTFPALPLALPQIFADQVTLENVSAIDLSKRFALNQATGTLEKL
FT                   QWQPGQLPAFEYQGKLGEYTNGLFQLAEMQGEGRLRAEDWQVQLTGEAYAGKFSAELEG
FT                   TRQPATLTIHELQLSDMQPELHPGWREWLATQPFQQVNLRRLDISHLSLISFDDSVPLT
FT                   MKWLDLFLTDLRWTPQGIQSSNHKARLEGSWLELVWQTLVSRKTEFQAELAENKIQLEH
FT                   FNTQLEESDFNISGQWGLDADTPHQLKLSLKKFDLEQLSDMLGPRYPFAGKSDLTLDLQ
FT                   AKGKDLTTIRQSLQGNATLDVLDLFVDGLKLDTYLDEQLTPKAPAPQSFEQLIGKLRGG
FT                   DTAFNHVHLQLRADKGALDFSGSAFESITHLIGVKQGFDLGKQQWQLQLGLLNEQNKPE
FT                   LLGSMSGELTTPQLRFRLPANTVASWPTKPISYPPQGRQGSLRE"
FT   gene            complement(271727..273796)
FT                   /locus_tag="Tola_0241"
FT   CDS_pept        complement(271727..273796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0241"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /note="KEGG: asa:ASA_4113 ATP-dependent DNA helicase RecG;
FT                   TIGRFAM: ATP-dependent DNA helicase RecG; PFAM: DEAD/DEAH
FT                   box helicase domain protein; helicase domain protein;
FT                   nucleic acid binding OB-fold tRNA/helicase-type; SMART:
FT                   DEAD-like helicase ; helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91871"
FT                   /db_xref="GOA:C4L8K1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8K1"
FT                   /inference="protein motif:TFAM:TIGR00643"
FT                   /protein_id="ACQ91871.1"
FT                   /translation="MELSAIPVSMLKGVGSKLAEKLAHLRLHTVQDLLFHLPLRYEDRT
FT                   RLYPIAELSADHACTTEGVIQSCDIQQGKRRMLLCRISDGNGSLTLRFFHFTAGQKNAL
FT                   AIGRRIRCFGEIKRGLHGFEIVHPEYKLLDDDAPLDTDATLTPVYPTTEGLRQASLRNL
FT                   TDQALQLLKENGVKELLPEGLYPRQLSLSDALLLLHRPPPDISLAQLENGQHPAQQRLA
FT                   LEELIAHHLTVLQLRYSVQQHQARPLATDWSLCEQLLAHLPFKPTGAQQRVVSEISHDL
FT                   TLPHPMMRLVQGDVGSGKTLVAALAALQVIAHGGQVVLMAPTELLAEQHANNFSNWLTP
FT                   LGIETGWLAGKIKGKAREKQLEAIRSGQVKMVVGTHAVFQDQVEFQQLLLVIVDEQHRF
FT                   GVHQRLALREKGAQDGVYPHQLIMTATPIPRTLAMTIYADLDTSIIDELPPGRTPITTV
FT                   ALPDTRRETVIERVRQACLEGRQAYWVCTLIEESEVLECQAAENTAEELQLLLPELHIG
FT                   LVHGRMKPAEKQRVMQEFKEGILHLLVATTVIEVGVDVPNASLMIIENPERLGLAQLHQ
FT                   LRGRVGRGSVASHCVLLYHAPLSKTAQQRLGVLRDSNDGFVIAQKDLELRGPGEMLGAK
FT                   QTGLADLKIADLIRDQALIPQVQQLAQRIFQQYPACVTPLIRRWFGERDDYSQA"
FT   gene            274302..274856
FT                   /locus_tag="Tola_0242"
FT   CDS_pept        274302..274856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0242"
FT                   /product="PTS system, glucitol/sorbitol-specific, IIC
FT                   subunit"
FT                   /note="TIGRFAM: PTS system, glucitol/sorbitol-specific, IIC
FT                   subunit; PFAM: PTS system protein II sorbitol-specific
FT                   factor; KEGG: asa:ASA_3583 PTS system,
FT                   glucitol/sorbitol-specific IIBC component"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91872"
FT                   /db_xref="GOA:C4L8K2"
FT                   /db_xref="InterPro:IPR004699"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8K2"
FT                   /inference="protein motif:TFAM:TIGR00821"
FT                   /protein_id="ACQ91872.1"
FT                   /translation="MDLVIHAAEWFIGLFQKGGEVFVSMVTGILPLLISLMVAMNALIR
FT                   FIGQERVERLAQKCAGNPVSRYLILPVVGTFVFMNPMTLSLGRFMPERYKPSYYAAASY
FT                   SCHSMNGLFPHINPGELFVYLGIANGLTTLGLPLAPLAISYLFVGMISNFFRGWVTDLT
FT                   TAFVERQQNIRLSTEVHMHAN"
FT   gene            274878..275861
FT                   /locus_tag="Tola_0243"
FT   CDS_pept        274878..275861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0243"
FT                   /product="PTS system, glucitol/sorbitol-specific, IIBC
FT                   subunit"
FT                   /EC_number="2.7.1.69"
FT                   /note="KEGG: asa:ASA_3582 PTS system,
FT                   glucitol/sorbitol-specific IIBC component; TIGRFAM: PTS
FT                   system, glucitol/sorbitol-specific, IIBC subunit; PFAM:
FT                   Sorbitol phosphotransferase protein II domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91873"
FT                   /db_xref="GOA:C4L8K3"
FT                   /db_xref="InterPro:IPR004702"
FT                   /db_xref="InterPro:IPR011618"
FT                   /db_xref="InterPro:IPR011638"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8K3"
FT                   /inference="protein motif:TFAM:TIGR00825"
FT                   /protein_id="ACQ91873.1"
FT                   /translation="MANSLVITKGNGGWGGPLTIPVDKNKKIIYITAGTRPDIVDRMVE
FT                   LTGMEAVDGFKSSVPDTETAVAIIDCGGTLRCGLYPKKRIPTVNIHSTGKSGPMADYIM
FT                   EDIYVSGVRPDNIQLQDQAGVAPSRPAAAPAQEEYRQYDSSKKLSEQSDGLLAKIGIGM
FT                   GSVMATFFQSGRETIDTVLKSILPFMAFVSMLIGVIIASGIGDVIAHALIPLAKSPIGL
FT                   ITLALICSFPFLSPFLGPGAVIAQVIGVLVGTQIGMGNIPPQLALPALFAINAQAACDF
FT                   IPVGLSLAEAKPKTVQIGVPSVLYSRFLTGAPTVLLAWFVSFFIYQ"
FT   gene            275880..276245
FT                   /locus_tag="Tola_0244"
FT   CDS_pept        275880..276245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0244"
FT                   /product="PTS system glucitol/sorbitol-specific IIA
FT                   component"
FT                   /note="PFAM: PTS system glucitol/sorbitol-specific IIA
FT                   component; KEGG: asa:ASA_3581 PTS system,
FT                   glucitol/sorbitol-specific IIA component"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91874"
FT                   /db_xref="GOA:C4L8K4"
FT                   /db_xref="InterPro:IPR004716"
FT                   /db_xref="InterPro:IPR036665"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8K4"
FT                   /inference="protein motif:PFAM:PF03829"
FT                   /protein_id="ACQ91874.1"
FT                   /translation="MTMLYRTQVTHIGEYAADALDDNMMILFNDNAPADVADYCFIHPA
FT                   ADLTGEIKTGGQFVLGASRYPITAVGDVVNQNLAELGHITIRFDGGAEAEYPGTVHVAG
FT                   QCPEALVLGTELIFQTE"
FT   gene            276328..277104
FT                   /locus_tag="Tola_0245"
FT   CDS_pept        276328..277104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0245"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   asa:ASA_3580 sorbitol-6-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91875"
FT                   /db_xref="GOA:C4L8K5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8K5"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACQ91875.1"
FT                   /translation="MSKVALVVGGGRNLGAFLCNGLAAAGYKVAVADLDGQSAQETATA
FT                   IAEQFGADNVMAVQANSTDEADVARMVGAIEDRFGRIDVMVYNAGVAQAARIDSFPLDA
FT                   WKRSIEVNLTGYFLCARAVSKIMMRQNFGRIIQINSKSGKVGSKHNSGYSAAKFGGVGL
FT                   TQSLALDLADYNITVHSLMLGNLLKSPMFQSLLPQYAKKLGIPEDQVEQTYIDKVPLKR
FT                   GCDYQDVLNVLKFYASEEASYCTGQMINITGGQVMF"
FT   gene            277210..277566
FT                   /locus_tag="Tola_0246"
FT   CDS_pept        277210..277566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0246"
FT                   /product="Glucitol operon activator"
FT                   /note="PFAM: Glucitol operon activator; KEGG: asa:ASA_3579
FT                   glucitol/sorbitol operon activator"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91876"
FT                   /db_xref="GOA:C4L8K6"
FT                   /db_xref="InterPro:IPR009693"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8K6"
FT                   /inference="protein motif:PFAM:PF06923"
FT                   /protein_id="ACQ91876.1"
FT                   /translation="MDATYILIVCAVIAWSLQIATGFLQMRAFNRMLQEMSLKGVVKIG
FT                   KTSSRWKPKTLVVLAHDANNVIVDASIMKGLTIFARPKKLSAVIHARIPLSEKILSELE
FT                   PSTREAIICALSTK"
FT   gene            277646..278410
FT                   /locus_tag="Tola_0247"
FT   CDS_pept        277646..278410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0247"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: regulatory protein DeoR; SMART: regulatory
FT                   protein DeoR; KEGG: asa:ASA_3578 DNA-bindng transcriptional
FT                   repressor SrlR"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91877"
FT                   /db_xref="GOA:C4L8K7"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8K7"
FT                   /inference="protein motif:PFAM:PF08220"
FT                   /protein_id="ACQ91877.1"
FT                   /translation="MSVGIRREMLVRYLREHGRTTVNDLASHFNITGATVRSDLRYLEQ
FT                   ASLVTRRYGGAEAVSHPVAEDRTMDEKTALNQNIKQRIGAKAASLVHDGESIILDNGST
FT                   TLQMVPWLVERVALTVMTNSLLIINEAVSRDCNMNLLMPGGTYRKRSSSFHGGLAEQAF
FT                   RAFTFDKLFIGADGFDIEQGTTTFNEAYQVSQAMCQAAKQIIVVTDSSKFGRKTPNVVV
FT                   PIDKIDIVITDHGISEADQAALEQRGIQVLLV"
FT   gene            complement(278407..278862)
FT                   /locus_tag="Tola_0248"
FT   CDS_pept        complement(278407..278862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0248"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: sbm:Shew185_3498 MarR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91878"
FT                   /db_xref="GOA:C4L8K8"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8K8"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACQ91878.1"
FT                   /translation="MTDDNMPDLLRLDNQLCFALYSASNAIVRAYRPLLDKLDITYPQY
FT                   LVLLVLWQQDEISLKQLGEQLFLDSGTLTPLLKRLESKGLIRRERNERDERLRVLKLTA
FT                   EGNALKKLAANIPVQMRDQLRLSDTQLQLLKAHCELVQKQLHEQDDC"
FT   gene            complement(278999..279796)
FT                   /locus_tag="Tola_0249"
FT   CDS_pept        complement(278999..279796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0249"
FT                   /product="lipoprotein, YaeC family"
FT                   /note="TIGRFAM: lipoprotein, YaeC family; PFAM: NLPA
FT                   lipoprotein; KEGG: asa:ASA_3380 ABC-type methionine
FT                   transporter, periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91879"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8K9"
FT                   /inference="protein motif:TFAM:TIGR00363"
FT                   /protein_id="ACQ91879.1"
FT                   /translation="MNLFSKAILSAAILGIALTGCGEKKDNHLKVGAISGAETQVAEEA
FT                   AKIAKEKFGLEVEIVQFSDFATPNVALNDGSIDVNAFQHKPYLDSQIKDRGFKLVAVGN
FT                   TFVYPIAGYSKKIKNISELKEGTQVAVPNDPTNLGRSLLLLQQQGLLKLKEGSGLSATV
FT                   LDIVENPKNLKIVELEAAQLPRALEDVELAIINTVYASQVDLQPTRDGLFVEDKESPYV
FT                   NLIVARENNQNDENVKNFVKAYQDEAVFKKASELFNGGVVKGW"
FT   sig_peptide     complement(279728..279796)
FT                   /locus_tag="Tola_0249"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.818) with cleavage site probability 0.524 at
FT                   residue 23"
FT   gene            complement(279856..280509)
FT                   /locus_tag="Tola_0250"
FT   CDS_pept        complement(279856..280509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0250"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: aha:AHA_0914 D-methionine
FT                   ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91880"
FT                   /db_xref="GOA:C4L8L0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8L0"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACQ91880.1"
FT                   /translation="MFSSMHELLLLALGETLWMVFASALFGTILGVPLGVALHITKPGQ
FT                   IAAHPIFNKVLGTVVNVGRSVPFIILLVAIIPLTRLIVGTSIGTNAAIVPLAIGAIPFL
FT                   ARLVEGALMEIPAGLIEAAQAMGATHRQIIRKVMLPEALPGILNAIVITLVALVNYSAM
FT                   AGAIGGGGLGDVGIRYGYQRFDPAIMLITVAILVILVQLIQSIGERLVKRVDHR"
FT   gene            complement(280490..281533)
FT                   /locus_tag="Tola_0251"
FT   CDS_pept        complement(280490..281533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0251"
FT                   /product="D-methionine ABC transporter, ATPase subunit"
FT                   /note="KEGG: asa:ASA_3378 DL-methionine transporter
FT                   ATP-binding subunit; TIGRFAM: D-methionine ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91881"
FT                   /db_xref="GOA:C4L8L1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012692"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8L1"
FT                   /inference="protein motif:TFAM:TIGR02314"
FT                   /protein_id="ACQ91881.1"
FT                   /translation="MIKLSSLSKAYGEGKNAFYALKGIELDVPAGQIVGVIGASGAGKS
FT                   TLIRCVNLLERPTQGRVEVDGVDLTALDDQALTLARRNIGMIFQHFNLLSSRTVFENVA
FT                   LPLELANWPKEKITARVNELLDLVGLTHRAKAYPSQLSGGQKQRVAIARALGPAPKVLL
FT                   CDEATSALDPQTTQSILALLKEINQKLGITILLITHEMGVVKSICDSVALLDQGTIIEQ
FT                   GEVGWFFAHAQAPLAKEFIRSSLHLEIPAPYRERLQKAPADGFIPLLRLGFSGNTIDTP
FT                   AISHASRQFGIDVNILSASIEQIGHSRFGFLLVELLGDAAAQQTTIAYLQQQQIDVEVL
FT                   GYVQQHA"
FT   gene            complement(281756..282796)
FT                   /locus_tag="Tola_0252"
FT   CDS_pept        complement(281756..282796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0252"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pat:Patl_2280 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91882"
FT                   /db_xref="GOA:C4L8L2"
FT                   /db_xref="InterPro:IPR018677"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8L2"
FT                   /inference="similar to AA sequence:KEGG:Patl_2280"
FT                   /protein_id="ACQ91882.1"
FT                   /translation="MELKQRHLQQACNQGLLTPEQVTPLWNYLQNLPADSATFRATHIL
FT                   FYLGGLIAIAAMSLFMTLGWDAFGGIGILLIACGYGVAACLVADWLLWRQRQPIPAGLL
FT                   AALAVTMVPLAIYGLQAQLGYWDDATHTEYRDFHRYIDWRWLMMELGTLLFGTILLWRY
FT                   RLPFMVMPLAVVLWYLSMDLTPFLFQEEDYSWLRRQQVSMVVGLLMLGLAFYIDLRTRH
FT                   TLDFAWWLYLFGLMAFWGGLSMQHSDSELSKLGYCLINLLLITVGGMIGRRVFVIFGGM
FT                   GVAGYLGYLAWDLFEDSLTFPFVLSLIGLGIIWLGLLWQRHEAQIQRQLQRHLPAAWRE
FT                   LLAQRR"
FT   gene            283089..284132
FT                   /locus_tag="Tola_0253"
FT   CDS_pept        283089..284132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0253"
FT                   /product="cell shape determining protein, MreB/Mrl family"
FT                   /note="TIGRFAM: cell shape determining protein, MreB/Mrl
FT                   family; PFAM: cell shape determining protein MreB/Mrl;
FT                   KEGG: asa:ASA_3937 rod shape-determining protein MreB"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91883"
FT                   /db_xref="GOA:C4L8L3"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8L3"
FT                   /inference="protein motif:TFAM:TIGR00904"
FT                   /protein_id="ACQ91883.1"
FT                   /translation="MFKKLRGLFSNDLSIDLGTANTLIYVKGKGIVLNEPSVVAIRQER
FT                   GGTAKSVAAVGHAAKMMLGRTPGNIAAIRPMKDGVIADFSVTEKMLQHFIKQVHENNLM
FT                   RPSPRVLVCIPCGATQVERRAIKESAQGAGAREVYLIEEPMAAAIGAGLPVSEATGSMV
FT                   VDIGGGTTEVAIISLNGVVYSSSVRIGGDRFDEAIISYVRRNYGSLIGESTAERIKHEI
FT                   GSAYPGEEVREIEVRGRNLAEGVPRSFTLNSNEILEALQEPLSGIVSAVMVALEQSPPE
FT                   LASDISEKGMVLTGGGALLRNLDRLLMEHTGIPVVVAEDPLTCVARGGGRALELIDMHG
FT                   GDLFHYE"
FT   gene            284181..285134
FT                   /locus_tag="Tola_0254"
FT   CDS_pept        284181..285134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0254"
FT                   /product="rod shape-determining protein MreC"
FT                   /note="TIGRFAM: rod shape-determining protein MreC; PFAM:
FT                   Rod shape-determining protein MreC; KEGG: aha:AHA_0401 rod
FT                   shape-determining protein MreC"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91884"
FT                   /db_xref="GOA:C4L8L4"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8L4"
FT                   /inference="protein motif:TFAM:TIGR00219"
FT                   /protein_id="ACQ91884.1"
FT                   /translation="MRTIFGRGPSLQLRLFITVLLSLAGIVSDARFHLFDGMRLYINTF
FT                   ASPLLHLASVPRDVVEEASLQLSSRSQLLKDNQQLQQQLFLLRSDLLRMAELSQENRRL
FT                   RELLGSPVTQDSRKLVARILSVDSDPFVYQVVIDKGVEHHVYEGQPVVNDQGVIGQVVS
FT                   VGKTSSRVLLITDISHALPVRVLRNDLRAIASGTGNINELTLKNLPRNVDIKDGDILVT
FT                   SGMGGHFPEGYPVAKVTRFANEEQSPFAEIKAEPLATLDRLRYVLLLWQDAKSMGPLPV
FT                   MSSAATVSAAQPAMSATDKNKSATASAEVPHQEGRQ"
FT   gene            285131..285622
FT                   /locus_tag="Tola_0255"
FT   CDS_pept        285131..285622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0255"
FT                   /product="rod shape-determining protein MreD"
FT                   /note="TIGRFAM: rod shape-determining protein MreD; PFAM:
FT                   Rod shape-determining protein MreD; KEGG: asa:ASA_3935 rod
FT                   shape-determining protein MreD"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91885"
FT                   /db_xref="GOA:C4L8L5"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="InterPro:IPR026034"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8L5"
FT                   /inference="protein motif:TFAM:TIGR03426"
FT                   /protein_id="ACQ91885.1"
FT                   /translation="MSGSLTGHGKGSIYLTLIVAIILTMVPLPVAIDMFRPDWVALVVL
FT                   YWVIALPHHLNVVSAWIVGLIMDILLGSTLGIHALSMAVISCVVAAQYQKIRNFSVWQQ
FT                   ALVMGSLIFVGQLLIFWVEHLFASPRLNTRFVWASLSSTLLWPSVYLFLRYIRRRFNIR
FT                   "
FT   gene            285628..286206
FT                   /locus_tag="Tola_0256"
FT   CDS_pept        285628..286206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0256"
FT                   /product="maf protein"
FT                   /note="TIGRFAM: maf protein; PFAM: Maf family protein;
FT                   KEGG: aha:AHA_0403 septum formation protein Maf"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91886"
FT                   /db_xref="GOA:C4L8L6"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8L6"
FT                   /inference="protein motif:TFAM:TIGR00172"
FT                   /protein_id="ACQ91886.1"
FT                   /translation="MSASAALYLASASPRRRELLALLDYPFTVLSVDVEEQQQPDETPA
FT                   DYVQRLARDKSQAGWLACRGQKPVLGADTIVVFEQEVLEKPRDFADAQRILQLLSGNTH
FT                   TVMTAVALSSEQGCEVVLVNSQVTFRKLTPEEISRYWQTGEPADKAGAYGIQGIGGKFV
FT                   SHLSGSYSAVVGLPLLETDLLLQKYCRHS"
FT   gene            286230..287699
FT                   /locus_tag="Tola_0257"
FT   CDS_pept        286230..287699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0257"
FT                   /product="ribonuclease, Rne/Rng family"
FT                   /note="KEGG: aha:AHA_0404 ribonuclease G; TIGRFAM:
FT                   ribonuclease, Rne/Rng family; PFAM: RNA binding S1 domain
FT                   protein; SMART: RNA binding S1 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91887"
FT                   /db_xref="GOA:C4L8L7"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8L7"
FT                   /inference="protein motif:TFAM:TIGR00757"
FT                   /protein_id="ACQ91887.1"
FT                   /translation="MSTELLVNVTPSETRVALVDHGMLQEVHIERQAKRGIVGNIYKGK
FT                   ISRVLPGMQAAFVDIGMDKAAFLHASDIVPHTECVDVKEKEHFQAGNIAELVRQGQDIM
FT                   VQVVKDPMGTKGARLTTDITLPSRYLVFMPGSAHVGVSQRIDSEEERERLKEIVSRNVD
FT                   ELGGFIIRTAAEGIGEKELEQDTIFLKRLWRKVLERRQKYPTSHVLYAEWSLAFRILRD
FT                   FVGDDLDKIRVDSRQTYEQLSHFTEEFVPEMIGKLDYYSGESPIFDLYDVENEIQRALE
FT                   RKVELKSGGYLIIDQTEAMTTIDINTGAFVGHRNLEETIFNTNIEATAAIARQLRLRNL
FT                   GGIIIIDFIDMQSEDHRRRVLQSLEQALAKDRAKTGVNGFSQLGLVEMTRKRTRESLEH
FT                   VLCSECPACKGRGRVKTVESVCYEILREILRVNRAYDADQFVVYASPAVAEALRGEESH
FT                   SLAELEVFISKQVKVQAEPLYNQEQYDVVMM"
FT   gene            287754..291518
FT                   /locus_tag="Tola_0258"
FT   CDS_pept        287754..291518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0258"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aha:AHA_0405 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91888"
FT                   /db_xref="InterPro:IPR011836"
FT                   /db_xref="InterPro:IPR025263"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8L8"
FT                   /inference="similar to AA sequence:KEGG:AHA_0405"
FT                   /protein_id="ACQ91888.1"
FT                   /translation="MLLAVLVTALRFGLPDLQLHRDWVLKQFLPDTMSSASVAHIGWRW
FT                   QDYGLQLELRDVALQQQGAVPFELSAKQLQLHCNPFLQFWKTHGCLATLQADQLQLTLQ
FT                   LPKAAASSSDSPGLNDLLPLLLEQVAQANITNSQIRLVRQQQLLAEFHIDQLYAENRAD
FT                   QHKLFSRISVAQQALVVPLLLQAELQGAARQDALQGHIYLATEPHAGKQPGALLPTPLT
FT                   ANAQSIHGSLAFQLWLERQPGQWQSALLQLGLNRLGWQQAEQQHSLELQGGEIVWQRHA
FT                   GDWQLYSQGLQLHSNHQPWRSWQLQLKKQAEQYTGQMDPLLLDELTPLTGMFLPVESAA
FT                   AEALRTLMPQGRLSELRFSRDEAQDSWLFSGQLQQLQWQRWRMIPGLHDVDASFRLSPQ
FT                   GVALTLQQLKPQTWDLQPYFEKPWPVQTFSADLNWQKLSNGWALTADQVQLKTDVVTTA
FT                   TQFRLSQEGTQPLFLALDSGVDLKDASQAHYYFPHGAMGEPVIKYLTNALQGGHAENAR
FT                   ILWHGAFRDFPFKEKNGIFQAWVPLRDATFQFGAGWLPLREMSLDLLFENDRLDMQGDR
FT                   ALLGDASSPRLHAWFPKLAPGARLYIDADIAGTGEAVSDYLYRSPLQNSVGSALQAVRI
FT                   QKPLTGELKLDIPMDGTQVKVNGKVKLAGNSLYLPSLDLPLEQLQGELSFDDNKTAIEK
FT                   LQATLWGQPLRVQYAGEQLANEYQVKLGLQGEWDSQRDKALPQLAHQTLQGQANWQGAL
FT                   DLHLYKGGHYYYDAQLTSPLTALVLDLPAPYNKPSGRSWPLQVKISGNQRSSVINGSLN
FT                   HEWQLQADWTPDKKQFRRFWLDNQIIERSAGPRLPFSVSAILSEADGSAWLDWWQRWPA
FT                   NGQHAVNQLFPSAGAIDVRVDKLHVADQLWRDIRLNMSPDRDGSRIWLESSKAQGVIHL
FT                   PASKKKPIRIDMARLYWADSGVDTKPAEPMSLATQRAWLARWPDLLFSCQDCRYGGNTL
FT                   GQFRGHLYPVKQGGEIRDLHWQVANSHFDGQAGWSIKNYQPLSTLKGKFVSNNTEVFLG
FT                   HFGFDPGLTGTKSQLDIDVSWPGALVQPRLSALDGQIRMETGEGILREVKNTGGNRLLS
FT                   LFSLNAIVSRISFDFRDIFGDGLYFKKITFSSKLERGVLRNDDLVLESNSGELNGHGMV
FT                   DLGQKTIDYQVTFSPTLTGGFGVATAFAITPITGIAVLAATTILQPVFDVITQVSYSVK
FT                   GDIAKPVITELGRKQEKVKLSAPKAKESK"
FT   gene            291518..292339
FT                   /locus_tag="Tola_0259"
FT   CDS_pept        291518..292339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0259"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: asa:ASA_3930
FT                   beta-ureidopropionase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91889"
FT                   /db_xref="GOA:C4L8L9"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8L9"
FT                   /inference="protein motif:PFAM:PF00795"
FT                   /protein_id="ACQ91889.1"
FT                   /translation="MQLVALQINAQADWLSNRAQIASLLQRLPVERPCLVLLPENFACM
FT                   GAPQDYQQLAEPVGSGPVQRQLSEWAKEFGLWLVAGSLPTLIPQQNRVHTTSLVFNPQG
FT                   ELTGFYHKLHLFDVDVDDARGRYRESDSFVAGHDSCVVASPFGGLGLSICYDVRFPELY
FT                   RLLRQRGADVLLVPAAFTKVTGQAHWLPLLQARAIENQCYVVAANQCGSHGGNRETRGH
FT                   SVIIDPWGEVLAQQGSQPGLIVATLDPQKTEQIRKSMPVQLHARLTPAWRE"
FT   gene            292344..293789
FT                   /locus_tag="Tola_0260"
FT   CDS_pept        292344..293789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0260"
FT                   /product="peptidase U62 modulator of DNA gyrase"
FT                   /note="PFAM: peptidase U62 modulator of DNA gyrase; KEGG:
FT                   asa:ASA_3929 TldD protein, suppresses the inhibitory
FT                   activity of the carbon storage regulator (CsrA)"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91890"
FT                   /db_xref="GOA:C4L8M0"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8M0"
FT                   /inference="protein motif:PFAM:PF01523"
FT                   /protein_id="ACQ91890.1"
FT                   /translation="MLLPQVSERLLAANGLDQDILAQQLRQLMSHQIEFGDFYFQSGVH
FT                   ESWILEDGIVKDGSYNIEQGVGVRAISGEKTGFAYSDELSLNALQQAVVAARGVAAAGG
FT                   EGQVKIWQPTQPAARYLALDPLPGLPQPQKITLLEELDQFARSLDPCVTQVMASLSGVY
FT                   EEVLIAATDGTLVADIRPLVRLSVTVLAERKGRRERGSSGGGGRCGYDYFFEVENGESR
FT                   ARGYVREAVRQALVNLEAIDAPAGMMPVVLGAGWPGVLLHEAVGHGLEGDFNRKGSSAF
FT                   SGKIGQQVASKHCTIVDDGTLAGRRGSLSVDDEGTPTQYNVLIENGILKGYMQDKLNAR
FT                   LMGVAPTGNGRRESYAALPMPRMTNTYMLAGEHDPQEIIASVKKGIYAPNFGGGQVDIT
FT                   SGKFVFSASEAYLIENGKITAPIKGATLIGNGPEAMQQVSMVGNDLALDKGVGVCGKDG
FT                   QSVPVGVGQPTLKLDELTVGGTQ"
FT   gene            complement(293843..294367)
FT                   /locus_tag="Tola_0261"
FT   CDS_pept        complement(293843..294367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0261"
FT                   /product="protein of unknown function DUF615"
FT                   /note="PFAM: protein of unknown function DUF615; KEGG:
FT                   aha:AHA_3937 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91891"
FT                   /db_xref="InterPro:IPR006839"
FT                   /db_xref="InterPro:IPR023153"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8M1"
FT                   /inference="protein motif:PFAM:PF04751"
FT                   /protein_id="ACQ91891.1"
FT                   /translation="MNHQKNTQDDWDDDYVSKSGQKREAAALQKLGEELVNLKPAELER
FT                   VPLDEDLIAAIAMGHKLKGKHEALRRHLQYVGKMMRNRDTTEIKNVLDQIHSRNNSTNA
FT                   RLHKLEQWRDRLLSNGDDAINAVIGECHTLERQKLRQLISRAKKEAAANQPPAAFRELF
FT                   KYLREHMDEQL"
FT   gene            294453..295796
FT                   /locus_tag="Tola_0262"
FT   CDS_pept        294453..295796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0262"
FT                   /product="peptidase U62 modulator of DNA gyrase"
FT                   /note="PFAM: peptidase U62 modulator of DNA gyrase; KEGG:
FT                   aha:AHA_3936 protein PmbA"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91892"
FT                   /db_xref="GOA:C4L8M2"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8M2"
FT                   /inference="protein motif:PFAM:PF01523"
FT                   /protein_id="ACQ91892.1"
FT                   /translation="MNSQEQILQEQHKLEQVVTDALHIAQELGADTAEISISKQTGISV
FT                   NTRGGEVENIEFNKDGALGIAIYRDGRKGSSSTADLSIGAIRRCIEAALEISRYTAVDS
FT                   CAGLADRELMAWDAPELDLLYPVALEPEYGIELARRCELHALSLDKRIKQSDSGSFSSH
FT                   HGIKVYGNTHGFVKGYAASRHSLSCVLIGEQDGDMQRDYSYSTARELSDLWTPERIAED
FT                   AVSRTVSHLGGRKIATTEVPVLFLPEAANSLFGHLVSAISGGNLYRKSTFLLDSLGQQL
FT                   FPDWLHINEFAHLPKGLASSPFDGEGVRTQDRAIIQSGVLQTYLLTAYSARKLGMQSTG
FT                   HAGGIHNWFVEGQGQTLDALLQQMGTGLVVSELMGQGVNIVTGDYSRGATGFWVENGQI
FT                   VYPVEEITIAGNLKEMFRQIVAVGNDIDPRCSLQSGSVLLERMKIAGN"
FT   gene            complement(295840..296169)
FT                   /locus_tag="Tola_0263"
FT   CDS_pept        complement(295840..296169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0263"
FT                   /product="protein of unknown function DUF496"
FT                   /note="PFAM: protein of unknown function DUF496; KEGG:
FT                   ppr:PBPRA1961 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91893"
FT                   /db_xref="InterPro:IPR007458"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8M3"
FT                   /inference="protein motif:PFAM:PF04363"
FT                   /protein_id="ACQ91893.1"
FT                   /translation="MQSNEMNNILEFVRVARLKNKLTREIEDNARKIRDNQKRVALLAN
FT                   LTEYLKPGMSYEDILEIIHNMKGDYEDRVDDLTIVGAELSKQRREASKQLRNFPRTFRK
FT                   EGSAE"
FT   gene            complement(296278..296580)
FT                   /locus_tag="Tola_0264"
FT   CDS_pept        complement(296278..296580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0264"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91894"
FT                   /db_xref="GOA:C4L8M4"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8M4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACQ91894.1"
FT                   /translation="MSSARWKIQLSPKIRLSSLVLGIVPVIIVLGWLGIWMPQSLRLLM
FT                   LSLFDQLGTLIYYPLAALALAAGFFLAALWRREFNWQYLLEGTLSVWMLLNWPIY"
FT   gene            complement(296585..298615)
FT                   /locus_tag="Tola_0265"
FT   CDS_pept        complement(296585..298615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0265"
FT                   /product="ATP-dependent DNA helicase Rep"
FT                   /note="TIGRFAM: ATP-dependent DNA helicase Rep; PFAM:
FT                   UvrD/REP helicase; KEGG: asa:ASA_0087 ATP-dependent DNA
FT                   helicase Rep"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91895"
FT                   /db_xref="GOA:C4L8M5"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005752"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8M5"
FT                   /inference="protein motif:TFAM:TIGR01074"
FT                   /protein_id="ACQ91895.1"
FT                   /translation="MKLNPRQLDAMHYVSGPCLVLAGAGSGKTRVITAKIAYLIRECSY
FT                   QARHIFAVTFTNKAAREMKERVAQTLGRREARGLTVSTFHSLGLDLIRREHQHLQLKAN
FT                   FSLFDDTDQMSLIKELTEADPELQGNKELLQQLVQTISRYKNDLILPAQALKRAHTPEE
FT                   QRFAIWYERYQKQMSAYNALDFDDLILLPTLLLKTNAEVREQWQNRIRYLLVDEYQDTN
FT                   TSQYELVKLLVGERARFTVVGDDDQSIYSWRGAQPQNLVRLQQDFPRLNVIKLEQNYRS
FT                   KGRILKCANILIANNPHVFDKQLFSELDYGMPVRVLMAKNEEHEAEKVAAEIMGHRFMN
FT                   RTSWKDYAILYRGNHQSRLLEKVLMQNRIPYKISGGTSFFSRTEIKDIMAYLRLLVNPD
FT                   DDNAFLRVVNLPRREIGPTTLEKLGHYANQRGKSLYAASFEIGLEQHLHGRGLQALRHF
FT                   CDWLCRMSDNAARGNSEEVVRDLIKDIHYDEWLYETSPSPKAAEMRMQNVSTLYRWLTD
FT                   MLAGDVQQDAAPLNLSEAVARFTLRDMLERNEGDEALDQVQLMTLHASKGLEFPYVFMI
FT                   GMEEGLLPHQASIDEDNIDEERRLAYVGITRAQTELCFVLCKERRQFGDTVNPEPSRFL
FT                   LELPQDDLQWEARKEPASAEQRQQKAKTGIANLRAMLKEKG"
FT   gene            298691..299158
FT                   /locus_tag="Tola_0266"
FT   CDS_pept        298691..299158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0266"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91896"
FT                   /db_xref="GOA:C4L8M6"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8M6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACQ91896.1"
FT                   /translation="MAYVNSGIEMKTSQYDWRIIGFIILLLVAVCALVTIKLLFPDMTQ
FT                   EKLFSVLSSSSPAVNTASPQNVPSEKSAATASHPVIAVAEVPAKASPPAVEQVVKTETK
FT                   VVNSVPAATDTHVTVETTETATTQHIAEEPRSASKAQIVCSAEDREAELCQ"
FT   gene            299201..300319
FT                   /locus_tag="Tola_0267"
FT   CDS_pept        299201..300319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0267"
FT                   /product="TRAP-type uncharacterized transport system
FT                   protein, periplasmic component"
FT                   /note="KEGG: pna:Pnap_3259 TRAP-type uncharacterized
FT                   transport system protein, periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91897"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8M7"
FT                   /inference="similar to AA sequence:KEGG:Pnap_3259"
FT                   /protein_id="ACQ91897.1"
FT                   /translation="MKVNSYIVKGACLLMTLHITGASAQLSNAITTGNQSDTYYRIGED
FT                   LRQYAMPELRNLQSKGAVDNIKALSKTTGVSFAIVQSDVYQTYVNLEKNDPDPAVRQWA
FT                   ADLLNSLRVVAPLYNEEIYFVVHKDSPMQELQDIEGKRLAIGLNGSGANLTAKNIYYKL
FT                   FGKAPVVVEPFIEEGVVGSDEGTKYVRSALWHLAHPEAGPEERKADVVVIIGGQPLPLL
FT                   QRLGKDYKLLASNIKNDATEALLKDYSIGFADQKNYPFLPKHMPVMMVQSYLVTAQFRD
FT                   KQRNDFVKKFAGSLCKNYDKLYEHGHEKWKALAWSPQRPRLPSLLSGWRYSDVTKPILE
FT                   ACLPQGVTQPVASSNAPAFPCSMEDRAIGLCM"
FT   sig_peptide     299201..299275
FT                   /locus_tag="Tola_0267"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.971) with cleavage site probability 0.781 at
FT                   residue 25"
FT   gene            300429..301655
FT                   /locus_tag="Tola_0268"
FT   CDS_pept        300429..301655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0268"
FT                   /product="cysteine desulfurase, SufS subfamily"
FT                   /note="TIGRFAM: cysteine desulfurase, SufS subfamily; PFAM:
FT                   aminotransferase class V; aminotransferase class I and II;
FT                   KEGG: asa:ASA_0086 cysteine desulphurase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91898"
FT                   /db_xref="GOA:C4L8M8"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010970"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8M8"
FT                   /inference="protein motif:TFAM:TIGR01979"
FT                   /protein_id="ACQ91898.1"
FT                   /translation="MTSFDVQRVRGQFLILQQQINGYPLVYLDSAATAHKPECVLQAML
FT                   DFYRTDNANVHRSAHTLASRATQKFEQARQRVADFLHARRREEIIWTRGTTESINLVAQ
FT                   TWGLQSLQAGDEILLSAMEHHANLVTWQQVARQTGARLRIIPLLESGELDMQAYQAMLS
FT                   THTRMVAIVHVSNVLGTVNPVADVVRLAKQAGALTLIDGAQAVAHAPVDVQALGCDFYA
FT                   FSGHKVYGPTGIGVLYGRKEILAQLPPWQFGGEMIRKVTFTESEFSLPPLRFEAGTPAI
FT                   AEAVGLSAALDFLCEQLAAGAEVYQQQLLQRLLQGLQQIDGVSLVGQPAARQGVVSVVL
FT                   AHAHHHDVCQLLDAQGIAVRSGHHCAMPLLHSLGLAGTLRISLGVYNNETEIDAFLQAL
FT                   RQALELLHD"
FT   gene            301648..302106
FT                   /locus_tag="Tola_0269"
FT   CDS_pept        301648..302106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0269"
FT                   /product="Fe-S metabolism associated SufE"
FT                   /note="PFAM: Fe-S metabolism associated SufE; KEGG:
FT                   aha:AHA_4240 SufE protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91899"
FT                   /db_xref="InterPro:IPR003808"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8M9"
FT                   /inference="protein motif:PFAM:PF02657"
FT                   /protein_id="ACQ91899.1"
FT                   /translation="MTELFDFTVHFPVGAGTALDENHVRQLLADANSWEERYRQLLLLA
FT                   KQVPSVPQLWRHPDHEVGGCESRVWLLLCRDDAGKYHFAVDSESRIVKALLITILAAAN
FT                   HQTADKIHRIQVASYLAELGFAQHITLSRTNGLQAVWKKMSDFCASFA"
FT   gene            302184..302861
FT                   /locus_tag="Tola_0270"
FT   CDS_pept        302184..302861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0270"
FT                   /product="diguanylate phosphodiesterase"
FT                   /note="PFAM: EAL domain protein; SMART: EAL domain protein;
FT                   KEGG: vha:VIBHAR_04978 diguanylate
FT                   cyclase/phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91900"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8N0"
FT                   /inference="protein motif:PFAM:PF00563"
FT                   /protein_id="ACQ91900.1"
FT                   /translation="MLDGLPAVLNKASLRFVAQPIFRQKGELYGHEMMLLHKQHKDPAM
FT                   FMKIVNHMGLRQNLDLEVCRMAEPVLRTHNLTGCCCINLFADSLQEENVIEALLMLADP
FT                   SASRWVMVNVMQLDTSNKQFNLSEIIADLRQCGVRFCFDVKLLMQITAMSLPVDMLRMD
FT                   IRQVPEDQWARWISFAESNCVPMLAAGVDDDTHREALRELGIDFLQGKIFADMVLLNQN
FT                   QTA"
FT   gene            complement(302926..303705)
FT                   /locus_tag="Tola_0271"
FT   CDS_pept        complement(302926..303705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0271"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein; KEGG:
FT                   aha:AHA_4241 ThiF domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91901"
FT                   /db_xref="GOA:C4L8N1"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8N1"
FT                   /inference="protein motif:PFAM:PF00899"
FT                   /protein_id="ACQ91901.1"
FT                   /translation="MQSDYSQRFGGIARLYGEKALQCFQQSHVCVIGIGGVGSWAAEAL
FT                   ARSGIGQLTLIDMDDICVTNTNRQIHALQGNVGKLKTEVMAERIRLINPDCQIHIVDDF
FT                   ITEDNLAGFVDARFDFVVDAIDSIRAKVALLAHCKRQKISLITTGGAGGQKDPTQIAIT
FT                   DLSRTTQDPLAAKVRADLRRKFGFPRDPKKKFGIPCVYSTEQLTYPDGAGGTCSAKASS
FT                   DGNMKMDCASGFGATTVVTATFGLTAVSYVLQKLADK"
FT   gene            303910..304686
FT                   /locus_tag="Tola_0272"
FT   CDS_pept        303910..304686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0272"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   pst:PSPTO_5587 glycosyl transferase, group 2 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91902"
FT                   /db_xref="GOA:C4L8N2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8N2"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACQ91902.1"
FT                   /translation="MICDEQVEMVIHQPAVTVVIPAKNEAENIRPLINEIRTAMDDEFD
FT                   YELIYVDDGSTDDTFNILKSIRDEGFSKLKVIRHQQSVGQSFSVLNGARHGAGEWLVVL
FT                   DADGQNVPADIPGMLKTLQAAYASDPKKVGIIGHRVTRRDDWIKRLSSKLANGFRDWML
FT                   KDGIPDTGCGLKATRREWYVQLPAFNHMHRYVPALIQSMGGEMLVHPVNHRPRMAGVSN
FT                   YGVWNRLWVGLVDVFGVRWLQHRAKRIVIQEILNGR"
FT   gene            304676..305017
FT                   /locus_tag="Tola_0273"
FT   CDS_pept        304676..305017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0273"
FT                   /product="lipid A biosynthesis domain protein"
FT                   /note="PFAM: lipid A biosynthesis domain protein; KEGG:
FT                   smt:Smal_3961 lipid A biosynthesis domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91903"
FT                   /db_xref="GOA:C4L8N3"
FT                   /db_xref="InterPro:IPR011499"
FT                   /db_xref="InterPro:IPR014546"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8N3"
FT                   /inference="protein motif:PFAM:PF07578"
FT                   /protein_id="ACQ91903.1"
FT                   /translation="MGADWLDLPISWLEWTGVHITGWKIIGYTGALMFGGRWLVQFVAS
FT                   KRAGKPVIPRLFWYMSVGGSLMTLSYFLFSAKQDSVGVLQNLFPAFTALYSLWLDIKHR
FT                   GWHRDRASH"
FT   gene            305045..306760
FT                   /locus_tag="Tola_0274"
FT   CDS_pept        305045..306760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0274"
FT                   /product="glycosyl transferase family 39"
FT                   /note="PFAM: glycosyl transferase family 39; KEGG:
FT                   pat:Patl_3674 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91904"
FT                   /db_xref="GOA:C4L8N4"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8N4"
FT                   /inference="protein motif:PFAM:PF02366"
FT                   /protein_id="ACQ91904.1"
FT                   /translation="MITDRFALQGWQSDRLNLLFLLGLGLLILGAGLGLRDPWPADEPR
FT                   FALVAKQMVESGQWLFPFRGGEIYPDKPPMFMWGIALGYFITGSLRVAFLLPSLLAGLG
FT                   CIALVYDIARRIWDRATAFRAGLFLLFAVQFTVQAKQAQIDALVTFFITLGGYGFLRFL
FT                   LCGGGWRWYYLGWFAAGLGIITKGVGIIAALVLIPALWTHREQIKQASKAQWLKGLAGP
FT                   LFMLLACALWVIPMVLVVQQHPLPEFLAYRDNILFRQTVTRYANAWHHIKPFWFYLVNV
FT                   IPSFWLPWSLLLPWMVWQTKRDVKLGQRPVILLVGYLLLILLFFSASAGKRGVYITPAT
FT                   PVLALLVAYWLPELLTRRWPARLLAGLGWLLSGLFLCAGLVLLLKPALIAKLGEMDSPV
FT                   LLALSLGATGLVANWLLRRQPLSAILATLTILWLHYGFWAYPLMNHLRTPQQIMQQAGQ
FT                   RLAPQDELLLTNFREQFLLFADRPVYHFAYLQDDEPQPTDAAAWVQAASHRWVLGPGDK
FT                   LSPCFAADKGIALGQRHGDDWFLFRADAVLPACQSAQSSGAGIFYYAPKLLVGE"
FT   gene            306763..307770
FT                   /locus_tag="Tola_0275"
FT   CDS_pept        306763..307770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0275"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; Male sterility
FT                   domain; polysaccharide biosynthesis protein CapD;
FT                   short-chain dehydrogenase/reductase SDR;
FT                   dTDP-4-dehydrorhamnose reductase; KEGG: esa:ESA_01535
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91905"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8N5"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACQ91905.1"
FT                   /translation="MHYLVTGAAGFIGFHVAERLLAAGHQVTGLDNLNDYYDVNLKLSR
FT                   LALLQAHPAFHFVKGDLADRTLMADLFTNGQFRRVIHLGAQAGVRYSLDNPHAYADANL
FT                   VGHLNILEGCRQHKIEHLLYASSSSVYGLNRKTPFSVNDSVDHPVSLYAATKKANELMS
FT                   HSYAHLYGLPCTGLRFFTVYGPWGRPDMALFKFTKAILAGQPIDVYNFGEMKRDFTFID
FT                   DIAEAIIRLAEVIPQPNAEWTVETGSPAESSAPYRVYNIGNSQPVELKTFIHELEQALG
FT                   IPAQMNLLPLQPGDVLETSADTSALETVIGFKPQTPLASGLARFVSWYKSFYSL"
FT   gene            complement(307758..308351)
FT                   /locus_tag="Tola_0276"
FT   CDS_pept        complement(307758..308351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0276"
FT                   /product="protein of unknown function DUF330"
FT                   /note="PFAM: protein of unknown function DUF330; KEGG:
FT                   eca:ECA2531 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91906"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8N6"
FT                   /inference="protein motif:PFAM:PF03886"
FT                   /protein_id="ACQ91906.1"
FT                   /translation="MMMPRYVLVVLLLCGLSACSTATAPQYYAIALPDEQSGTLSASQQ
FT                   PVVAVSDVELADYLSSIGIVYQQDDVQLTTANQHRWAEALDKQLTRALLQNLRQQLPDW
FT                   QWQNGQMAGQNIAQLQVKIRGFHGKADGHAVISGEWVLNTGKQQYSGQFQQLYPLTADG
FT                   YPALVRELRTGWQQTTSQLAMQLKPLLQNAAHSE"
FT   sig_peptide     complement(308283..308351)
FT                   /locus_tag="Tola_0276"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.625 at
FT                   residue 23"
FT   gene            complement(308348..309985)
FT                   /locus_tag="Tola_0277"
FT   CDS_pept        complement(308348..309985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0277"
FT                   /product="Mammalian cell entry related domain protein"
FT                   /note="PFAM: Mammalian cell entry related domain protein;
FT                   KEGG: ypb:YPTS_1549 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91907"
FT                   /db_xref="GOA:C4L8N7"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8N7"
FT                   /inference="protein motif:PFAM:PF02470"
FT                   /protein_id="ACQ91907.1"
FT                   /translation="MPNNYARIKKLQRLSPIWLIPIVAACIGLWMVVTTINSQGPLITL
FT                   EMDNAEGLEPGKTPIKARSVEIGKVQTVRLGNDLKHVIVTAQMNVEAEPLLREDTRFWV
FT                   VKPRVGKSGISGLNTLLSGSYLELQPGKSKEHKLEFTVLDTPPVTPTNAPGLRIELSSE
FT                   QDSALSIGDPVLYRGFTVGRVEQAEFKSDSRQMSYQLFIQAPYDALVTSNTRFWLNRGI
FT                   QLQAATDGIKIKTGTLETILSGGVSFSVPPGWELGQPVKGYRSFNLYADEDSSTIRRYQ
FT                   DKVDYILLFDESVRGLNPGAPVEYRGIQVGSVLAVPFSVPGNDLLTARSRQIPVLIRIE
FT                   PGRIRGDMDKDQLPNWEKEFTTAVRQGLRASLRSGNLLTGALYVDLNFYPDLPKTTGLG
FT                   ELANYRTLPTASGGLARIEQQVVQLLNKLNQLDIEQVLTNAQTMLTETEAAMANVRQVS
FT                   ASMDKIANQQSSQELPAELKRTLAEMQQTLKGLSASSPAYGELNRSIQSLNRVLREVQP
FT                   MARTLNEKPNALLFQPDTATDPEPRKAK"
FT   gene            complement(309975..311276)
FT                   /locus_tag="Tola_0278"
FT   CDS_pept        complement(309975..311276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0278"
FT                   /product="integral membrane protein, PqiA family"
FT                   /note="TIGRFAM: integral membrane protein, PqiA family;
FT                   PFAM: Paraquat-inducible protein A; KEGG: eca:ECA2533
FT                   paraquat-inducible protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91908"
FT                   /db_xref="GOA:C4L8N8"
FT                   /db_xref="InterPro:IPR005219"
FT                   /db_xref="InterPro:IPR007498"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8N8"
FT                   /inference="protein motif:TFAM:TIGR00155"
FT                   /protein_id="ACQ91908.1"
FT                   /translation="MKRHRRSTYVRSAVQYTACHECDWLMVVPPLQPGEQAVCPRCEHK
FT                   LRSLPAEARLQPMVYSIAALIMLLCSNLFPFLGMMVKGMHQDMTLYQTATTLLEEQHPA
FT                   LALTVYLFMQILPAICLLLICLIYSRLGQWRGKRLRKRYTLWLFRLIPWCMVEVFLIGV
FT                   LVSLIKIASLADIELGYSFWAYVLFSLTMLKAFSAIDRDWLWWQQSGPVHLRTPPAPRG
FT                   RAIDQNLTLCHACHGLVSLKTHRCPRCQSVLHARKPHSLQWTLALLFTAAILYIPANIL
FT                   PIMVTESFGQQTYSTILGGVVLLWDMGSYPVALIIFIASVLVPMVKMLAISWLCWSVYV
FT                   KRLHHRRGRTRLYRLTEFIGRWSMVDVFVVAILVALIRMGKLMSVYPGSAALAFAGVVV
FT                   LTMLSAMSFDPRLLWDTEPDTVQPVTEGKSDRAE"
FT   gene            complement(311434..312918)
FT                   /locus_tag="Tola_0279"
FT   CDS_pept        complement(311434..312918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0279"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /note="KEGG: vco:VC0395_A2550 ketol-acid reductoisomerase;
FT                   TIGRFAM: ketol-acid reductoisomerase; PFAM: acetohydroxy
FT                   acid isomeroreductase; Acetohydroxy acid isomeroreductase
FT                   catalytic domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91909"
FT                   /db_xref="GOA:C4L8N9"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4L8N9"
FT                   /inference="protein motif:TFAM:TIGR00465"
FT                   /protein_id="ACQ91909.1"
FT                   /translation="MANYFNTLNLRQQLEQLGKCRFMNRDEFASECDFLKGKKVVIVGC
FT                   GAQGLNQGLNMRDSGLDVSYALRAEAIAEKRKSFKQASENGFTVGTYEDLIPTADLVVN
FT                   LTPDKQHTSVVKAVMPLMKDGAALGYSHGFNIVEEGTQIRKDITVVMVAPKCPGTEVRE
FT                   EYKRGFGVPTLIAVHPENDPKGDGLAIAKAWAAATGGHRAGVLQSSFVAEVKSDLMGEQ
FT                   TILCGMLQAGSILCYEKMIADGIDAGYAGKLIQFGWETITEALKQGGITAMMDRLSNPA
FT                   KLRAFELAEEMRVLMRPLFRKHQDDIISGAFSSGMMADWANNDADLFRWREETGASAFE
FT                   NAPAFDGAIAEQEYFDNGILMVAMVKAGVELAFETMTESGIIAESAYYESLHELPLIAN
FT                   TIARKRLYEMNVVISDTAEYGNYLFANAAVPLLKAHIMPKVGTDVIGKTLSVKDNGVDN
FT                   VTLVQVNEIIRNHPIEQVGKVLRGYMKDMKRIAVGG"
FT   gene            313071..313949
FT                   /locus_tag="Tola_0280"
FT   CDS_pept        313071..313949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0280"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: asa:ASA_4237 DNA-binding transcriptional
FT                   regulator IlvY"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91910"
FT                   /db_xref="GOA:C4L8P0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037404"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8P0"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACQ91910.1"
FT                   /translation="MDFRTLSLFAHLAHTLHFANTANQMAVSPSTLSRTMQRLEQETGC
FT                   ALFERDNRSVVLTAEGRRLLTFAERWLQEWQDLRDDLRHPREALQGRIRVFCSVTASYF
FT                   LLPEVLGRFRHRYPQLELKLETGDAALAVDKVLQEETDIAIAARPDALPARLQYCLLQQ
FT                   VPLVFIAPRNSTNVSQWLKDGEPDWSQVPLIVSQQGLARKRCDQWFRNKGISPNIYAEV
FT                   AGNEAIVSMVTLDCGIGLVPEAVIEHSTFGSQVRVIQPVPALKPFEVGFCVLKRRLEEP
FT                   LLQAFWQMVQQ"
FT   gene            314089..315738
FT                   /locus_tag="Tola_0281"
FT   CDS_pept        314089..315738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0281"
FT                   /product="Glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /note="PFAM: phosphoglucose isomerase (PGI); KEGG:
FT                   aha:AHA_0154 glucose-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91911"
FT                   /db_xref="GOA:C4L8P1"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4L8P1"
FT                   /inference="protein motif:PRIAM:5.3.1.9"
FT                   /protein_id="ACQ91911.1"
FT                   /translation="MKNINPTQTKAWKALETHFAANKDRQLSELFAADPARFDKFSTTY
FT                   KDNILVDYSKNLITDETLDLLIDLAHEVDLRSAIDAMFNGEKINHTEGRAVLHTALRNR
FT                   SNRPVMVDGKDVMPEVNAVLAKIKAFCDSVISGEWKGYTGKAIQHVVNIGIGGSDLGPV
FT                   MITEALRPFKNHLQMHFVSNVDGTHIAETLKNVDPETTLFLVASKTFTTQETMTNALSA
FT                   RDWFVNIAGDQAHVAKHFAALSTNTKAVAEFGIDTANMFEFWDWVGGRYSSWSAIGMPI
FT                   ALSLGFENFEALLEGAFEMDTHFATTSYEQNIPVLLALIGLWYNNFYEAESEAILPYDQ
FT                   YMHRFAAYFQQGNMESNGKYVDRNGNKVDYQTGPIIWGEPGTNGQHAFYQLMHQGTKLI
FT                   PCDFLAPAITHNPIGDHHPKLLANFFAQTEALAFGKSKEAVEAEFLAAGKTLEQVKDLV
FT                   PFKVFEGNRPTNSILFKQMTPQTLGALIAMYEHKIFVQGIIWNIFSFDQWGVELGKQLA
FT                   NKILPELNSDAAVTSHDSSTNGLINTWKAWKA"
FT   gene            complement(315807..317480)
FT                   /locus_tag="Tola_0282"
FT   CDS_pept        complement(315807..317480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0282"
FT                   /product="diguanylate cyclase"
FT                   /note="KEGG: aha:AHA_2666 GGDEF domain-containing protein;
FT                   TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain containing
FT                   protein; NMT1/THI5 like domain protein; SMART: GGDEF domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91912"
FT                   /db_xref="GOA:C4L8P2"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8P2"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACQ91912.1"
FT                   /translation="MEKDIQIAGFRWIVFLFIFCFINPLAAAEHVVVQLKWVNQFQFAG
FT                   YYAALEKGFYKAAGFDVELRPNGYDGAFVSPVDAVVSGKAQYGISNSGLVLDYLNGKPV
FT                   VALAATLQHSAVSWIVLEKSGIRNIHDMANKRLMTVFPLSESLELLEPFRAEGIAPEKL
FT                   NLIQTVFDLQPLIDGKVDAYDGYVTNEPFLLEQKGIAYRLIDPRTYGIDFYGDVLFTSQ
FT                   NELRDHPERVAAFRKASMDGWRYAMAHPEEITDLILNKYAPQKTREHLRYEAKAMWDLM
FT                   QPEIIEIGHMNPGRWLHIAEVMVEHKRLIDDKALNSFIYNEEDYQPDLLRYLRIATIAS
FT                   IIALLLAGIATWIYRINRRLTREIAAREAAEQQLRRLSETDALTGLANRRAFDQQLHKE
FT                   FQRFLRYRHTFSIVMIDIDLFKRINDTYGHPAGDHVLTEFAWRLRDHIRKTDILARIGG
FT                   EEFAIMLPETYPWEAKKRTLLLQQIISKTPFKLSDTTDTPVMITASFGISSVAENDLIA
FT                   DAALIRADTALYEAKNNGRNQVILFNADRKPVLVADKTTA"
FT   gene            317922..319841
FT                   /locus_tag="Tola_0283"
FT   CDS_pept        317922..319841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0283"
FT                   /product="PTS system, mannitol-specific IIC subunit"
FT                   /note="TIGRFAM: PTS system, mannitol-specific IIC subunit;
FT                   PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; phosphotransferase system
FT                   EIIC; phosphotransferase system lactose/cellobiose-specific
FT                   IIB subunit; KEGG: aha:AHA_0551 PTS system
FT                   mannitol-specific EIICBA component (EIICBA-mtl) (EII-mtl)"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91913"
FT                   /db_xref="GOA:C4L8P3"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR004718"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR029503"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8P3"
FT                   /inference="protein motif:TFAM:TIGR00851"
FT                   /protein_id="ACQ91913.1"
FT                   /translation="MLSPDTKVKIQNFGRFLSNMVMPNIGAFIAWGFITALFIPTGWLP
FT                   SETLAKLVGPMIMYLLPLLIGYTGGKLVGGERGAVVGAVTTMGVIVGTDIPMFMGAMMA
FT                   GPLGGWTIKRFDRMIDGKVKSGFEMLVNNFSAGIIGMLLAIVAFFLIGPFVKGMSAALA
FT                   AGVGFLVENGLLPLTSIFVEPAKILFLNNAINHGIFSPLGIQQATEHGKSIFFLIEANP
FT                   GPGFGILLAYMMFGRGNAKQSAAGASIIHFLGGIHEIYFPYVLMNPRLILAVIAGGMTG
FT                   VFTLTLFNAGLVSPASPGSIFAVLLMTPKDSILGILCSVTAATAVSFLVASVFVRQQAT
FT                   NTTSDDLEGATRKMKSMKQGNVAASSAANDDGHSPLTAKHIVVACDAGMGSSAMGASLL
FT                   RKKIEKAGLPITVVNQAINNLDEKADIVITHRDLTDRAKRHAPNAQHISLNNFLDNQLY
FT                   DNLIARLQEAGEGRRPKAVAANDDVYRGENLSPALFTLGKEHICLGLKASNKEEAIRKA
FT                   GEMLVANGCVEPEYIDAMLEREKLVSTYLGESIAVPHGTIESKDKVKKTGIVICQYPAG
FT                   VQFGPEKDEVARLVIGIAARNDEHLQVINNLTCTLDDPSLIERLATTTDVKFVLELLSG
FT                   QRAA"
FT   gene            319899..321047
FT                   /locus_tag="Tola_0284"
FT   CDS_pept        319899..321047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0284"
FT                   /product="Mannitol dehydrogenase domain protein"
FT                   /note="PFAM: Mannitol dehydrogenase domain; Mannitol
FT                   dehydrogenase rossman domain; KEGG: asa:ASA_3756
FT                   mannitol-1-phosphate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91914"
FT                   /db_xref="GOA:C4L8P4"
FT                   /db_xref="InterPro:IPR000669"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR023027"
FT                   /db_xref="InterPro:IPR023028"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4L8P4"
FT                   /inference="protein motif:PFAM:PF08125"
FT                   /protein_id="ACQ91914.1"
FT                   /translation="MKALHFGAGNIGRGFIGKLLAESDAEVTFADANTQLVDQLNHSQE
FT                   YHVRVVGDNQHTDVIRHIAAVQANSDDVINQIIKADIITTAVGPQVLAKIAATIARGLQ
FT                   LRFEQGNYAPVNIIACENMVRGTSQLKQAVLAELPAQYHAQLEEYVGFVDSAVDRIVPP
FT                   AAANDEDPLAVTVESFSEWIVDKNQFRGDIPPVQGMELTDNLIAYVERKLFTLNTGHIV
FT                   TAYLGKLAGYKTIREAIADEEIQQAVRQAMQQSGEVLVKRYGFDRQLHHAYIEKILTRF
FT                   ANPYLVDEIDRVGRQPLRKLGAEDRLTKPLLGTLEYGLPNDALLKGIAAALHYRNADDP
FT                   QAVELQGWIEQDGVEAALLRATGLKADEPCVATIVAEYQRMA"
FT   gene            321182..321718
FT                   /locus_tag="Tola_0285"
FT   CDS_pept        321182..321718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0285"
FT                   /product="mannitol repressor, MtlR"
FT                   /note="PFAM: Mannitol repressor; KEGG: asa:ASA_3755
FT                   mannitol repressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91915"
FT                   /db_xref="InterPro:IPR007761"
FT                   /db_xref="InterPro:IPR038026"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8P5"
FT                   /inference="protein motif:PFAM:PF05068"
FT                   /protein_id="ACQ91915.1"
FT                   /translation="MNKVKVSTYQEDAVFERLAEPENPRGFFIEVVDMLEDAVDQLMRR
FT                   AFRQEEYAVKYAIEPLLNGKGPLADLHIRLKLIFALGLISYEVSQDIERFIRLRDFLVN
FT                   DIHDHRFGEECVKDHLNRLHSLQNISMMQIDEPTDNADPVLQQLQLNRRDQVIRSALLL
FT                   AVSGVLSELSKDSPI"
FT   gene            complement(321992..323737)
FT                   /locus_tag="Tola_0286"
FT   CDS_pept        complement(321992..323737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0286"
FT                   /product="PTS system, fructose subfamily, IIC subunit"
FT                   /note="TIGRFAM: PTS system, fructose subfamily, IIC
FT                   subunit; PTS system, fructose-specific, IIB subunnit; PFAM:
FT                   phosphotransferase system EIIC; phosphotransferase system
FT                   PTS fructose-specific IIB subunit; KEGG: vha:VIBHAR_05960
FT                   PTS system fructose-specific IIBC component"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91916"
FT                   /db_xref="GOA:C4L8P6"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8P6"
FT                   /inference="protein motif:TFAM:TIGR01427"
FT                   /protein_id="ACQ91916.1"
FT                   /translation="MNIVIVTSCPSGIANSVIAAGLLEKAAASLGWNAVVECHNNIEPA
FT                   KLLTVDEISTADLVVVAGDNIDLARFTGKRVYQAGVMDAIPDAKAFLQTAAAAATVTSA
FT                   EAVASQQTQEKPKVSPMSKRIVAITACPTGVAHTFMAAEALEEEAKKRGYWIKVETRGS
FT                   VGAKNALTAEEIAQADVVIIAADIELDLSRFAGKKLYKTSTGAALKKTAQEMDHALATQ
FT                   NVFQGGASAAASHSGKAELPGVYKHLMTGVSHMLPIVVAGGLLIALSFVFGIEAFKEEG
FT                   TMAAALMKIGGASAFALMVPVMAGFIAFSIADRPGLAPGLIGGMLASSIGAGFLGGIVA
FT                   GFIAGYAAKAIADNVKLPQTMEALKPILIIPLFASLITGLAMIYVVGTPIASIMKGLTD
FT                   FLTGMSGANAILLGIILGAMMCFDLGGPVNKVAYVFGTGLLASNPNVPSLPMAAVMAAG
FT                   MVPAIGMGIATFVARNKFIDSEREAGKASFVLGLCFISEGAIPFAARDPMRVIPSTMAG
FT                   GALAGALSMLFGCGLMAPHGGLFVLLIPGAISNALMYIVAIAAGSALTGLMYATIKPSQ
FT                   EVQTA"
FT   sig_peptide     complement(323678..323737)
FT                   /locus_tag="Tola_0286"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.840) with cleavage site probability 0.829 at
FT                   residue 20"
FT   gene            complement(323749..324687)
FT                   /locus_tag="Tola_0287"
FT   CDS_pept        complement(323749..324687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0287"
FT                   /product="1-phosphofructokinase"
FT                   /note="TIGRFAM: 1-phosphofructokinase; PFAM: PfkB domain
FT                   protein; KEGG: vch:VCA0517 1-phosphofructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91917"
FT                   /db_xref="GOA:C4L8P7"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR022463"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8P7"
FT                   /inference="protein motif:TFAM:TIGR03168"
FT                   /protein_id="ACQ91917.1"
FT                   /translation="MSKPLLTVTLNPALDLTGHIGQIQVGSVNVVKSGSLHPAGKGINV
FT                   ARVLRDLGADVAVTGILGAGNQQAFRDLFKQCGLTDHFMTVPGDTRINVKMVEDSGDVT
FT                   DLNFPGVAVAEDELKEFEARLLRQAEQHEYIVVAGSLPRGISAEASRDLIAKLQQKGAK
FT                   VLFDSSKEALVKGLEAKPFLIKPNEVELAEWAGRPLETEAELRQEAEKLRAAGITNVVI
FT                   SRGADGVLWLADNEWWSACPPRMEVVSTVGAGDSMVAGFAWGMSQGMDKEQILRLASAV
FT                   SALAVTQISVGVPNKQQLADMMARIDVKRLG"
FT   gene            complement(324680..325813)
FT                   /locus_tag="Tola_0288"
FT   CDS_pept        complement(324680..325813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0288"
FT                   /product="phosphocarrier, HPr family"
FT                   /note="TIGRFAM: phosphocarrier, HPr family; PFAM:
FT                   phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system EIIA 2; phosphoryl transfer system HPr; KEGG:
FT                   ppr:PBPRA1573 bifunctional fructose-specific PTS IIA/HPr
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91918"
FT                   /db_xref="GOA:C4L8P8"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8P8"
FT                   /inference="protein motif:TFAM:TIGR01003"
FT                   /protein_id="ACQ91918.1"
FT                   /translation="MLTLAEQDIQLGAKADDKQSAIRMVAQKMVDAGLIEAPYVEGMLR
FT                   RETQNSTYLGNGIAIPHGTTDTREQVKQTGVRVLHFADGVNWGDGQTAYVVIGIAARSD
FT                   EHLGILRQLTRVLADDSVADYLKHCKSTADLAKLLSGQKPTPTLLLDSSTVQLQTSAQD
FT                   IFGLQSTACVLLQNGGALDASGTAAIQASSPVWMGQGLWLARTNTGVKRTAVSLVRPAA
FT                   PFQHAGQPVQGLLLIAAQDALHKPVLDRLVDMISEQNVAQLWSAADSMKAVKLLTEKPI
FT                   EGLEGTFTITNPHGLHARPSATLVKVAKEFQSEIWVANLDGDGKSVNAKSLMKIVSLGV
FT                   KSGHRLQFIAKGDDAQQAISKIGQSIADGLGEGAGHE"
FT   gene            326070..327065
FT                   /locus_tag="Tola_0289"
FT   CDS_pept        326070..327065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0289"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="KEGG: ppr:PBPRA1572 DNA-binding transcriptional
FT                   regulator FruR; TIGRFAM: D-fructose-responsive
FT                   transcription factor; PFAM: regulatory protein LacI;
FT                   periplasmic binding protein/LacI transcriptional regulator;
FT                   SMART: regulatory protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91919"
FT                   /db_xref="GOA:C4L8P9"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR012781"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8P9"
FT                   /inference="protein motif:TFAM:TIGR02417"
FT                   /protein_id="ACQ91919.1"
FT                   /translation="MKLEEIARLAGVSRTTASYVVNGKAEQHRISEKTRERVMAVVNQY
FT                   NYKPDQAATALRLGSSRLFGFILPDLENTSYARLAKLLEAGARAHGFQLIITCSDDNPE
FT                   TEKALAEMLTSRRIDALLVSTVLEPYNDFYPRLQQKGLPVIAIDRALDDEKFASVISED
FT                   LDGAIRLTNSLLSPLPASIGLLGAVPDLGISHERERGFRAALRSADITGEPLIAYGEHF
FT                   SRSEGARICADWIARGVMPEALVTTSYVLLEGVLNTLQEHPELMKNLRLATFGDNQLLD
FT                   FLPVKVNALPQQFSLIAERALALALAATEHNYTPGVEVIPRRLKVRSHTG"
FT   gene            327138..327605
FT                   /locus_tag="Tola_0290"
FT   CDS_pept        327138..327605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0290"
FT                   /product="sugar-phosphate isomerase, RpiB/LacA/LacB family"
FT                   /note="TIGRFAM: sugar-phosphate isomerase, RpiB/LacA/LacB
FT                   family; ribose 5-phosphate isomerase B; PFAM:
FT                   Ribose/galactose isomerase; KEGG: pin:Ping_3554
FT                   sugar-phosphate isomerases, RpiB/LacA/LacB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91920"
FT                   /db_xref="GOA:C4L8Q0"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8Q0"
FT                   /inference="protein motif:TFAM:TIGR00689"
FT                   /protein_id="ACQ91920.1"
FT                   /translation="MKIAMASDHAGFSLKEEIKAYLQSQGHEVLDFGAHSEDACDLPDT
FT                   VYPAALAVGEGKADRGIFVDGVGYGSAMIANKIYGVFAAVCQDPFCANLARSHSDTNVL
FT                   CIGGKIIGSAIAMEIVKTWMTTEYLGHTEEKYRRRVGKVQEIAEKHLKKLS"
FT   gene            327751..329121
FT                   /locus_tag="Tola_0291"
FT   CDS_pept        327751..329121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0291"
FT                   /product="MATE efflux family protein"
FT                   /note="TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE; KEGG: aha:AHA_1500
FT                   Na+ driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91921"
FT                   /db_xref="GOA:C4L8Q1"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8Q1"
FT                   /inference="protein motif:TFAM:TIGR00797"
FT                   /protein_id="ACQ91921.1"
FT                   /translation="MTSVSAVRSQSLFQITWPLFIDLALHFLTAALNTFMISHVSYQAV
FT                   AALSVGNQFFDVSITLFNFVGIGSSVVITQYLGAGQRDVARRVVQQAIGFNALIGLVVA
FT                   LGVLFGATPILQLMNMPEHLQSMGHVYLQIIALCLLPEAIALCLAASLRAYGYTREAMY
FT                   VTVIVNLVTLVGNALLLYGWFGLPQMSVAGVAWSTVAGRVIGVMLLVWLIRRRIGLQLR
FT                   WAECCRFSSDIISKIMKIGLPAAGENLSWMLQMMVITSFVALLGDKMLATQSYFFQISL
FT                   FVMLFGIAIGLGTEIMIGHLVGAGELDQAYHRLMRSLKIGLVVTVLSVALVVVSGPYLM
FT                   ELFTADEVILATAGQLFLLSLILEPGRTFNIIVISSLRATGDARFPFRMALISMWGIAI
FT                   PIAYLCGIHWAWGLVGIWCGFVVDEWVRGLTMFWRWRSRRWEKKVLVQRTAPANQAH"
FT   gene            complement(329146..330540)
FT                   /locus_tag="Tola_0292"
FT   CDS_pept        complement(329146..330540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0292"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: hch:HCH_01213 outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91922"
FT                   /db_xref="GOA:C4L8Q2"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8Q2"
FT                   /inference="protein motif:TFAM:TIGR01845"
FT                   /protein_id="ACQ91922.1"
FT                   /translation="MNKLSPLYLALCILTACSQHTASPPQKDLSPATPAQWQNNLFSAQ
FT                   EVLKQAHWWQAFQDPALDQLIQQVLEKNNDLAVAALKVRQARLNAGLTATNLTPDLSAA
FT                   LSAEKQKTWQQTAAVNSNDTATYNTALSLNYELDLWGKLADERAAANFEAEATEQDRQA
FT                   SALSLIGTTATLYWQQGYLNEQIRLNQESLTYTRQALKIANAHYQAGANSKLDVLQAEQ
FT                   SVASQLASHELLLQQREENQNALAILLDQPPGATLPLPSALPVTPIPDIPAGLPADVLA
FT                   QRPDVKAAELRVRSDYATRQYTAKSYYPTFSLTGALSTGSEQLHSVLRNPTGSIGTGLT
FT                   LPFIEWQTTRLSIAKQQVVYEQTVRNFRQTFYTALSEVENQLSARQHYLNAASQLVHSL
FT                   ALAQQTETITAVRYHAGEIEMQNWLEQQENRRTAEKELLDNRYQQLTTQLALYQALGGN
FT                   PARQQN"
FT   sig_peptide     complement(330475..330540)
FT                   /locus_tag="Tola_0292"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.967 at
FT                   residue 22"
FT   gene            complement(330533..332512)
FT                   /locus_tag="Tola_0293"
FT   CDS_pept        complement(330533..332512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0293"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; protein of unknown
FT                   function DUF214; SMART: AAA ATPase; KEGG: glo:Glov_0394 ABC
FT                   transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91923"
FT                   /db_xref="GOA:C4L8Q3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017911"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8Q3"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACQ91923.1"
FT                   /translation="MKMMQTPPLMELQQISRHFQTGDERLTVLHEISLSIYAGEMVAII
FT                   GASGSGKSTLMNILGCLDRPSSGDYRVNGRSTATLSSDQLADLRRDCFGFIFQHYHLLS
FT                   HLKAEGNVEIPAIYAAQHKHTRIQRARSLLQRLGLADKQSNRPGQLSGGQQQRVSIARA
FT                   LMNGGDVILADEPTGALDSQSGKEVMQILRQLHRQGHTIVLVTHDQNIAAHAERVIEIS
FT                   DGRIIADHRQTASHIELPDNDASLPEQPAEPHTFRWWSRQWTRFSEAFRMAWISMLTHR
FT                   MRTLLTMLGIIIGITAVVSVVAVGQGARNKVISDISSMGTNTIDVYPGKDWGDRNASAI
FT                   QTLTPQDLPLLSGQIYTDSVTPNVSTNALLRDGGQALKAMVYGVAGQYFQVKDLQMVFG
FT                   KAFDQRAVEQLEPVVVIDHNTRIKLYGEHINPVGKVILLNNLPCRIIGVTAEKKSSFDT
FT                   QNLNAWLPYTSAMYRLMGQHYFSSVSVRIKDGVSSGIAEQQIIKLLTRAHGRKDFYTRN
FT                   SDSILQTIEKTTATLTLLISSIAVISLIVGGIGVMNIMLVSVTERTREIGIRMAVGARQ
FT                   QDILQQFLIEAVMVCLLGGSLGILLSFAVSAVFSMLVSSMQMAFSIWSLLAAFLCSSLI
FT                   GVLFGYLPARNAARLDPIEALARE"
FT   gene            complement(332509..333711)
FT                   /locus_tag="Tola_0294"
FT   CDS_pept        complement(332509..333711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0294"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   yen:YE1200 HlyD family secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91924"
FT                   /db_xref="GOA:C4L8Q4"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8Q4"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ACQ91924.1"
FT                   /translation="MVFLKKRWLYFLLPLLAMFAVFAVLQRPEPVQYITSPVRYGNIEQ
FT                   TVLASGTLNAVNQVNVGSQVSGQLKSLKVALGDQVTKDQLIAEIDPILQQYTLRQAQAS
FT                   LDSAKAQKQAKQALLRQYELAYRRQQQMWRQDATSKASLEEAAATLDTTRAAINQLDAE
FT                   ITSAQVSVDTAKANLGYTRITAPISGTVVSIVTKEGQTVAASQSVPTIIKLANLDTMTV
FT                   KAEISEADVIHVKPGMSVWFTTLGDPDKRYHATLRAIEPASTSDSSDDDSSSSSSSSSD
FT                   SSSSSSSAVYYNGLFDIANMDHKLRVSMTAQVTIVSGEAKNVLLVPIAAVENNAQQQST
FT                   VRVLEQGKVISKIIQTGLKDSLNIQIISGLKEKEQVILGDSQSSTDNAGNSGQMMPPPG
FT                   P"
FT   sig_peptide     complement(333640..333711)
FT                   /locus_tag="Tola_0294"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.945 at
FT                   residue 24"
FT   gene            complement(333808..334719)
FT                   /locus_tag="Tola_0295"
FT   CDS_pept        complement(333808..334719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0295"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: aha:AHA_2858 drug/metabolite exporter
FT                   family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91925"
FT                   /db_xref="GOA:C4L8Q5"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8Q5"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACQ91925.1"
FT                   /translation="MSPKDWGFALLIVFAWGFNFVIIHWGLDGVPPLLLGALRFTLVAF
FT                   PAILFVPRPRISWRWLLAYGLTISFGQFAFLFTAMKIGMPAGIASLVLQSQVLFTLLFA
FT                   ALLLREHWLPHQPFTLGIAALGLFVLATQQGQNGMTLAGFLLTVAAAASWGMGNIINRY
FT                   ITREGSLNLLSLVVWSGLIPPVPFFIASYWLEGPALIAESLQQIQLHSVLAVVYLALVA
FT                   TLYGYVAWGRLLQRYPVAQVAPLTLLVPLVGLMCARLFLDEQLTRWQWLGILLVLLGLV
FT                   LNIFWPRYLRLRRQSAQQQPKA"
FT   gene            complement(334815..335900)
FT                   /locus_tag="Tola_0296"
FT   CDS_pept        complement(334815..335900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0296"
FT                   /product="molybdate ABC transporter, ATPase subunit"
FT                   /note="KEGG: dar:Daro_2784 molybdate ABC transporter
FT                   ATP-binding protein; TIGRFAM: molybdate ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related; TOBE domain
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91926"
FT                   /db_xref="GOA:C4L8Q6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR011868"
FT                   /db_xref="InterPro:IPR015852"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8Q6"
FT                   /inference="protein motif:TFAM:TIGR02142"
FT                   /protein_id="ACQ91926.1"
FT                   /translation="MHDIEIRLCWSRSEFQLDVALQLPGQGVSALFGPSGCGKTTCLRA
FT                   IAGLEKLPDAYIAIGDEVWQDSARNIFIPPHQRALGYVFQEASLFPHLSVEQNLLFGVK
FT                   RLPPQHPKADQSYICQLLGIQSLLQRHPHQLSGGERQRVAIARALLLAPRILLMDEPLS
FT                   ALDQARKQEILPYLERLHRQLSIPIIYVSHAADEVSRLADHLVLLQQGKVVASGALNET
FT                   LTRLDLPADFTEQAGVVWEMTLHELEDDGLAELKTKTSDQMSLLVAQTAQALGSSVRCR
FT                   IDARDVSLSLHKAVDSSILNLLPATITGMVPADTPGHLLIKLQAGQQPLLARITQRSAK
FT                   ALQLQSGMTVWAQIKAVALLE"
FT   gene            complement(335893..336570)
FT                   /locus_tag="Tola_0297"
FT   CDS_pept        complement(335893..336570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0297"
FT                   /product="molybdate ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: molybdate ABC transporter, inner membrane
FT                   subunit; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: molybdate ABC transporter,
FT                   inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91927"
FT                   /db_xref="GOA:C4L8Q7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8Q7"
FT                   /inference="protein motif:TFAM:TIGR02141"
FT                   /protein_id="ACQ91927.1"
FT                   /translation="MTEQDWSTVWLTLKLALLVTGILLLIATPLAWWLAQTRSRYKPLF
FT                   NAALSLPMVLPPTVLGFYLLLLLGPHGPAGKLLIALDWQALPFSFNGIVLGAVLHSLPF
FT                   AIQPIQNAFEAIGRRPLEVAATLRASPVDCFFSVALPLARPGLVTAAVMAFCHSIGEFG
FT                   VVLMIGGSIPGETKVLSILLYEHVENQEYQQAHWLAGGMVIFAMLALMLIYWFGNSRRT
FT                   HHA"
FT   gene            complement(336584..337435)
FT                   /locus_tag="Tola_0298"
FT   CDS_pept        complement(336584..337435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0298"
FT                   /product="transcriptional regulator, ModE family"
FT                   /note="PFAM: TOBE domain protein; regulatory protein LysR;
FT                   KEGG: dar:Daro_1477 molybdenum-binding protein,
FT                   N-terminal:molybdenum-pterin binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91928"
FT                   /db_xref="GOA:C4L8Q8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR004606"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR016462"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8Q8"
FT                   /inference="protein motif:PFAM:PF03459"
FT                   /protein_id="ACQ91928.1"
FT                   /translation="MSRRLTSTQPSLLGELKLCTEVGPSLGDSRIQLLEAIERLGSLSQ
FT                   AAKSIPLSYRAAWDALDEMNNLAEQPLVIRTAGGKNGGGTQLTAYGKQAVALYRALQTE
FT                   YQQALARIQQQLQRASCQQGNDYYDIGQFRRLLRRISMRSSARNQFIGTVVAMHTAPVD
FT                   FEVTLQLSDNVQLIAVITRESAETLGIALGQELYALVKSSSVMLVTDRQLKLSPRNQLW
FT                   GQISKIHQGPVNSEVVINLPGDKSVCAVVTTESVNTMQLMENQEVCAAFKASSVLLCGY
FT                   SG"
FT   gene            complement(337613..338377)
FT                   /locus_tag="Tola_0299"
FT   CDS_pept        complement(337613..338377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0299"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; Autoinducer-binding
FT                   domain protein; SMART: regulatory protein LuxR; KEGG:
FT                   asa:ASA_3763 transcriptional activator AsaR"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91929"
FT                   /db_xref="GOA:C4L8Q9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR005143"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036693"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8Q9"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ACQ91929.1"
FT                   /translation="MQNFTFPQEEQHFRIQNCKTPQMLANQLTILCAANNFEYYQLCLT
FT                   LRRGLQQTDLTLLTQTPDNWAEHYAKNNTIQNDSLYQRAQTQSRPLFWQSEAKPEHENF
FT                   LPMDCWRQFGMEEGIAVPLHGPAGFCGYFALSRHKKEPIRLQDFFHLSYLGHILQEQAI
FT                   QLFSPEQSNLSGREKECLFWVSEGKTSWEIAQILGITERTVNFHLNNAIRKSGCKNRYQ
FT                   TVAKNIITGELAHTVTRINLTHLLQSPQSLSA"
FT   gene            338618..339982
FT                   /locus_tag="Tola_0300"
FT   CDS_pept        338618..339982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0300"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /EC_number="2.3.1.157"
FT                   /note="KEGG: aha:AHA_4260 UDP-N-acetylglucosamine
FT                   pyrophosphorylase/glucosamine-1-phosphate
FT                   N-acetyltransferase; TIGRFAM: UDP-N-acetylglucosamine
FT                   pyrophosphorylase; PFAM: transferase hexapeptide repeat
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91930"
FT                   /db_xref="GOA:C4L8R0"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4L8R0"
FT                   /inference="protein motif:TFAM:TIGR01173"
FT                   /protein_id="ACQ91930.1"
FT                   /translation="MSLHVVILAAGKGTRMRSSLPKVLHPVAGRPMVSHVIDTARSLNA
FT                   EKIHLVYGHGGEAMQARLNDADVEWVLQAEQLGTGHAVAQAMPTIPDHAKVLVLYGDTP
FT                   LISPVTLETLLTIQPANGIGLLTVSLANPTGYGRILRADGQVVGIVEQKDATAEQQLIN
FT                   EVNTGVLVAPAKQLKQWLSGLTNLNAQGEYYLTDVIAAAHHSGSSIQTAQPVCAQEVEG
FT                   ANNRLQLAQLERFYQKRAAEQLMLEGVTLLDPARFDLRGTLQCGEDVLLDVNVIIEGQV
FT                   ELGHRVQIGAGCVLKNCRIADDSIISPYSIIEGSVLAEGCTVGPFARLRPGAELAAQAH
FT                   VGNFVELKNARLGLGSKAGHLSYLGDSEIGANVNIGAGTITCNYDGANKHKTIIEDDVF
FT                   VGSDTQLVAPVRVAKGATLGAGSTITRDVGEDELVLTRVRQHHITGWHRPVKQKK"
FT   gene            340118..340891
FT                   /locus_tag="Tola_0301"
FT   CDS_pept        340118..340891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0301"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: regulatory protein DeoR; Helix-turn-helix type
FT                   11 domain protein; SMART: regulatory protein DeoR; KEGG:
FT                   aha:AHA_4255 glucitol operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91931"
FT                   /db_xref="GOA:C4L8R1"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8R1"
FT                   /inference="protein motif:PFAM:PF08220"
FT                   /protein_id="ACQ91931.1"
FT                   /translation="MIKRNTQQRRHAIISLLNEQGEVSVEDLSQRFETSEVTIRKDLAE
FT                   LERSGVLLRRYGGAIPLPSEILAEEVPAKVSKRKLAIAQAAVQHIRDHNRIIIDSGSTT
FT                   GAMIPLLATKRGLVVMTNSLTVAQALRELENEPTLLMTGGTWDPHSEAFQGQVAEQVLR
FT                   SYDFDQLFIGADGVDPARGTITFNELVGLSRVMAEVAREVIVLVDSEKFGRRIPNLELP
FT                   WSAIDTLITDDGIGEELKVQIEQHGVRVIRVPVTG"
FT   gene            340996..342831
FT                   /locus_tag="Tola_0302"
FT   CDS_pept        340996..342831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0302"
FT                   /product="glucosamine/fructose-6-phosphate
FT                   aminotransferase, isomerizing"
FT                   /note="TIGRFAM: glucosamine/fructose-6-phosphate
FT                   aminotransferase, isomerizing; PFAM: glutamine
FT                   amidotransferase class-II; sugar isomerase (SIS); KEGG:
FT                   asa:ASA_4342
FT                   glucosamine-fructose-6-phosphateaminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91932"
FT                   /db_xref="GOA:C4L8R2"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8R2"
FT                   /inference="protein motif:TFAM:TIGR01135"
FT                   /protein_id="ACQ91932.1"
FT                   /translation="MCGIVGAVAQRDIAEILVEGLRRLEYRGYDSAGVAIISPQGELQR
FT                   VRRLGKVQELAAALEQQPLSGGIGIAHTRWATHGEPSEANAHPHVSNGDLAVVHNGIIE
FT                   NYEELREKLQGLGYEFVSQTDTEVIVHLVHHYLKTSDSLLQALQTTVKDLRGAYGTVLM
FT                   DRRDPSRLVVARSGSPLVIGRGLGENFIASDQLALLPVTRRFIFLEEGDVAEVTRRGVQ
FT                   IFNVAGQPVERAEIESELSHDAGDKGHYRHYMQKEIYEQPQAILNTLEGRLVGNHIVPE
FT                   AFGTHAREIFQKVKHVQIVACGTSYHSGMVARYWFESLAGVSCNIEIASEFRYRKSVVH
FT                   PNSLIITLSQSGETADTLAALRLAKELGYMASLTLCNVPGSSLVRESDLAFMTRAGAEI
FT                   GVASTKAFTTQLTGLLMLVTAIGRCNGQMTETDERCVASALQALPSQIEQALKLDKQIE
FT                   PLAEQFANKQHSLFLGRGDQYPIAMEGALKLKEISYIHAEAYAAGELKHGPLALIDSEM
FT                   PIIVVAPNNELLEKLKSNVEEVRARGGLLYVFADRAAGFSSDDTMRVMPMESVADIIAP
FT                   IVYTIPMQLLAYHIALIKGTDVDQPRNLAKSVTVE"
FT   gene            342991..343821
FT                   /locus_tag="Tola_0303"
FT   CDS_pept        342991..343821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0303"
FT                   /product="TnsA endonuclease"
FT                   /note="PFAM: TnsA endonuclease; KEGG: asa:ASA_4341
FT                   transposon Tn7 transposition protein TnsA"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91933"
FT                   /db_xref="GOA:C4L8R3"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR014832"
FT                   /db_xref="InterPro:IPR014833"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8R3"
FT                   /inference="protein motif:PFAM:PF08721"
FT                   /protein_id="ACQ91933.1"
FT                   /translation="MARKNYFLSEKLIEQRIKDGRGQGYVEKYQPWLRVQDVPSDGRSH
FT                   RIFSHKTKRIHHLLSDLELATFLLFDWSESVLDIREQFPLIRDDTRIIAQREGIKHPVT
FT                   QGVDLVMTTDFLIDAKDPFPAQFAVQVKYQESFKDPRTIEKLDLERCYWQQKGIPWVTI
FT                   TEQDIDVQIRKNIEWLYSVKIDDITSTKQISETMAFLPAAVARFSEFSVIDACKHIDLA
FT                   YELELGQSLRDLRLLMANRLAVFDIRKPVHQLKIADIKFMQLNGMEPFLYVENQ"
FT   gene            343805..345892
FT                   /locus_tag="Tola_0304"
FT   CDS_pept        343805..345892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0304"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   spc:Sputcn32_3935 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91934"
FT                   /db_xref="GOA:C4L8R4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8R4"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ACQ91934.1"
FT                   /translation="MWKINEVLSFDDVRYRILHIHQSEIIWINIDENKGIPKLVLHLQL
FT                   IEWMDNGRLVRSQDPYAYLIHEEPLVDSAAFKKREHAYQVISPVIFDDQCFDTTVRAQR
FT                   IKHVEQTGIATKANIYRLLRQYWQRGQTLNALLPDFKNQGAPNKKRAATNTNKVGRKRQ
FT                   YGDSVGIKIDENIERLMRLAIEEKLLASTQLSIAKVLRDFKSKFIQYYPDVSKENLPTR
FT                   RQFEYFYKREYDQSVRVKARTDDGIYKKDVRPLTGTATAASFGPGSRYEIDATIADIYL
FT                   VADDDRSKIIGRPTLYIVIDVFSRMIVGFYIGFDNPSYVVAMQAFINACVDKTEICHSL
FT                   GLNISVDDWPCIGLPDVVLADRGELMSNQLDSLISTFNVRIESAPPRRGDAKGIVERCF
FT                   KTLQAEFKPYAPGVVVGNKIKKHGEQDYRLNAAITISDFARIIIRSILFRNNHHVLTKY
FT                   DRDADLPIDMPSIPIYLWRWGLQNRTGRLRTVDPEFLRIAVLPREKVSVSTSGVCLWGM
FT                   YYTSSEMLREGWLLRSQEVNRPDKLEAAYDPGCADTIYLFPQSGSRGYWICSLTEQSRR
FT                   FRGMTFWQVWDIQKEEKHSQANAKFDEDVHRRELDDFIQGVIAESKKLLPNIQESNQQR
FT                   IQQIRSNKKEAREQERQQRTKSNTVQPEQNIAEVIPLQSSEDDYSYPSFIPGLFETDED
FT                   E"
FT   gene            345895..347556
FT                   /locus_tag="Tola_0305"
FT   CDS_pept        345895..347556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0305"
FT                   /product="AAA ATPase"
FT                   /note="SMART: AAA ATPase; KEGG: ssn:SSON_3893 ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91935"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR021542"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8R5"
FT                   /inference="protein motif:SMART:SM00382"
FT                   /protein_id="ACQ91935.1"
FT                   /translation="MTTSRITAIYRDTGVEAYKANPLIEALPPLLDAYDATLDLKATLK
FT                   FEASDLAQSRVIRAHNICRIQDDFFQPLSSHMALNERVSIMIRGGYVGRNPQNGMLQRH
FT                   LQNGYERVQRGELSAFRYDDVGSTAQSLLLIGCSGCGKTTSLKRILSAYPQVIYHPEMN
FT                   LEQVVYLKIDCSHNGSLKEICLNFFRALDRALGENYEKRYGLKKHGIETMLALMAQIAN
FT                   AHALGLLVIDEIQHLSRSKSGGSQEMLNFFVTMVNTIGVPVMLIGTPKARDIFEADLRS
FT                   ARRGAGFGAIYWEPMPQYVKGAPNNEWIGFTNNLWKLQLLQKRDLLLSDDIRALWFDLS
FT                   QGVMDIVVKLFILAQLRALAIGKERITTGLLQQVYDDDLIPVHPMLDALRSGIPERIAR
FT                   YSDLMVPEMDKRLIQLQQKISSISQETPATLAMKELPTEDEQRIYMMLQEDYDSTLLVK
FT                   TIRNAFSQHPQLTRQQLLPIILEWLMTSVGEVDTPSEIAKPKKQTSIIKSKDWDTLQTD
FT                   SLRYMYSQNSAPTAIYNEMVKAGYILKLSDILQKAG"
FT   gene            347561..349078
FT                   /locus_tag="Tola_0306"
FT   CDS_pept        347561..349078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0306"
FT                   /product="transposition protein"
FT                   /note="KEGG: spc:Sputcn32_3931 transposition protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91936"
FT                   /db_xref="InterPro:IPR009492"
FT                   /db_xref="InterPro:IPR032750"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8R6"
FT                   /inference="similar to AA sequence:KEGG:Sputcn32_3931"
FT                   /protein_id="ACQ91936.1"
FT                   /translation="MKLPAPHPNELIYSTVARAGVYFGLVSPKQLLDEVFADRKVIATL
FT                   DLPSHLQSIVGLLSGTGLYDLETLVYKHTLFPLYAPFVPEHIRQKAIKRMSDRADGAVH
FT                   LMLGVATSRIKSVRTFRFCPICMERQLHTYGEYYWQRDWFLPELPVCPEHGCLIDTSIH
FT                   LDEHRHQFVPLNPACFTTKTSNKYVANDLPLALAAAELLEQPAQQSPTFAQWTHFYHEI
FT                   ATESGCGRGKQVDHEKILNLVCSRFDIRYLENKGLLKQSQSNSFWLRSIFRKHRKSFSF
FT                   FEHLIVWQALVPALSVSEIFIKVRRYAPETVLKKSQSSVDNAISISDECRMYRQKWEAL
FT                   VLQHGVKPARHQATGGSLYAWLYRHDRDWLLTFNEQQKRPLKTVNNRVDWHLRDRQLVR
FT                   HLIRIHLLSENHPVHQRMSATWLLNQLPHKNSVAKKLHKLPLTHQFLVRYAESVTEYQL
FT                   RRISQFIVESREKHMEIRRWSLFRNVGLSEQRITPDTMKILDSLTYL"
FT   gene            349090..350706
FT                   /locus_tag="Tola_0307"
FT   CDS_pept        349090..350706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0307"
FT                   /product="transposition regulatory protein"
FT                   /note="KEGG: spc:Sputcn32_3930 transposition regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91937"
FT                   /db_xref="InterPro:IPR041419"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8R7"
FT                   /inference="similar to AA sequence:KEGG:Sputcn32_3930"
FT                   /protein_id="ACQ91937.1"
FT                   /translation="MVPIEGFDENVRIVHIGDLFKKIGTKDWKINVFGSPIQDKKYTRF
FT                   ANLPLLSRDKIINATKPDRSSVDRIIHLRPKHQIESVFLSDFSELSDYESVVRAEGTQK
FT                   AFKIKQRNQPTIYIPQLELAKAIFLIDSYLCRACTSTTHLSLEFDVKPKNSEGHVDIHV
FT                   LKTTTFPLDAFDQNGTRMILAWLLTNKAALQSFESIYRRLDKERQSDKTWERWTFNFDP
FT                   PDMTNWKFHVKGKMSHKQQAYLVHEIIGVEIDSEMPDSVQFHNPSFIRRKPKEHTALEG
FT                   GGDSQSWHVRPDELSIDDIESASDENNTIVLDDGRLWVSFSKPCSVTKKTKEKDITKVS
FT                   ENGDNGILAGEKVSTSDAHQGGTLPSADVGGKQDLSDKEKECASRFQSFNDMLKILEHK
FT                   HGCTKLDTKMIELPKVGRSRKHLLANGLQRVIQYVKIKTTNVTVRLLEIDTSDGEKMIS
FT                   TKILYGAGDKDWLENFKSIREGVISKRLSWPTALLDDLYGEKGHKGTNHPQHQGAQAGN
FT                   IPVDALESWAGRVFADIERIR"
FT   gene            350834..351115
FT                   /locus_tag="Tola_0308"
FT   CDS_pept        350834..351115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0308"
FT                   /product="protein of unknown function DUF134"
FT                   /note="PFAM: protein of unknown function DUF134; KEGG:
FT                   ppr:PBPRB1238 putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91938"
FT                   /db_xref="InterPro:IPR002852"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8R8"
FT                   /inference="protein motif:PFAM:PF02001"
FT                   /protein_id="ACQ91938.1"
FT                   /translation="MGRPKIPRNICGKPADSCFKPNGIPMSELERIDLAPDEFEALRLV
FT                   DLQGMLQQDAAVVMGVSRQTLANLVKAARCKVVDCLVHGKALMMHQPD"
FT   gene            complement(351241..351366)
FT                   /locus_tag="Tola_0309"
FT   CDS_pept        complement(351241..351366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0309"
FT                   /product="ribosomal protein L36"
FT                   /note="TIGRFAM: ribosomal protein L36; PFAM: ribosomal
FT                   protein L36; KEGG: vsa:VSAL_I0889 50S ribosomal protein
FT                   L36"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91939"
FT                   /db_xref="GOA:C4L8R9"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8R9"
FT                   /inference="protein motif:TFAM:TIGR01022"
FT                   /protein_id="ACQ91939.1"
FT                   /translation="MKVLSSLKSAKTRHPDCQIVKRRGRVFVICKTNPRFKARQG"
FT   gene            351558..351929
FT                   /locus_tag="Tola_0310"
FT   CDS_pept        351558..351929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0310"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mca:MCA0357 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91940"
FT                   /db_xref="GOA:C4L8S0"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8S0"
FT                   /inference="similar to AA sequence:KEGG:MCA0357"
FT                   /protein_id="ACQ91940.1"
FT                   /translation="MLLLIGLALIGLSAGVLSGLFGIGGGILIVPALMYGLGFSQKLAT
FT                   GTSLAILLPPVGIAAVMEYYRQGAVDMKAAMIIAVMVVVGSWFGSKFSVGIDPVMMKLL
FT                   FGIFLILLGGYIIYDATSG"
FT   sig_peptide     351558..351614
FT                   /locus_tag="Tola_0310"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.849) with cleavage site probability 0.618 at
FT                   residue 19"
FT   gene            352107..352631
FT                   /locus_tag="Tola_0311"
FT   CDS_pept        352107..352631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0311"
FT                   /product="Disulphide bond formation protein DsbB"
FT                   /note="PFAM: Disulphide bond formation protein DsbB; KEGG:
FT                   asa:ASA_2303 disulfide bond formation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91941"
FT                   /db_xref="GOA:C4L8S1"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR022920"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8S1"
FT                   /inference="protein motif:PFAM:PF02600"
FT                   /protein_id="ACQ91941.1"
FT                   /translation="MTFWLRHITRERSAWLLLGLSAVFLEVCALLFQHGLGLRPCLMCI
FT                   YERLAVIGLFGSALIALIDPAKSLWRWGGLILWGLSIYRGLQLSLRHVDYLLHPSPFNS
FT                   CAFFPDFPAWLPLDIWFPWWFKPLAECSERQWNLWGWELPQWLVLIFSVYLIVWIVIVA
FT                   ANLLTHKYLAE"
FT   gene            352730..353152
FT                   /locus_tag="Tola_0312"
FT   CDS_pept        352730..353152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0312"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG: amc:MADE_01084
FT                   ferric uptake regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91942"
FT                   /db_xref="GOA:C4L8S2"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8S2"
FT                   /inference="protein motif:PFAM:PF01475"
FT                   /protein_id="ACQ91942.1"
FT                   /translation="MSIKKLKKAGLKITNQRMSVLDYLSDADERHFSAEDIFRDLRLNG
FT                   ADVGQATVYRVLNQLEKAGMLERHHFEGSKAYYELKSKEHHDHLVCLRCGKIVEFFDPL
FT                   IEQRQKEIAEQYGIQLSHHHLCLFGYCSDPDCKLKN"
FT   gene            353447..353992
FT                   /locus_tag="Tola_0313"
FT   CDS_pept        353447..353992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0313"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_1975 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91943"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8S3"
FT                   /inference="similar to AA sequence:KEGG:Sfri_1975"
FT                   /protein_id="ACQ91943.1"
FT                   /translation="MITAIPMKEDRVASHFTKADSFVFVNENGDVLSRKANPALNANCS
FT                   GKKDLLAMLLAENAKRVIVRNIGERILGKLLESQFAVFQTSCGRQNVQELVSAQANKLV
FT                   LMTSSSQGRQSLNYEAKQANGGCGCEHDGHEPHQSCCGQDGQHEHSHHQHGAGRCCQNR
FT                   SDAQKTGHGHGKGRCCHS"
FT   gene            353989..354156
FT                   /locus_tag="Tola_0314"
FT   CDS_pept        353989..354156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0314"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91944"
FT                   /db_xref="GOA:C4L8S4"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8S4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACQ91944.1"
FT                   /translation="MNIWIAVLAGFISLLIIAVAMMGFFFLLTKAVEKSVLSEEKNNNA
FT                   ESGKETTIHF"
FT   sig_peptide     353989..354084
FT                   /locus_tag="Tola_0314"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.860 at
FT                   residue 32"
FT   gene            354257..354904
FT                   /locus_tag="Tola_0315"
FT   CDS_pept        354257..354904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0315"
FT                   /product="Peroxiredoxin"
FT                   /EC_number="1.11.1.15"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   swi:Swit_3743 1-Cys peroxiredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91945"
FT                   /db_xref="GOA:C4L8S5"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR022915"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8S5"
FT                   /inference="protein motif:PRIAM:1.11.1.15"
FT                   /protein_id="ACQ91945.1"
FT                   /translation="MTEAGNNVAMPRLNEAAPSFTAKTTHGMLSLSDYKGKWLILFSHP
FT                   ADFTPVCTTEFMGFAKAGGDFKALNCELLGLSIDGVHAHIAWARSIKDNFGVEINFPII
FT                   ADLNMAVARSYGMVQPGASDTSAVRATFVIDPDGVLRAMLYYPMSNGRSVAEILRLVKA
FT                   LQTTDNNVCATPENWQPGDEVIVPPPATTMAAEARKSEGFNYTDWYFSKRKL"
FT   gene            354959..355936
FT                   /locus_tag="Tola_0316"
FT   CDS_pept        354959..355936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0316"
FT                   /product="C4-dicarboxylate transporter/malic acid transport
FT                   protein"
FT                   /note="PFAM: C4-dicarboxylate transporter/malic acid
FT                   transport protein; KEGG: ppr:PBPRB1236 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91946"
FT                   /db_xref="GOA:C4L8S6"
FT                   /db_xref="InterPro:IPR004695"
FT                   /db_xref="InterPro:IPR038665"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8S6"
FT                   /inference="protein motif:PFAM:PF03595"
FT                   /protein_id="ACQ91946.1"
FT                   /translation="MSNIQTDHGIVAEQSRLLHFPVSFFSIVMGLSGVTLAWKAAGQPT
FT                   PAAIPFMLMLFTSLVMVVITSFYAVKLLRYPSAVLDELRHPVRLNFFPAFSISLLLLSV
FT                   AWQDYSQISFGLWLCGAVIQFCLTLYVMSSWIHHSHYTLSHANPSWFIPVVGNIIVPIT
FT                   GSHFAYTEVSWFFFSIGLVFWLVLLTIVLYRLFFHEPLPARLTPMLFILLAPPSVGFVS
FT                   YSGLVGGLDNFGRVLYYIALFLSLLLFSNVLRFIRLPFFLSSWAYSFPVAALTIATKKM
FT                   FMFTALPLFNVLFMALISILSLLVLWLVVRTCKAVIAGELCRPE"
FT   gene            355988..357697
FT                   /locus_tag="Tola_0317"
FT   CDS_pept        355988..357697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0317"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; pyridine nucleotide-disulphide
FT                   oxidoreductase dimerisation region; SMART: Rhodanese domain
FT                   protein; KEGG: sfr:Sfri_0585 FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91947"
FT                   /db_xref="GOA:C4L8S7"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8S7"
FT                   /inference="protein motif:PFAM:PF00070"
FT                   /protein_id="ACQ91947.1"
FT                   /translation="MTKIVIIGGVAGGASAAARARRLSETAEIIVLERGEFVSFANCGL
FT                   PYHISGEIEARDALLLQTPESFRHRFNVDVRVFNEVIAIDKHKKEVTVRRVLTGEIYQE
FT                   SYDKLLLSPGASPVKPPIPGINSHYVFSLRNIPDMDQILSSLLLNQPQHATVVGGGFIG
FT                   LEMVEALHHRGIKVTLLELSDQVMAPVDREMANMLHQELVEKGVDLRLNTGLAAVTELE
FT                   IQPAEPEATGEYDKQIEHTNTLELMLSTGEMLKTGLVVLAIGVKPETMLANQAGIELGA
FT                   RGGIKVDARMCTSDPDIFAVGDVVETEDFVTALPSLVPLAGPANRQGRIAADNMLGRRE
FT                   IYRRTQGTSICKLFDMAIGSTGLNEKTLKRLKLPYEKIYVHTASHASYYPGAHPVTLKL
FT                   LFNPTDGEILGAQAAGLDGVDKRIDVLAVAQRARMSVYTLQDLELTYAPPFGSARDVVN
FT                   QAGMVASNILKGDEAVCHSEELLLGASDQIVLDVRNPPELEASGTFPDAINIPLDQLRQ
FT                   RLHELPKDKEILVACQVGLRGHVACRMLIQHGFKARNLTGGFKTYQMVTTKF"
FT   sig_peptide     355988..356050
FT                   /locus_tag="Tola_0317"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.963) with cleavage site probability 0.624 at
FT                   residue 21"
FT   gene            357727..358071
FT                   /locus_tag="Tola_0318"
FT   CDS_pept        357727..358071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0318"
FT                   /product="alkylhydroperoxidase like protein, AhpD family"
FT                   /note="TIGRFAM: alkylhydroperoxidase like protein, AhpD
FT                   family; PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   mmw:Mmwyl1_1812 alkylhydroperoxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91948"
FT                   /db_xref="GOA:C4L8S8"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8S8"
FT                   /inference="protein motif:TFAM:TIGR00778"
FT                   /protein_id="ACQ91948.1"
FT                   /translation="MAKSYKEINQDQRQFGSAYRKASPDTMNAFLALHKAAMVEGAVSI
FT                   KHKELIATGIAIAARCDGCIGAHVAAALKAGATKQELIETIDVAVLMGGGPAIIYGTQA
FT                   LAAVEELSAE"
FT   gene            358125..358550
FT                   /locus_tag="Tola_0319"
FT   CDS_pept        358125..358550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0319"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   sbn:Sbal195_1431 thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91949"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8S9"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="ACQ91949.1"
FT                   /translation="MKTYQACLQSHAHCVVCSDGSTNPHSLQLSFKQITENEVAADYQV
FT                   DKKHQGYTDLLHGGIASTLLDAAMTHCLLSKGIEALTAELNVRFHTPVLVGDSVQVIGR
FT                   LISQRRGIYLLEATLSVAKQICVKATGKFIQPKGGVI"
FT   gene            358552..359394
FT                   /locus_tag="Tola_0320"
FT   CDS_pept        358552..359394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0320"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   pca:Pcar_1589 beta-lactamase superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91950"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041712"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8T0"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACQ91950.1"
FT                   /translation="MSCRFELTVICDNHAKNELLSEHGLSFHILADGLTILFDTGGGET
FT                   LLPNAMKLGIDLANCTHLVLSHGHYDHTGGIAQMLAKNTHCSVIAHPFILSERYSRHAD
FT                   RPVKRIGMPVSVRAVLQQLDPVRLHCSPVASFISDNIGITGFIPRTHVFEDTGGPFYLD
FT                   ETGQFADLIPDDQALWINTPQGLVVILGCCHSGVINTVEYIRQLNDGASVAGIIGGLHL
FT                   LHASAERLEQTIIYLKKLKPQFIYAGHCTGDDVIVKLRENLRDTAVGQFFAGMQIGTE"
FT   gene            359424..359762
FT                   /locus_tag="Tola_0321"
FT   CDS_pept        359424..359762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0321"
FT                   /product="Rhodanese domain protein"
FT                   /note="SMART: Rhodanese domain protein; KEGG: sdy:SDY_1936
FT                   thiosulfate:cyanide sulfurtransferase (rhodanese)"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91951"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8T1"
FT                   /inference="protein motif:SMART:SM00450"
FT                   /protein_id="ACQ91951.1"
FT                   /translation="MFRVFLLFTALTGCFTVSAKEWLIDVRTAAEYTIEHADGAANIEY
FT                   QQIVIGAQQAGIEKQDTVHLYCRSGRRAEIAKELLIQNGYQKVENLGSLQDAESWAKTS
FT                   HLAVATNH"
FT   sig_peptide     359424..359483
FT                   /locus_tag="Tola_0321"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.996 at
FT                   residue 20"
FT   gene            complement(359770..360378)
FT                   /locus_tag="Tola_0322"
FT   CDS_pept        complement(359770..360378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0322"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 12; Methyltransferase
FT                   type 11; KEGG: gbm:Gbem_0757 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91952"
FT                   /db_xref="GOA:C4L8T2"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8T2"
FT                   /inference="protein motif:PFAM:PF08242"
FT                   /protein_id="ACQ91952.1"
FT                   /translation="MSDFFDNAAKEWDTKHQRVAQAKAIAQIIEQTIPLTRATKALEFG
FT                   CGTGLLGFNLIEKVGEMTFSDTSRGMLSEVENKLKISACTSAKIVDLNVAKIVDRYDLI
FT                   FSSMVLHHIADHKQTIADLSQSLHPEGYLCICDLDKEDGLFHSKETVPHHGFERAEIKQ
FT                   EFQNSGLNVIHSCTGFVNRKIINGQEVDFPVFLLIGQKK"
FT   gene            complement(360443..361036)
FT                   /locus_tag="Tola_0323"
FT   CDS_pept        complement(360443..361036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0323"
FT                   /product="methyltransferase type 11"
FT                   /note="KEGG: aeh:Mlg_1406 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91953"
FT                   /db_xref="GOA:C4L8T3"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8T3"
FT                   /inference="similar to AA sequence:KEGG:Mlg_1406"
FT                   /protein_id="ACQ91953.1"
FT                   /translation="MWNEKYSDPRFIYGTAPNDFLKQSVHHFHPGGNILCIAEGEGRNA
FT                   VWLAELGFNVTAVDASEVGLSKGLTLAKSKGVKVDWIHADLQHYNPGKQAWDGVVAIFA
FT                   HFPPDLRSQVHADCVESLKEGGVLLLEAYTPEQLEFKTGGPSNPDWLMTPEILEQELRG
FT                   LTFERLQKVERKIIEGIGHTGTGSVVQVIGVRNS"
FT   gene            361155..362216
FT                   /locus_tag="Tola_0324"
FT   CDS_pept        361155..362216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0324"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   pap:PSPA7_6170 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91954"
FT                   /db_xref="GOA:C4L8T4"
FT                   /db_xref="InterPro:IPR004630"
FT                   /db_xref="InterPro:IPR018383"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8T4"
FT                   /inference="protein motif:PFAM:PF03601"
FT                   /protein_id="ACQ91954.1"
FT                   /translation="MSQYIRFLLNKKDEAESNCIGLICAASVALAGIFMAQSNIAQHWG
FT                   LSALTIAIALGIVLGNTVYPHISHACGAGVGIAKQQLLRIGIVLYGLRITFQQIAGVGV
FT                   TAILTDLLVLSSTFLLAYWLGTRIFKLERDSVLLIGAGSSICGAAAVMATEPVVQAQAS
FT                   KVSIAVATVVVFGTAGMFLYPMFYHLGTTLLPIFKNQNSYGVYVGSTIHEVAQVFAAGQ
FT                   AIGTKAADTAVIVKMIRVMMLAPFLLILSGWLRFNSVKGSAQSRKITIPWFAVFFIVMA
FT                   GINSLQWLPSTLTQSLIVLDNFLLAMAMAALGLTTHLGGVRAAGLKPLMLGGILFIYLI
FT                   FGGGCINWLVAIF"
FT   sig_peptide     361155..361271
FT                   /locus_tag="Tola_0324"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.771) with cleavage site probability 0.544 at
FT                   residue 39"
FT   gene            complement(362352..362828)
FT                   /locus_tag="Tola_0325"
FT   CDS_pept        complement(362352..362828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0325"
FT                   /product="Ferritin Dps family protein"
FT                   /note="PFAM: Ferritin Dps family protein; KEGG: bba:Bd1236
FT                   DNA-binding stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91955"
FT                   /db_xref="GOA:C4L8T5"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8T5"
FT                   /inference="protein motif:PFAM:PF00210"
FT                   /protein_id="ACQ91955.1"
FT                   /translation="MSAQAINIGINESDRLDIATGLSRLLADSYTLYLKTHYYHWNVTG
FT                   PMFNTLHLMFETQYNELALAVDLIAERIRALGVYAPGTYLEFAKLTVIAEDTDVPKAQE
FT                   MIKNLVAGQEAVVRTARSLFSVVEKANDEASADLLTQRIQLHEKTAWMLRSLLE"
FT   gene            complement(363278..364099)
FT                   /locus_tag="Tola_0326"
FT   CDS_pept        complement(363278..364099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0326"
FT                   /product="Cof-like hydrolase"
FT                   /note="TIGRFAM: Cof-like hydrolase; HAD-superfamily
FT                   hydrolase, subfamily IIB; PFAM: Haloacid dehalogenase
FT                   domain protein hydrolase type 3; Haloacid dehalogenase
FT                   domain protein hydrolase; sucrose-6F-phosphate
FT                   phosphohydrolase; KEGG: asa:ASA_3565 HAD superfamily
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91956"
FT                   /db_xref="GOA:C4L8T6"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8T6"
FT                   /inference="protein motif:TFAM:TIGR00099"
FT                   /protein_id="ACQ91956.1"
FT                   /translation="MADIAVIALDMDGTLLTSDHTVTRETVDTLRQARDKGIEVILVTG
FT                   RHHMMACPVHHQLALETPLICSNGAYIFDFQAKRITAGNPLHDWQWQQLLPLIESLQLD
FT                   VICHFSDGIGHQPDNVHIAKIKNHLSTLPPEHYPHFIEHSSLATLCNTHVPLWKIEIAH
FT                   ATPAAIDAFIDALPDGLAITHDRTAPNGLEIVNTGSSKGNRLAEWVAGKGIALDQVIAF
FT                   GDNHNDISMFQQVGLGVAMGNATPEIQQYADFVTCSNDDSGIASALRRWVL"
FT   gene            364318..365127
FT                   /locus_tag="Tola_0327"
FT   CDS_pept        364318..365127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0327"
FT                   /product="undecaprenol kinase"
FT                   /EC_number="3.6.1.27"
FT                   /note="KEGG: mfa:Mfla_2527 undecaprenyl-diphosphatase;
FT                   TIGRFAM: undecaprenol kinase; PFAM: Bacitracin resistance
FT                   protein BacA"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91957"
FT                   /db_xref="GOA:C4L8T7"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/TrEMBL:C4L8T7"
FT                   /inference="protein motif:TFAM:TIGR00753"
FT                   /protein_id="ACQ91957.1"
FT                   /translation="MSDILNSLIMGVVEGITEFLPVSSTGHLIVTKELLKFEGSDTFEI
FT                   VIQLGGVLAVLWFYFKTILQQVKSVATDAAVRRFWMAVIVAFLPAACIGLAFHHYITEY
FT                   LFNSVTVACSLIVGGVIMWWIEGVAFKPRTLAFEQITLKQALAIGCAQLCALIPGVSRS
FT                   ASTIMGGMLTGLDRSTATGFSFFLSIPTLGAASIYSLLKDLNGVGEHGILNISIGLISS
FT                   FIVSLLSIGWLLRYISKHNFRGFAVYRIVVGIIILALSYFGFFSPSV"
FT   gene            365487..367020
FT                   /locus_tag="Tola_R0018"
FT   rRNA            365487..367020
FT                   /locus_tag="Tola_R0018"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            367070..367145
FT                   /locus_tag="Tola_R0019"
FT                   /note="tRNA-Glu2"
FT   tRNA            367070..367145
FT                   /locus_tag="Tola_R0019"
FT                   /product="tRNA-Glu"
FT   gene            367283..370169
FT                   /locus_tag="Tola_R0020"
FT   rRNA            367283..370169
FT                   /locus_tag="Tola_R0020"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            370298..370411
FT                   /locus_tag="Tola_R0021"
FT   rRNA            370298..370411
FT                   /locus_tag="Tola_R0021"
FT                   /product="5S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            370474..370550
FT                   /locus_tag="Tola_R0022"
FT                   /note="tRNA-Asp3"
FT   tRNA            370474..370550
FT                   /locus_tag="Tola_R0022"
FT                   /product="tRNA-Asp"
FT   gene            370745..371233
FT                   /locus_tag="Tola_0328"
FT   CDS_pept        370745..371233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0328"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   aha:AHA_0618 ErfK/YbiS/YcfS/YnhG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91958"
FT                   /db_xref="GOA:C4L959"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:C4L959"
FT                   /inference="protein motif:PFAM:PF03734"
FT                   /protein_id="ACQ91958.1"
FT                   /translation="MKFAILISGLLLGFSVNATIMPKADLVVVKKSQYSLTLYSKGVPL
FT                   KRYWVALGPNPRGPKIREGDNKTPEGRYLLDYRKMDSNYYKAFHISYPSLNDMKRAQHL
FT                   GVEPGGQILLHGQRKGSVMSDETLQRSNWTNGCIALINADMDELWESVSPGTPIEIRP"
FT   sig_peptide     370745..370801
FT                   /locus_tag="Tola_0328"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.995 at
FT                   residue 19"
FT   gene            371380..371763
FT                   /locus_tag="Tola_0329"
FT   CDS_pept        371380..371763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0329"
FT                   /product="Calcium-binding EF-hand-containing protein"
FT                   /note="PFAM: Calcium-binding EF-hand-containing protein;
FT                   SMART: Calcium-binding EF-hand-containing protein; KEGG:
FT                   reu:Reut_A3217 calcium-binding EF-hand"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91959"
FT                   /db_xref="GOA:C4L960"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:C4L960"
FT                   /inference="protein motif:PFAM:PF00036"
FT                   /protein_id="ACQ91959.1"
FT                   /translation="MKVMGAALLVTFLCAPVYATEVTQTKSVPVQADNLFTKADKDQDG
FT                   KLDQKEFAAFKQLQEERMIRQIKQRMSKMQFSAFDKDGDSEVTQDELKSARIEARQKMM
FT                   QQLRERQLQLKPVVSTAVDSAKK"
FT   sig_peptide     371380..371439
FT                   /locus_tag="Tola_0329"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 20"
FT   gene            complement(371800..372810)
FT                   /locus_tag="Tola_0330"
FT   CDS_pept        complement(371800..372810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0330"
FT                   /product="Porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /note="PFAM: delta-aminolevulinic acid dehydratase; KEGG:
FT                   asa:ASA_4302 delta-aminolevulinic acid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91960"
FT                   /db_xref="GOA:C4L961"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:C4L961"
FT                   /inference="protein motif:PRIAM:4.2.1.24"
FT                   /protein_id="ACQ91960.1"
FT                   /translation="MPQFVSSPFPLRRLRRVRKHEFSRRLVRENQLSVDDLIYPMFVLD
FT                   GESRRETITSMPGIERLSLDLLLQEAEELVRLGIPAIALFPVIPAEQKSLLAEEAYNDD
FT                   GLVPCVVRALKERFPELGVITDVALDPYTTHGQDGIIDDHGYVLNDITSDILVRQALCH
FT                   AKAGADIVAPSDMMDGRIAAIRRSLEQHNLVNTQIMAYSAKYASNYYGPFRDAVGSSAN
FT                   LGKGNKNTYQMDPANSNEALQEVGLDIQEGADMVMVKPGMPYLDIIHRVKHQYGVPTFA
FT                   YQVSGEYAMHMAAIQNGWLKERECIMESLLCFKRAGADGILTYFAKQVAYWLQNK"
FT   gene            complement(372833..374464)
FT                   /locus_tag="Tola_0331"
FT   CDS_pept        complement(372833..374464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0331"
FT                   /product="2-polyprenylphenol 6-hydroxylase"
FT                   /note="TIGRFAM: 2-polyprenylphenol 6-hydroxylase; PFAM:
FT                   ABC-1 domain protein; KEGG: asa:ASA_4307 putative
FT                   ubiquinone biosynthesis protein UbiB"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91961"
FT                   /db_xref="GOA:C4L962"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4L962"
FT                   /inference="protein motif:TFAM:TIGR01982"
FT                   /protein_id="ACQ91961.1"
FT                   /translation="MILREWRRFYTIGSVLLRHGLDELIPRHWQPWPVRLFRRSLFWLR
FT                   NRYPEQSRGARLRHAFEGLGPVFIKFGQMLSTRRDLLPPDLAEELAMLQDRVPSFDGQL
FT                   AREQIEQALGQPIEALFADFDQQPLASASVAQVHTARLKENNAEIVIKVIRPDIKPVIN
FT                   DDIRLMRLCAKIVAFLIPNNRLRPVEVIEEYRRTLLDELNLMSEAANAIQLRRNFENSS
FT                   HLYVPLVYSDYCRESVLVMERIYGIPVSDRAALEANGTDLKLLAERGVEVFFTQVFRDS
FT                   FFHADMHPGNVFVSYEHPHDPQWIGIDCGIVGTLNRQDKRYLAENFLAFFNRDYRKVAE
FT                   LHVQSGWVPPDTKVEEFESALRTVLEPIFAKPLAEISFGQVLLNLFNTARRFNMHVQPQ
FT                   LVLLQKTLLYIEGLGRHLYPQLDLWQTAKPFLEHWMRQQIGPKAAWRAIKEKAPFWAEK
FT                   LPDMPDLIYDTLTQVQHQQHMVKGLYQQYHQQHRRHAQARFLLGAGATLLLGSILLLPT
FT                   HEQLASAGLTISIICWLNGWWKISRR"
FT   gene            complement(374461..375081)
FT                   /locus_tag="Tola_0332"
FT   CDS_pept        complement(374461..375081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0332"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aha:AHA_0085 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91962"
FT                   /db_xref="GOA:C4L963"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR038989"
FT                   /db_xref="UniProtKB/TrEMBL:C4L963"
FT                   /inference="similar to AA sequence:KEGG:AHA_0085"
FT                   /protein_id="ACQ91962.1"
FT                   /translation="MTLSPLSVALAALLETGLNQLLSLDPQSRERSKTLYGKVLKLELQ
FT                   RLPAIWLIFSPQQVDVLTCYEHPAHASLSLKWQGLQVLRQPEKLSRYIREERIDLQGDP
FT                   VLFHAFSHLFSELDIDWEEQLSACTGDVLAHWICRGINRIQQSASVQLLSAKQELREAI
FT                   TEEWQLAPGTLQLAAFCDDVSDLERDSERLLQRAEQFFKRSQQ"
FT   gene            complement(375106..375849)
FT                   /locus_tag="Tola_0333"
FT   CDS_pept        complement(375106..375849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0333"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase"
FT                   /note="TIGRFAM: ubiquinone/menaquinone biosynthesis
FT                   methyltransferase; PFAM: UbiE/COQ5 methyltransferase;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   asa:ASA_4309 ubiquinone/menaquinone biosynthesis
FT                   methyltransferase UbiE"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91963"
FT                   /db_xref="GOA:C4L964"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C4L964"
FT                   /inference="protein motif:TFAM:TIGR01934"
FT                   /protein_id="ACQ91963.1"
FT                   /translation="MADNTHFGFKTVAETEKEHLVADVFHSVADKYDLMNDLMSFGIHR
FT                   LWKRFTIDCAGVRPGQKILDLAGGTGDLTAKFSRLVGESGEVILADINDSMLKVGREKL
FT                   RNKGLVNNIRYVQANAENLPFPDNYFDLITIGFGLRNVTHKDQALASMYRALKPGGRLL
FT                   VLEFSKPTNAVMSKLYDFYSFKVLPKMGQLVAKDSDSYQYLAESIRMHPDQETLKAMME
FT                   SVGFEQVTYHNLTQGVVALHRGFKF"
FT   gene            complement(376528..376698)
FT                   /locus_tag="Tola_0334"
FT   CDS_pept        complement(376528..376698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0334"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91964"
FT                   /db_xref="UniProtKB/TrEMBL:C4L965"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACQ91964.1"
FT                   /translation="MSARTLTNHFAHKMAVDYSEARDYTDKNGRNKFGIKLIIKSHALT
FT                   CRTFQAVPCLG"
FT   gene            376739..377398
FT                   /locus_tag="Tola_0335"
FT   CDS_pept        376739..377398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0335"
FT                   /product="conserved hypothetical protein"
FT                   /note="TIGRFAM: conserved hypothetical protein; PFAM:
FT                   protein of unknown function DUF165; KEGG: asa:ASA_0187
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91965"
FT                   /db_xref="GOA:C4L966"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:C4L966"
FT                   /inference="protein motif:TFAM:TIGR00697"
FT                   /protein_id="ACQ91965.1"
FT                   /translation="MLFTEHQSRQALWRLSLFHILIIASSNYLVQLPIEIAGVHTTWGA
FT                   FSFPFIFLATDLTVRIFGSLLARRIILYAMLPALVISYLLSVLFNAGDFLGLAQITQFN
FT                   LFVARIACASFMAYLLGQILDISVFSRLRQLPQWWAAPLASTIIGNLLDTVAFFGIAFY
FT                   QSPDPFMAEHWVEIAAVDYAVKLIISIGLFVPAYGVLLRHLTRKLLGQDNANWQTI"
FT   gene            377707..380439
FT                   /locus_tag="Tola_0336"
FT   CDS_pept        377707..380439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0336"
FT                   /product="DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: aha:AHA_0196 DNA polymerase I; TIGRFAM: DNA
FT                   polymerase I; PFAM: DNA-directed DNA polymerase; 5'-3'
FT                   exonuclease; 3'-5' exonuclease; SMART: DNA-directed DNA
FT                   polymerase; 3'-5' exonuclease; Helix-hairpin-helix domain
FT                   protein class 2; 5'-3' exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91966"
FT                   /db_xref="GOA:C4L967"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C4L967"
FT                   /inference="protein motif:TFAM:TIGR00593"
FT                   /protein_id="ACQ91966.1"
FT                   /translation="MTQTPPLILVDGSSYLYRAFFASQQADLRTSNGEPTGAIRVVTNM
FT                   LRSLLKQYPDSVVAVVFDAKGKSFRNDLYAEYKSHRPPMPDDLRSQIEPIHQIIGAMGL
FT                   PLLVIDGVEADDVIGTLARQATESQIDTLISTGDKDMAQLVSEHVTLMDTMKDQLTDRQ
FT                   GVIDKFGVPPELIVDYLALMGDSSDNIPGMAGVGDKTAVAVLQGVGSIDTIAAHPERVA
FT                   ELSFRGAKTFAAKFKEQEAMVRLSQQLATIKTDVELPVSLAELRRHELQKDVLLALYRQ
FT                   FEFKNLVQELESASEADAEIVTPSDVTAHYDTILTDADLTRWFEKLQQAELFSFDTETN
FT                   SLDYIQAQVVGLSFAVAPGDAAYLPLAHDYLGAPEQLDREQTLAKLKPLLEDPTRLKVG
FT                   QHLKFDRNVLRNHGIHLQGIAFDTMLESYVLNSTASRHNMDDLAKKYLNYTTQTFEDVA
FT                   GKGVKQLTFNQVELEKAAFYAAEDADITLRLHQTLWPQVEKEPALKSLLLEMELPLAEV
FT                   LSDMERTGALIDPFLLQNQSQQIEVRLAELESQAHEIAGGPFNLGSPKQLGEVLFEKLQ
FT                   LPVIKKTPKGAPSTAEEVLQELAYDYPLPKLLLEHRSLSKLKSTYTDKLPLMIAPSTGR
FT                   VHTSYHQAVTATGRLSSSDPNLQNIPVRTEEGRRIRQAFVADHGYKIVAADYSQIELRI
FT                   MAHLSEDDGLLQAFAHGQDIHRATAAEIMNITPEAVTSEQRRNAKAINFGLIYGMSAFG
FT                   LAKQLGIPRGEAQRYMDRYFERYPGVLTYMERTREQAEQAGYVETLFGRRLYLPDIKAK
FT                   NMGLRKAAERAAINAPMQGTAADIIKRAMIKLADWIKTCDNGTIRMVMQVHDELVFEVR
FT                   EDKLDAYVPVIRQYMMDAASLKVPLDVGIGVGDNWDQAH"
FT   gene            complement(380483..381121)
FT                   /locus_tag="Tola_0337"
FT   CDS_pept        complement(380483..381121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0337"
FT                   /product="GTP-binding protein HSR1-related"
FT                   /note="PFAM: GTP-binding protein HSR1-related; KEGG:
FT                   asa:ASA_4129 GTP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91967"
FT                   /db_xref="GOA:C4L968"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4L968"
FT                   /inference="protein motif:PFAM:PF01926"
FT                   /protein_id="ACQ91967.1"
FT                   /translation="MDTPLLNFRKVHFVTSAPDIRHLPNDGGIEIAFAGRSNAGKSSAL
FT                   NALTQQRQLARTSKTPGRTQLINLFELEPGKRLVDLPGYGYAQVPIEMKLKWQAALSEY
FT                   LQKRESLKALVLLMDIRHPLKDLDLQMLEWASNSDLNILVLLTKADKLNPGPRKTVVQQ
FT                   VRKATMVFGDSVRVEAFSSLKGTGVDEVTRILSDWYQPEDTPDEISEAE"
FT   gene            complement(381278..381523)
FT                   /locus_tag="Tola_0338"
FT   CDS_pept        complement(381278..381523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0338"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91968"
FT                   /db_xref="GOA:C4L969"
FT                   /db_xref="UniProtKB/TrEMBL:C4L969"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACQ91968.1"
FT                   /translation="MNKTKLLVPLPWLTLDMAGILLVMWGGLEYFGWLHWWPETWHYPY
FT                   YELLLMMVGFFMMVPYQVMLLMAVMRKIQEVKKAQQ"
FT   gene            381637..382047
FT                   /locus_tag="Tola_0339"
FT   CDS_pept        381637..382047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0339"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aha:AHA_3969 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91969"
FT                   /db_xref="UniProtKB/TrEMBL:C4L970"
FT                   /inference="similar to AA sequence:KEGG:AHA_3969"
FT                   /protein_id="ACQ91969.1"
FT                   /translation="MKKIIVAGALLVMSGVANAGLLDAVAETATAVASSKETGVSADQA
FT                   ITALLKTKFQENVTTKAQVKENLGEPKATATDNSLDVWTYDMDSVNNKLSTITGIAKAF
FT                   GNDTSKVEKVVELKFDGDVMKSYAVVDAASAG"
FT   sig_peptide     381637..381696
FT                   /locus_tag="Tola_0339"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 20"
FT   gene            complement(382373..383041)
FT                   /locus_tag="Tola_0340"
FT   CDS_pept        complement(382373..383041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0340"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: abu:Abu_1030 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91970"
FT                   /db_xref="UniProtKB/TrEMBL:C4L971"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACQ91970.1"
FT                   /translation="MNLSCKANETKNSCYIANIEARLIYFIFYYIKDGDDKAFERAGTT
FT                   RHNLIKEKTKKENNTLILSFPIKTSTEFKSAWDKIKNMQKEKLSLIKEGHIFSHASKGE
FT                   SEDGLEFLASNSEDGTISYDEILSLPRLSWAKNATLTLYGCNSGISGEARDLSIAELFS
FT                   ESQKTIVCGQKGYAYFSESDIEYKKISTTSKEVYLWAYKRGQNSVFGNGFKIKPQIVRP
FT                   "
FT   gene            complement(383045..385207)
FT                   /locus_tag="Tola_0341"
FT   CDS_pept        complement(383045..385207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0341"
FT                   /product="type VI secretion system Vgr family protein"
FT                   /note="TIGRFAM: type VI secretion system Vgr family
FT                   protein; Rhs element Vgr protein; PFAM: Rhs element Vgr
FT                   protein; KEGG: vfm:VFMJ11_A1069 VgrG protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91971"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:C4L972"
FT                   /inference="protein motif:TFAM:TIGR03361"
FT                   /protein_id="ACQ91971.1"
FT                   /translation="MWFFSANEAQFLFTVDGCHEELGVLRFSGQEALGSDYLFEIDVVC
FT                   DSDSLDLLALQHQTACLILQNNPTPRYIHGIVLCAGHIKTDSRHHHYRFHLVPQAKLLQ
FT                   YRTDQRIFQNKSVTGIIQAVWQQAGLNPAAIRFQTTQQHPPLAYCVQYRETDLNFIQRL
FT                   CEFHSLFYYFEHTVNQLTMVFVDGKENCPKTGAVSYQPDSGQNPDKPAISQLDWQFQAT
FT                   EGSTEIREYDFTRPSFSLTGKTQTARCEWYEYGTRQDSQHQAGKRAALFLNQQQNECQR
FT                   AYATGNVRNITPGYFLPVTEHPLATLNIDWLVVSIQHSGEQPQVLKELASGSSKYQNNL
FT                   VLHHKDIPFSLPRIHAKPQISGYQTALVTGPDGQEICTDEYGRIKVQFHWDKDATGDAN
FT                   SSCWLRVAQGWAGAAYGQHFLPRVGQEVIVAFLEHDIDRPYVTGYVYNAANTSPVKYPV
FT                   NHSQSGIRTLSSPGGGGFNELRFEDKKGKEQIVLHAQRNWYRKVKRTSRTEIGGNEHRW
FT                   IGGKDVQHTSGEAHLTINKNRLTDISGNQDLHVLQNQHLHIDHKWLTKIDQELHVKAGQ
FT                   TMVLEAATAMSFDAGGSTLLLDDAGIKLQGASIRINSGGAIAPTLYPILQKITLPVILS
FT                   SIQLPAIKKITPLSKIYNSKQEPSIIYDEQVKLIEKNSGEPLKNVPYKLIRKSNNDLLA
FT                   HGHTDEGGLTERVFCKNPDDIKILIG"
FT   gene            complement(385297..385815)
FT                   /locus_tag="Tola_0342"
FT   CDS_pept        complement(385297..385815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0342"
FT                   /product="type VI secretion system effector, Hcp1 family"
FT                   /note="TIGRFAM: type VI secretion system effector, Hcp1
FT                   family; PFAM: protein of unknown function DUF796; KEGG:
FT                   vfm:VFMJ11_A1070 hemolysin co-regulated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91972"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:C4L973"
FT                   /inference="protein motif:TFAM:TIGR03344"
FT                   /protein_id="ACQ91972.1"
FT                   /translation="MPTPAYMTINGEKQGLITAGTFTEASVGNIYQEGHEDEVMVQGFE
FT                   HQVVLPRDPQSGQPSGQRVHKPVKITKVFDKCSPLIYNSLTSGERLPSVKIKWYRTSAA
FT                   GTQEHYFTTELTDAIVVDVQASMPNCQDPSQAHFTHLEDVFMTYRAIKWTHEVSGTSGS
FT                   DDWRSPTTA"
FT   gene            complement(386123..386707)
FT                   /locus_tag="Tola_0343"
FT   CDS_pept        complement(386123..386707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0343"
FT                   /product="cytochrome B561"
FT                   /note="PFAM: cytochrome B561; KEGG: shw:Sputw3181_0211
FT                   cytochrome b561"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91973"
FT                   /db_xref="GOA:C4L974"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:C4L974"
FT                   /inference="protein motif:PFAM:PF01292"
FT                   /protein_id="ACQ91973.1"
FT                   /translation="MGLSSEKVKIWDPFIRIFHWTVVTLFFCNYLLSDKGMPFERGGTL
FT                   HIYAGYIVIGFVLARLIWGVIGSHHARFKNFIPKPAEFMAYMRAMLRGEHTNYEGHNPA
FT                   GAVMILCLLSGLLLTGLTGWLASLADVFDGWQAGIAAATDFIDWGEMHEFFANLTMLGA
FT                   GIHITAVLIISHLMGENLVHAMLSGYKKKSG"
FT   gene            complement(386908..388164)
FT                   /locus_tag="Tola_0344"
FT   CDS_pept        complement(386908..388164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0344"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="PFAM: sodium:dicarboxylate symporter; KEGG:
FT                   aha:AHA_2438 serine/threonine transporter SstT"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91974"
FT                   /db_xref="GOA:C4L975"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR023025"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4L975"
FT                   /inference="protein motif:PFAM:PF00375"
FT                   /protein_id="ACQ91974.1"
FT                   /translation="MSQTPPSFIRLLNNTSLVSQILIGMIVGILLATLIPSAAQSAGLL
FT                   GTLFVGALKAVAPVLVLLLVTDSIAGHKQGQKTSIRPLLILYLFGTFCAAVVAVVASFA
FT                   FPSVLHLSAQNADIVPPGGIAEVLNTLLFNVVANPVKALLEGNYIGILAWAIALGLSLR
FT                   KASDTTKAVIHDLSHAVSGIVKGVIRCAPLGIMGLVASTFAETGFSALLSYAQLLIVLI
FT                   GCMLFVAFVVNPLIVFWKIKRNPYPLVLMCLKESGVTAFFTRSSAANIPVNMALCEKLR
FT                   LPEETYAVSIPLGATINMAGAAITITVLSMAAVNTLGISVDLATAVLLSVVATISACGA
FT                   SGVAGGSLLLIPLACSLFGISNDVAMQVVAVGFIIGVLQDSAETALNSSTDVLFTAAAC
FT                   MAEDGSLSEGNLQEDADIV"
FT   sig_peptide     complement(388039..388164)
FT                   /locus_tag="Tola_0344"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.933 at
FT                   residue 42"
FT   gene            complement(388410..388679)
FT                   /locus_tag="Tola_0345"
FT   CDS_pept        complement(388410..388679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0345"
FT                   /product="protein of unknown function DUF156"
FT                   /note="PFAM: protein of unknown function DUF156; KEGG:
FT                   rpi:Rpic_2938 protein of unknown function DUF156"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91975"
FT                   /db_xref="GOA:C4L976"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:C4L976"
FT                   /inference="protein motif:PFAM:PF02583"
FT                   /protein_id="ACQ91975.1"
FT                   /translation="MSHTLKHKKPLLNRVRRLKGQLEALERALDEETGCYPILQQITAI
FT                   RGAINGLMATVIEGHIREHMQPLLEQDEPQATEELIKVLRSYLK"
FT   gene            388779..389771
FT                   /locus_tag="Tola_0346"
FT   CDS_pept        388779..389771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0346"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG:
FT                   aha:AHA_0626 heavy metal transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91976"
FT                   /db_xref="GOA:C4L977"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:C4L977"
FT                   /inference="protein motif:TFAM:TIGR01297"
FT                   /protein_id="ACQ91976.1"
FT                   /translation="MSSVREMMQCCQAAAFQRPVQGAEQRIRWVVILTVIMMVVEIFAG
FT                   WLFHSMALLADGWHMSTHALALGISLLAYALSRRWAGDHRLAFGTWKIEVLGAYTSALI
FT                   LAAVAFSMIAESVSRLSNPGEINYVESMLVAVLGLAVNLFSAWLLGDQHHHGLGHHHSD
FT                   DHHADDHDHDHDHDHDHDHDHDHDHSHDHGHHDLNKKAAYIHVLTDAATSVLAIFALAG
FT                   GLLWGAAWLDPLMGIVGGVVILVWAWGLLKESTLILIDADNQNSMRAAILETAIGHDLQ
FT                   ISDLHVWRIGEQRYAAIIGLASSQPESISELRGALSQLDKLAHITIEQV"
FT   gene            complement(389826..391811)
FT                   /locus_tag="Tola_0347"
FT   CDS_pept        complement(389826..391811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0347"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: cja:CJA_0922
FT                   Zn-dependent protease with chaperone function"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91977"
FT                   /db_xref="GOA:C4L978"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:C4L978"
FT                   /inference="protein motif:PFAM:PF01435"
FT                   /protein_id="ACQ91977.1"
FT                   /translation="MDFYQYQDQAKKISARLLFLFFAGLISLSAALTFAGLLLWKLTDQ
FT                   VVYINTDSQFWHWYIVGNIAIFAALVLITLLKYSSLCKGGRVVAEALGGRYVHVNTQDP
FT                   GDTRLRNVVEEMALASGTPVPSVYVLDNEPGINAFAAGMSVNDAVIVVTQGAISYLSRD
FT                   ELQAVVAHEFSHILHGDIRLNQQLAALIGSLMFLGELGRWLSQGSGRHRHRINTSQGKS
FT                   SSALPFFGLTLMLLGAAGTVWGRLMKSALNRQREFLADAAAVQFTRYPAPLASALKKVG
FT                   GHRYASLIFHPQAETFSHLFFSQGLTQNFRGWLASHPPLQERIRRLDPAWDGKYYANLQ
FT                   PMADEVPPPLPASFVSAVQLKATGNQDLAAMLLAQSALATTPVEMPKRPKPEQTGLPLT
FT                   TGSEPVLYDTTAPGEWLPQLPEPLVRAARSPFDARLLLYRLVLASDLTIRLKQRHLLGQ
FT                   EESAVLALTQYPVPCGLQLALVELAIPALKELTAEQYQQFHDMLWQLIQADQQVSLPEW
FT                   LLYRMLVHQLRPHFSAEARQNINYREINELSSAITVWLSYLTHLSTHDTPAEQIFAAYA
FT                   APLAMTELSLQPMPSLDTLSAALDQLQQSSPAIRFKLLQTIIDAIEQDGKITEQEAGVF
FT                   QMLAYCLDCPLPPPQVWSQNNSPKTG"
FT   sig_peptide     complement(391704..391811)
FT                   /locus_tag="Tola_0347"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.892) with cleavage site probability 0.837 at
FT                   residue 36"
FT   gene            complement(391824..392420)
FT                   /locus_tag="Tola_0348"
FT   CDS_pept        complement(391824..392420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0348"
FT                   /product="LemA family protein"
FT                   /note="PFAM: LemA family protein; KEGG: cja:CJA_0923
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91978"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:C4L979"
FT                   /inference="protein motif:PFAM:PF04011"
FT                   /protein_id="ACQ91978.1"
FT                   /translation="MMIGLLVVLGVLLLAVFWLVSIYNQLVALKGRYQNAFAQIEVQLK
FT                   RRYDLIPNLVETAKGYLQHESKTLTAVTEARNAALAGLKAATAAPGNPAAMQQLAAAEH
FT                   QLHGALQGLNIQIEAYPDLKANENMLQLSEELTATENRVAFARQGFNDCVTAYNIYRQQ
FT                   FPNSLIANRFGHTSDASLLEIENPEEYRQTPKVSF"
FT   gene            complement(392583..394772)
FT                   /locus_tag="Tola_0349"
FT   CDS_pept        complement(392583..394772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0349"
FT                   /product="DNA helicase II"
FT                   /note="TIGRFAM: DNA helicase II; PFAM: UvrD/REP helicase;
FT                   KEGG: aha:AHA_0220 DNA helicase II"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91979"
FT                   /db_xref="GOA:C4L980"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005753"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:C4L980"
FT                   /inference="protein motif:TFAM:TIGR01075"
FT                   /protein_id="ACQ91979.1"
FT                   /translation="MDISHLLDGLNDKQRDVVAAPLQNMLVLAGAGSGKTRVLVHRIAW
FT                   LLQIEQVSPHSILAVTFTNKAAAEMRGRIERLLGNSLGFGRGGMWIGTFHGLAHRLLRA
FT                   HPLDANLPEDFQIIDSDDQLRLLKRILRNLNLDEKQWVPRAVAGYINSKKDEGLRPHHI
FT                   DVYDPVGRTYQKIYATYQETCDRAGLVDFAELLLRAHELWLHKPHLLEHYQQRFRHILV
FT                   DEFQDTNGIQYAWIRMLAGDSSKVMIVGDDDQSIYGWRGARVENIQRFMQDFDDVQTIR
FT                   LEQNYRSTSTILKAANQLIANNSARLGKELWTDGVAGESISVYAAFNEIDEARFVVSRL
FT                   KAWREQGNSLLDAAILYRNNAQSRILEEALMQEQLPYRIYGGLRFFERQEIKDAIAYLR
FT                   LLSNHSDDASFERVVNTPTRGIGDRTLGLIREAARDRSLNLWQSAWQLCEQGVLAGRAA
FT                   NAVRNFLALINQLETDTSELPLHVQVDRVIRQSGLWTHYENEKGEKGQSRIENLEELVN
FT                   ATRLFRPAEEYLDMSPLTAFLAHATLESGDKQADEFDEAVQLMTLHSAKGLEFPLVFMV
FT                   GVEEGMFPSQQSSEEPGRLEEERRLCYVGMTRAMQKLYLTHAESRRLYGKESYNRPSRF
FT                   LKELPSDCLEEIRLRTQVGWSNSAQSQSRFSQEKLQDSFASTGFKLGQRVLHPTFGEGV
FT                   VLNYEGVGAQSRVQVNFATAGSKWLVVAYARLEAI"
FT   gene            complement(394916..396784)
FT                   /locus_tag="Tola_0350"
FT   CDS_pept        complement(394916..396784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0350"
FT                   /product="potassium uptake protein"
FT                   /note="TIGRFAM: potassium uptake protein; PFAM: K potassium
FT                   transporter; KEGG: ypb:YPTS_4165 potassium uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91980"
FT                   /db_xref="GOA:C4L981"
FT                   /db_xref="InterPro:IPR003855"
FT                   /db_xref="InterPro:IPR023051"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4L981"
FT                   /inference="protein motif:TFAM:TIGR00794"
FT                   /protein_id="ACQ91980.1"
FT                   /translation="MDAHQKQSLPAVTLAAIGVVYGDIGTSPLYTFKECFSPHIGLPPT
FT                   QQVVYGFLSLIFWALILVVSVKYLAFVLRADNRGEGGILTLMSLAGRNTYAGTTTVLLV
FT                   LGLIGGGFFYGEVVITPAMSVLSALEGLSVATPALTPYILPVAIAVLTALFVIQKHGTG
FT                   SVGKLFGPVMLLWFFSLGTLGAISIFKNPQVLAALNPHWAIQFFLTYKTVAFFSLGSVV
FT                   LAITGVEALYADMGHFGKFPIQLAWFTVALPALLLNYFGQGALILSNPEAIANPFFMLA
FT                   PEWLVFPMVILSTMATVIASQAVISGVFSLTRQAVRLGYLPGMNILHTSEVEAGQIYIP
FT                   FVNWMLYIAVLIVVVTFRESTNLAAAYGIAVTGTMVITTILACTVAHYNWDWPRRVVKI
FT                   ILISLLLIDVPLFLANVVKFFAGGWLPVMLGAIMFMVMATWKWERFLLLRQLSRMSMPL
FT                   ESFVAMVEKETPQKVPGTAIYLSRTQQGIPHALLHNLNHNHVLHERIVLMTFRTQDVPY
FT                   VDPDQHIEIKSLSPNVWRISATYGFHETPDVYEVFRRCAMKGMAFNLNTTSFFLSRETL
FT                   LPSHRSILARLRAALFIWLSKNSLRTNDFIHVPADRVVEMGVQVEV"
FT   gene            complement(396802..397494)
FT                   /locus_tag="Tola_0351"
FT   CDS_pept        complement(396802..397494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0351"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91981"
FT                   /db_xref="GOA:C4L982"
FT                   /db_xref="UniProtKB/TrEMBL:C4L982"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACQ91981.1"
FT                   /translation="MNKIRKLLFSSGLLLLPSLAYAVPVTEFVDTLFIGGGVMLFIAGV
FT                   LLLLVPGLFKTGVFITLLADILFMFRMLFPDVLEQDLAAQSDWQPLIESASTGSSRFYA
FT                   AIGVALIVITTLSLRWLLHSFLAAPSAAPKSSSRTSLTARKKTVSQNHPSRQKPSGRTK
FT                   SRLNRDRDDFSGYTEEPPAPQAEPVSPVHNKRFRVHDYLENLEQQQAQPAPSPQETEPA
FT                   IHFDRIER"
FT   sig_peptide     complement(397426..397494)
FT                   /locus_tag="Tola_0351"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 23"
FT   gene            complement(397764..399155)
FT                   /locus_tag="Tola_0352"
FT   CDS_pept        complement(397764..399155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0352"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: aha:AHA_2909 outer membrane protein OprM"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91982"
FT                   /db_xref="GOA:C4L983"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:C4L983"
FT                   /inference="protein motif:TFAM:TIGR01845"
FT                   /protein_id="ACQ91982.1"
FT                   /translation="MIKRPIAFLVSLLLAGCSLAPDYQRPAAPIPAGYDTSSASTIAAV
FT                   KATDWQQAFTDPALQKLIDTALQNNRDLRIAILNVEAYQAQYRIQRAAQLPTLTASGYQ
FT                   ARQRIPSTYSGTADAISNTDSATVGISAYELDLFGRVQSLKDQALENYLAQEETQRSTQ
FT                   LSLIANVATAYMTLLADQDLLRLAEQTAKSYEQSYQLIEQRYQAGISSSLDVSQSRSNL
FT                   ESVRSSLAQYRRQVTLDKNALRLLMGTNIPAGLSSGLPEQDLTLLSPLGADIPSTLLTR
FT                   RPDILAAEHSLKAANANIGAARAAFFPTISLTANAGSMSSSLNKLFDAGSGTWLFQPNI
FT                   SLPIFDWGSRDAQLDVAKVQEKIEVATYEKAIQTAFQEVSDGLAAQDGYRDQLQAQQAL
FT                   VDANRTYYQLAQSRYEKGVDSYLTLLDAQRSLFSAEQGLVSTRLALLSNRVSLFKALGG
FT                   GWQQK"
FT   sig_peptide     complement(399081..399155)
FT                   /locus_tag="Tola_0352"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.726) with cleavage site probability 0.439 at
FT                   residue 25"
FT   gene            complement(399148..402294)
FT                   /locus_tag="Tola_0353"
FT   CDS_pept        complement(399148..402294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0353"
FT                   /product="transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family"
FT                   /note="TIGRFAM: transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family; PFAM: acriflavin resistance protein; KEGG:
FT                   aha:AHA_2910 AcrB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91983"
FT                   /db_xref="GOA:C4L984"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:C4L984"
FT                   /inference="protein motif:TFAM:TIGR00915"
FT                   /protein_id="ACQ91983.1"
FT                   /translation="MSRFFIDRPIFAWVIAIVIMLAGALAIKSLPIEQYPTIAPPSVRI
FT                   STSYPGASAQTVEDSVTQVLEQNMTGIDNLLYMSSQSDSSGNVTVSLSFLAGTNADTAQ
FT                   VQVQNKVQQALSSLPQTVQDQGVRVEKSTESFLMVAGLISENGEMDQSDISDYMVTNIK
FT                   EPLSRIKGVGTVQIFGSQYAMRVWLDPNKLNSFNLTPGDVTSAITSQNTQISVGQLGAT
FT                   PAVAGQQFNATITGQGRLTSMDEFKNILLKVNTNGSQVRLRDVARVELGAESYNAVSRY
FT                   NGKPASGIAIRLASNANALDTAELVKAKMADLSKYFPTGLKVVYPFDTTTFVKISISEV
FT                   AQTLVEAVILVFFIMYLFLQNFRATLIPTIAVPVVLLGTFGIMSVFGYTINTLTMFGLV
FT                   LAIGLLVDDAIVVVENVERVMSEEGLSPLEATRKSMDQITGALIGIALVLSAVFVPMAF
FT                   FSGSTGAIYRQFSLTIVSAMALSVVVALILTPALCATMLKPVPKGDHGIQTGFFGWFNH
FT                   MFERNSRRYRNTVGRILQRSGRMLVIYVVLLLGLVWLFTRMPTSFLPEEDQGIALTMVQ
FT                   LPTGATQERTLKVLDKVSDHFTTAEKKNVESVFTVAGFSFAGSGQNMGLAFVKLKDWSE
FT                   RKASDDAASAIIGRAMGAFSQIKDASIFAFNMSSIPALGNSSGFDLYLQDRGGLGHEKL
FT                   IEARNQLLGMAAKEPSLTRVRPNGMEDTPQYNINIDYEKAMALGLTVSDINSTLSTAWG
FT                   SNYVNDFIDRGRVKKVYVQADAPFRMQPEHLQLWYVRNAQEQMVPFSAFAEGNWSYGSP
FT                   RLERYNGSSAIDIVGEAAEGYTTGEAMATMTRLISQLPEGIGFEWTGLSYQEQESGSQA
FT                   PALYAISLLVVFLCLAALYESWTIPFSVMLIVPLGVVGALAAATLRGLSNDIFFQVGLL
FT                   TTIGLAAKNAILIVEFAKELFDKGMGIKQAVIEASRMRLRPILMTSLAFILGVFPLVIS
FT                   SGAGASGRHAIGTGVTGGMIAATVLAIFYVPSFFVLVMKYFSKHRHSLRAPTSAEKHHD
FT                   "
FT   sig_peptide     complement(402214..402294)
FT                   /locus_tag="Tola_0353"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.613) with cleavage site probability 0.515 at
FT                   residue 27"
FT   gene            complement(402312..403502)
FT                   /locus_tag="Tola_0354"
FT   CDS_pept        complement(402312..403502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0354"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   gme:Gmet_0809 secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91984"
FT                   /db_xref="GOA:C4L985"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:C4L985"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ACQ91984.1"
FT                   /translation="MLHHSCSFRVTILALLTTTLLLTGCNPSAENNQTAMATQAPEVNV
FT                   IALQPRALTLHTELPGRTSAYRVAEVRPQVGGIVIKRLFREGSDVKAGQTLYQIDPATY
FT                   EASLASAKASWERAKASEAIARLKAERYRDLSKTNGVSRQENDDAEASWKQAVADVASA
FT                   KAALDTARINLEYTKVKAPISGRIGKSTVTEGALVTAQQTTALTTVQQLDPLYVDVSQS
FT                   SNELLKLKKALAEGQLEKAGPQEAKVKLLLEDGSYYTESGKLQFSDVTVDEGTGSVTVR
FT                   AIFANSELQLLPGMFVRAELTEATLKDALLVPQLAVSHDPRGKATVLVVNAQDQVEQKA
FT                   FETARSIENNWLVKDGLSAGDRIIVNGAQKVKAGMKVSAKNVDVASLTVASPATKQ"
FT   sig_peptide     complement(403413..403502)
FT                   /locus_tag="Tola_0354"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.974) with cleavage site probability 0.662 at
FT                   residue 30"
FT   gene            403716..404324
FT                   /locus_tag="Tola_0355"
FT   CDS_pept        403716..404324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0355"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: azo:azo0243
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91985"
FT                   /db_xref="GOA:C4L986"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/TrEMBL:C4L986"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACQ91985.1"
FT                   /translation="MSEMTVTSPESDRAAQRRNQVLDAAAVCFRNHGFHGASMAQISKT
FT                   AGMSPGHIYHYFDNKEAIISAIVERDMEEMMEWTEIFYSSDDILQSMLDGVTCGVEANT
FT                   NPDCAALMLEIMAESARNPQIAATVQKSNQIGRQRLSDLLIKEMAQRCAVSTVDVQVKT
FT                   DLIAAMFDGLLMKSVHNPTMDKEALTVLMRQVMLFVLTL"
FT   gene            complement(404299..407595)
FT                   /locus_tag="Tola_0356"
FT   CDS_pept        complement(404299..407595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0356"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC and GAF sensor(s)"
FT                   /note="KEGG: lch:Lcho_3018 diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC sensor(s); TIGRFAM:
FT                   diguanylate cyclase; PAS sensor protein; PFAM: EAL domain
FT                   protein; PAS fold-3 domain protein; GGDEF domain containing
FT                   protein; GAF domain protein; PAS fold domain protein; PAS
FT                   fold-4 domain protein; SMART: EAL domain protein; GGDEF
FT                   domain containing protein; PAC repeat-containing protein;
FT                   PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91986"
FT                   /db_xref="GOA:C4L987"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:C4L987"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACQ91986.1"
FT                   /translation="MNSATAQIPLRTATRIMLFYTVLSVAWFYFSGYSLSPSATKGAPP
FT                   FDSLTFWVSLTTFITGITVGVFFLLVWRQHYMQHRQALSRRVAEKDRLLHHFFDLPLLG
FT                   MAITTNANGSWLRFNDHLSTLFNLSRDELAELNLLALTHPDDRPYDRQEWMRMQDGESQ
FT                   GYRREKRFVRPDGSMLFALVDTRCIRHPDGSIDCMINVIEDISARKNSELRLIRQNNLY
FT                   DMLSLTNQAIVRSQDRLVLLQNICRIAVRNGGFVFAWVSATEQEHSSHVASYGHDNGFL
FT                   QFIRDYQQQHRLSAGSHAPVLMPTDRAIAAESHVILNHFLTDESVQPFHEAATRAGFQS
FT                   AGYFVIREKGQVIGALNLYADEPDFFSPEVRATLNDMVMDVTYALDMLLQAKERANALI
FT                   ALQNAAEVIDASPTILFRWQPNSSWKMEYVSSNVQRWGYQADDFINGKLTMSDLLHPED
FT                   LQRVWAEVIHHIETRHKEYILECRVRTAAGEYLWVENHVTTSFDRKGKPQRFTGVMTDI
FT                   TQQKNNELQLRQAAIVFESTREGIVITDAERNIIKVNRALIDLFGYPENELLGQRPRIF
FT                   HSGKHDGHFYQQMLQALDEHGFWRGEMWNRRQNGELLPMMTSINPVCDSNGEILYYISI
FT                   YTDISQLKDSEARLEHMALHDPLTGLPNRAMLGQKLDSALQHAMLNSTRVALLMLDLDH
FT                   FKNVNDSFGHHFGDELLHQVSARLKQQLRESDVVCRLGGDEFTVLLQNNPSPDDVSLLA
FT                   ERIIHALHQPFLLSNAREVMIGTSIGISLYPEHGSTAEELMQQADTAMYRAKHDGRDGY
FT                   RYFSEELFLKAKARLELEQRLHRAITGQEFKVFYQPQISIKTNQIIGAEALLRWDDPEY
FT                   GLIPPSEFISVAEETGLIQNIGEWVLYETCRQGRDWLDQHLPPINLAVNLSPLQLHHGD
FT                   VRQLIGTILHNSGFPAHHLELELTESALMEQQEETVKILQGLRQQGIRIAIDDFGTGYS
FT                   SLAYLKQFPLDVLKIDKRFVEDIPHERDDMEIAATIVAMGHSLRLTVLAEGVETKAQLE
FT                   FLEQQGCDYYQGYLYSMPLPAEEFAQLLSQQNPPVTQAHIGKLRESAQIA"
FT   gene            complement(407724..408497)
FT                   /locus_tag="Tola_0357"
FT   CDS_pept        complement(407724..408497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0357"
FT                   /product="type II secretion system protein N"
FT                   /note="PFAM: type II secretion system protein N; KEGG:
FT                   aha:AHA_0579 type II secretion system protein N"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91987"
FT                   /db_xref="InterPro:IPR022792"
FT                   /db_xref="UniProtKB/TrEMBL:C4L988"
FT                   /inference="protein motif:PFAM:PF01203"
FT                   /protein_id="ACQ91987.1"
FT                   /translation="MTIKNLSPRLTLLLLFLFCYLLFLLATFPAAQLLPRLPLPAGMQL
FT                   HNIRGTVWQGQIGELRWQKRALHDVQWEVLFSRLWLGMPTVKLSLQDPEIAIASATVGW
FT                   RGDWKINDLTLKTPASVLQQQIPYPLPAEASGTLQLNISHLSFNNKQCLALEGQAEWLQ
FT                   AQLLTPAGELVLGNPQAELSCRNNELEINIRQDSAALRSQAQLQLNMQGLYKLQATLYP
FT                   GNELPADLRTSLNWLGTSDSEGAIRIKNEGRWNGY"
FT   sig_peptide     complement(408402..408497)
FT                   /locus_tag="Tola_0357"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.917 at
FT                   residue 32"
FT   gene            complement(408502..408981)
FT                   /locus_tag="Tola_0358"
FT   CDS_pept        complement(408502..408981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0358"
FT                   /product="General secretion pathway M protein"
FT                   /note="PFAM: General secretion pathway M protein; KEGG:
FT                   cps:CPS_4582 general secretion pathway protein M"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91988"
FT                   /db_xref="GOA:C4L989"
FT                   /db_xref="InterPro:IPR007690"
FT                   /db_xref="InterPro:IPR023229"
FT                   /db_xref="UniProtKB/TrEMBL:C4L989"
FT                   /inference="protein motif:PFAM:PF04612"
FT                   /protein_id="ACQ91988.1"
FT                   /translation="MKQWWQDRTTRERRIVLAAALVLLSIILYWNVWSPLQQHLQQQRG
FT                   QVQQLQQQLSWMQQQAPLVRQLKQQSASPREYSGDIASTLSNSSQGYQIVLKRIQPQGT
FT                   NALVEMDTTSFEQLVSWLNMLEQQYGITPQQIDLQPAEVPGKAQVRRLLLGRNKE"
FT   gene            complement(408978..410165)
FT                   /locus_tag="Tola_0359"
FT   CDS_pept        complement(408978..410165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0359"
FT                   /product="general secretion pathway protein L"
FT                   /note="TIGRFAM: general secretion pathway protein L; PFAM:
FT                   General secretion pathway L; KEGG: aha:AHA_0577 general
FT                   secretion pathway protein L"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91989"
FT                   /db_xref="GOA:C4L990"
FT                   /db_xref="InterPro:IPR007812"
FT                   /db_xref="InterPro:IPR024230"
FT                   /db_xref="InterPro:IPR025691"
FT                   /db_xref="UniProtKB/TrEMBL:C4L990"
FT                   /inference="protein motif:TFAM:TIGR01709"
FT                   /protein_id="ACQ91989.1"
FT                   /translation="MNEFLLIRLGSRHQERVHWLVWSVTQQAVISSGQLDNAAQLSELT
FT                   ERAGHRPVYVLVPGCDVIFRELTLPGRLNAQTMRALPFMLEDEIASDVEQLHITVLAHQ
FT                   GQQVNIAAVEQTQMQQWLSWLADAGLTAQQLLPDVLALPQPEGEQWSLLQLGDQWLIRQ
FT                   SAWQGSVVDNDLFSAWMTCHQPYPALHSYTPPPAEPPAEWIVSLCELPMQLLAEQVPVQ
FT                   RIDLLQGAFRRVSTWKKQWLRWRLPAVLTGLLLLLFMANQGMEYVQLRQQQQQLQQQMT
FT                   ALYRQLFPEEKRIVNPRAQLKQHLQGLQQAPLTDSFLSQLALLAPLLHKTPEIELQQLR
FT                   FEADKQEFRLQISAKDFGMLDKFRNQANTTFATEMTNMQDQGGRVSGMLIIRSKS"
FT   gene            complement(410162..411145)
FT                   /locus_tag="Tola_0360"
FT   CDS_pept        complement(410162..411145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0360"
FT                   /product="General secretion pathway protein K"
FT                   /note="PFAM: General secretion pathway protein K; KEGG:
FT                   aha:AHA_0576 general secretion pathway protein K"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91990"
FT                   /db_xref="GOA:C4L991"
FT                   /db_xref="InterPro:IPR005628"
FT                   /db_xref="InterPro:IPR038072"
FT                   /db_xref="UniProtKB/TrEMBL:C4L991"
FT                   /inference="protein motif:PFAM:PF03934"
FT                   /protein_id="ACQ91990.1"
FT                   /translation="MKRQQGMALLVVLLLLAVMVTMASSMTQRFRMEWQRTYNQQLQLQ
FT                   NYWYLLGSETLISKVLVQDFKDNPEKNSLAQYWAIEGQVFPVENAILQGVVRDSQACFN
FT                   LNSLTNDSTDETSTAVSATYRATVFKDLLINLGADDYRAQQITAAVQDWLDTNTIARSL
FT                   GAEDSEYEALTPPYLPANGLMQDVSELRAVRGMDAALYRRLLPQVCVIPEKTLQVNANT
FT                   LRTVQAPLLAALFLNDLSVDDARNILEQRPREGWDSVAEFLELGALSNTAAAGDQVQSA
FT                   LTIKSFYFLATLQAETDNYQTRLISLFQRQSDNQVTVIRRHFGGLE"
FT   sig_peptide     complement(411074..411145)
FT                   /locus_tag="Tola_0360"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.619 at
FT                   residue 24"
FT   gene            complement(411142..411789)
FT                   /locus_tag="Tola_0361"
FT   CDS_pept        complement(411142..411789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0361"
FT                   /product="general secretion pathway protein J"
FT                   /note="TIGRFAM: general secretion pathway protein J; KEGG:
FT                   asa:ASA_3781 general secretion pathway protein J"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91991"
FT                   /db_xref="GOA:C4L992"
FT                   /db_xref="InterPro:IPR010055"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:C4L992"
FT                   /inference="protein motif:TFAM:TIGR01711"
FT                   /protein_id="ACQ91991.1"
FT                   /translation="MLTIPSAKSQQTGFTLLEVLLALVIFAMLSLSAYAVLQGVMRNDE
FT                   VSREKITRLSELQRAFATLARDFTQVIPRPTRINGETSTILFQAERFKLGSEDGAVTLV
FT                   RAGWFNPGGELRRSELQKVGYRLRQQTLERLTYIYPDAVTGTEPTATPLLSRVTAFSLR
FT                   FYNNGQWLTQWITPDELPAAVEITITAEDYGTIRRLFLLTGTSDTASSGSRE"
FT   sig_peptide     complement(411682..411789)
FT                   /locus_tag="Tola_0361"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.982 at
FT                   residue 36"
FT   gene            complement(411796..412143)
FT                   /locus_tag="Tola_0362"
FT   CDS_pept        complement(411796..412143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0362"
FT                   /product="general secretion pathway protein I"
FT                   /note="TIGRFAM: general secretion pathway protein I; PFAM:
FT                   type II secretion system protein I/J; KEGG: asa:ASA_3780
FT                   general secretion pathway protein I"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91992"
FT                   /db_xref="GOA:C4L993"
FT                   /db_xref="InterPro:IPR003413"
FT                   /db_xref="InterPro:IPR010052"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:C4L993"
FT                   /inference="protein motif:TFAM:TIGR01707"
FT                   /protein_id="ACQ91992.1"
FT                   /translation="MTLLEVMVAMAIFAVAGIALMKTVTEQVVALATLEEKTFASWVAD
FT                   NQLVTIRLTEKWPNLNWSNGTEEMAGRTYYWRWHGVETADPQFRAIDVEVRDAEQAPDP
FT                   RATMRSYVSKN"
FT   gene            complement(412155..412817)
FT                   /locus_tag="Tola_0363"
FT   CDS_pept        complement(412155..412817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0363"
FT                   /product="general secretion pathway protein H"
FT                   /note="TIGRFAM: general secretion pathway protein H; KEGG:
FT                   ecf:ECH74115_B0007 general secretion pathway protein H"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91993"
FT                   /db_xref="GOA:C4L994"
FT                   /db_xref="InterPro:IPR002416"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR022346"
FT                   /db_xref="UniProtKB/TrEMBL:C4L994"
FT                   /inference="protein motif:TFAM:TIGR01708"
FT                   /protein_id="ACQ91993.1"
FT                   /translation="MRKTMRGFTLIEIMLVIVIIGCATGIIVLSIPGGPSPKLGNDLAE
FT                   ESQQLAATIQVMSEQATQQGRTIGLHISDHGYQFMIRQQTTAANDDTVTQSTSQALDTL
FT                   PDWDHQVWQPYTSEKLRTAGEFDEKVSLALTLDGLQLQEEENRLGRSNPQWFDTENQLE
FT                   AKTPQILLLPSGEITPFSLTLEELGSNSTLYRQIKGQENGQITVLNEPEDNVSGGHS"
FT   gene            complement(412817..413257)
FT                   /locus_tag="Tola_0364"
FT   CDS_pept        complement(412817..413257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0364"
FT                   /product="general secretion pathway protein G"
FT                   /note="TIGRFAM: general secretion pathway protein G; PFAM:
FT                   type II secretion system protein G; KEGG: asa:ASA_3778
FT                   general secretion pathway protein G"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91994"
FT                   /db_xref="GOA:C4L995"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR010054"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR013545"
FT                   /db_xref="UniProtKB/TrEMBL:C4L995"
FT                   /inference="protein motif:TFAM:TIGR01710"
FT                   /protein_id="ACQ91994.1"
FT                   /translation="MQRRQQRGFTLLEIMVVIVILGILASLVVPNLMGNKDQADHQKAV
FT                   SDIVALENALDMYKLDNSRYPTTDQGLNALLIKPDSDPVPRNYKDGGYIKRLPADPWQS
FT                   EYQLLSPGEHGTIDVFSMGPDGQSGTEDDVGNWALDKRDNQQ"
FT   gene            complement(413287..414507)
FT                   /locus_tag="Tola_0365"
FT   CDS_pept        complement(413287..414507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0365"
FT                   /product="general secretion pathway protein F"
FT                   /note="TIGRFAM: general secretion pathway protein F; PFAM:
FT                   type II secretion system protein; KEGG: aha:AHA_0571
FT                   general secretion pathway protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91995"
FT                   /db_xref="GOA:C4L996"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR011850"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:C4L996"
FT                   /inference="protein motif:TFAM:TIGR02120"
FT                   /protein_id="ACQ91995.1"
FT                   /translation="MAAFAYQALDAKGRNKEGMIEADSPRQARQALREQGLTPVSLTEA
FT                   VEQVKQQSLKRSWLQPRISTAELALLTRQLATLVAAALPIEEALKAVAQQTEKARLSTL
FT                   VAAVRTKVLEGHSLADGMSAFPSVFDQLYRAMVAAGEKSGHLEIVLNRLADYTEQRQQM
FT                   KNKLLQAMIYPIILTLVAISVISILLATVVPKVVEQFIHMKQELPFSTRFLMGASDLVR
FT                   DYGLWFVLLIAIALILWRGWVVKPANRRRYHAILLRLPVIGKVSRGLNTARFARTLSIL
FT                   NSSAVPLLEGMRISGDVLSNDEAKIRVTVAAERVREGSSLQTSLEQTKLFPPMMLHMIA
FT                   SGERSGELDNMLERAADNQDREFESQVNIALSIFEPALVVSMAVIVLFIVLAILQPILQ
FT                   LNNMIGR"
FT   gene            complement(414509..416011)
FT                   /locus_tag="Tola_0366"
FT   CDS_pept        complement(414509..416011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0366"
FT                   /product="general secretory pathway protein E"
FT                   /note="KEGG: aha:AHA_0570 general secretory pathway protein
FT                   E; TIGRFAM: general secretory pathway protein E; PFAM: type
FT                   II secretion system protein E; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91996"
FT                   /db_xref="GOA:C4L997"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013369"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="InterPro:IPR042181"
FT                   /db_xref="UniProtKB/TrEMBL:C4L997"
FT                   /inference="protein motif:TFAM:TIGR02533"
FT                   /protein_id="ACQ91996.1"
FT                   /translation="MPQESTATVIEHEQPVRLNFSFARDHGVLLQWQQAEPVLFCRTGV
FT                   SAQTLQEIRRLLRRPFRLHWLDADAFEQQLTDDYQRDSSEARQLMEDIGNEVDFFTLAE
FT                   ELPTSEDLLDADDDAPIIRLINAMLSEAIKSEASDIHIETFEKHLIIRFRIDGVLREIL
FT                   RPQRKLASLLVSRIKVMAKLDIAEKRVPQDGRIGLRIGGRAVDVRVSTMPSSYGERVVL
FT                   RLLDKNNVRLELKQLGMTDANRAHIADLIQKPHGIILVTGPTGSGKSTTLYAALSEINT
FT                   KDRNILTVEDPIEYDLEGVGQTQVNPKVDMTFARGLRAILRQDPDVVMVGEIRDVETAQ
FT                   IAVQASLTGHLVLSTLHTNTAIGAITRLQDMGVEPFLLSTSLLAVLAQRLVRTLCPVCK
FT                   QPQLLSEEERQRYELPVGVTHLFKAGGCDACNFTGYRGRTGIYELLIVDEKVREAIHAG
FT                   AGEFAIEHLIRSHTPSIRADGLQKVLNGETTLEEVMRVTRED"
FT   gene            complement(416011..418068)
FT                   /locus_tag="Tola_0367"
FT   CDS_pept        complement(416011..418068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0367"
FT                   /product="general secretion pathway protein D"
FT                   /note="TIGRFAM: general secretion pathway protein D; PFAM:
FT                   type II and III secretion system protein; NolW domain
FT                   protein; KEGG: aha:AHA_0569 general secretion pathway
FT                   protein D"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91997"
FT                   /db_xref="GOA:C4L998"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR013356"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:C4L998"
FT                   /inference="protein motif:TFAM:TIGR02517"
FT                   /protein_id="ACQ91997.1"
FT                   /translation="MKQFLKRSLVIGCLCTQLGISPALAAEYSASFKGTDIQEFINTVG
FT                   KNLGKTIIVDPSVRGTINVRSYDLLNEEQYYQFFLSVLDVYGFAVVPMPNGILKVVKAQ
FT                   NAKTSSIPVADETRTGSGDEMVTRVVPVRNVSVRELAPLLRQLNDNAGGGNVVHYEPSN
FT                   VLLLTGRAAVVNRLVEIVRRVDKVGDENVDVIKLKYASAGEMVRLITALTKNDKNALTN
FT                   VLTPKVVADERTNAVVISGENQGRQRIVTMIRQLDREQQTQGNTRVFYLKYANAKNLVE
FT                   VLSGTSKTIQNEKNSASGSMTATGNTADSASSSGSGSSSSGYNGKDLSIVADEQTNALV
FT                   ITAQPDVMQELERIIAKLDIRRAQVLVEAIIVEIQDGDTLNFGVQWANTNGGGTQFTAT
FT                   GLPTTTVANAANEWRNDGELSSTSTAALSSFNGLVAGFYEGNWAGLVTALSSNTKSNIL
FT                   ATPSIVTLDNKEAAFNVGQEVPVVTGSQSSTAGSVYSTVERKTVGTKLKVTPQINEGDS
FT                   VLLEVEQEVSSVASSSSTDSSSSSSNSSLGSTFNTRTVKNSVLVKSGETVVLGGLLSNN
FT                   TSESVYKVPLLGDIPILGYLFRYNGTSTTKQNLMVFIHPTILRDPVTYTGVSSSKYNLF
FT                   RAEQIAQDEDADSLSLPVNRPVLPAYGTETTLSPKMKALLEQQGQAGSLQ"
FT   sig_peptide     complement(417991..418068)
FT                   /locus_tag="Tola_0367"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 26"
FT   gene            complement(418092..418331)
FT                   /pseudo
FT                   /locus_tag="Tola_0368"
FT   gene            complement(418438..419442)
FT                   /locus_tag="Tola_0369"
FT   CDS_pept        complement(418438..419442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0369"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; SMART: helix-turn-helix- domain containing
FT                   protein AraC type; KEGG: asa:ASA_2543 AraC family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91998"
FT                   /db_xref="GOA:C4L999"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:C4L999"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ACQ91998.1"
FT                   /translation="MNKSVSNLLAKKMLTHLGSKGLDTDRICKACNILPTDITNPGGRI
FT                   IAAKHYKLLTETIPYLDFNERVFSQNLSSLYDDYPELIGYCLNSRNPFDAIHAYSKYRT
FT                   IIGNCDSFIITETDDKMSIEYINEGSKILGSSQAIFNFSSILKIMKKYEENYSIKISLT
FT                   DGIGKNSPLEDFFGTRCQWNEKKNILEINKTKTEMAYEKYNSTLADFQKEKLDKKISEL
FT                   SENIGFASIVSRIVLNTLHNKESSDDENILDSICYKLNMSRWTLNRHLHLEGVNFQSIL
FT                   KEIRMKEACRLLKESHLTLQEISEIIGFSSQSTFTRFFKGQFDVNPSNFRKNN"
FT   gene            complement(419741..420589)
FT                   /locus_tag="Tola_0370"
FT   CDS_pept        complement(419741..420589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0370"
FT                   /product="general secretion pathway protein C"
FT                   /note="TIGRFAM: general secretion pathway protein C; KEGG:
FT                   aha:AHA_0568 general secretion pathway protein C"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ91999"
FT                   /db_xref="GOA:C4L9A0"
FT                   /db_xref="InterPro:IPR001639"
FT                   /db_xref="InterPro:IPR024961"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9A0"
FT                   /inference="protein motif:TFAM:TIGR01713"
FT                   /protein_id="ACQ91999.1"
FT                   /translation="MQLLTIQNWCLSENGLSALRRAAVLLLLVGCSYQLARLSWQLLPA
FT                   SQTTAPASVSTNIPATPGDQQESQQRLAAIREAALFGIDVQPQDRGTTAAPKSRLNAQL
FT                   TGIMASNIASRSIAIIARNGQQQSYAIGDVIQGTDARITEIFPDRIIITRQQQDEALFL
FT                   DENAATAPPAAAPAPGNITGLRQQIMKNPAQLQDYLSITPVMENNQLQGYRLNPGRNPE
FT                   IFGQSGLQANDLAISINGLDLRDKGDAVQAMQQLAHQAEMNITVLRNGAEQDIYINLAQ
FT                   P"
FT   gene            420775..421365
FT                   /locus_tag="Tola_0371"
FT   CDS_pept        420775..421365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0371"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: aha:AHA_0583 ADP-ribose
FT                   diphosphatase NudE"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92000"
FT                   /db_xref="GOA:C4L9A1"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9A1"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ACQ92000.1"
FT                   /translation="MSEKPVKPERALPEILQRDVVAQSRLFRVEALQLRFSNGEERVYE
FT                   RIPGGNRHAVMIVPVLNKDTLMLIREYAAGTHSYEIGFPKGLVDMGETDAEAANRELQE
FT                   EIGMAARQLTFLKQVSLAPGFMNARMGIFLAEDLFPQQLTGDEPEPLEVIPWPLKDAEA
FT                   LLEHPQFHEARSVAALLLLLRQVKDGVLSDHPA"
FT   gene            complement(421362..422066)
FT                   /locus_tag="Tola_0372"
FT   CDS_pept        complement(421362..422066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0372"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pap:PSPA7_6229 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92001"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR021488"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9A2"
FT                   /inference="similar to AA sequence:KEGG:PSPA7_6229"
FT                   /protein_id="ACQ92001.1"
FT                   /translation="MAKLRLCMILLAGITLLPAQARVNAEDHHAFWLWSAVRPQPVLAQ
FT                   AESIYILQGQISERRGQTRFIPQGIATPRLRHGQIWLAYRVETLQWSESIYQSIAQQII
FT                   RWKTQGNPVTGIQIDFDARTLQMQQYITFLQELRRRLPAPYALSITGLLDWSNHTSPAL
FT                   VNQLAGIVDEVVVQTYQGRTTISNYADYLPRLAQLRIPFKVGLVQHGDWQAPDYLEQAA
FT                   FFRGYVVFLLNN"
FT   sig_peptide     complement(422001..422066)
FT                   /locus_tag="Tola_0372"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.911 at
FT                   residue 22"
FT   gene            complement(422066..424228)
FT                   /locus_tag="Tola_0373"
FT   CDS_pept        complement(422066..424228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0373"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pap:PSPA7_6231 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92002"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9A3"
FT                   /inference="similar to AA sequence:KEGG:PSPA7_6231"
FT                   /protein_id="ACQ92002.1"
FT                   /translation="MHWRHIITGGVILSALFQWPAQACSDDSCYPTWDLKKDLLDTCNN
FT                   TPFLSPANDSRINLQLLLADHSHQPLTVPTADDYYKEQGYALVPFPVDLADSTETPASD
FT                   ASPLVTLAVQMGVSSDTASGLLAQSTIWEGSRCASNNQQTALRYLQQLVQAGDIPAEER
FT                   RQLATSRLAILQSCAADPEQQAGLLPDNIQSESGQLFANYLQGALAFYNGDFTRSIAAF
FT                   NVLSQSSQPWLKETAIYMQGRVFLNAAQQNAFDDIGYPSNDKIDLAALQAAESAFNRYL
FT                   TAYPQGQYSASATGLLRRVYWLMNDQKRLAQAYAYWFGHPLSEANITSNQLVQEIDNKL
FT                   LLSFSDTGSIDDPHLLAIIDLMLMRQRSSDDSRPPFTLTQLQAQQSRFARQPELYTYLL
FT                   GAYALYVEKDADKTLTILPESSAEEIPDYLGFSQQTLRGFALEMQEQWSQAEQLWLKML
FT                   QQVTQPVQRQQLELSLAMNYERSQKLEQVFASNSPIKTPMIREILLRNVAAPVLLRQQI
FT                   SRPLSAQEHDVALFTLLYKDLTRSMYADFLKDINLLPEKVSTAPLFMGFTYNTQQALAL
FT                   FQWDGKNATEYQCPALSAVVQTLQDDSSNPRALNCLGEFIFRHGLDDFPLNNQPESNEL
FT                   GGTESHFTGKLFSRLDGYQQVIASQQAAREDKAYALYRAVNCFAPSGYNSCGTQDIPIA
FT                   QRKQWFYTLKSQFGDTSWAQQLKYYW"
FT   sig_peptide     complement(424157..424228)
FT                   /locus_tag="Tola_0373"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.909 at
FT                   residue 24"
FT   gene            complement(424335..425237)
FT                   /locus_tag="Tola_0374"
FT   CDS_pept        complement(424335..425237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0374"
FT                   /product="transcriptional regulator, ArgP, LysR family"
FT                   /note="TIGRFAM: transcriptional regulator, ArgP family;
FT                   PFAM: regulatory protein LysR; LysR substrate-binding;
FT                   KEGG: aha:AHA_0555 chromosome replication initiation
FT                   inhibitor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92003"
FT                   /db_xref="GOA:C4L9A4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR017685"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9A4"
FT                   /inference="protein motif:TFAM:TIGR03298"
FT                   /protein_id="ACQ92003.1"
FT                   /translation="MNHLDYKLLQALDVVLREQSFERAAQQLHLTQSAVSQRIKQLELL
FT                   VAQPVLIRSQPLQLTAMGQLLLTHYQQVQQLERELLPHLSPSAPAKPLPVTIATNADSL
FT                   ATWLIPALTPLLQPGLIELNLLIEDENRTIDRLRRGEAFGAITTQQEPLPGCQSDLLGY
FT                   MDYVLTASPGFIRQYFPDGLTEQALRKAPGVAFDQRDDMHVSFVEKHFGLPPGSYPCHT
FT                   VRSSEAFVALAKAGAAYCLIPKLQITTELARGELVELMPETPLLQRGLYWQRWVLERGI
FT                   YRQISQNLLIWSSQVLPRQ"
FT   gene            425333..425956
FT                   /locus_tag="Tola_0375"
FT   CDS_pept        425333..425956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0375"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   eta:ETA_28110 arginine exporter protein ArgO"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92004"
FT                   /db_xref="GOA:C4L9A5"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9A5"
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /protein_id="ACQ92004.1"
FT                   /translation="MLNGAIYLQGMLVGASLIIPIGAQNAFVLERGIRRNHAMLVAGLC
FT                   FLADAFLIALGVGGAGKVIAQSLLLQLLLTLGGAAFLLRYGWSSLQRAWRAMAQTLEQK
FT                   GGMSRIQAVTMTLAVTLLNPHVYLDTVMIQGAVAGQYPREQQLSFALGSISASLCWFFG
FT                   LALLASWLAPQLQRVRVQQCIDTGVGLLMWLLAFGLLRHAASLV"
FT   gene            426067..426498
FT                   /locus_tag="Tola_0376"
FT   CDS_pept        426067..426498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0376"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG: afr:AFE_2086
FT                   heat shock protein, HSP20 family"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92005"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9A6"
FT                   /inference="protein motif:PFAM:PF00011"
FT                   /protein_id="ACQ92005.1"
FT                   /translation="MRLEKWNPFRDLDDIFHNYQRSFLTPSLSRESMVGSEWVPAVDIV
FT                   EDDKEYQLKVEIPEIPREAVKLQINHGMLTITGERKMEKSDEKHHRIERYYGSFSRSFT
FT                   LPDDVKAENISANFSNGMLYVHMMKSTPTGDKPLEIEIH"
FT   gene            complement(426555..427658)
FT                   /locus_tag="Tola_0377"
FT   CDS_pept        complement(426555..427658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0377"
FT                   /product="tRNA (uracil-5-)-methyltransferase"
FT                   /EC_number="2.1.1.35"
FT                   /note="KEGG: esa:ESA_03801 tRNA
FT                   (uracil-5-)-methyltransferase; TIGRFAM: tRNA
FT                   (uracil-5-)-methyltransferase; PFAM:
FT                   (Uracil-5)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92006"
FT                   /db_xref="GOA:C4L9A7"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR011869"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4L9A7"
FT                   /inference="protein motif:TFAM:TIGR02143"
FT                   /protein_id="ACQ92006.1"
FT                   /translation="MTNAVHSDALYQQQLHEKQQRLTQLLAPFQAPEPEVFASAPSHYR
FT                   MRAEFRIWHEGVDELYYVMFNSETKQRYYVHEFPTGSQLINRLMPRLLELIRGNHTLKY
FT                   KLFQIDFLTTLSGEALISLLYHKTLNEAWQPAATELRQALRAEFGEVDVVGRAHKQKIV
FT                   LEREYVLEQLQVGDRTLEYMQVENSFTQPNAGMNQQMLGWATDVTADCQGDLLELYCGN
FT                   GNFSLALAKNFNRVLATEIAKPSVHAAQHNIAVNKIDNVQILRMSAEEFTQAMNGEREF
FT                   NRLKGIDLQSYQCNTILVDPPRAGLDPATVAMIQAYEQILYISCNPETLCDNLKTLCQT
FT                   HNIARCALFDQFPFTHHMESGVWLVRK"
FT   misc_binding    427804..427998
FT                   /bound_moiety="adenosylcobalamin"
FT                   /note="Cobalamin riboswitch as predicted by Rfam(RF00174),
FT                   score 96.74"
FT   gene            428051..429904
FT                   /locus_tag="Tola_0378"
FT   CDS_pept        428051..429904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0378"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: vha:VIBHAR_00261
FT                   phosphatidylglycerophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92007"
FT                   /db_xref="GOA:C4L9A8"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010101"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9A8"
FT                   /inference="protein motif:PFAM:PF00593"
FT                   /protein_id="ACQ92007.1"
FT                   /translation="MSKRLTASVLSALAIAAPTHAEESTGLPITVTATRFAEPTASVLA
FT                   PVNIITRKDIEQLHARSLADVVKTLPGVEMVSNGGRGQQASVIVRGATSAETLVLMDGV
FT                   RINSATNGATDFSSIPLNQVERVEFVRGARASVYGSDAIGGVINIITRGTAGQTKHTLN
FT                   GSAGSRDYQNLNGSTSFDINQQQHLKLAAGYETEDGYNVHPVEGVNDGDEHGFLGRNAM
FT                   LDYQNQLTDEVNVYGAMHWTRNTMQSDGSYSYGDYSQHERDETWEENTHYQLGTKYQKD
FT                   RYQTELNTSLINNDMYYYPDTISRDEASSVYKTSQYQLSWLNNYQITDPWTVGAGVDLR
FT                   RDVLHSDSQSSGSAFFDEDKNRNNVSVYALSQYRWEQWLGELSGRTDDNQQYGRHNTWQ
FT                   AGLGWNFLPEYRLSARYGTAFRAPTFNDLYTPYSVSPDLKPETSKNSEIALEGTTQEVL
FT                   WRVTAYRNDLEDMIEWAPDSSGYWYPGNVGRARIKGIELEAEFATGWLTHKLSADFKNA
FT                   RDLEDGTVLSRRAKRNYKWTGMANWDKWDASLTGQYQSERYDSSTRLAPYALWNAAAGY
FT                   HVLPQLRIGGRIDNLFDKDYALASGYATPERSYYVDFSYQL"
FT   sig_peptide     428051..428116
FT                   /locus_tag="Tola_0378"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            complement(429983..431890)
FT                   /locus_tag="Tola_0379"
FT   CDS_pept        complement(429983..431890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0379"
FT                   /product="arginine decarboxylase"
FT                   /note="TIGRFAM: arginine decarboxylase; PFAM: Orn/DAP/Arg
FT                   decarboxylase 2; KEGG: asa:ASA_2740 arginine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92008"
FT                   /db_xref="GOA:C4L9A9"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002985"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="InterPro:IPR040634"
FT                   /db_xref="InterPro:IPR041128"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4L9A9"
FT                   /inference="protein motif:TFAM:TIGR01273"
FT                   /protein_id="ACQ92008.1"
FT                   /translation="MANWSCQDALKMYNVPYWGAGFFNIDALGRVVVTPDKTRLDCKIA
FT                   LVDIIEQLRKQGYATPVLLRFPDIIKTRINALFGAFEQAIQSYGYKGRYQCVYPIKVNQ
FT                   QNQVIESVTRAFADKPALGLEAGSKPELLAVLSHHHDLGSVIVCNGYKDREYVRHALLG
FT                   SLLGHHVYIVVEKPSELELILDEAARLNITPRIGVRARLASQGSGKWQASGGEKSKFGL
FT                   NAAQILRLVERLREADKLDCLQLVHFHLGSQIANIRDIQGGIRECGRFYAELRHLGANI
FT                   EVVDVGGGLGVDYEGSRSQSHCSANYNLREYANNVVWGIGDVCAEFDLPHPMIISESGR
FT                   AITAHHAVLISNIVGMESQLPTSLPDAPDAEAPMLLQNMWDSWKELHEKEDPGLLEIFH
FT                   DSVSDLADVHTQYTLGMLSLHQRAWAEDLHLNLCLKLKVMLDPVNRMHRNLQDELNEKL
FT                   ADKCFVNFSLFQSLPDAWGIDQIFPIMPLSGLDQQPTRRGVIMDITCDSDGMIKEYVDG
FT                   VGIENSLPMPEMRNDETNYMGFFLVGAYQEILGDLHNLFGDTHSAEVCLNDNGEPVITN
FT                   IIKGDNVDNLLRYVNIDTSVIRRDYQKLVAHPSLSEETRKALLEELEAGLQGYAYLEDE
FT                   "
FT   gene            complement(432149..433522)
FT                   /locus_tag="Tola_0380"
FT   CDS_pept        complement(432149..433522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0380"
FT                   /product="anion transporter"
FT                   /note="TIGRFAM: anion transporter; PFAM: sodium/sulphate
FT                   symporter; Citrate transporter; KEGG: aha:AHA_2430 divalent
FT                   anion:Na+ symporter (DASS) family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92009"
FT                   /db_xref="GOA:C4L9B0"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="InterPro:IPR031312"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9B0"
FT                   /inference="protein motif:TFAM:TIGR00785"
FT                   /protein_id="ACQ92009.1"
FT                   /translation="MSDDTSTTGIFKSQYKPLILLLDIALLLILLNWLPFEPQINKGLS
FT                   LFLFIAVLWLSEAIHVTVTALLVPIMAVLLGIFGLQPAISHFANPTIYLFFGGFALAAA
FT                   LHKQQLDQFLAQQILVLAKGRLQTAVGLLFGITALLSMWISNTATAAMMLPLAMGIAVQ
FT                   LDQEKDRSTRTFILLGMAYSASIGGIGTLVGSPPNVIAAAQAHITFLQWLVFGIPIVLI
FT                   LMPCAMAALYLVLRPQLNQQCAMQQMDFVWTRQHKLTLVIFSCTVLAWISSQQLSVWLG
FT                   GIDQLDTLIALVAAVMICITGVASWRDVERQTEWGVLMLFGGGLTLSAVLKETGTSLFM
FT                   AQQITAWFSHAHPLLLLLAIAAFVVFLTELASNTATAALMVPLFASVATNMGMSVSIMS
FT                   IMIAVSASCAFMLPVATPPNAIVYASGYVPQRDMIRVGFVLNIMCTILLALFAYYGGI"
FT   gene            complement(433586..434062)
FT                   /locus_tag="Tola_0381"
FT   CDS_pept        complement(433586..434062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0381"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein"
FT                   /note="TIGRFAM: anaerobic ribonucleoside-triphosphate
FT                   reductase activating protein; KEGG: aha:AHA_1232 anaerobic
FT                   ribonucleotide reductase-activating protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92010"
FT                   /db_xref="GOA:C4L9B1"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR012837"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9B1"
FT                   /inference="protein motif:TFAM:TIGR02491"
FT                   /protein_id="ACQ92010.1"
FT                   /translation="MFYHQYYPIDVVNGPGTRCTLFVSGCEHQCRGCYNQSTWRTDSGH
FT                   PFTQEMADRIIADLNDTKIKRRGITFSGGDPLHPANQADVLALVKRIRAECPGKDIWMW
FT                   TGYLLAELTPDQQEITALIDVLVDGKFVQELADPSLVWRGSSNQVIHYLRQPAE"
FT   gene            complement(434183..434917)
FT                   /locus_tag="Tola_0382"
FT   CDS_pept        complement(434183..434917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0382"
FT                   /product="Carbonate dehydratase"
FT                   /EC_number="4.2.1.1"
FT                   /note="PFAM: carbonic anhydrase; KEGG: aha:AHA_3404
FT                   carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92011"
FT                   /db_xref="GOA:C4L9B2"
FT                   /db_xref="InterPro:IPR001148"
FT                   /db_xref="InterPro:IPR018338"
FT                   /db_xref="InterPro:IPR023561"
FT                   /db_xref="InterPro:IPR036398"
FT                   /db_xref="InterPro:IPR041891"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9B2"
FT                   /inference="protein motif:PRIAM:4.2.1.1"
FT                   /protein_id="ACQ92011.1"
FT                   /translation="MKKNLFCAAMLLTSFSAFTAEQHAHWGYSGETGPENWAKLTPEFG
FT                   ACAGKNQTPVNLDGFIKAELKPLKFNYKAGGSQILNNGHTVQVVYDAGSNVVIDGVEYA
FT                   LKQFHFHAPSENQIKGESYPLEGHFVHADKDGNLAVVTVMFKEGHANEALESLWTHMPA
FT                   KEGDKIALSPANNALKFFPKDHAYYRFNGSLTTPPCTEGVRWIVMKKPVFVSKAQIDAF
FT                   KKVMVHANNRPLQPINAREILG"
FT   sig_peptide     complement(434858..434917)
FT                   /locus_tag="Tola_0382"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 20"
FT   gene            complement(435037..435990)
FT                   /locus_tag="Tola_0383"
FT   CDS_pept        complement(435037..435990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0383"
FT                   /product="lipid A biosynthesis lauroyl (or palmitoleoyl)
FT                   acyltransferase"
FT                   /note="TIGRFAM: lipid A biosynthesis lauroyl (or
FT                   palmitoleoyl) acyltransferase; PFAM: lipid A biosynthesis
FT                   acyltransferase; KEGG: aha:AHA_3768 lipid A biosynthesis
FT                   lauroyl acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92012"
FT                   /db_xref="GOA:C4L9B3"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="InterPro:IPR011920"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9B3"
FT                   /inference="protein motif:TFAM:TIGR02207"
FT                   /protein_id="ACQ92012.1"
FT                   /translation="MRATQLPDTAPRLTAGLFHPRYWPQWFGHAVLWLIVQLPYPVLMQ
FT                   LGAALGWLTMKILPRRVRIARTNLQLAFPEWDEETREQQIRENFANVGRAIFETGIAWF
FT                   WPDRRIRKIMQVVGAEHVEQAVANKQGMLLLSAHFMTLELNARMFGLLRPGVGVYRPNT
FT                   NPVLEYAQYHGRCKSNKYLVNRDDVKGMIKTLRQGEALWYAPDHDYGPHASVFVPFLGV
FT                   SDAATITGTATLARVKNTVVLPCYNIRLPQGGYQLIIEPPLQNYPTGDDIADATRSNQV
FT                   LEAAVRKAPAQYMWLHRRFKSRPDGTKFRYNPGEQR"
FT   gene            436123..437568
FT                   /locus_tag="Tola_0384"
FT   CDS_pept        436123..437568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0384"
FT                   /product="rfaE bifunctional protein"
FT                   /note="TIGRFAM: rfaE bifunctional protein;
FT                   cytidyltransferase-related domain protein; PFAM: PfkB
FT                   domain protein; cytidylyltransferase; KEGG: aha:AHA_3767
FT                   bifunctional heptose 7-phosphate kinase/heptose 1-phosphate
FT                   adenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92013"
FT                   /db_xref="GOA:C4L9B4"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011913"
FT                   /db_xref="InterPro:IPR011914"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023030"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9B4"
FT                   /inference="protein motif:TFAM:TIGR02199"
FT                   /protein_id="ACQ92013.1"
FT                   /translation="MTMRITLPDFSAARVLVVGDIMLDRYWSGPTRRISPEAPVPVVKV
FT                   EKNEDRPGGAANVALNVAALGGKTTLLGFVGQDEAADCLEAKLASHKVSYDLVKVAELP
FT                   TITKLRILSGNQQLIRLDFEDSFAAADPAPLLAKLDAALPDFDVLILSDYAKGALTCVR
FT                   DIIALARKHKVPVLIDPKGDSFEKYRGATLIKPNMLEFETIVGKVKNEEDLIEKAKNLL
FT                   NELDLEALLVTRSENGMLLVRRGGAVLALRTQAREVFDVTGAGDTVVGALATALSAGKS
FT                   LEEACAIANCAAGVVVAKLGTSTVSPQELAQALHEHSSVEQAFGVMNEAELKTAVLAAR
FT                   RRGEKIVMTNGCFDILHAGHVSYLKAAHKLGDRLIVAVNDDASVRRLKGEKRPIVPEDQ
FT                   RMAVLAALDSVDWVVPFTEDTPQRVIAGILPDLLVKGGDYQPQDIAGYAEVTANGGEVR
FT                   VLHFEDGCSTSNIVKTIIERECK"
FT   gene            437689..438963
FT                   /locus_tag="Tola_0385"
FT   CDS_pept        437689..438963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0385"
FT                   /product="Ferric reductase domain protein/transmembrane
FT                   component domain protein"
FT                   /note="PFAM: Ferric reductase domain protein transmembrane
FT                   component domain; Oxidoreductase FAD-binding domain
FT                   protein; oxidoreductase FAD/NAD(P)-binding domain protein;
FT                   FAD-binding 8 domain protein; KEGG: pae:PA0545 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92014"
FT                   /db_xref="GOA:C4L9B5"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9B5"
FT                   /inference="protein motif:PFAM:PF01794"
FT                   /protein_id="ACQ92014.1"
FT                   /translation="MRYLFLLLLISLSCWGLTLPLDAMQQGFLFWRNQGVQLTGILALA
FT                   LMGALMLMATRPAWLEQRLGGLDHLYQLHKWSGITAGSMVLLHWLLTKSPRWLVDWGLL
FT                   ELGPRPAGAHVPDVWRGIAKEVGEYCFYAMILFMIVSLVKVLPYGRFRQIHKVGAVLFL
FT                   LAAFHSIYLLPDATRWTPFGLLTLIAGVLGSLAALWSLFGLIGRPRRYPGQIIEIREHD
FT                   GNVLELEVVLPTDFQDEYLPGQFALLTLHKEEGSHPFTIVREDVQNGSIIFAIKALGDY
FT                   TRQLIGQVQEGDEVTVEGPYGRFVLPESGGQEYWIAGGIGITPFLAWLEGLVAEGYHRP
FT                   GAHLYYCVNNRQEILFAERLQQLSKQTGVKVTIVDRETDGFLDPSRLDIDEDTRLWFCG
FT                   PKGMRDMLLKHVPASQLHYEQFDFR"
FT   sig_peptide     437689..437760
FT                   /locus_tag="Tola_0385"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.870 at
FT                   residue 24"
FT   gene            complement(438981..439931)
FT                   /locus_tag="Tola_0386"
FT   CDS_pept        complement(438981..439931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0386"
FT                   /product="C4-dicarboxylate transporter/malic acid transport
FT                   protein"
FT                   /note="PFAM: C4-dicarboxylate transporter/malic acid
FT                   transport protein; KEGG: ajs:Ajs_1367 potassium-tellurite
FT                   ethidium and proflavin transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92015"
FT                   /db_xref="GOA:C4L9B6"
FT                   /db_xref="InterPro:IPR004695"
FT                   /db_xref="InterPro:IPR038665"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9B6"
FT                   /inference="protein motif:PFAM:PF03595"
FT                   /protein_id="ACQ92015.1"
FT                   /translation="MTSRHIPASFFGMVLGLSGLGQAWRIAAHLWQLPALIGEGLLLLA
FT                   GCVWAVLLLGYLAQAIRHFALVKAEFLHPVQGGTPALLGASTLLIVLAVLPYSLTAAWL
FT                   LTIAGISWHLVFSLWHTGTLWQGGRDTLDTAPTLYLPTVAGNFTSAAALGALGHADWGW
FT                   LFLGAGVFSWLALESLIIQRLWHPKTMPVAQRPLLGIQFAPPVVCAMASLLLMPGSTAP
FT                   WLLMLWGYGLFQLLLGLRLGAWLGAQAFAPSYWAYTFGVAATTVSGLKLAAAGLPSAQW
FT                   LAIPIFIGANLFIGYLAFRTVQMLLRGQLYGKAAR"
FT   sig_peptide     complement(439860..439931)
FT                   /locus_tag="Tola_0386"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.832) with cleavage site probability 0.755 at
FT                   residue 24"
FT   gene            complement(440020..441333)
FT                   /locus_tag="Tola_0387"
FT   CDS_pept        complement(440020..441333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0387"
FT                   /product="type I secretion outer membrane protein, TolC
FT                   family"
FT                   /note="TIGRFAM: type I secretion outer membrane protein,
FT                   TolC family; PFAM: outer membrane efflux protein; KEGG:
FT                   asa:ASA_0523 outer membrane protein TolC"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92016"
FT                   /db_xref="GOA:C4L9B7"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010130"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9B7"
FT                   /inference="protein motif:TFAM:TIGR01844"
FT                   /protein_id="ACQ92016.1"
FT                   /translation="MKKSLLSVFILLGLSPWAYAESLLDIYHQAREKDPQLQETLAQRN
FT                   VAFEKINEADAAKLPQIGLDANANYLKSNNDDAYTARTTGAGITLTQALFRQSVWMNSD
FT                   ITSKQAMASDVALNLEKQGLMLRTAQAYFSVLAAQDSLEYATTNEKALQRQLDETQQRF
FT                   DVGMTAITDVQEAKAVHDLAVADTINAQNALSNSYEALRQLTGTEHRYLDVLNIERFSP
FT                   TPMTQSAEQWLKQAQDHSLALNQLRIAKDVAKQQIDLAKAGHLPTLDLKLGANSDYTDY
FT                   EKNTASREDGTVNEGTIGLQFNLPLYSGGATQSQVKQAQFNYVAASESLEKTYRSMQAD
FT                   LYKNYNNVFASIGTIKAYQQSVISADSALTATQAGYQVGTRTIVDVLNSTTKLYFAKQK
FT                   LSDARYNYILNTLQLKQTAGTLSEQDLLDINNGLMTKK"
FT   sig_peptide     complement(441271..441333)
FT                   /locus_tag="Tola_0387"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.957 at
FT                   residue 21"
FT   gene            complement(441353..442489)
FT                   /locus_tag="Tola_0388"
FT   CDS_pept        complement(441353..442489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0388"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: rce:RC1_2058 ABC
FT                   transporter, permease protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92017"
FT                   /db_xref="GOA:C4L9B8"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9B8"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ACQ92017.1"
FT                   /translation="MNQVLSWHRLLAMIVKEFIQLRRDRLTFAMMLGIPLIQLILFGFA
FT                   INGDPKHLPTVIVAHEQTPFTRAIVQGLENSGYFQLVATDLGEAEADHWLEEGDAQFAV
FT                   VIPAGFAKKLQRGERPQLLVAADATDPSATANAIGALQQLSQQWLQHELTGTLSALNGK
FT                   AQPYEVVIQRRFNPEGLTQYNIVPGLMGVILTMTMIMMTALAVTREVERGTMENLLATP
FT                   VRPLEVMLGKILPYVLIGFVQVAVILIVAELLFEVPFIGPGSWLLLGILVFIAANLSIG
FT                   ITISSVARNQTQAMQMTFFFFLPSMLLSGFMFPFRGMPFWAQQIGELLPLTHFIRLIRG
FT                   IMLKGNGMAEMWPHLWPLLLFLFAMLLVGVLRFRKTLD"
FT   gene            complement(442498..443424)
FT                   /locus_tag="Tola_0389"
FT   CDS_pept        complement(442498..443424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0389"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mag:amb0182 ABC-type multidrug transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92018"
FT                   /db_xref="GOA:C4L9B9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9B9"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACQ92018.1"
FT                   /translation="MNSENWIIDVQGLNKSFGDKLVVDNLSLQVRRGEIFGFLGPNGSG
FT                   KTTSIRMMCGLLTPDSGSGHTLGYDIVRQAADIKRHVGYMTQRFGLYDDLSLRENLDFI
FT                   ARIYGMPQRKQRVQQALERLGLQARQNQLAGTLSGGWKQRLALAACMLHEPQLLLLDEP
FT                   TAGVDPKARRDFWDEIHQLAAEGMTVLVSTHYMDEAERCHRLGYIAYGQLLAGGTPKEL
FT                   IQQSQFTTWLVEGEVDVLLPALQNHPAVALITRFGNSLHINGLDAAALAMAIEPFRQRN
FT                   DLRWQLITPQLEDVFIHLMQQSQDNFR"
FT   gene            complement(443428..444384)
FT                   /locus_tag="Tola_0390"
FT   CDS_pept        complement(443428..444384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0390"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   pol:Bpro_3452 HlyD family secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92019"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9C0"
FT                   /inference="protein motif:PFAM:PF00529"
FT                   /protein_id="ACQ92019.1"
FT                   /translation="MRKYILLLCAFGLSACQPKTENTLPGYVEGDYVRIATPVAGYLRE
FT                   LAVTEGQPVQTGQPLFRLESSEVSSNQQTALATLKKAQAQAADLSKGKRSEEITALEAQ
FT                   LGAAQAALRLSEQELSRQQRLRQQGFSNQATLDQAASSRLQAQGKVRDLKAQLSLASQA
FT                   ARSDLRQAAQADITAAEAQTGHADWLVAQTSPLSPVTATVEETLYLPGEWIPAGSPVVT
FT                   LLAPDAVKIRFYIPETALATIKTGQSVTISCDGCKATIPARISFIASNAEYTPPVIYSK
FT                   ENRAKLVFMVEAKPLDTHAFPLHPGQPVAVALSPTEQ"
FT   sig_peptide     complement(444322..444384)
FT                   /locus_tag="Tola_0390"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.816) with cleavage site probability 0.580 at
FT                   residue 21"
FT   gene            complement(444377..445039)
FT                   /locus_tag="Tola_0391"
FT   CDS_pept        complement(444377..445039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0391"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: Transcriptional regulator TetR ; regulatory
FT                   protein TetR; KEGG: dal:Dalk_2023 transcriptional
FT                   regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92020"
FT                   /db_xref="GOA:C4L9C1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015292"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9C1"
FT                   /inference="protein motif:PFAM:PF09209"
FT                   /protein_id="ACQ92020.1"
FT                   /translation="MPAFPTIHDLAASAHGEETRLKLIHAATPEFIEQGFRAARVQQIA
FT                   ARAGVRLSAINYHFGGKEGLYLAVLRYHGDLAITQQPLLSDSELPLPDRFRFLIHSVLL
FT                   RMLDEQQGCRIAQLVLREMVNPTAALDDIYHRFQQPQLQQMLSLLQQILPEETPDTLLR
FT                   CTLSMMSQCIIYVLARPLIVRTSPHLLTDPGWLEEIENHIVRFSWAGLMALREEPHA"
FT   gene            445215..445856
FT                   /locus_tag="Tola_0392"
FT   CDS_pept        445215..445856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0392"
FT                   /product="ADP-ribose diphosphatase"
FT                   /EC_number="3.6.1.13"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: aha:AHA_3765
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92021"
FT                   /db_xref="GOA:C4L9C2"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR004385"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9C2"
FT                   /inference="protein motif:PRIAM:3.6.1.13"
FT                   /protein_id="ACQ92021.1"
FT                   /translation="MTDQLLAADQHYDRNDVEIIKCEPCFKGFFRINRYHLRHKLFAGG
FT                   WGPVIQREMFERGHAAAVLPYDIENDKVVLLEQFRLGAYETKQDPWLLELVAGIIEPGE
FT                   QADEVIHREAEEESGLKLQRAEFVLSYMVSPGGTTERIDLYVGKVDSTLANGLHGLAHE
FT                   GEDIRVHVVSREQAYRWVEEGRIDNATTVIALQWLQLHHADLQRRWLGGS"
FT   gene            445853..446296
FT                   /locus_tag="Tola_0393"
FT   CDS_pept        445853..446296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0393"
FT                   /product="protein of unknown function DUF1249"
FT                   /note="PFAM: protein of unknown function DUF1249; KEGG:
FT                   asa:ASA_0526 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92022"
FT                   /db_xref="InterPro:IPR009659"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9C3"
FT                   /inference="protein motif:PFAM:PF06853"
FT                   /protein_id="ACQ92022.1"
FT                   /translation="MTTLCVARRHVPDLPELHRAYETNYMALMKLLPSTNDGAARLYNI
FT                   AQSLQFAVRILENTRYTTLIEICQHNDEFPDFLRSHMQVRLYHDARMAEVCVSQQISRL
FT                   LPSYDYPNPAMHQRDEKEQCNHFLAEWLRFCLAHGYSAEALAY"
FT   gene            446382..447203
FT                   /locus_tag="Tola_0394"
FT   CDS_pept        446382..447203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0394"
FT                   /product="Calcineurin phosphoesterase domain protein"
FT                   /note="PFAM: Calcineurin phosphoesterase domain protein;
FT                   metallophosphoesterase; KEGG: aha:AHA_3763 Icc protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92023"
FT                   /db_xref="GOA:C4L9C4"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026575"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9C4"
FT                   /inference="protein motif:PFAM:PF08413"
FT                   /protein_id="ACQ92023.1"
FT                   /translation="METCTLSKPDDGIVRLLQISDTHLFAETNRDLLGIATADSFQAVL
FT                   DAITELPQTYDVVLATGDLSQDHSAASYQRFARMVTTLQKPVHWLPGNHDHRVLMQNEL
FT                   QVSGIRPEMQLVGDHWQVILLDSQVYGTPHGWLSHLQLEQLEAALLQYPEKHVLICLHH
FT                   HTFPIGSIWLDQHDLKNASDFLAVLARYPRVKAVLCGHVHQEYDQYHQGIRFLTSPSTC
FT                   IQFQPLSVDFSLDTMSPGWRYLQLYPDGRIATQVWRLEPGQFAPDLQSTGY"
FT   gene            447205..447780
FT                   /locus_tag="Tola_0395"
FT   CDS_pept        447205..447780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0395"
FT                   /product="protein of unknown function UPF0227"
FT                   /note="PFAM: protein of unknown function UPF0227; KEGG:
FT                   aha:AHA_3762 esterase YqiA"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92024"
FT                   /db_xref="InterPro:IPR008886"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9C5"
FT                   /inference="protein motif:PFAM:PF05728"
FT                   /protein_id="ACQ92024.1"
FT                   /translation="MSPTLIYLHGFNSTPNSVKARQIAEYLAAELPDIQVCIPKLPNTP
FT                   AASWQTIQETLADLGDRKIGLVGSSMGGFWATKVAEVYGHKAVVINPAIHPHHLLQQLL
FT                   GPQHNPYTGEDYLLEQHHVDELRDLGIPELQHPERIWLLQQQGDEVLDYRHALQFYHFA
FT                   RTTVEQGGTHAFTGFERYCAQIVRFLQL"
FT   gene            447800..449692
FT                   /locus_tag="Tola_0396"
FT   CDS_pept        447800..449692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0396"
FT                   /product="DNA topoisomerase IV, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: aha:AHA_3756 DNA topoisomerase IV subunit B;
FT                   TIGRFAM: DNA topoisomerase IV, B subunit; PFAM: DNA
FT                   topoisomerase type IIA subunit B region 2 domain protein;
FT                   ATP-binding region ATPase domain protein; DNA gyrase
FT                   subunit B domain protein; SMART: DNA topoisomerase II;
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92025"
FT                   /db_xref="GOA:C4L9C6"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005737"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9C6"
FT                   /inference="protein motif:TFAM:TIGR01055"
FT                   /protein_id="ACQ92025.1"
FT                   /translation="MTQAYTAESIEVLNGLEPVRRRPGMYTDTSRPNHLGQEVIDNSVD
FT                   EALAGHARRIDVILHDDQSLEVTDDGRGMPVDIHPEEGVPAVELIMCKLHAGGKFSNSN
FT                   YQFSGGLHGVGISVVNALSRRVEVTVRRDGNVYEMAFEQGDKVADLTITGTCGKRNTGT
FT                   RVKFWPDAKYFDSPKFSASRLVHILKAKAVLCPGLTIHFEDRVNQQVYDWCYQDGLRDY
FT                   LLDNLKDVIRLPEQPFTGQFSADNSAVDWALCWLPEGGELISESYVNLIPTVQGGTHVN
FT                   GLRQGLLDAMREFCEFRNLLPRGVKLTPDDIWDRCAYILSIKMQDPQFAGQTKERLSSR
FT                   QSAAFVSGIVKDAFSLWLNSNIELAEQLAELCINSAQRRLRAAKTVVRKKITQGPALPG
FT                   KLTDCNCSDPMQGELFLVEGDSAGGSAKQAREREFQAIMPLRGKILNTWEVDASEVLAS
FT                   QEVHHISIAVGMDPDSDDLSGLRYGKICILADADSDGLHIATLLCALFVKHFRPLVEKG
FT                   HVYVAMPPLFRIDLGKEVYYALDEDEKEGVLQRLKAEKKRGTPQVTRFKGLGEMNPKQL
FT                   RETTMDPNTRRLVQLTLDDETEETMQLMDMLLAKKRSGDRREWLESKGNLADIG"
FT   gene            449767..449967
FT                   /locus_tag="Tola_0397"
FT   CDS_pept        449767..449967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0397"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_C0182 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92026"
FT                   /db_xref="GOA:C4L9C7"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9C7"
FT                   /inference="similar to AA sequence:KEGG:Bxe_C0182"
FT                   /protein_id="ACQ92026.1"
FT                   /translation="MEKKTARLTLLIDPVKKKAFEDLCTAQDLTPSQVVRQMIRDYLDE
FT                   HGVTYATKSTLGAKAKNETTP"
FT   gene            complement(449992..451671)
FT                   /locus_tag="Tola_0398"
FT   CDS_pept        complement(449992..451671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0398"
FT                   /product="sulfate transporter"
FT                   /note="TIGRFAM: sulfate transporter; PFAM: sulphate
FT                   transporter; Sulfate transporter/antisigma-factor
FT                   antagonist STAS; Xanthine/uracil/vitamin C permease; KEGG:
FT                   pfl:PFL_3280 sulfate permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92027"
FT                   /db_xref="GOA:C4L9C8"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9C8"
FT                   /inference="protein motif:TFAM:TIGR00815"
FT                   /protein_id="ACQ92027.1"
FT                   /translation="MIAILEAQRAGLLRAKNWLPNLVAGLIVGVVALPLAMAFAIASGV
FT                   KPEQGLYTAMVAGAVVAVFGGSRLQIAGPTGAFIVILAGITAKYGVSGLQIATLMAGVI
FT                   LMLMGFSRLGSIIKFIPAPVIVGFTSGIGVIIWVGQWKDFFGLPSVSGEHFHEKFWHLL
FT                   QQLPHANLTTSALALCSLALVLLTPRIPYLRKVPGPLMAMIFSTLIVSLFHPEGVATIG
FT                   SAFGGIPQKLPDFALPEFTFSDMVQLIGPAFTIAMLGAIESLLSAVVADGMAGTRHDSN
FT                   QELIGQGLANIIAPLFGGFAATGAIARTATNIRNGGNSPLAGIIHSVVLLMILLFLAPL
FT                   ANNIPLCALAAILFVVAWNMSELPHFVEMVKKAPKTDTAILLITFLLTVFTDLVVAVNI
FT                   GVILAAFSFMQRMAGAVEIQQHSEDDLEKELQIIGHKKLPPQVMVYSIDGPLFFGAAET
FT                   FQRALAQTNTEPKALVLRLNHVPFMDFTALQSLEHVIHLLAKHNVTILLCEANKTVQQK
FT                   LTKAGIIDLVGEGHNFTTFDEALNYCELRFAENSEKMAVNER"
FT   gene            451930..452154
FT                   /locus_tag="Tola_0399"
FT   CDS_pept        451930..452154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0399"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ppw:PputW619_5074 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92028"
FT                   /db_xref="InterPro:IPR009506"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9C9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACQ92028.1"
FT                   /translation="MIKHSLVHAKIPQYAQRPDRGHSIFSHIKHMLLLWKQNWQTRRQL
FT                   ARLSAEDLRDIGLSEAQRQEELNKSFWEP"
FT   gene            452408..452668
FT                   /locus_tag="Tola_0400"
FT   CDS_pept        452408..452668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0400"
FT                   /product="sodium pump decarboxylase, gamma subunit"
FT                   /note="TIGRFAM: sodium pump decarboxylase, gamma subunit;
FT                   PFAM: sodium pump decarboxylase gamma subunit; KEGG:
FT                   apj:APJL_1393 oxaloacetate decarboxylase subunit gamma"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92029"
FT                   /db_xref="GOA:C4L9D0"
FT                   /db_xref="InterPro:IPR005899"
FT                   /db_xref="InterPro:IPR023424"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9D0"
FT                   /inference="protein motif:TFAM:TIGR01195"
FT                   /protein_id="ACQ92029.1"
FT                   /translation="MTNGELMLEGVNLMIAGMGFVMVFLLLLVYAVQLMSRIIARFTPD
FT                   LPLPVIPIPQPEQPLSSTDDALTKVAIAAALHHHRRTHDKK"
FT   gene            452691..454496
FT                   /locus_tag="Tola_0401"
FT   CDS_pept        452691..454496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0401"
FT                   /product="oxaloacetate decarboxylase alpha subunit"
FT                   /note="TIGRFAM: oxaloacetate decarboxylase alpha subunit;
FT                   PFAM: pyruvate carboxyltransferase; Conserved carboxylase
FT                   region; biotin/lipoyl attachment domain-containing protein;
FT                   KEGG: pmu:PM1422 pyruvate carboxylase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92030"
FT                   /db_xref="GOA:C4L9D1"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR005776"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9D1"
FT                   /inference="protein motif:TFAM:TIGR01108"
FT                   /protein_id="ACQ92030.1"
FT                   /translation="MIVTPRPVAITDVVLRDAHQSLFATRLRLDDMLPAAEMLDQVGYW
FT                   SLESWGGATFDSCIRFLGEDPWDRLREFKKAMPKTRQQMLLRGQNLLGYRHYADDVVER
FT                   FVERASATGIDVFRVFDAMNDPRNMRCALQAVKKNGAHAQGTLSYTTSPVHNEQTWIDL
FT                   AEQLLEIGVDSIAIKDMSGILTPTAAYNLISKLKEQFDVELHLHCHATTGLAEMTLLKA
FT                   IEAGVDRVDTAISSMSGTYGHAATEAIVAALQGTPYDTGLDLMQLEKIAAYFRDIRKKY
FT                   SAFEGQLKGIDSRILIAQVPGGMLTNLESQLKQQNAADKLDLVLAEIPRVREDLGFLPL
FT                   VTPTSQIVGTQAVLNVLTGERYKNIAKETAGVLKGEYGATPAPVNAELQQRVLNGELPI
FT                   TCRPADNLKPEMETLEESVIESAAQKGVKLSENIIDDVLTVALFPQIAWKFLENRGNPA
FT                   AFEPHPQVAPAVVPPTVVPAAKEKVEGPAIYTIEVEGRSYVVKVSEGGEVRHVQEVSSA
FT                   VSPVVPAPAVSAANAVPVAAPLAGNIWKVVVKAGQAVKEGDVLVILEAMKMETEIRAGL
FT                   SGTVNTIQVKEGDAVAVGDCMLTLV"
FT   gene            454510..455811
FT                   /locus_tag="Tola_0402"
FT   CDS_pept        454510..455811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0402"
FT                   /product="sodium ion-translocating decarboxylase, beta
FT                   subunit"
FT                   /EC_number="4.1.1.3"
FT                   /note="KEGG: efe:EFER_0028 oxalacetate decarboxylase beta
FT                   chain; TIGRFAM: sodium ion-translocating decarboxylase,
FT                   beta subunit; PFAM: Na+transporting
FT                   methylmalonyl-CoA/oxaloacetate decarboxylase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92031"
FT                   /db_xref="GOA:C4L9D2"
FT                   /db_xref="InterPro:IPR005661"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9D2"
FT                   /inference="protein motif:TFAM:TIGR01109"
FT                   /protein_id="ACQ92031.1"
FT                   /translation="MDRIGALLQGMGFMSLTVGQAVMLLISLLLLWLAIVKKFEPLLLM
FT                   PIGFGGLLANIPDAGLAFSALDMALYKAQPDVIAAIAANIGSLPDVSAIKLQMPDLTLP
FT                   ALHSIEEIAAGYGYTDGIQYIFYKVAIASGVAPLVIFMGVGAMTDFGPLLANPRTLMLG
FT                   AAAQFGIFTTVLGALGLNYLGVMNFSLAQAASIGIIGGADGPTAIYLTSILAPELLGAI
FT                   AVAAYSYMALVPLIQPPIMRLLTTEEERKIVMTQLRPVNKREKILFPIILLLLVALILP
FT                   DAAPLLGMFCFGNLMRECGVVDRLSDTVQNALINIVTIILGLSVGAKLMADKFLQPQTL
FT                   GILLLGVIAFGVGTASGVLMAKLMNRFSKNKINPLIGSAGVSAVPMAARVSNKLGLEAN
FT                   HQNFLLMHAMGPNVAGVIGSAIAAGVMIKYILAL"
FT   gene            complement(455881..456399)
FT                   /locus_tag="Tola_0403"
FT   CDS_pept        complement(455881..456399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0403"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: hch:HCH_06669 transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92032"
FT                   /db_xref="GOA:C4L9D3"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9D3"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACQ92032.1"
FT                   /translation="MQTDHVDRILSQWQHERPELDPLAMSIFGRLWRLNAIASKAIEQV
FT                   HLQFGLTQPEFDVLVTLRRSGEPYTLSPTALYTSLLLSSGAMTNRLDKLEARGLIYREP
FT                   SPEDRRSMLVALTKTGLALINETMTAHVANEQRLLHSLDRAQQQELADLLRTLLLNIGK
FT                   DPVETIQPE"
FT   gene            456499..457350
FT                   /locus_tag="Tola_0404"
FT   CDS_pept        456499..457350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0404"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: aha:AHA_1538 drug/metabolite exporter
FT                   family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92033"
FT                   /db_xref="GOA:C4L9D4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9D4"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACQ92033.1"
FT                   /translation="MSPIFVALTPILWGTTYFITGRYLAEWPALWLSVMRAIPPGLLLL
FT                   AIRPAKVPWRQVPYLLLISFLYIGAFFPLLFISALYLPGSVAGTLAATLPLVLLGLQWL
FT                   FLHKRPSRQALICALLGLGGIILLLGPGAELNWIGVGAALTSVLLIGICSLLLQQRPWH
FT                   GELISFTGWQLLLGGLMILPLAFWVEGAMPIPAGDDWFGLLWLILLNSALAYVLWLWGM
FT                   ANLPLNRLGLMTLLNPLTAVMAGSILMHEALSYWQWLGVLTVFASLLLELLLRPKRYPA
FT                   AA"
FT   gene            complement(457403..457684)
FT                   /locus_tag="Tola_0405"
FT   CDS_pept        complement(457403..457684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0405"
FT                   /product="transcriptional activator HlyU"
FT                   /note="KEGG: aha:AHA_3835 transcriptional activator HlyU"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92034"
FT                   /db_xref="InterPro:IPR018772"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9D5"
FT                   /inference="similar to AA sequence:KEGG:AHA_3835"
FT                   /protein_id="ACQ92034.1"
FT                   /translation="MFGKLFKSLFSGSEKTAAKVEPVEYKGYLIYAEPMDEGSQYRLAG
FT                   RICKEINGEVKTHVFIRSDLFPSKEDASQWMVRKAELFIDQSGDSMFQ"
FT   gene            457871..459223
FT                   /locus_tag="Tola_0406"
FT   CDS_pept        457871..459223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0406"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: protein of unknown function DUF224
FT                   cysteine-rich region domain protein; KEGG: azo:azo0062
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92035"
FT                   /db_xref="GOA:C4L9D6"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9D6"
FT                   /inference="protein motif:PFAM:PF02754"
FT                   /protein_id="ACQ92035.1"
FT                   /translation="MRTELDWSEYQDRGMGDAYADIPRQGGDFAKAVAVCIRSGVCEQH
FT                   GRGVMCPSFRITDNPLLSPGGRVQLLKRALNSDEAALTSDQELAEAMDLCVACKGCKRE
FT                   CENNVDMAQIKIEYLAQKLKTESLSWRSRLFAYSPLWLNQYPVLGSLIRWRNKSALLAK
FT                   AGEKFLGIAAKVPLPETARKPFSPRESSFPPLVAHPSGEARAVVLWLDSFSTLFAPQQA
FT                   EDALYLLRMTGLTVHVIHPNSQPGTVLDSGRSLLTFGLATETRELAKQLLAVLSPYVAQ
FT                   GLSVVGLEPSSLLMLRDEYKTLGLGQPAVALAKQAMLFEEFIAAELTRGGFCLPFQTGK
FT                   ITQPVLIHGHCHQKAIGAMKSVRRVLKTVPGLEFSFIESSCCGMAGTFGLEAEHVDYSH
FT                   QMAQQSLVPALQAAPDALVVCNGFGCAHQIKVTAGRQTLHLATLLRQALAE"
FT   gene            complement(459267..460199)
FT                   /locus_tag="Tola_0407"
FT   CDS_pept        complement(459267..460199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0407"
FT                   /product="1-phosphofructokinase"
FT                   /note="TIGRFAM: 1-phosphofructokinase; PFAM: PfkB domain
FT                   protein; KEGG: ecq:ECED1_1926 6-phosphofructokinase II"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92036"
FT                   /db_xref="GOA:C4L9D7"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9D7"
FT                   /inference="protein motif:TFAM:TIGR03168"
FT                   /protein_id="ACQ92036.1"
FT                   /translation="MPLIVTLTLTPSLDTATSTAKVYPEGKLRCQAPVFEPGGGGINVA
FT                   RAITHLGGQATALLPSGGPTGAHLVELLQQEGVTVDALQTHDWTRQNLHVVSDATGEQF
FT                   RFVMPGAALHEDEWQQLLTKIAQLPAGTLLVLSGSLPPNMTTSAVTELLQCARQQGLRT
FT                   IVDSSGDALKAAVAFGGLELLKPNQSELAELTGQSLEQPDQVVNAARSLISQGAAKRIV
FT                   VSLGPQGALAVDAEQCIQVVPPPVIKRSTVGAGDSMVGAMVLKLAEDAPLADMVRFGVA
FT                   AGTAATMNQGTKLCSKDDTEKLYQYLQQQ"
FT   gene            complement(460227..460562)
FT                   /locus_tag="Tola_0408"
FT   CDS_pept        complement(460227..460562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0408"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tbd:Tbd_1197 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92037"
FT                   /db_xref="InterPro:IPR027392"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9D8"
FT                   /inference="similar to AA sequence:KEGG:Tbd_1197"
FT                   /protein_id="ACQ92037.1"
FT                   /translation="MDCPVCKGVKLVMSERQGIEIDYCPQCRGVWLDRGELDKIIERSA
FT                   QAEPVASSPRMQHHSPEPSHSHEEKPHWRHHDDDRRRYQDDEHRHREESYHKKRRGGFL
FT                   GDLFDFD"
FT   gene            460736..462097
FT                   /locus_tag="Tola_0409"
FT   CDS_pept        460736..462097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0409"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="PFAM: PAS fold-3 domain protein; KEGG: tbd:Tbd_1411
FT                   diguanylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92038"
FT                   /db_xref="GOA:C4L9D9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR006189"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9D9"
FT                   /inference="protein motif:PFAM:PF08447"
FT                   /protein_id="ACQ92038.1"
FT                   /translation="MGADFTGVTMSGIKTPVLQWLRSCFSGKGFPWFVLICMLTVTTGL
FT                   WQYTEITLINQSLDRFHSRVDKQKNSIVNRLQDYIQALHAAAGLFAADDDVTRANWHDY
FT                   VRALKPERYLPGTRGFGVQDPLSKVVFIEPPGDAGVGTPGDNLNSAPVLRSAMDQARDS
FT                   GQITLSRRITSGLTTDAKEQPDFVLYLAIYNPHEPADTVAARRRALRGFIYIPFRAAEF
FT                   MQSVLAEQVNRDVVINLFDGKPVRENLLYSSAQDRPETRYATERELSVDGHIWTLQFRS
FT                   SPEFEASTVSRLPLIIRFGGMALDLILFFVLFINTNRLHTIRELTVRLELSDENFNRLE
FT                   EHLSGAVFRVKPEFPWQVQYIGHGIEALTGIPQERFLMKELSLDRVIHPDDQARFTAAV
FT                   TEAQTRPAAFDITLRIKREDDRILWGNLRGRIIYDDAGTPLWLEGVMFDITRFR"
FT   gene            complement(462098..462763)
FT                   /locus_tag="Tola_0410"
FT   CDS_pept        complement(462098..462763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92039"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9E0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACQ92039.1"
FT                   /translation="MKIKPFTSLTRADLTPMQYFYNHMKLLVLFCGLALYGCSRFESDQ
FT                   ARGHAQQALKQLASSAQKCAKDRACDCEQAAAEASAKKVSPSGLVAKLDDTLSQTKEFK
FT                   SWPLSGTGRCQRQLPYHFTVISVSPLLVIGTPVKSLADANCSASDSPLTCLRSKRFAGN
FT                   YEIANKFTHTPGLVWFSPEHGPRLFDVPQHAKSMYLLINGKSLRLKRKGNQWMFSRKQ"
FT   gene            463268..464608
FT                   /locus_tag="Tola_0411"
FT   CDS_pept        463268..464608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0411"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   eca:ECA3577 glucarate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92040"
FT                   /db_xref="GOA:C4L9E1"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9E1"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACQ92040.1"
FT                   /translation="MEAEVAIESVETRKRTNIRYIIIALLFVVGAINYADRAIFSIAGP
FT                   AMMKSLNLDLVNLGYLMSTFGWAYVLGQLPGGWLLDRFGARKVYIGSLFSWSLCTLLLG
FT                   FAGYLGAAAVVTIFALVFMLSICESPAFPANARIVASWFPTHERGTATAIFTTAQYFAL
FT                   VIFLPLMGWLTNKFGWQSVYWAMGVLGIALAVVMPFILYNPKDHPRISSEEFEYIKAGG
FT                   ALVDNYTTKVGDNTKKESSFSHIKQLLNNRLMVGVLIGQFCIVTLVWFFTTWFPIYLAQ
FT                   GRGLSLTSVGLIATIPAISGCLGGILGGLFSDFLLRKKFSLTFARKAPIILGMALAMSI
FT                   IGCVFVDSLEMIVFFLSLAFFGKGLGALGWAVVGDIAPREIVGLCGGLSNMAGNIAGIV
FT                   TPIVIGYIVKTTGSFNGALIYVGVAAFMAIFSYVFLVGKISRIELKK"
FT   gene            complement(464703..465632)
FT                   /locus_tag="Tola_0412"
FT   CDS_pept        complement(464703..465632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0412"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: rfr:Rfer_0441 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92041"
FT                   /db_xref="GOA:C4L9E2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9E2"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACQ92041.1"
FT                   /translation="MCATSELEFFSILINAGSLSAAAGELNLTPPAVSKRLAQLEARLG
FT                   VRLLNRSTRHFNITPEGEIYLNRCRQIIQDINAMEQEVLSLRAKPKGLLRINTTPGFGR
FT                   NYIARAISAFLKQYPEMEVQLTLDSNQPDPTSGDFDIGVRFGLPPDSNIVARKIMTNRR
FT                   FVCASPLYLRNNPQPLVPADLAKHNCIVLKQDESASGIWRFKRGDSSETVKVRGTLSSN
FT                   DGEVVANWALEGHGILIRAEWDVNKYLQSGRLVRLLEDYELPAADIYVVYPERHYLSAK
FT                   VRVFIDFLANNFSEITLSHSSVAAVKGK"
FT   gene            466108..467007
FT                   /locus_tag="Tola_0413"
FT   CDS_pept        466108..467007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0413"
FT                   /product="hydro-lyase, Fe-S type, tartrate/fumarate
FT                   subfamily, alpha subunit"
FT                   /EC_number="4.2.1.32"
FT                   /note="KEGG: mag:amb3179 tartrate dehydratase subunit
FT                   alpha; TIGRFAM: hydro-lyase, Fe-S type, tartrate/fumarate
FT                   subfamily, alpha subunit; PFAM: Fe-S type hydro-lyase
FT                   tartrate/fumarate alpha region"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92042"
FT                   /db_xref="GOA:C4L9E3"
FT                   /db_xref="InterPro:IPR004646"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9E3"
FT                   /inference="protein motif:TFAM:TIGR00722"
FT                   /protein_id="ACQ92042.1"
FT                   /translation="MNKEVAVQSLTDVMTKFTGYVGKHLPTDVKEKLTELRAKETKPLA
FT                   KVVYDSMFQNLDAADELDRPCCQDTGVIQYFITAGAKFPYLGELESILKNATLGATKKS
FT                   PLRHNAVETFIEVNTGTNTGSRIPWLDWEIIPDDENCTIEVYMAGGGCSLPGAAKVLMP
FT                   GQGYEGVNQFVFDVITSYGVNACPPLLVGVGVSTSVETAARLSKKAILRPVDSRHPNDD
FT                   AAKMETLLEDGLNAVGLGPQGLSGNSTVMGVNIESSARHPSTIGVAVSTGCWAHRRGTI
FT                   KFAPDLSYEIISHKGAEL"
FT   gene            467004..467612
FT                   /locus_tag="Tola_0414"
FT   CDS_pept        467004..467612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0414"
FT                   /product="hydro-lyase, Fe-S type, tartrate/fumarate
FT                   subfamily, beta subunit"
FT                   /EC_number="4.2.1.32"
FT                   /note="KEGG: bph:Bphy_5632 tartrate/fumarate subfamily Fe-S
FT                   type hydro-lyase beta subunit; TIGRFAM: hydro-lyase, Fe-S
FT                   type, tartrate/fumarate subfamily, beta subunit; PFAM: Fe-S
FT                   type hydro-lyase tartrate/fumarate beta region"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92043"
FT                   /db_xref="GOA:C4L9E4"
FT                   /db_xref="InterPro:IPR004647"
FT                   /db_xref="InterPro:IPR036660"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9E4"
FT                   /inference="protein motif:TFAM:TIGR00723"
FT                   /protein_id="ACQ92043.1"
FT                   /translation="MKKILTTPIKDEDLESLNIGDVVYLNGTLVTCRDVAHRRLIELGR
FT                   ELPVDLKGMAIFHAGPIVVEQEDGSFQMISIGPTTSMRMEKFEKEFIEQTGVKLIVGKG
FT                   GMGPNTEAGCKEHKAVHAVFPGGCAVLAATQVEEIEDAQWRDLGMPETLWVNRVKEFGP
FT                   LIISIDTKGKNLFEQNKVFFNEAKLPIIEEINKQVRFIK"
FT   gene            467828..468706
FT                   /locus_tag="Tola_0415"
FT   CDS_pept        467828..468706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0415"
FT                   /product="5-carboxymethyl-2-hydroxymuconate
FT                   Delta-isomerase"
FT                   /EC_number="5.3.3.10"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   cko:CKO_03358 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92044"
FT                   /db_xref="GOA:C4L9E5"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9E5"
FT                   /inference="protein motif:PRIAM:5.3.3.10"
FT                   /protein_id="ACQ92044.1"
FT                   /translation="MKLASYIHPEFHRKSFGLVDKHGIIDLGRHMGPKHSDLKSVLNAG
FT                   MLSEINRYSSFPTDYKVDDVTFLPVIDRPNKIICVGMNYLEKRNEFNETINAPTLFIRF
FT                   ADTLTGHDCPLVKPSSTNEFDYEGELAVIIGKPAMNVSKENALSYVAGYSCFMDGSVRD
FT                   MQYSWFTSGKNWLNTGGFGPWLVTTDEIEDPQQLSIHTYLNGQQVQSDNTANMVRSVPE
FT                   LIAYISAFSPLSPGDVIITGSPGGVGKKRNPPLFMKSGDLIEVEISGIGRLSNPIVQNR
FT                   NTSAQMNVSPV"
FT   gene            468966..470588
FT                   /locus_tag="Tola_0416"
FT   CDS_pept        468966..470588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0416"
FT                   /product="phosphoenolpyruvate carboxykinase (ATP)"
FT                   /EC_number="4.1.1.49"
FT                   /note="KEGG: eta:ETA_32170 phosphoenolpyruvate
FT                   carboxykinase (PEP carboxykinase); TIGRFAM:
FT                   phosphoenolpyruvate carboxykinase (ATP); PFAM:
FT                   phosphoenolpyruvate carboxykinase (ATP)"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92045"
FT                   /db_xref="GOA:C4L9E6"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR015994"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9E6"
FT                   /inference="protein motif:TFAM:TIGR00224"
FT                   /protein_id="ACQ92045.1"
FT                   /translation="MSYSESVKKHIRDLGITDVAEIIYNPDFDTLLREETKPGLDEYER
FT                   GVVTQSGAIAVDTGVFTGRSPKDKYIVRDDLTRDTLWWSDQGKGKNDNHPISQETWGHF
FT                   KSLVTKQLSGKRLFVVDAWCGANPETRLSVRFITEVAWQAHFVKNMFIRPDEKSLATFE
FT                   PDFIVMNGAKCSNPDWQEQGLNSENFVAFNLTEKMQLIGGTWYGGEMKKGLFSVMNYLL
FT                   PLKDIASMHCSANVGAAGDVAVFFGLSGTGKTTLSTDPKRQLIGDDEHGWDDDGVFNFE
FT                   GGCYAKTIKLSKQAEPEIYNAICRNALLENVAVDAHGQVDFDDGSKTENTRVSYPIYHI
FT                   ENIVKPVSKAGPAKKVIFLTADAFGVLPPVSRLTAEQTKYHFLSGFTAKLAGTERGVTE
FT                   PTPTFSACFGAAFLTLHPTQYAEVLIKRMEAVNAEAYLVNTGWNGTGKRISIKDTRTII
FT                   NAILDGSLAKAETHTLPIFNLEVPVALSGINNHILDPRNTYADNSVWKEKAEDLATRFI
FT                   NNFEQYTDTPAGAELVKAGPKLG"
FT   gene            470660..471064
FT                   /locus_tag="Tola_0417"
FT   CDS_pept        470660..471064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0417"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92046"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9E7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACQ92046.1"
FT                   /translation="MNYEDVISCISSNPGASFTGIKFSESDNYLSVYTISSDKDDPEWI
FT                   TIFFEGGKLFSTSGEEGCYVMEDAPDELTTLHFKNTKALPFISEYTSEYVLYELFPNLP
FT                   DPDDICSEQEKLLFISEAKRHINELWYASK"
FT   gene            complement(471118..473241)
FT                   /locus_tag="Tola_0418"
FT   CDS_pept        complement(471118..473241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0418"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /EC_number="1.17.4.2"
FT                   /note="KEGG: ent:Ent638_0437 anaerobic ribonucleoside
FT                   triphosphate reductase; TIGRFAM: anaerobic
FT                   ribonucleoside-triphosphate reductase; PFAM: formate
FT                   C-acetyltransferase glycine radical; ATP-cone domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92047"
FT                   /db_xref="GOA:C4L9E8"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9E8"
FT                   /inference="protein motif:TFAM:TIGR02487"
FT                   /protein_id="ACQ92047.1"
FT                   /translation="MQAKPLVIKRDGCRVSFDGSRIWQAVAKAAEAVNVRDDAYCASVA
FT                   GQIASLLAGRDEVDISEVQTLVENLLMEGPHKKLARAYIEYRHDRDLAREKQGRLNKEI
FT                   QGLIQQTNAELLNENANKDSKVIPTQRDLLAGIVAKHYAKQYLLPRDVVQAHEKGEIHF
FT                   HDLDYSPFFPMFNCMLIDIEGMLTHGFKMGNAEIDTPKSISTATAVSAQIIAQVASHIY
FT                   GGTTINRIDEVLAPYVTKSYEKHRKVAEEWQIPDVEAYAHARTEKECYDAFQSLEYEVN
FT                   TLHTANGQTPFVTFGFGLGESWESRLIQKSILQNRISGLGKNHKTAVFPKLVFAIRDGL
FT                   NHKKTDPNYDIKQLALECATKRMYPDILNYDQVVKVTGSFKTPMGCRSFLGVYEEDGKQ
FT                   YHEGRNNLGVVSLNLPRIALEARDEAHFHDLLDSRLRLCKKALMARIERLNGVKARVAP
FT                   ILYMEGACGVRLKADDDVSQIFKNGRASISLGYIGVHETINALYGDKVHVFDDEVLRQK
FT                   AIGIVQKLRDAVDAWKEETGYGFSLYSTPSENLCSRFCNLDTKEFGLVDGVTEKGYYTN
FT                   SFHLDVEKKVDPYAKLDFEMAYPAIANGGFICYGEYPNLQHNPEALENVWDYSYSRVPY
FT                   YGTNTPIDECYECGFTGEFNCTSKGFACPKCGNHDSNKVSVIRRVCGYLGSPDSRPFNA
FT                   GKQEEVKRRVKHI"
FT   gene            complement(473575..475182)
FT                   /locus_tag="Tola_0419"
FT   CDS_pept        complement(473575..475182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0419"
FT                   /product="phosphoenolpyruvate carboxykinase (ATP)"
FT                   /EC_number="4.1.1.49"
FT                   /note="KEGG: asa:ASA_3771 phosphoenolpyruvate
FT                   carboxykinase; TIGRFAM: phosphoenolpyruvate carboxykinase
FT                   (ATP); PFAM: phosphoenolpyruvate carboxykinase (ATP)"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92048"
FT                   /db_xref="GOA:C4L9E9"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR015994"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9E9"
FT                   /inference="protein motif:TFAM:TIGR00224"
FT                   /protein_id="ACQ92048.1"
FT                   /translation="MTTAGLDLERYGICNVKEIIRNPSYDQLYEEELNPNLVGYERGVV
FT                   TKLGAVKVDTGVFTGRSPKDKYIVMDDMTRDTVWWSEGGKNDNKPITPVIWSELKKLVA
FT                   EELSGKRLFVIDGFCGANPDSRLSVRIITEVAWQAHFAKNMFIRPSEAELVNFEPDFVV
FT                   LNGAETVNPNWKEQGLNSENFVAFNLTEKMQVIGGTWYGGEMKKGLFSVMNYLLPLKGI
FT                   ASMHCSANVGKDGDVAIFFGLSGTGKTTLSADPKRLLIGDDEHGWDDDGVFNFEGGCYA
FT                   KTIKLSKEAEPDIYNAIRRDALLENVIVDAEGNVDFDDGSLTENTRVSYPIYHIENIVK
FT                   PVSKAGPAKKVIFLTADAFGVLPPVSKLTHDQTQYHFLAGFTAKLAGTERGVTEPTPTF
FT                   SACFGKAFLSLHPTQYSEVLVKRMEAAGADCYLVNTGWNGTGKRISIHDTRAIIDAILD
FT                   GSIDKAPMKTLPIFNLAMPIDLPGVNPQILDPRDTYADPAEWQRKAEDLAQRFIKNFAQ
FT                   YTDNEQGKRLIAAGPQLP"
FT   gene            complement(475436..476335)
FT                   /locus_tag="Tola_0420"
FT   CDS_pept        complement(475436..476335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0420"
FT                   /product="Hsp33 protein"
FT                   /note="PFAM: Hsp33 protein; KEGG: asa:ASA_3772 33 kDa
FT                   chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92049"
FT                   /db_xref="GOA:C4L9F0"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="InterPro:IPR023212"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9F0"
FT                   /inference="protein motif:PFAM:PF01430"
FT                   /protein_id="ACQ92049.1"
FT                   /translation="MSQIPDQLHRFIFENYEVRGELVQLNQTTKDILGGHHYPLAIQRL
FT                   LSELLVATSLLTATLKFEGSITVQLQGDGPVRFAVINGDHQQRLRGVARYEGVIAENAG
FT                   LHELIGKGHMMITVIPDEGERYQGIVALDGDTLAACLEGYFAQSEQLPTRIWLKTGLNE
FT                   EQPKAAGMLIQAMPNSNSEQHALDFEHIVTLTDTIKSEELLDLPAEEVLYRLYHQEEVR
FT                   LFDPQAVSFVCTCSRSRCEAALLQLGKTEVDALLEEHDEIRMDCDYCGTEYHFSASDVE
FT                   KIYNDQLTPPETSQGVLH"
FT   gene            complement(476378..476776)
FT                   /locus_tag="Tola_0421"
FT   CDS_pept        complement(476378..476776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0421"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="PFAM: RNA-binding S4 domain protein; SMART:
FT                   RNA-binding S4 domain protein; KEGG: sgl:SG2315 heat shock
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92050"
FT                   /db_xref="GOA:C4L9F1"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025708"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9F1"
FT                   /inference="protein motif:PFAM:PF01479"
FT                   /protein_id="ACQ92050.1"
FT                   /translation="MPEATDNSAIRLDKWLWAARFYKTRALARSMIEGGKVHYNGQRSK
FT                   PGKLVEVGAMLRIRQGHDEKEVRVLALSVQRLSAAQAQLLYAETDESIVKRERNAEAHR
FT                   LNALYAPHPDTKPDKKQRRDLMRFKQGE"
FT   gene            476971..477603
FT                   /locus_tag="Tola_0422"
FT   CDS_pept        476971..477603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0422"
FT                   /product="Glutathione S-transferase domain protein"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   aha:AHA_3900 stringent starvation protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92051"
FT                   /db_xref="GOA:C4L9F2"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034341"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9F2"
FT                   /inference="protein motif:PFAM:PF00043"
FT                   /protein_id="ACQ92051.1"
FT                   /translation="MAFAANKRSVMTLFSGNDMFSHQVRIVLAEKGVTFDICMVDVNAL
FT                   PEELLELNPYNSVPTLVDRDLVLYTSRIIMEYLDERFPHPPLMPVYPVARGNCRLMMHR
FT                   VELDWYTLADKILNNAPDAEAARKQLRESLQAMAPLFQEYPYFMNEEFSQVDCYMAPLL
FT                   WRLPVMGIEFTGKGAKELKAYMTRLFDRDSFQASLTDIEREMRNGPL"
FT   gene            477603..478043
FT                   /locus_tag="Tola_0423"
FT   CDS_pept        477603..478043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0423"
FT                   /product="Stringent starvation protein B"
FT                   /note="PFAM: Stringent starvation protein B; KEGG:
FT                   aha:AHA_3899 stringent starvation protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92052"
FT                   /db_xref="InterPro:IPR007481"
FT                   /db_xref="InterPro:IPR036760"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9F3"
FT                   /inference="protein motif:PFAM:PF04386"
FT                   /protein_id="ACQ92052.1"
FT                   /translation="MVPNMTPSRPYLLRAFYEWLLDNDMTPHLLVDANARMVQVPQQYA
FT                   RDGQIVLNIAPQAVVAFTMDNEAISFNARFGGVPQQLYIPMAAVLAIHSRENGAGTFFP
FT                   PESAYEAWQEVQPAPAEKTDVTDGDKSPSPRPDGRPTLRIIK"
FT   gene            complement(478088..478666)
FT                   /locus_tag="Tola_0424"
FT   CDS_pept        complement(478088..478666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0424"
FT                   /product="transport-associated"
FT                   /note="PFAM: transport-associated; SMART:
FT                   Transport-associated and nodulation region; KEGG:
FT                   aha:AHA_3898 secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92053"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9F4"
FT                   /inference="protein motif:PFAM:PF04972"
FT                   /protein_id="ACQ92053.1"
FT                   /translation="MLRKLLPLSLASLLLLQGCVGVLLAGGAATGVVVAKDRRSVTAQM
FT                   DDQKIELNTRNELSDRTDISRISHISINSNNGIVLLVGQTPYRKHSDEVKAMAERQNGV
FT                   RKVYNEIKITEPTGYDIRTNDSWITSKVRTRLIAEKNFDSSHIKVVTEDSQVFLMGMVT
FT                   RDEGELAVEIARNVSGVTKVIRVFEYVQQ"
FT   sig_peptide     complement(478589..478666)
FT                   /locus_tag="Tola_0424"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.555 at
FT                   residue 26"
FT   gene            complement(478683..479261)
FT                   /locus_tag="Tola_0425"
FT   CDS_pept        complement(478683..479261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0425"
FT                   /product="phosphoheptose isomerase"
FT                   /note="KEGG: asa:ASA_0341 phosphoheptose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92054"
FT                   /db_xref="GOA:C4L9F5"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9F5"
FT                   /inference="similar to AA sequence:KEGG:ASA_0341"
FT                   /protein_id="ACQ92054.1"
FT                   /translation="MDRIRENFTESIQTKIAAAEVLSESIQTAAQMLAICLLNGNKILA
FT                   CGNGASGALAQIFVSHLMSRFETARPSLPAIALTCDGNLMSSLSHYGKFEDVYAHQIRA
FT                   LGQQGDILLLITTEEDNRELIHAAEAALSRDMTMVILNTGHGGELAGLLGPSDVEIRCP
FT                   SARFSRILEVHLLVLNCLSDLIDQTLFPQ"
FT   gene            complement(479272..479646)
FT                   /locus_tag="Tola_0426"
FT   CDS_pept        complement(479272..479646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0426"
FT                   /product="protein of unknown function UPF0102"
FT                   /note="PFAM: protein of unknown function UPF0102; KEGG:
FT                   aha:AHA_3896 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92055"
FT                   /db_xref="GOA:C4L9F6"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9F6"
FT                   /inference="protein motif:PFAM:PF02021"
FT                   /protein_id="ACQ92055.1"
FT                   /translation="MNQHLLNPPFSNRRSKGQHYEQQARCFLEQQGLLFVCANYHCRQG
FT                   ELDLIMRERDTLVFIEVRFRASRDYGGALSSVTPAKQHKIRHTARYYLMSQHINEAHQA
FT                   CRFDIVSYDDGQCSWLKNAF"
FT   gene            complement(479600..481477)
FT                   /locus_tag="Tola_0427"
FT   CDS_pept        complement(479600..481477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0427"
FT                   /product="LppC family lipoprotein"
FT                   /note="PFAM: LppC family lipoprotein; KEGG: asa:ASA_0343
FT                   LppC family lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92056"
FT                   /db_xref="InterPro:IPR007443"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9F7"
FT                   /inference="protein motif:PFAM:PF04348"
FT                   /protein_id="ACQ92056.1"
FT                   /translation="MSRISKLRTVPHFWWLFAIVLLLSGCAAGNRDSSVDNAPLSAFGP
FT                   LTHDSQWYLSRIDSASPEDRFALQVLATRRLIADGDRSQANAVQQQLAREATTPRQTVA
FT                   LRLLNALQLGKDGQSSKALNRIAGIDLRPLDSNTVQFYYRLQSELLLKTGQKTAAANSL
FT                   ISLDPYLKGDLASKNQQQIWLLLQDSNSNTLKNYVSAANRMKREKAAGWLELTLIAKEP
FT                   KNQSQLFADWQKRYPGHPAAAFFTPATDTSAQPVIAESTGITPTAGIQKIAVFLPLSGK
FT                   LAEPANALKSGLEQANIAAGNKFTFTYYDENSLSMPELITKAQQNGAQLVIGPLQKNKV
FT                   EQLSASNVTVPVLALNQLGNQPAADNLYYFSLSPEDEAAQIAQKIHEDGLKNPLLLLPS
FT                   NALGDRTAAGFNSYWQSLEIGEATVAKFRSRDELLTLLRQKLGGTGTALQAGQIQSLAD
FT                   DPASDPNRVDAIFMLASAFEASNIKSSVDMMLGDSPVRPTYYLGSKSNSSGLRADVALA
FT                   LNGMQLGDMPWMLNRMPEELAKATAALPQASGDQLRLYAMGYDAGNLVNQLSELRQNPD
FT                   MTLNGLTGVLHVTTDGVILHDLVWTRYTNGQLTTNEPALAQPAVQQPAQ"
FT   sig_peptide     complement(481388..481477)
FT                   /locus_tag="Tola_0427"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.976) with cleavage site probability 0.406 at
FT                   residue 30"
FT   gene            481559..482404
FT                   /locus_tag="Tola_0428"
FT   CDS_pept        481559..482404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0428"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: aha:AHA_3894
FT                   tetrapyrrole methylase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92057"
FT                   /db_xref="GOA:C4L9F8"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9F8"
FT                   /inference="protein motif:PFAM:PF00590"
FT                   /protein_id="ACQ92057.1"
FT                   /translation="MTISPCLYIVPTPIGNLSDITLRAIEVLKSVDCIAAEDTRHSGIL
FT                   LQHLDVKVPMLALHDHNEQQRAGVLIQRIQQGQSIALISDAGTPLISDPGYHLVKACRD
FT                   AGVKVVPLPGPCAAITALSAAGLPTDRFVFEGFLPAKEKGKDDRLQALADETRTMVFYE
FT                   SPRRVIDTLTAMLQVFGERQIVIARELTKTFETLHSLPLSEMLVWLQEDDNRTRGEFVL
FT                   MLAGKPDNSDELPAEVLRTLTLLMSDLPLKKAAALTAEIYGVKKNALYAWGLEKQNSER
FT                   "
FT   gene            482499..482805
FT                   /gene="rnpB"
FT                   /locus_tag="Tola_R0023"
FT   ncRNA           482499..482805
FT                   /gene="rnpB"
FT                   /locus_tag="Tola_R0023"
FT                   /product="RNA component of RNaseP"
FT                   /note="Bacterial RNase P class A as predicted by Rfam(RF000
FT                   10), score 234.22"
FT                   /ncRNA_class="RNase_P_RNA"
FT   gene            complement(482832..484208)
FT                   /locus_tag="Tola_0429"
FT   CDS_pept        complement(482832..484208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0429"
FT                   /product="O-succinylbenzoate-CoA ligase"
FT                   /note="TIGRFAM: O-succinylbenzoate-CoA ligase; PFAM:
FT                   AMP-dependent synthetase and ligase; KEGG: aha:AHA_0527
FT                   O-succinylbenzoate-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92058"
FT                   /db_xref="GOA:C4L9F9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR010192"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9F9"
FT                   /inference="protein motif:TFAM:TIGR01923"
FT                   /protein_id="ACQ92058.1"
FT                   /translation="MAKLNCPIRQHAQRQPAQPALWNAGVSLSYQQLDVRLNALQQQLR
FT                   HAGLRAGDHLFFCSKNSTELVMLFWACWREQIVCCPVNPAFPVARQQALQQQVHATYCW
FT                   PSSGLIFDFSQEIAASGDCQLDEEQLSDLIFTSGSSGSPKIVAHRLRNHLANAQGSLVP
FT                   ITAHDGWLLSLPLFHVGGLAILFRCFLAGACVVLPDPALSLPELLKKAPVTHLSLVPTQ
FT                   LYRLLQQADFHFSATRVRHLLLGGAPLPESLIAACREQQLTPWVSYGLSEMASQVCTTL
FT                   AGQAGRVGKPLAGREVAIKNSEICVRGDTLFAGYYQPDGSLLLPLDDNGWFHTGDAGYW
FT                   QDDSLVITGRIDNQFISGGENIQPEQIEQQLLQHPAVAQAIVVPVADAEWGMRCACFID
FT                   WQQSAISFSELTDWLRQYLPAYMLPKQWLDWPELPAGQLKIQRAEFKRLAETKNPATVK
FT                   "
FT   gene            complement(484196..485122)
FT                   /locus_tag="Tola_0430"
FT   CDS_pept        complement(484196..485122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0430"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: aha:AHA_0528 O-succinylbenzoic acid (OSB)
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92059"
FT                   /db_xref="GOA:C4L9G0"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9G0"
FT                   /inference="protein motif:PFAM:PF01188"
FT                   /protein_id="ACQ92059.1"
FT                   /translation="MDITLYRYQLPLTQPLTFHDQTITQREGLLLHWGSSWSEIAPLPG
FT                   FSRETLAEAEQEAIAFLTAFKQGKTIPVSCPSVQFGLDCARRSWPILKHTPLPPYLLLQ
FT                   GSPDDIIWSWKEWLYDYPIRIKLKVARYPMRDELSMVRELIRLAPKTKLILDANQQWTR
FT                   EEAWTFMNHLDPSHIEYVEDPCPSYADIRSVATHTGIGVALDEILCCEGQWDFFPQLKG
FT                   LILKPMLIGSLEKCHDLVVKAKANGVKVVISSSHESQLGNRLLALLATEWSPEQAPGLD
FT                   TLRYFNGSVLDDKQQVDVSKLQVVWQS"
FT   gene            complement(485218..486078)
FT                   /locus_tag="Tola_0431"
FT   CDS_pept        complement(485218..486078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0431"
FT                   /product="naphthoate synthase"
FT                   /note="TIGRFAM: naphthoate synthase; PFAM: Enoyl-CoA
FT                   hydratase/isomerase; KEGG: kpe:KPK_1489 naphthoate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92060"
FT                   /db_xref="GOA:C4L9G1"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR010198"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9G1"
FT                   /inference="protein motif:TFAM:TIGR01929"
FT                   /protein_id="ACQ92060.1"
FT                   /translation="MQHHDDDARWYAPVEWQDCSADYQDIRYHKSADGIAKITINRPQV
FT                   RNAFRPLTVMEMMKALQDARFDASIGVIILTGEGELAFCSGGDQKVRGDYGGYKDDEGT
FT                   HHLNVLDFQRQIRTCPKPIVAMVAGYAIGGGHVLHMLCDLTIAADNARFGQTGPKVGSF
FT                   DGGWGASYMARLVGQKKAREIWFLCRQYDAQQALDMGLVNTVVPLAELEKETVRWCREI
FT                   LQHSPMALRCLKAALNADCDGQAGLQELAGNATMLFYMTEEGQEGRNAFNEKREPDFNK
FT                   FPRNP"
FT   gene            complement(486091..486837)
FT                   /locus_tag="Tola_0432"
FT   CDS_pept        complement(486091..486837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0432"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: asa:ASA_3736
FT                   hydrolase or acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92061"
FT                   /db_xref="GOA:C4L9G2"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022485"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9G2"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACQ92061.1"
FT                   /translation="MSKPNIVLLHGFLGAASDWQPLSDLLPEINCVALDLPGHGNAQNQ
FT                   QLRHMADFPVWLQQQLTLRDIRQYHLLGYSLGGRLALQFAATHPAGLQSLLLENAHPGL
FT                   NSPAERQNRAKADAQWARRFYREALPDVLADWYQQPVFSDLSPQERTLLIAERSQNTGR
FT                   SLARMLCRCSLARQADYQGWIKTTSLPMLYLCGEQDLKFRTVGEQLAATNPQLQLTCLA
FT                   GGHNLHRATPDSMAAVIRQWLNAFTF"
FT   gene            complement(486834..488555)
FT                   /locus_tag="Tola_0433"
FT   CDS_pept        complement(486834..488555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0433"
FT                   /product="2-succinyl-6-hydroxy-2,
FT                   4-cyclohexadiene-1-carboxylic acid synthase/2-oxoglutarate
FT                   decarboxylase"
FT                   /note="TIGRFAM:
FT                   2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic acid
FT                   synthase/2-oxoglutarate decarboxylase; PFAM: thiamine
FT                   pyrophosphate protein TPP binding domain protein; KEGG:
FT                   aha:AHA_0531
FT                   2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic acid
FT                   synthase/2-oxoglutarate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92062"
FT                   /db_xref="GOA:C4L9G3"
FT                   /db_xref="InterPro:IPR004433"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR032264"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9G3"
FT                   /inference="protein motif:TFAM:TIGR00173"
FT                   /protein_id="ACQ92062.1"
FT                   /translation="MTEQWQSLDSLNALWSALLIEELARLGIRDICIAPGSRSTPLTLA
FT                   AAANPAISTHLHFDERGLGFLALGLAQGSQRPVAVIVTSGSAVANLLPAVVEARQSGIP
FT                   LWLLTADRPAELLGCGANQAITQANIFANYPVYQQLFPAPDHDITPSWLLASVDQAAFQ
FT                   QQQTPGPVHLNCPFREPLYPVAGQQIPGNALRGLTHWLRSAQPWTQYHAVQPICQTHPL
FT                   WAEVRQSKGIIIAGRLSRQQDTGAILKLAQQTGWPLLADIQSQLRFHPQAMTYADLALH
FT                   HPAFREELAQAETLLLFGGRLTSKRLQQFADGHNWQHCWQIDAGSERLDSGLAVQQRFV
FT                   TSPELWCQAHQCEPHRIPWHQLPRWDGKLAGLITQQLPEWGEITLCHQLNSQLQGQLFI
FT                   GNSMPIRLLDMLGTSGAQPSHIYTNRGASGIDGLIATAAGIARANTSQPTTLLLGDSSA
FT                   LYDLNSLALLRELTAPFVLIIINNDGGNIFHMLPVPEQNQIRERFYQLPHGLDFRASAE
FT                   QFRLAYAAPTGAISFRQAYQQALSHPGATLLECKVATGEAADWLKNFALQVRSLPA"
FT   gene            complement(488548..489867)
FT                   /locus_tag="Tola_0434"
FT   CDS_pept        complement(488548..489867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0434"
FT                   /product="isochorismate synthase"
FT                   /note="TIGRFAM: isochorismate synthase; PFAM: Chorismate
FT                   binding-like; KEGG: asa:ASA_3738 menaquinone-specific
FT                   isochorismate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92063"
FT                   /db_xref="GOA:C4L9G4"
FT                   /db_xref="InterPro:IPR004561"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR034681"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9G4"
FT                   /inference="protein motif:TFAM:TIGR00543"
FT                   /protein_id="ACQ92063.1"
FT                   /translation="MLAQIRLLEQLNALAKTDQHGFVRLRAPVDVTSLIGWLKAQPLYP
FT                   RIYWHARERDREFAVLGAIRELTDPAQLAELTGQQRPNAGSYPRYYGGLAFDYQQPVTG
FT                   EWQDFGQCRFVLPRIELIRQGNQTELVCNLWFEGANAEQEMAAARTALQQLQPEKTLRK
FT                   YLPTQRERQDTPDKPRWMQWLSQVLQPEALKTIPKVVLSRRSTLTFNEPLEPWSLLASW
FT                   QCAAPACFHIGFQFSPDSCFIASSPERLYRRQDRQLLSEALAGSTPRTGDPEQDAELAT
FT                   LLLQDGKNRLENRFVHTDILTRLDGLAETAVVSDAHILPLQHIQHIKREIEASLRPDTT
FT                   DWQLLKSIHPTPAVGGSPRRKALAQIRALEQHQRGWYAGACGFISEDVSEFTVAIRSGL
FT                   WHDQQLHLYTGAGILTGSDADTEWQELDTKLGSMLGAWHD"
FT   gene            490064..490984
FT                   /locus_tag="Tola_0435"
FT   CDS_pept        490064..490984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0435"
FT                   /product="1,4-dihydroxy-2-naphthoate octaprenyltransferase"
FT                   /note="TIGRFAM: 1,4-dihydroxy-2-naphthoate
FT                   octaprenyltransferase; PFAM: UbiA prenyltransferase; KEGG:
FT                   asa:ASA_3739
FT                   1,4-dihydroxy-2-naphthoateoctaprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92064"
FT                   /db_xref="GOA:C4L9G5"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR004657"
FT                   /db_xref="InterPro:IPR026046"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9G5"
FT                   /inference="protein motif:TFAM:TIGR00751"
FT                   /protein_id="ACQ92064.1"
FT                   /translation="MSGRMNKPRWKIWLQAARLRTLPLACAAVLLGSGLAAGADQFRNS
FT                   VFVLCLLTAIGLQVLSNLANDYGDAVSGADNEDRVGPQRTVVSGLITREQMQRAMSLVA
FT                   GLTIVSGLSLLWTAFSGDWPAILTFIGFGTLALVAAVTYTVGRRPYGYRGLGDLSVFLF
FT                   FGLLGVLGTYYLFTRQFDPLLILPAAGCGFLATAVLNINNIRDMDTDIATGKRTFAARI
FT                   GRSWARRYHWFLVLGGGLMAMVYIVLRAQTAWPWLCLPAWGPLILSAWVVATSQDPVLL
FT                   DKQLKRTAISSLLFNLLLAIGFALD"
FT   sig_peptide     490064..490180
FT                   /locus_tag="Tola_0435"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.804 at
FT                   residue 39"
FT   gene            491032..491652
FT                   /locus_tag="Tola_0436"
FT   CDS_pept        491032..491652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0436"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   vpa:VP2973 homoserine/homoserine lactone efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92065"
FT                   /db_xref="GOA:C4L9G6"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9G6"
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /protein_id="ACQ92065.1"
FT                   /translation="MDFHVWLTYLATTIVFSIYPGSGAVNTISNAIRYGVRGSVPAIAG
FT                   LQLGLSIHLALVGVGLGTLLAQSATAFAVLKWLGVAYLVWLGWTKWREVPQLMKNGVGQ
FT                   EDGPRPALFWPAVFVNITNPKSIVFLVALFPQFLHADYPLWSQALILSVTCVLVDIIVM
FT                   LGYASLAAPLTHLVQNEKGMRTQNRIFGSLFIAAGALLSGASR"
FT   gene            491801..492373
FT                   /locus_tag="Tola_0437"
FT   CDS_pept        491801..492373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0437"
FT                   /product="protein of unknown function DUF414"
FT                   /note="PFAM: protein of unknown function DUF414; KEGG:
FT                   aha:AHA_0270 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92066"
FT                   /db_xref="GOA:C4L9G7"
FT                   /db_xref="InterPro:IPR007336"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9G7"
FT                   /inference="protein motif:PFAM:PF04220"
FT                   /protein_id="ACQ92066.1"
FT                   /translation="MATKPEKSAGNAKRPDNKKKKPAFSAQEAREQKKQAKRKGLRPGA
FT                   RNSAETQEQKNQSVKNKDARVGSRKPVALVAEAPVAVVKAPKPAAPKAEPQMPPEQQLA
FT                   KWERELEKLENDDRLNALLDKLELEQPISEEDQEWLDKKLARHQELLKLLGLNEEEKVA
FT                   SDPDELLQRFIESDFDPNQFDSRYKED"
FT   gene            492495..492740
FT                   /locus_tag="Tola_0438"
FT   CDS_pept        492495..492740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0438"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92067"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9G8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACQ92067.1"
FT                   /translation="MDSELELLEKYIRANFEYDSAGSLIDPLDAVVISPVNESQLTTSP
FT                   FKEAGARMGDYWVDDSVYGFIFRIENGVVTKLWSND"
FT   gene            complement(492803..493846)
FT                   /locus_tag="Tola_0439"
FT   CDS_pept        complement(492803..493846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0439"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; SMART: regulatory
FT                   protein LacI; KEGG: vfi:VF_0608 LacI family DNA-binding
FT                   transcriptional repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92068"
FT                   /db_xref="GOA:C4L9G9"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9G9"
FT                   /inference="protein motif:PFAM:PF00356"
FT                   /protein_id="ACQ92068.1"
FT                   /translation="MVKMDDIAQLAGVSKASVSRVINNKAVSPAIRERVEKIINELHYQ
FT                   PNLIAQSLTTKTTNVIGLIIPNRSNYYINTYDFITTCIDLLAESGKVAIVVEMDDSASS
FT                   FIDSINKLMVHQCDGIIYYHSSFINVDFNSKNIRTVLDNLRKPIAILNKKGEQQAEKYF
FT                   WFDNEKIASLAAEYLLSNGHEKIAYLSAPLSEETARTRVSGVKNTIEKHNKAFLPTHFS
FT                   EGTRDIDGGYSACRDLFRKTRDFTGLLCFNDAMALGAVKYLSEINEIAHSDISIVGIGA
FT                   DPLINKIYPSLVTVYTPLRELIANAVSYVLGENMEVLETELSGTLYIDERIKNRSNTNL
FT                   FTWSMHT"
FT   gene            494172..494948
FT                   /locus_tag="Tola_0440"
FT   CDS_pept        494172..494948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0440"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: regulatory protein DeoR; SMART: regulatory
FT                   protein DeoR; KEGG: spe:Spro_0997 DeoR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92069"
FT                   /db_xref="GOA:C4L9H0"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9H0"
FT                   /inference="protein motif:PFAM:PF08220"
FT                   /protein_id="ACQ92069.1"
FT                   /translation="MEKLAPEERQQIILDLLQSEGKVLAIDLATRLNTTEATIRRDLRY
FT                   LSDNGLCKRIHGGALAKSAIIATPLERKLISSDEKKALAIAALRLIKNNQVIFLDSSTT
FT                   HLLLADLLPQDKNLTVVTNSINIAAHLLDRSGIRTIVLGGELNSLIGGAVDSKAIQELA
FT                   ILKFDLALVGVCSWSSESGFSAVDYQDAQFKRILVDRAGEIAVLCTQDKIDKFAPYKIM
FT                   DTEDIDHLILYENSDSQLEKQVTDAGGAIFYNEGTV"
FT   gene            495088..496461
FT                   /locus_tag="Tola_0441"
FT   CDS_pept        495088..496461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0441"
FT                   /product="oxygen-independent coproporphyrinogen III
FT                   oxidase"
FT                   /EC_number="1.3.99.22"
FT                   /note="KEGG: asa:ASA_4125 coproporphyrinogen III oxidase;
FT                   TIGRFAM: oxygen-independent coproporphyrinogen III oxidase;
FT                   PFAM: HemN domain protein; Radical SAM domain protein;
FT                   SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92070"
FT                   /db_xref="GOA:C4L9H1"
FT                   /db_xref="InterPro:IPR004558"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9H1"
FT                   /inference="protein motif:TFAM:TIGR00538"
FT                   /protein_id="ACQ92070.1"
FT                   /translation="MSTQHVIWDDALIQKYNYSGPRYTSYPTALEFSESFDYPQFLRAA
FT                   QQYPQRPLSLYVHIPFCHKLCYYCACNKIVTRQRHKAEEYLGYLEKEIRQQAKLFAGRA
FT                   VTQLHWGGGTPTYLSHEQIARLMTMLKTNFNFAEEGEFSIEIDPREITLDTLDVLKQAG
FT                   FNRISLGVQDFDKRVQEVVNREQDNDFIRAMIRHAKELGFRSTNLDLIYGLPLQTRESF
FT                   RHTLEQIAELQPDRLSVFNYAHLPSRFAGQHKIKEELLPSPAEKLAMLQETIEYLTSQG
FT                   YLYIGMDHFAKPDDELAQAQRAGVLHRNFQGYTTQGDCDLLGLGVSAISMLGDAYSQNQ
FT                   KELQVYYEQVTQLGHAQWKGCALQRDDLIRRDVIKQLICNFTLDPKQIEAIYGISFAEY
FT                   FAEDLKLLQPFVNDGLVEVEGQCLRVTATGRLLIRNICMCFDVYLRQKARQQQFSRVI"
FT   gene            496674..498050
FT                   /locus_tag="Tola_0442"
FT   CDS_pept        496674..498050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0442"
FT                   /product="L-serine dehydratase 1"
FT                   /EC_number="4.3.1.17"
FT                   /note="KEGG: mmw:Mmwyl1_3280 L-serine dehydratase 1;
FT                   TIGRFAM: L-serine dehydratase 1; PFAM: serine dehydratase
FT                   alpha chain; serine dehydratase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92071"
FT                   /db_xref="GOA:C4L9H2"
FT                   /db_xref="InterPro:IPR004644"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9H2"
FT                   /inference="protein motif:TFAM:TIGR00720"
FT                   /protein_id="ACQ92071.1"
FT                   /translation="MTLSLFDLFKIGIGPSSSHTVGPMKAGYLFSQLLQQLELLHHVAR
FT                   VQVIFYGSLAATGKGHGTPPALLLGLEGALPESVDPDWITPRYQALQAGAELQLAGQHA
FT                   IAFDEARDVLLRWECLPRHTNGMQLFAFDAAGNTLLAKTYYSVGGGFVVDDDEADNAAS
FT                   VDAVSVPYPFTSAAELIALCHQHQLSVAELMLANEKVWRNETEIAVGIEQIWHTMQLCV
FT                   QRGIQQQGILPGGLNVRRRAARLHDSLLKQLGSPGWNAMEWVNLYALAVNEENAAGGRV
FT                   VTAPTNGAAGIIPAVLHYYMQFCPQFSIQASAAKVQEFLLTAAAIGMLCKLNASISGAE
FT                   VGCQGEVGSACAMAAAGLAAVLGGTPDQVENAAEIGMEHNLGLTCDPVAGLVQIPCIER
FT                   NAMASVKAINAASMALRGDGQHYISLDKVIATMRDTGKDMLDKYKETSRGGLAINITEC
FT                   "
FT   gene            498291..499328
FT                   /locus_tag="Tola_0443"
FT   CDS_pept        498291..499328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0443"
FT                   /product="PTS system, fructose subfamily, IIC subunit"
FT                   /note="TIGRFAM: PTS system, fructose subfamily, IIC
FT                   subunit; PFAM: phosphotransferase system EIIC; KEGG:
FT                   cvi:CV_2309 protein-N p-phosphohistidine-sugar
FT                   phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92072"
FT                   /db_xref="GOA:C4L9H3"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9H3"
FT                   /inference="protein motif:TFAM:TIGR01427"
FT                   /protein_id="ACQ92072.1"
FT                   /translation="MKEQLQRYKQYLLTGVSYVIPFIASGGILIALAVAFAPMTSQGPS
FT                   FSDSPLLKLIVDIGNQVFALLLPVLAGYIAYARAGKPALVAGMLGGQISSTIHAGFIGA
FT                   LVAGLLAGWVVELLKKMPVPKAFRPLTPILIIPILSALIVGALMFEVVGVPLANLMVFL
FT                   ADWLKGMGTANAVVLGALLGAMVAFDMGGPINKTAFFFGSAMIAEGNPTIMGAVATAIC
FT                   IPPLGLGLATKLNKKLWSAQEQEAGSAALAMGCIGITEGAIPFAAADPLRVIPTICFGS
FT                   ALGSVIAMLSGVADHAPHGGPIVLPVIDNRLMYLVAITVGVVVTALLINFLKARSGAPV
FT                   VADHE"
FT   gene            499348..499647
FT                   /locus_tag="Tola_0444"
FT   CDS_pept        499348..499647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0444"
FT                   /product="PTS system, fructose-specific, IIB subunnit"
FT                   /note="TIGRFAM: PTS system, fructose-specific, IIB
FT                   subunnit; PFAM: phosphotransferase system PTS
FT                   fructose-specific IIB subunit; KEGG: cvi:CV_2310 PTS
FT                   system, fructose-like-2 IIB component 1"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92073"
FT                   /db_xref="GOA:C4L9H4"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9H4"
FT                   /inference="protein motif:TFAM:TIGR00829"
FT                   /protein_id="ACQ92073.1"
FT                   /translation="MRIVAVTACPTGIAHTYMAAEKLFATAKALGHEIKVETQGAMGIE
FT                   NELSVHDIKAADRVLMAIDIVIEGEERFENQRVLKVPIQDVLKDPKAVFKRLED"
FT   sig_peptide     499348..499407
FT                   /locus_tag="Tola_0444"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.792) with cleavage site probability 0.784 at
FT                   residue 20"
FT   gene            499681..502182
FT                   /locus_tag="Tola_0445"
FT   CDS_pept        499681..502182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0445"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase"
FT                   /note="TIGRFAM: phosphoenolpyruvate-protein
FT                   phosphotransferase; PTS system, fructose subfamily, IIA
FT                   subunit; PFAM: PEP-utilizing protein;
FT                   phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system EIIA 2; PEP-utilising protein mobile region;
FT                   PEP-utilising protein domain protein; phosphoryl transfer
FT                   system HPr; KEGG: cvi:CV_2311 phosphoenolpyruvate-protein
FT                   phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92074"
FT                   /db_xref="GOA:C4L9H5"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR004715"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9H5"
FT                   /inference="protein motif:TFAM:TIGR01417"
FT                   /protein_id="ACQ92074.1"
FT                   /translation="MGSHKIEYRCSLLHGLHARPATQLEAFCKRFSSTIDWCNQRNGRC
FT                   ANAKSVLALLGTDTLYDDLCEITLSGKDAGPAASALLHFLRHEMCEETDAEPEPESCSI
FT                   RVPRSLRATQSLLVHGTAVSPGIGRGQLVVLDTIAPVLPADLRPERLSRRQQLLQNALT
FT                   RLQQQLLLQLQQAKAQTAQVLQAHLSLVSDCEFQQALQRLLPAVATVAQAILQVQQHFQ
FT                   TQFLASASGYLQERELDLRDVCQQLLALLYPEWAQKASLTLNTASVVLADELTPSEFLQ
FT                   LDQRYLQALLLTHAGQTSHTIILARAANIPVLTGLADSRVQQAAGQTVIADAELGICLL
FT                   KPDAVAERYYALYAQVKQQRWQQLQQQSLLAGCSADQQRLEIAANITSVTDAQNAFQAG
FT                   AEGIGLFRTEMLFMERDAPPDEEEQYQVYRAVLQAAEGKPVIIRTFDIGGDKPLDYLPF
FT                   TTERNPYLGLRGVRLYPYCEALFRTQLRALLRAASDGPLKVMLPMVSQPEELLWVQQLI
FT                   TEEESALHAALIPHASFSLGIMLEVPAAALQVSTFCALADFFSIGSNDLTQYLLAVDRN
FT                   NPRVARYYHYAHPALWLLLQQVVIQAHQHGRWIGLCGELGSDRRFLPLLLGLGLDEISL
FT                   SSARITECKTQLSQLHAGRCRQLLRQVCGCENSEQVLSLLASSQVSEPRPILSTENMIL
FT                   QADWLNKEEVLKGMVDHLWLTGWTSQPLQLEETLWAREAAYSTGLGHGIAIPHAMTDAI
FT                   DHPAISICRLAHPVDWGSLDGQPVDLVIMLTLSTRLGREQHLRIFSRLARRIMYEEFCQ
FT                   QLRTAGDEQALCALLQQELNM"
FT   gene            complement(502201..503055)
FT                   /locus_tag="Tola_0446"
FT   CDS_pept        complement(502201..503055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0446"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; SMART: helix-turn-helix- domain containing
FT                   protein AraC type; KEGG: ppr:PBPRA2717 putative
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92075"
FT                   /db_xref="GOA:C4L9U6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9U6"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ACQ92075.1"
FT                   /translation="MQQVFQDIFSVITEEELSEHTHQLVYAHDTCPPPQYAFQVTFPRL
FT                   EWVLSGNYQNILCDSQGDKIEQRLTTGQFLFVPANCWNKPVWQEDVCVLSLLFGRRQLG
FT                   LSLVSWSQQQQNFIDVQKHSYPLSAKSPVHSMLQALIDLQASELQTPRSLQLQLMTVLT
FT                   FTQELLHQPQPEKYQRAQSVFQRICIYVQENFHKAISRETVARRFNISPNHLSRLFRQQ
FT                   GHMNFADYMVYVRIDRAKFMLRRYPMHLEEIAHRCGFRDTNYFCRVFKKKTGRTPTEYR
FT                   LEK"
FT   gene            503269..503796
FT                   /locus_tag="Tola_0447"
FT   CDS_pept        503269..503796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0447"
FT                   /product="17 kDa surface antigen"
FT                   /note="PFAM: 17 kDa surface antigen; KEGG: ypy:YPK_1877 17
FT                   kDa surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92076"
FT                   /db_xref="GOA:C4L9U7"
FT                   /db_xref="InterPro:IPR008816"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9U7"
FT                   /inference="protein motif:PFAM:PF05433"
FT                   /protein_id="ACQ92076.1"
FT                   /translation="MKFKACVVLSVVSSMFVVAGCTNLHSGDVYQGNRAGIVQNVSYGT
FT                   VTSIRQVTIQDDSSNMPIGAVAGAVVGGILGHSVGGGTGKQLATVGGVVAGGLAGNAIQ
FT                   NQANKTTGMEVEIRLDNGQTIAVVQANDPNFQVGSRVRLVDAGGRTTAALVSNVNSGAA
FT                   PVVVQPGYTPVQ"
FT   sig_peptide     503269..503349
FT                   /locus_tag="Tola_0447"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.547 at
FT                   residue 27"
FT   gene            complement(503855..504757)
FT                   /locus_tag="Tola_0448"
FT   CDS_pept        complement(503855..504757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0448"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: asa:ASA_0476 ROK
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92077"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9U8"
FT                   /inference="protein motif:PFAM:PF00480"
FT                   /protein_id="ACQ92077.1"
FT                   /translation="MLRLGLDIGGTKIEAQLLDDRGQCLKKHRIATPNQQYCEFLNSVT
FT                   ALVTQYRTEFNHSFSVGIGLPGAISPDTGRIKNSNILILNGQDLRADLEQRLGQTVALA
FT                   NDADCFALSEAVDGAGKDGRTVFGVIIGTGCGGGVVVNKQLLSGPNAIAGEWGHNPLPG
FT                   HSPEQDGPAQPCYCGRNNCLERFVSGTGFTTRFNQRYDTQLTAAEIIAAKENGDIKAEE
FT                   HYQHLVNALARSLGSVINVIDPHVIVLGGGLSNVDSLYRDLPAALLPYIFSDRCNTRIV
FT                   KAKHGDSSGVRGAAWLPGL"
FT   gene            complement(504832..505149)
FT                   /locus_tag="Tola_0449"
FT   CDS_pept        complement(504832..505149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0449"
FT                   /product="phosphotransferase system PTS
FT                   lactose/cellobiose-specific IIA subunit"
FT                   /note="PFAM: phosphotransferase system PTS
FT                   lactose/cellobiose-specific IIA subunit; KEGG: yen:YE4105
FT                   putative phosphotransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92078"
FT                   /db_xref="GOA:C4L9U9"
FT                   /db_xref="InterPro:IPR003188"
FT                   /db_xref="InterPro:IPR036542"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9U9"
FT                   /inference="protein motif:PFAM:PF02255"
FT                   /protein_id="ACQ92078.1"
FT                   /translation="MMDLEEAVMGIIVNAGQSRSLCFEALHQAKQGQFVEADSLLKEAN
FT                   TFAREAHAVQTQLIEADEGEGKTRMTLVMVHAQDHLMTSILAKELITELVDLYKQNAAR
FT                   I"
FT   gene            complement(505159..506541)
FT                   /locus_tag="Tola_0450"
FT   CDS_pept        complement(505159..506541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0450"
FT                   /product="Beta-glucosidase"
FT                   /EC_number="3.2.1.21"
FT                   /note="PFAM: glycoside hydrolase family 1; KEGG:
FT                   asa:ASA_0478 glycoside hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92079"
FT                   /db_xref="GOA:C4L9V0"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9V0"
FT                   /inference="protein motif:PRIAM:3.2.1.21"
FT                   /protein_id="ACQ92079.1"
FT                   /translation="MMQYRFPENFWWGSASSGPQSEGATLRDGKSATIWDKWFDESPNR
FT                   FFNQVGPQDTSTFYDHFRSDIQLMKQLNHNTFRTSIAWARLIPNGTGEVNPLAVRFYND
FT                   MLDELLANGIEPFINLFHFDMPLCMQEKGGWESREVVDAYADFAETCFRLFGGKVKFWF
FT                   TFNEPIVPVEGGYLYDFHYPNVVDFRRAATVAYHTMLAHAKAVQRYRALQQEGQIGIVL
FT                   NLTPSYPRSQHPSDLQASKIADLFFNRSFLDPAVKGEYPAELVELLKQYDQLPHCEAGD
FT                   AELLAQGKVDLLGVNYYQPRRVKARANAVNPASPFMPEWFFDYYEMPGRKMNPHRGWEI
FT                   YEKGIYDILINLRDNYGNIPSYISENGMGVEGEEKFLVEGQIQDDYRIKFVSDHLQWLH
FT                   KGISENCACKGYHLWTFIDNWSWSNAYKNRYGFVQLDLATQKRTIKKSGEWFADVSRNN
FT                   GF"
FT   gene            complement(506615..507934)
FT                   /locus_tag="Tola_0451"
FT   CDS_pept        complement(506615..507934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0451"
FT                   /product="PTS system, lactose/cellobiose family IIC
FT                   subunit"
FT                   /EC_number="2.7.1.69"
FT                   /note="KEGG: esa:ESA_02023 hypothetical protein; TIGRFAM:
FT                   PTS system, lactose/cellobiose family IIC subunit; PFAM:
FT                   phosphotransferase system EIIC"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92080"
FT                   /db_xref="GOA:C4L9V1"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004501"
FT                   /db_xref="InterPro:IPR004796"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9V1"
FT                   /inference="protein motif:TFAM:TIGR00410"
FT                   /protein_id="ACQ92080.1"
FT                   /translation="MSAYNKMVTMIEDTVTPLAAKLGQQKYVTSIRDGFIAALPFMIVG
FT                   SFMLVFIFPPFDPETKWGFARAWLDFAKTYQNQLLLPFQLSMGVMTLFISVGVAASLGR
FT                   HYKLDPITTGLLSLMSFLLVAAPIKDGAISTQYFSGQGIFTALICSIYATEVYAFLKRK
FT                   NITIRLPEQVPTGVARSFEILIPVMVIILTLHPLNLFIESETGMILPEAIMSMVKPLVS
FT                   ASDSLPAILISLFICQILWFAGIHGALIVTGIMNPFWMANLAENQAALAAGGELTHIYL
FT                   QGFWDHYLLIGGVGSTLPLAFLLLRSKAIHLRTIGKMGVVPGLFNINEPILFGAPIVMN
FT                   PVFFLPFILVPMVNAVLAYVATSMGLVARVVSMTPWTSPAPLGASWAANWSFSPVVMCL
FT                   ICMVMSAVMYYPFLKAYERTLLKQEEETAAEAHAGEPATA"
FT   gene            complement(507962..508267)
FT                   /locus_tag="Tola_0452"
FT   CDS_pept        complement(507962..508267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0452"
FT                   /product="phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit"
FT                   /note="PFAM: phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit; KEGG:
FT                   ppr:PBPRB2008 PTS system cellobiose-specific IIB component"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92081"
FT                   /db_xref="GOA:C4L9V2"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013012"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9V2"
FT                   /inference="protein motif:PFAM:PF02302"
FT                   /protein_id="ACQ92081.1"
FT                   /translation="MKKIMLCCSAGMSTSLLVKKMLAEAEKRQLPVEIKAFGAAEFDEQ
FT                   VSKYQAVLLGPQVKYMLADLQARAKPYGVPVEPIAMTDYGMQRGDKVLDFALSLIK"
FT   sig_peptide     complement(508211..508267)
FT                   /locus_tag="Tola_0452"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.900) with cleavage site probability 0.522 at
FT                   residue 19"
FT   gene            508510..509817
FT                   /locus_tag="Tola_0453"
FT   CDS_pept        508510..509817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0453"
FT                   /product="PTS system, lactose/cellobiose family IIC
FT                   subunit"
FT                   /EC_number="2.7.1.69"
FT                   /note="KEGG: ppr:PBPRB2009 phosphotransferase
FT                   systemcellobiose-specific component IIC; TIGRFAM: PTS
FT                   system, lactose/cellobiose family IIC subunit; PFAM:
FT                   phosphotransferase system EIIC"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92082"
FT                   /db_xref="GOA:C4L9V3"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004501"
FT                   /db_xref="InterPro:IPR004796"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9V3"
FT                   /inference="protein motif:TFAM:TIGR00410"
FT                   /protein_id="ACQ92082.1"
FT                   /translation="MGSYWMQLMVSAIEQWMTPLARYLTKSRYLIALRDGFQLAMPFVI
FT                   VGSLCVPLLYPPFPPDSTNWLAVLWNHVSTDLRVVWLAPYQITMGLISLLVSFGMAASL
FT                   AKSYGLPERLSGLTGSVSFMLLAGFYQNGGVDARYLGGMGLFTAIIAAIYSIEVIRFFY
FT                   QRNWTIRVPEEVPKITSSGFLLIIPLFFILISLTLINLLLQQHFGAVFPELVEKLFRPM
FT                   IVASDSLPAVWLSLLVCNLLWFMGIHGALLITGIMYPFWMSNILDNQAALAAGQVLPHI
FT                   YVHAFWDFYLLIGGVGSTLPLAFMALRSRSQQLRSAGKLGLFPSLFNINEPILFGFPVI
FT                   MNPLFLLPFLLAPLVNATLAWYLTEWGWLDRFVAILPWSMPSPIGAAWSANGSWRTALM
FT                   SLLALANAWIIYYPFFKVHERMLLENKRAMMQKKGY"
FT   gene            509929..510915
FT                   /locus_tag="Tola_0454"
FT   CDS_pept        509929..510915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0454"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; SMART: regulatory
FT                   protein LacI; KEGG: asa:ASA_0474 LacI family transcription
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92083"
FT                   /db_xref="GOA:C4L9V4"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9V4"
FT                   /inference="protein motif:PFAM:PF00356"
FT                   /protein_id="ACQ92083.1"
FT                   /translation="MTTILDVCRLANVSKATVSRVLSGNRKVKEDTRDVVMRAVEQLNY
FT                   RPNQLAQSLATKVSNTVGVLTNGLTDSQLGQVLRQLDSALWGQGRSFILANGVDGAASL
FT                   ADKLSFLASRHCDAILLLGKNYDHRWFDDLDVSDLPPLLTMNQTLDEIDGVQFDQALTA
FT                   ELACNYLYSHGHTQIAVLLESGSGGEQMLQGYRHALENRSLPFNRQMVAQHADGATAIS
FT                   MLINRYIPFTAVLVPDDHQAIEVIRTLAQYNIQVPQEVSVISLMTGIEGERYTPAITGF
FT                   EVPEEKMLQSLLRLLDDVIKGGGEGGSDVTREFMGKLIIRQSVRTME"
FT   gene            complement(510943..511062)
FT                   /locus_tag="Tola_0455"
FT   CDS_pept        complement(510943..511062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0455"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92084"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9V5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACQ92084.1"
FT                   /translation="MKQLILTPHRLPPHHEQQIRRILQTIERMLKQSEYDKKR"
FT   gene            complement(511337..512761)
FT                   /locus_tag="Tola_0456"
FT   CDS_pept        complement(511337..512761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0456"
FT                   /product="nitrogen metabolism transcriptional regulator,
FT                   NtrC, Fis Family"
FT                   /note="KEGG: aha:AHA_0274 nitrogen regulation protein
FT                   NR(I); TIGRFAM: nitrogen regulation protein NR(I); PFAM:
FT                   sigma-54 factor interaction domain-containing protein;
FT                   helix-turn-helix Fis-type; response regulator receiver;
FT                   SMART: response regulator receiver; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92085"
FT                   /db_xref="GOA:C4L9V6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010114"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9V6"
FT                   /inference="protein motif:TFAM:TIGR01818"
FT                   /protein_id="ACQ92085.1"
FT                   /translation="MAAKVWIVDDDSSIRWVLERALSAEHFECQSFEDGESLLAALDNN
FT                   QTIPDVIVSDIRMPGIDGLSLLQLIQDKQPDIPVIIMTAHSDLDSAVNAYQSGAFEYLP
FT                   KPFDIDEAVALVQRAESHLHEQRNKRRARQQVATTAPEIIGEAPAMQEVFRAIGRLARS
FT                   SISVLINGQSGTGKELVAHALHRHSPRAAKPFIALNMAAIPKDLIESELFGHEKGAFTG
FT                   ANSVRQGRFEQANGGTLFLDEIGDMPLDVQTRLLRVLADGQFYRVGGHQSIQVDVRIIA
FT                   ATHQDLEKRVVAGDFREDLFHRLNVIRIHIPSLRERREDIPKLAQHFLLRAAKELNVEA
FT                   KMLHPDTEAYISRLPWPGNVRQLENVCRWLTVMASGQEVLVSDLPPELLNPVEERPVAG
FT                   KEPVSLRWQEQLQQWIAQKLARGEVDILSEALPEFERIMLNTALQHTHGHKQEAARLLG
FT                   WGRNTLTRKLKELDMN"
FT   gene            complement(512776..513828)
FT                   /locus_tag="Tola_0457"
FT   CDS_pept        complement(512776..513828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0457"
FT                   /product="signal transduction histidine kinase, nitrogen
FT                   specific, NtrB"
FT                   /note="KEGG: aha:AHA_0275 nitrogen regulation protein
FT                   NR(II); TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region ATPase domain protein; PAS fold domain protein; PAS
FT                   fold-4 domain protein; histidine kinase A domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; histidine
FT                   kinase A domain protein; PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92086"
FT                   /db_xref="GOA:C4L9V7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9V7"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ACQ92086.1"
FT                   /translation="MNSRPDLPKLLLDNLLTAVILLDKHLIVRYVNPAAEQLMGVSARR
FT                   LLDHALEQVVDYISLDLERLRHCLIQGQGFTDNEVTLVVENEPRSVEVSVIAVYDHQEQ
FT                   MALVELRKIDQQKRISQEQQQHSQQLAARDLVRGLAHEIKNPLGGLRGAAQLLEKALPD
FT                   EQLKEYTGIIIAQADRLRNLVDRLLGPQRPGRHQVHNVHSVLEQVRRLVEMELPPGIKI
FT                   ERDYDPSIPDFEMEQEQLQQAFLNIVRNAVEAMHGHGTIKLKTRTVFQITIHGKRYRLA
FT                   AEIRIIDDGPGIPENIRDTLFYPMVTGKDGGTGLGLSIAQNLIDQHKGRIECVSWPGHT
FT                   EFCIYLPLRK"
FT   gene            complement(513927..514469)
FT                   /locus_tag="Tola_0458"
FT   CDS_pept        complement(513927..514469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0458"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aha:AHA_0276 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92087"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9V8"
FT                   /inference="similar to AA sequence:KEGG:AHA_0276"
FT                   /protein_id="ACQ92087.1"
FT                   /translation="MKRISGIWLALGLSWAVQAADENANVYYWTDAQGVMHFSDRPVPG
FT                   KQMQRMQIEIANPPASNPNPVIDTSAQDQKETPPTIAYSLSISSPLTEQTIRDNEGRIT
FT                   VQNQLTPAIPEEDPAELFLYVDENRYPCDAASLSCQVSDIDRGAHQLRTELVSKSGKIL
FT                   ASSGTVTVYLFRVIAVR"
FT   sig_peptide     complement(514410..514469)
FT                   /locus_tag="Tola_0458"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 20"
FT   gene            complement(514579..515988)
FT                   /locus_tag="Tola_0459"
FT   CDS_pept        complement(514579..515988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0459"
FT                   /product="glutamine synthetase, type I"
FT                   /note="TIGRFAM: glutamine synthetase, type I; PFAM:
FT                   glutamine synthetase catalytic region; glutamine synthetase
FT                   beta-Grasp; KEGG: aha:AHA_0277 glutamine synthetase, type
FT                   I"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92088"
FT                   /db_xref="GOA:C4L9V9"
FT                   /db_xref="InterPro:IPR001637"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9V9"
FT                   /inference="protein motif:TFAM:TIGR00653"
FT                   /protein_id="ACQ92088.1"
FT                   /translation="MSAANVLNMIKENEVKFVDLRFTDTKGKEQHVSIPSHQVNEDFFE
FT                   DGKMFDGSSIAGWKGINESDMVLMPDATTALMDPFTEESTLIIRCDILEPATMKGYDRD
FT                   PRSIAKRAEEYLKASGIADTVLFGPEPEFFIFEDVRFENTMSGSFFKIDDPEAAWNSGK
FT                   SFEGGNKGHRPGVKGGYFPVAPVDSSQDLRSAMCLILEEMGQVVEAHHHEVATAGQNEI
FT                   ATRFNTMTKKADEVQVQKYVIHNVAHAYGKTVTFMPKPMFGDNGSGMHCHQSLGKDGVN
FT                   LFSGDAYGGLSEMALFYIGGIIKHAKAINAFTNPSTNSYKRLVPGYEAPVMLAYSARNR
FT                   SASIRIPVVPSPKAARIEVRFPDPAANPYLAFTAQLMAGLDGIINKIHPGDAADKDLYH
FT                   LPPEEAAQIPQVCGSLDEALKALDADREFLTRGGVFSEDFIDAYIELKNIDVDRLRMTP
FT                   HPVEYEMYYSV"
FT   gene            516334..518160
FT                   /locus_tag="Tola_0460"
FT   CDS_pept        516334..518160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0460"
FT                   /product="GTP-binding protein TypA"
FT                   /note="TIGRFAM: GTP-binding protein TypA; small GTP-binding
FT                   protein; PFAM: protein synthesis factor GTP-binding;
FT                   elongation factor G domain protein; elongation factor Tu
FT                   domain 2 protein; KEGG: asa:ASA_4119 GTP-binding protein
FT                   TypA"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92089"
FT                   /db_xref="GOA:C4L9W0"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9W0"
FT                   /inference="protein motif:TFAM:TIGR01394"
FT                   /protein_id="ACQ92089.1"
FT                   /translation="MLENLRNIAIIAHVDHGKTTLVDKLLQQSGTLDRSSDGQERIMDS
FT                   NDLEKERGITILAKNTAIRWKDYRINIVDTPGHADFGGEVERVMSMVDCVLLLVDAVDG
FT                   PMPQTRFVTQKAFARGLRPIVVVNKVDRPGARPDWVVDQVFDLFDNLGATDEQLDFPIV
FT                   YASALQGYATMDLSQPSDNMDPLFQAIVDFVEPPKADPAGEFQMQISQLDYSSYVGVIG
FT                   IGRIVRGSVKPNQQVTVVGADGKTRTGKIGQVQGYLGLHRTEVAEAQAGDIIAITGLGE
FT                   LKISDTICSNSCVEALPPLSVDEPTVTMTFQVNTSPFAGKEGKYVTSRNILERLQNELR
FT                   HNVALRVEETEDPDKFRVSGRGELHLGILIENMRREGFELAVSRPEVIMRVIDGVKMEP
FT                   METLTVDIEEQNQGSVMEKLGERKAELRNMVPDGKGRVRLDYMIPARGLIGFQTEFMTL
FT                   TSGTGLLYHTFEEYGEFKGGAIGQRQNGVLISNATGKALGFALFNLQERGRLFIEHATE
FT                   VYEGQIIGIHSRSNDLTVNCLKGKQLTNMRASGTDEAIVLTTPIKMTLEQAMEFIDDDE
FT                   LVEVTPLNIRVRKKLLTEMDRKRANRGSGKEE"
FT   gene            518259..519167
FT                   /locus_tag="Tola_0461"
FT   CDS_pept        518259..519167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0461"
FT                   /product="ribonuclease BN"
FT                   /note="TIGRFAM: ribonuclease BN; PFAM: ribonuclease BN;
FT                   KEGG: asa:ASA_4118 ribonuclease BN"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92090"
FT                   /db_xref="GOA:C4L9W1"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="InterPro:IPR023679"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4L9W1"
FT                   /inference="protein motif:TFAM:TIGR00765"
FT                   /protein_id="ACQ92090.1"
FT                   /translation="MTQDPRRLLALRNQRWAKSRLFCLRSRRFSAFFWRRVWHDRLPVL
FT                   AGHLAYVSLLSIVPLLAVVFSVLSWLPRFSYFRRQFELFMFSNFVPETEIAFRYHFSLF
FT                   VKNASKTTSIGLLMLVLLALLLIAAIDENMNHIWRCRGQRKWLKTITMYSIVLGVVPLL
FT                   VGGSLLLSSQIQGWALWHYELVSSLGGGLLELLPYLLSLGGILLLYKVVPNIYVRWQHA
FT                   LLGATLAALLFEVAKEGFGYYIAHFGTYKSIYGALAGIPILMIWLYMSWLVVLLGAEFT
FT                   ATLGEWQLNRTLRGRKPRLPG"
FT   gene            complement(519246..519566)
FT                   /locus_tag="Tola_0462"
FT   CDS_pept        complement(519246..519566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0462"
FT                   /product="protein of unknown function DUF440"
FT                   /note="PFAM: protein of unknown function DUF440; KEGG:
FT                   aha:AHA_2131 dsDNA-mimic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92091"
FT                   /db_xref="InterPro:IPR007376"
FT                   /db_xref="InterPro:IPR036763"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9W2"
FT                   /inference="protein motif:PFAM:PF04269"
FT                   /protein_id="ACQ92091.1"
FT                   /translation="MTDKHTNTDELIDQAYELFLELAADNLDEATIARFNQEFPEHGGL
FT                   GDCEPEADWEEEIQAEVRPEEWLEVRVGLLNSDDELNYLFARMLISRDPESQECHILWQ
FT                   PE"
FT   gene            519722..522001
FT                   /locus_tag="Tola_0463"
FT   CDS_pept        519722..522001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0463"
FT                   /product="DNA topoisomerase IV, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: aha:AHA_3755 DNA topoisomerase IV subunit A;
FT                   TIGRFAM: DNA topoisomerase IV, A subunit; PFAM: DNA
FT                   gyrase/topoisomerase IV subunit A; DNA gyrase repeat
FT                   beta-propeller; SMART: DNA gyrase/topoisomerase IV subunit
FT                   A"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92092"
FT                   /db_xref="GOA:C4L9W3"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005742"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9W3"
FT                   /inference="protein motif:TFAM:TIGR01062"
FT                   /protein_id="ACQ92092.1"
FT                   /translation="MSDAELSLEGVERQPLRTFTEQAYLNYSMYVIMDRALPHIADGLK
FT                   PVQRRIVYAMSELGLSALSKHKKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYP
FT                   LVDGQGNWGAPDDPKSFAAMRYTEARLSRFSELLLSELEQGTVEWQPNFDGTMQEPQIL
FT                   PARLPHILLNGITGIAVGMATDIPPHNVREVAQACITLLERPDATISDLLEHVQGPDYP
FT                   TKAEIITPRSEIRKIYESGKGSIKARAVYHMEDGDIVITALPHQASGAKIIEQIANQMQ
FT                   AKKLPMVSDLRDESDHENPTRLVIIPRSNRIDVEQLMQHLFASTDLEKSYRVNLNMLGM
FT                   DHRPQVKNLLTILTEWLAFRRETVRRRLQFRLDKVLNRLHILDGLLIAYLNIDEVIAII
FT                   RNEDEPKKELMRRFGLSEIQADAILDLKLRHLAKLEEFKIRGEQDELAKERDQLEALLG
FT                   SARKLGNLLKKEIQADAEKYGDDRRSPLVERQEAKQLTEKELTPSELVTVVVSEMGWVR
FT                   AAKGHDVDVQGLNYKAGDGYLVSAQGRSNQQTVFMTNLGRTYSLEAHTLPSARGQGEPL
FT                   TGKLSFTAGEQTRYVLLGNEDERYLICSDAGYGFLCEYNDLISKNKNGKALLTLPEGAQ
FT                   VLPPQLTAKQDDDALCLVISNEGRMLLFPLNTLPQLGKGKGNKLIGIPADKVASREEFV
FT                   THVAVVKADQAVTLYAGKRKLTLKPADMVLYHGERGRRGAKLPRGLQRVDRVEPEQSAS
FT                   ASDNAV"
FT   gene            522014..522736
FT                   /locus_tag="Tola_0464"
FT   CDS_pept        522014..522736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0464"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /EC_number="2.3.1.51"
FT                   /note="KEGG: aha:AHA_3740 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferase; TIGRFAM: 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferase; PFAM: phospholipid/glycerol
FT                   acyltransferase; SMART: phospholipid/glycerol
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92093"
FT                   /db_xref="GOA:C4L9W4"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR004552"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9W4"
FT                   /inference="protein motif:TFAM:TIGR00530"
FT                   /protein_id="ACQ92093.1"
FT                   /translation="MLKVLRILVLAVLVLIWFVIGLVICLVRPRHRNNVYLLARMLNWG
FT                   CWVFGVKVRRVIPDECRHIESAVYVGNHQTNYDIMVMTGCVMPGVVAVGKKSLAWVPLF
FT                   GQLFYLSGNILIDRARRSRAVDTIRQVVAKIKQRRISVWMYPEGTRSQGRGMIPFKTGA
FT                   FHTAIQAGVPLVPIICSSYVGQIDLNRWDNGEILIEMLPPVDSQQWNRATVKECSDTIR
FT                   ALMEAKLADLDARVKKPQ"
FT   gene            522836..523501
FT                   /locus_tag="Tola_0465"
FT   CDS_pept        522836..523501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0465"
FT                   /product="SNARE associated Golgi protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   aha:AHA_2446 DedA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92094"
FT                   /db_xref="GOA:C4L9W5"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9W5"
FT                   /inference="protein motif:PFAM:PF09335"
FT                   /protein_id="ACQ92094.1"
FT                   /translation="MEWLHLIVDFVLHIDVHLQELFTTYGIWVYGILFLIIFSETGFVV
FT                   TPFLPGDSLLFAAGALVAATQGTPESMDIHVLVFLLITAAVTGNILNYAVGHFFGEKLF
FT                   QNPNSKIFRKDQLDKTHAFFEKHGGKTIIITRFIPIIRTFSPFVAGMGAMTYKRFMAFN
FT                   LIGGALWVMSFAYAGFEFGQQEFVRKNFTLLMMGIIVVSLLPMVIHAIRAKFAPQSKA"
FT   gene            523740..524891
FT                   /locus_tag="Tola_0466"
FT   CDS_pept        523740..524891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0466"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   asa:ASA_3327 major facilitator superfamily permease BdhT"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92095"
FT                   /db_xref="GOA:C4L9W6"
FT                   /db_xref="InterPro:IPR024989"
FT                   /db_xref="InterPro:IPR026032"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9W6"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACQ92095.1"
FT                   /translation="MSPYPWLALNLSAIYLVLGIFSPFWGVWLESVGLQSEQIGLLLGI
FT                   GFAMRLCGSLVIMRQAKRAERLIPIARLLVWGGLLSFAGFYLSSQFWVVLLFTLLINFV
FT                   YPTLLPLSDAVAARMVIQVNLDYGNVRLWGSAAFIVGATLIGFVIEHLGPAWILHCIVL
FT                   CLLLAGFCIHAPMSPAPRTIGEENESHGYGMLLRNKAFLNFLGIEALIFGSHAAYNSFS
FT                   AIYWHSQGFAASTISVLWTTGVVFEIIMFAASRRLLANWSPERLLCWAAIGAVIRWVTI
FT                   GTTLDLWLLFPAQALHAFTYTLAHLGAMRYLAQRLPREAIISGQTLYSAIGQSLSLALF
FT                   TVLSGIMYRHMQQDVFLVMAVIVLPAFYLIWRVRHTAVALPAQ"
FT   gene            524899..525819
FT                   /locus_tag="Tola_0467"
FT   CDS_pept        524899..525819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0467"
FT                   /product="Auxin Efflux Carrier"
FT                   /note="PFAM: Auxin Efflux Carrier; KEGG: pat:Patl_2785
FT                   auxin efflux carrier"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92096"
FT                   /db_xref="GOA:C4L9W7"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9W7"
FT                   /inference="protein motif:PFAM:PF03547"
FT                   /protein_id="ACQ92096.1"
FT                   /translation="MQPADVNQQFLLSICIILLGYLAKRTRYLTEKEGESIAKLIFNIT
FT                   LPALVINVFSTLPLQPQLALLPVLGFAANAVLCICILFIFRNHPRNIRGMMGMSLAGAN
FT                   IGLFAYPLVEAIWGKQGLTYMAMYDLGNSYMVFLVCYTVGAYFSGEKPLSWRQLLHSVV
FT                   RSIPVMASLLALSINLLGIPLPDLVLETTGVISKANMPLSLLLLGMYLNFSFPADQRKL
FT                   LLQALCSKYIIGGTLGGLLFWLLPYDALFRHSLLLAGVLPLPTMVLTYAVVFGYDRRMT
FT                   GAMLNASVIISILLSWLVFHFSTLS"
FT   gene            525884..526123
FT                   /locus_tag="Tola_0468"
FT   CDS_pept        525884..526123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0468"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: saz:Sama_0799 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92097"
FT                   /db_xref="InterPro:IPR021343"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9W8"
FT                   /inference="similar to AA sequence:KEGG:Sama_0799"
FT                   /protein_id="ACQ92097.1"
FT                   /translation="MALKISYSYKGQPRLIQYANDKYHDIYEAIAAEEGVDLRAYLAME
FT                   RQLASLTKKVGAVKDFRDNKFLEFGFNDIKVIKE"
FT   gene            complement(526188..527519)
FT                   /locus_tag="Tola_0469"
FT   CDS_pept        complement(526188..527519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0469"
FT                   /product="heat shock protein HslVU, ATPase subunit HslU"
FT                   /note="KEGG: aha:AHA_4115 ATP-dependent protease
FT                   ATP-binding subunit; TIGRFAM: heat shock protein HslVU,
FT                   ATPase subunit HslU; PFAM: ATPase AAA-2 domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92098"
FT                   /db_xref="GOA:C4L9W9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4L9W9"
FT                   /inference="protein motif:TFAM:TIGR00390"
FT                   /protein_id="ACQ92098.1"
FT                   /translation="MSEMTPREIVHELDRHIIGQAEAKRAVAIALRNRWRRMQLSNELR
FT                   QEVAPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDTIIRDLT
FT                   DMALKMMREQEMEKVRFRAHEAAEERVLDVLLPPARSNWGEAEKSETGTHTRQIFRKKL
FT                   REGELDDKEIEIDVAAPQMGVEIMAPPGMEEMTNQLQGLFQNMSAGNTHKRKLKVKDAL
FT                   KQLVEEEAGRLLNPEELKEKTIHAVENNGIVFIDEFDKICKRGESSGPDVSREGVQRDL
FT                   LPLIEGCTVNTKHGMVRTDHILFIASGAFQIAKPSDLIPELQGRLPIRVELKNLTVDDF
FT                   ERILTEPNASLTEQYQALMATEQVKIEFTAEGIRSIAEAAWQVNERTENIGARRLHTVL
FT                   EKLMEDISYDAADNAGQLFSIDAEYVNRYLGALIEDEDLSRFIL"
FT   gene            complement(527545..528087)
FT                   /locus_tag="Tola_0470"
FT   CDS_pept        complement(527545..528087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0470"
FT                   /product="20S proteasome A and B subunits"
FT                   /note="PFAM: 20S proteasome A and B subunits; KEGG:
FT                   aha:AHA_4114 ATP-dependent protease peptidase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92099"
FT                   /db_xref="GOA:C4L9X0"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4L9X0"
FT                   /inference="protein motif:PFAM:PF00227"
FT                   /protein_id="ACQ92099.1"
FT                   /translation="MTTIVSVRRNGQVVIGGDGQVSLGNTVMKGNARKVHRLYNGKVLA
FT                   GFAGGTADAFTLLERFEAKLQAHQGNLERAAVALAKEWRTDRALRRLEALLAVADAQRS
FT                   FIITGNGDVVQPENDLIAIGSGGAFAQSAARALLENTELSAEEIVKKALTIAGDICVFT
FT                   NSFHTIEVLEYPTVTPV"
FT   gene            complement(528238..529281)
FT                   /locus_tag="Tola_0471"
FT   CDS_pept        complement(528238..529281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0471"
FT                   /product="Sporulation domain protein"
FT                   /note="PFAM: Sporulation domain protein; KEGG:
FT                   spe:Spro_4791 cell division protein FtsN"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92100"
FT                   /db_xref="GOA:C4L9X1"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9X1"
FT                   /inference="protein motif:PFAM:PF05036"
FT                   /protein_id="ACQ92100.1"
FT                   /translation="MTRDYVRSSRPAKRKPASRGTGTGRGSSHNTSAPFPLVRALLALT
FT                   LVIGFGVFLYHISGSSGETDTAANSLADAQAPVPIEQQRPAKEEFDYMQILQNKEVPVE
FT                   LPDGQVISDPSKDPQLLQYQQKMQEMLRAQQERAKLLAQQQNGQLPAGQLPADSTALTQ
FT                   MAMSQTQAPPTVRSQTPAKTTANGTTATTAQRATDAPAQAANPRKPRSFADVIAKESAG
FT                   NSKPAAAPVTKTASQERDEALAMFGKPRPYAADSTVTASRNVATTTTNKRFMMQCGAFR
FT                   TADQASTLQSRIAVQGQNAQVRKGSSAAGTWHRVILGPYSSRATAEQSLSRLKGAGTVQ
FT                   SCTIYAQ"
FT   gene            complement(529285..531027)
FT                   /locus_tag="Tola_0472"
FT   CDS_pept        complement(529285..531027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0472"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="KEGG: aha:AHA_4112 arginyl-tRNA synthetase; TIGRFAM:
FT                   arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92101"
FT                   /db_xref="GOA:C4L9X2"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9X2"
FT                   /inference="protein motif:TFAM:TIGR00456"
FT                   /protein_id="ACQ92101.1"
FT                   /translation="MKAQIQQLLEQTVSSLKAAALIPVELEPRIQVDNTKDKAHGDLAT
FT                   NLAMLLAKPAGKNPRELAQLIIEHLPASTLVARAEIAGPGFINFFLDSAWLAKQIEAIA
FT                   ASPKAEVKAAAPAQTIVLDYSAPNVAKEMAVHHIRSTVIGDAVTRTMEFLGHHVIRANH
FT                   IGDWGTQFGMLIAYLEKVQNEQASELELSDLEAFYREAKKHYDEDEVFAERARGYVVKL
FT                   QGGDEYCRAMWKKLVDITMAQNQIIYDRLNVSLSEKDVMGESLYNPMLRTVVEDLQAKG
FT                   LAVESEGALVVYLDEIKGKDGEAMAVIIQKRDGGFLYATTDIACAKYRVETLKADRVLY
FT                   FIDSRQHQHLQQAWMIARKAGYVPEQVSLEHHAFGMMLGKDGKPFKTRTGGTVKLSELL
FT                   DEAELRAGALIAEKSADLPEAEKAKVIHAVAMGAVKYADLSKNRTTDYIFDWDNMLTFE
FT                   GNTAPYLQYAYTRIQSIFRRVGDEAQPGPVQITAPAEETLAQKLLQFNDVVHNVAQKGM
FT                   PHLLCTYLYELSGCFMSFYEACPINKEGVTAAEKGSRLTLCQATAKTLTLGLSLLGIET
FT                   LERM"
FT   gene            531287..531871
FT                   /locus_tag="Tola_0473"
FT   CDS_pept        531287..531871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0473"
FT                   /product="peptidase S16 lon domain protein"
FT                   /note="PFAM: peptidase S16 lon domain protein; SMART:
FT                   peptidase S16 lon domain protein; KEGG: aha:AHA_4111
FT                   ATP-dependent protease La"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92102"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9X3"
FT                   /inference="protein motif:PFAM:PF02190"
FT                   /protein_id="ACQ92102.1"
FT                   /translation="MQLAIFPLRINILPDGVLPLCIFEPRYVRMIAESSRRGMGLCLLG
FT                   KALDGGFSLLLTVGTRIEIIDFDQLTNGLLTVTMKGVERFRIHSMEVEPDGLLCAEVQV
FT                   LPEWQHAPLQPEQHILAEKLGQLFHEHPNYAAYYPTPHWADACWVVQRWLEVLPLEAEE
FT                   KFNLMVSNDYHDALHFLLQAVQEEDAAVRQH"
FT   gene            532022..532600
FT                   /locus_tag="Tola_0474"
FT   CDS_pept        532022..532600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0474"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; Sigma-70
FT                   region 4 type 2; sigma-70 region 4 domain protein; KEGG:
FT                   asa:ASA_0204 ECF subfamily RNA polymerase sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92103"
FT                   /db_xref="GOA:C4L9X4"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9X4"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACQ92103.1"
FT                   /translation="METANLDLTALLLQVATQRSKAAYSQLFHYFAPRIRHYGLRHLRS
FT                   EARAMELVQETLLAVWQKAALYHPEKGAPTTWIYTVMRNQCFDMLRRQQVSKEDLVAED
FT                   IWPVLEYQAVEDDKNDPGENEILTRQLAHYLHLLPAAQQEVVRSVYLQDQTLQEIADRL
FT                   QIPLGTIKSRLRLGLAKLREQIEQEHEHD"
FT   gene            532593..533249
FT                   /locus_tag="Tola_0475"
FT   CDS_pept        532593..533249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0475"
FT                   /product="anti-ECFsigma factor, ChrR"
FT                   /note="TIGRFAM: anti-sigma factor, , ChrR family; KEGG:
FT                   aha:AHA_4109 transcriptional activator ChrR"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92104"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012807"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR025979"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9X5"
FT                   /inference="protein motif:TFAM:TIGR02451"
FT                   /protein_id="ACQ92104.1"
FT                   /translation="MINFHPDNALLAAYAADTLPLTMTLAVAIHVEFCPACAQRVAELE
FT                   RKLAENILLAAPVSPADELQFDDMLSYILQQPESAALQPMTEPTIEIQGQVFWLPRALR
FT                   RLARQNWQQMGNIGRSRLLLDEQSTGRASLMYLSAGAAVPRHVHKGMELTLPISGAFRD
FT                   EFGEYIPGDFILRDSQVTHQPQSKEGCLCFALLDAPVQFTQGLPRLLNNFGELLY"
FT   gene            complement(533197..534147)
FT                   /locus_tag="Tola_0476"
FT   CDS_pept        complement(533197..534147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0476"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: saz:Sama_2520 putative transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92105"
FT                   /db_xref="GOA:C4L9X6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037402"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9X6"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACQ92105.1"
FT                   /translation="MKLHQLDLNLLLAFDALMTCRHVTRAAGQLFISQPAMSHALNRLR
FT                   EQFADPLLVKTPQGMQPTARALKLHAGIQQALYLLEQQLEEIEEFDPLSSDRRFVISTT
FT                   DYVECVLIPPLIRRLKEIAPQIQIEIAILRDQLPEAELANGEIDLVLGFDEYMDVPRYL
FT                   CRETWLQEPLAGLVQQDNPLAGEKLDLAQLIALPHVFHSPLGTRESMVDRYLMSHGLQR
FT                   RISANSQSYLSAAAIVSQTDHILVLPKKVASMLAGNWPLRMVALPDDMPCYHLNCVWHP
FT                   AQGEHPSVIWLRQLMLQLLNTATHQNYSVTAANPA"
FT   gene            534302..535186
FT                   /locus_tag="Tola_0477"
FT   CDS_pept        534302..535186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0477"
FT                   /product="N-carbamoylputrescine amidase"
FT                   /note="TIGRFAM: N-carbamoylputrescine amidase; PFAM:
FT                   Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: eca:ECA4274 putative
FT                   carbon-nitrogen hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92106"
FT                   /db_xref="GOA:C4L9X7"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR017755"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9X7"
FT                   /inference="protein motif:TFAM:TIGR03381"
FT                   /protein_id="ACQ92106.1"
FT                   /translation="MALVTVAATQMACTWDIDGNVARAEKLVREAAAKGAQIILIQELF
FT                   QTPYFCIDQSPEHFDLAQTLEESPLIQHFSALAKELDVVLPLSFFERAGNAHYNSLVMI
FT                   DADGEVLDVYRKTHIPNGPAYQEKQFFTPGDTGFIVWETKYANVGVGICWDQWFPETAR
FT                   SLALLGADVIFFPTAIGSEPAYPEIDSQPHWTRVQQGHAAANIIPVIASNRIGTEKSKF
FT                   VEGLEMTFYGSSFIADQTGELVAQADKTSECVLVHTFDLEAIRKQRISWGLFRDRRPAM
FT                   YGTIMTSDGETSW"
FT   gene            535215..536309
FT                   /locus_tag="Tola_0478"
FT   CDS_pept        535215..536309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0478"
FT                   /product="agmatine deiminase"
FT                   /EC_number="3.5.3.12"
FT                   /note="KEGG: aha:AHA_0738 agmatine deiminase; TIGRFAM:
FT                   agmatine deiminase; PFAM: Porphyromonas-type
FT                   peptidyl-arginine deiminase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92107"
FT                   /db_xref="GOA:C4L9X8"
FT                   /db_xref="InterPro:IPR007466"
FT                   /db_xref="InterPro:IPR017754"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9X8"
FT                   /inference="protein motif:TFAM:TIGR03380"
FT                   /protein_id="ACQ92107.1"
FT                   /translation="MTSKTITGLPKQDGFFMPAEWAPQQAVWMIWPFRPDNWREAGKFA
FT                   QATFAKVAAAIAGATPVYMAVPEQFMAQAKAIMPADVTLVVMESDDCWARDTGPTVVIN
FT                   GNGECRGIDWGFNAWGGHHGGLYFPWDKDELVARQMLAVHGFDRYEAPLILEGGSIHVD
FT                   GEGTCMTTAECLLNKNRNPHLSKAQIEDYLRDYLNVSTFIWLEEGVYMDETDGHIDNMC
FT                   CFARPGEVILHWTDDETDPQYARSQAAYKVLSETMDAKGRKLKIWKLPQPGPLYCTEEE
FT                   SAGVVDGSGVPRDAGGRLAGSYVNFLITNDRVVYPLLDPKTDDEAKVILQQIFPQHTVV
FT                   GVPAREILLGGGNIHCITQQIPKG"
FT   gene            complement(536360..539665)
FT                   /locus_tag="Tola_0479"
FT   CDS_pept        complement(536360..539665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0479"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="KEGG: rfr:Rfer_3572 diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC sensor(s); TIGRFAM:
FT                   diguanylate cyclase; PAS sensor protein; PFAM: EAL domain
FT                   protein; PAS fold-3 domain protein; GGDEF domain containing
FT                   protein; PAS fold-4 domain protein; PAS fold domain
FT                   protein; SMART: EAL domain protein; GGDEF domain containing
FT                   protein; PAC repeat-containing protein; PAS domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92108"
FT                   /db_xref="GOA:C4L9X9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9X9"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACQ92108.1"
FT                   /translation="MKKKQNTRLREFASANIVLYYALFAALWIAVSDKLLAWLISDREW
FT                   LTFLSIVKGFLFVTLTSFLLYLLLNLQHRKTTNQKQQTSSRRLYWLFAFQILLMPLIPA
FT                   LLYGIHGQQIRDDSHNTLNTLAKVKAEQVETWLQERLADGLMLQSDQAFSQAVALANAG
FT                   GHAADEAIRNPLELLARNKHYQSLLLLDQQNAPRFIVGHVPVHKTVINAHSHLSLSSHD
FT                   HQAGHGSLKTSWYWDENNRVYLDIQVPLIDTRNDKRIGTLIMSQDLQANLLPLIQNWPG
FT                   ATSTGLIYLLQPHAEWLSYIALPANKADQTQATTRWFTTGSLSLLKQALSDQADIFEGK
FT                   NAEATDVVASYIPVRYSGWHILVQQDRAEIYAPLHNLVYWITLVVFFAGLLVIFVVSLL
FT                   WRQQQYTNQLELQRQTSEKDRLLKHFFELPLFGMAITHGQTGHWIRFNHQLSDLLGYSH
FT                   SEMAEHTLLSLTANEYQEADIAAMYQMTQDLCDGYLCEKQLRRKDGQLIYVNVDTRCVR
FT                   TADRNIAFIISVIEDISSQKENEAILRQSATVFDNTREGIMITDKNAQIIRVNPAFAEL
FT                   FGFSQHELQGKTPVIFKSGKHTHEFYQHIRDSLNTSAFWRGEIWNRRKDNHIIPLICSI
FT                   SAVRNDKQQLTHYVSVYSDISKLKASEAKLAHLAHHDPLTQLPNRTLLTINLSHAIDLA
FT                   VRNHHRIALLMLDLDRFKDVNDSFGHQIGDALLQEVARRLRRRVRISDTICRLGGDEFT
FT                   VLIEGNPALHDVEHFAEDILQLLKDPFSLPNGREVIIGASIGISLYPEHGQTPKELLQQ
FT                   ADAAMYRAKAHGRSCFRYFSDELTRAAEQRLDLEVRLQRALRLNELCLYFQPQIDISSN
FT                   RIIGAEALVRWQDPAHGLISPAQFIPVAEETGLIKQLGEWVLLEACRQGKEWQQKGLPA
FT                   INLAVNISPVQFRNSNILESVFNALKQTGYPASLLELELTESALMTHENEAVEILSALR
FT                   KYGIRLAIDDFGTGYSSLAYLKRFPLDVLKIDKSFVDDIPHKKDDMEIAAAIVAMAHTL
FT                   RLKVLAEGVETEEQLTFLKEQGCDCYQGYLMSPPVPADQFEQLLRAQAEDSEK"
FT   gene            complement(539673..541877)
FT                   /locus_tag="Tola_0480"
FT   CDS_pept        complement(539673..541877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0480"
FT                   /product="primosomal protein N'"
FT                   /note="KEGG: asa:ASA_0128 primosomal protein N'; TIGRFAM:
FT                   primosomal protein N'; PFAM: DEAD/DEAH box helicase domain
FT                   protein; helicase domain protein; type III restriction
FT                   protein res subunit; SMART: DEAD-like helicase ; helicase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92109"
FT                   /db_xref="GOA:C4L9Y0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9Y0"
FT                   /inference="protein motif:TFAM:TIGR00595"
FT                   /protein_id="ACQ92109.1"
FT                   /translation="MPESLTLIQVALPVPLYRRFDYLASQPLPPVGCRVLVPFGRQQLV
FT                   GIVVAHPAESELALSKLKPVSRQLDASALFPPALWKLLLWAADYYHHPLGEVLHHALPV
FT                   LLRQGEAAERKPIACWQLSDHATHDVIATLKRAPRQQQAIQLLQDGPLPAAELREQGVD
FT                   TPVLKQLAAKELIKPFDLHLQAREWLDHLLLHENDAPYLNTEQAAVLAAINHADDKRPF
FT                   LLEGVTGSGKTEIYLQLIKAMLAQGKQVLVLVPEIGLTPQLLRRFRRRFHAPILTLHSG
FT                   MNDRERLDTWLACKAGEAAILIGTRSAIFTPFKTLGLIVVDEEHDSSFKQQEGFRYHGR
FT                   DLAIMRAQREQIPIVLGSATPSLESLHNALQGRYHHLQMTQRAGGAQAAQQHLLDVKHL
FT                   PLQAGMAPQLLQLMDEQLAAGNQVMLFLNRRGYAPALLCHDCGWVAACPHCDAFYTWHQ
FT                   QDRRLHCHHCDDMRPVPHQCPECNSRNLVSSGVGTEQLAQFLEQRFPAYKTIRIDRDNT
FT                   RRKGELEAHLNAIRHQEYQILLGTQMLAKGHHFPHVTLVGILDVDGALFASDFRATERL
FT                   AQLYVQVAGRAGRASKSGMVVLQSHHPEHALLQDLLNNGYHHFARTCLQERQVLALPPF
FT                   TYQAVLRADAPAREPLELFMQQAAQICHHYGAPDLQLLGPLSPVMERRAGRYRMLLMLQ
FT                   CPHRMHLQHYLQQLLPAIDNLPIHHSLRWHLDVDPLEVSG"
FT   gene            542021..542233
FT                   /locus_tag="Tola_0481"
FT   CDS_pept        542021..542233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0481"
FT                   /product="ribosomal protein L31"
FT                   /note="TIGRFAM: ribosomal protein L31; PFAM: ribosomal
FT                   protein L31; KEGG: asu:Asuc_0525 50S ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92110"
FT                   /db_xref="GOA:C4L9Y1"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4L9Y1"
FT                   /inference="protein motif:TFAM:TIGR00105"
FT                   /protein_id="ACQ92110.1"
FT                   /translation="MKEGIHPDYHEITAKCSCGHVFVTRSTGKDLNLDVCSECHPFYTG
FT                   KQKVLDTGGRIDRFKKRFAVLGGKN"
FT   gene            542439..543683
FT                   /locus_tag="Tola_0482"
FT   CDS_pept        542439..543683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0482"
FT                   /product="Malate dehydrogenase
FT                   (oxaloacetate-decarboxylating) (NADP(+))"
FT                   /EC_number="1.1.1.40"
FT                   /note="PFAM: malic protein NAD-binding; malic protein
FT                   domain protein; KEGG: aha:AHA_4195 NADP-dependent malic
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92111"
FT                   /db_xref="GOA:C4L9Y2"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9Y2"
FT                   /inference="protein motif:PRIAM:1.1.1.40"
FT                   /protein_id="ACQ92111.1"
FT                   /translation="MSADLRQAALDYHAQPVPGKIAIALTKPAETADDLSLAYSPGVAE
FT                   PVREIAANPADAYLYTSKANLVAVITNGTAILGLGNLGPLASKPVMEGKALLFKRFAGI
FT                   DAIDIEVTHTDSADFIRTVANIADTFGGINLEDIKAPECFEIEKALIELCDIPVFHDDQ
FT                   HGTAIVTAAGMLNALEIQGKNLSDVRIVCMGAGAAAVACMDLLIVCGAKPENIYMLDRK
FT                   GVIHSARTDINEHKRRFVNDSGLKTLEQVMDGADVFVGVSGPNVITAEHVKSMAPKPVI
FT                   FACSNPDPEIRPELAKTVRDDLIIGTGRSDYPNQVNNVICFPFIFRGALDVRASRINSA
FT                   MKRAAVEAIRSIAKEPVPAEVLLAAGETELTFGVNYVLPKPMDPRLLPRVARAVAIAAE
FT                   DSGVARIPLPDNYML"
FT   gene            complement(543742..544872)
FT                   /locus_tag="Tola_0483"
FT   CDS_pept        complement(543742..544872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0483"
FT                   /product="porin Gram-negative type"
FT                   /note="PFAM: porin Gram-negative type; KEGG: aha:AHA_0463
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92112"
FT                   /db_xref="GOA:C4L9Y3"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9Y3"
FT                   /inference="protein motif:PFAM:PF00267"
FT                   /protein_id="ACQ92112.1"
FT                   /translation="MKKLTAVAIALLVATQANAAEVYKNEKVSLDLNGRAYAGHFFGTK
FT                   EKAGEPGEKSEKIGANQFIRFGAKGDAVVSGTTKAIGVYEAQFNIGNSEKTLNGDKTDT
FT                   VYNTDGDEITVTTSDSNDGNLRTRLAYGGLKDETWGQATFGRQKGAVSLISDWTDKSLT
FT                   DGYGNEALGVATDTYATGRAADVVKYSGVFGSNKEFMLDASYKFDGDTKEETGGNNNDS
FT                   KSADAYGIAAVYNLPMNFSIGTGYNVGKFEKAGESTDAKLWVIGAKYDDKAAYAAVNYA
FT                   QGTDFVGVGKDHTGIEAVAGYDFINGFGLMAMYNNQTVEQSGKDDVDTVKYYTLGAQYK
FT                   FNKNLRVAAEYRINDKDTDASYDYKNDMQLAVRYDF"
FT   sig_peptide     complement(544813..544872)
FT                   /locus_tag="Tola_0483"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT   gene            545106..546113
FT                   /locus_tag="Tola_0484"
FT   CDS_pept        545106..546113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0484"
FT                   /product="fructose-1,6-bisphosphatase, class II"
FT                   /EC_number="3.1.3.11"
FT                   /note="KEGG: aha:AHA_0464 fructose 1,6-bisphosphatase II;
FT                   TIGRFAM: fructose-1,6-bisphosphatase, class II; PFAM: GlpX
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92113"
FT                   /db_xref="GOA:C4L9Y4"
FT                   /db_xref="InterPro:IPR004464"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9Y4"
FT                   /inference="protein motif:TFAM:TIGR00330"
FT                   /protein_id="ACQ92113.1"
FT                   /translation="MRRELAIEFSRVTEAAALAGYKWLGRGDKNLADGAAVEAMRFVLN
FT                   QIEIDGEIVIGEGEIDEAPMLYIGEKVGCGGDGVDIAVDPIDGTRMTAMGQNNAVAVLA
FT                   AGDKGSFLKAPDMYMEKLIVGPKAKGAIDLNRPLSENIIAVARALDKPLHRLSVITLAK
FT                   PRHDAAIKEMQEMGVRVFAIPDGDVAASMLTCLPDNEIDMLYCIGGAPEGVISAATVRA
FT                   LDGDMQGRLLPRHTVKGDTPENRVLGEQEIARCQAMGIDVNTVLTLTDMAKTDNVIVSV
FT                   TGITKGDLLEGITSDGMLATTETLLIRGKSRTIRRIHSTHYLQRKDPQIQKIIF"
FT   gene            complement(546192..546578)
FT                   /locus_tag="Tola_0485"
FT   CDS_pept        complement(546192..546578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0485"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eta:ETA_32730 conserved hypothetical protein
FT                   YhhK"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92114"
FT                   /db_xref="GOA:C4L9Y5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR040448"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9Y5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACQ92114.1"
FT                   /translation="MRLTVHHSHDVLPLWQESLSKLLQTNQLTIDTARTLGDWHLATFN
FT                   DRVVGLAISQGADLRYFAVRDLTRRRGIGRYLLADTLRWLIEQGKQQITMDLSKIDEQE
FT                   LAGLQAFLRQAGFHAEGNQWTLSL"
FT   gene            complement(546670..548136)
FT                   /locus_tag="Tola_0486"
FT   CDS_pept        complement(546670..548136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0486"
FT                   /product="glutamate synthase, NADH/NADPH, small subunit"
FT                   /note="TIGRFAM: glutamate synthase, NADH/NADPH, small
FT                   subunit; PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: tmz:Tmz1t_0843 glutamate synthase,
FT                   NADH/NADPH, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92115"
FT                   /db_xref="GOA:C4L9Y6"
FT                   /db_xref="InterPro:IPR006005"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9Y6"
FT                   /inference="protein motif:TFAM:TIGR01317"
FT                   /protein_id="ACQ92115.1"
FT                   /translation="MGKPTGFLEFDRVKEHYAPVEERVQHYHEFVPTLTVQEASTQGAR
FT                   CMDCGIPFCNNGCPVNNIIPDWNDLVYRGKAEMAIRVLHSTNNFPEFTGRICPAPCESA
FT                   CTLGINADPVGIKSIERYTIDTAWDNNWVKPQPSAVKTGKKVAVVGSGPAGLAAAQQLA
FT                   RVGHDVTVFEKNTRVGGLLRYGIPDFKLDKGLIDRRVTQMEAEGVVFKTSTLVALDNNL
FT                   PAGVTNDAQTVVTPAQLDAEFDAVILAGGSETPRDLPVKGRELSGIHFALEFLIPQNKE
FT                   VAGDGVNPINVKGKHVVVIGGGDTGSDCVGTSNRHGAASVTQLEVMPQPPVQENKELTW
FT                   PYWPLKLRTSSSHEEGCVREFAVSTKEFIGENGKLTGLKLVNVEFKDGKLIEVPGSEFE
FT                   LKADAVFLAMGFTNPLAKVLDAFGVEKDARGNAKATTEDEGCYATSIPKVYAAGDIRRG
FT                   QSLVVWAIREGRQCAREVDQFLMGSSLLPR"
FT   gene            complement(548136..552770)
FT                   /locus_tag="Tola_0487"
FT   CDS_pept        complement(548136..552770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0487"
FT                   /product="Glutamate synthase (ferredoxin)"
FT                   /EC_number="1.4.7.1"
FT                   /note="PFAM: ferredoxin-dependent glutamate synthase;
FT                   glutamate synthase alpha subunit domain protein; glutamate
FT                   synthase; glutamine amidotransferase class-II; KEGG:
FT                   dar:Daro_0217 glutamate synthase (NADH) large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92116"
FT                   /db_xref="GOA:C4L9Y7"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9Y7"
FT                   /inference="protein motif:PRIAM:1.4.7.1"
FT                   /protein_id="ACQ92116.1"
FT                   /translation="MEPAVPQRQGMYDPVNEHDACGVGFVAHMKGQKSHSIVEQGLLIL
FT                   KNLDHRGAVGADPLQGDGAGILIQIPDQLYREELAKQGIALPVTGEYGVGMVFLPQEAA
FT                   SRLACQEEIERAVRGEGQIVLGWRDVPVNRDMPMSPAVRAKEPVIRQIFVARGPDVLVT
FT                   DALERKLYIIRKRASHAIRALKLKHCNEFYVPSFSARTVNYKGLLLADQVGVYYNDLAD
FT                   PRCVSALAMVHQRFSTNTFPTWDLAHPFRMIAHNGEINTVRGNVNWMRARERSVTSPVL
FT                   GADLDKVWPLIYPGQSDSASFDNALELLIMGGYSMAHAVMMMIPEAWEKHSLMDENRRA
FT                   FYEYHAAMMEPWDGPAAVAFTDGRQIGATLDRNGLRPARYLVTKDDLVVMASESGVLPI
FT                   EDSRIAKKWRLQPGKMFLIDLEQGRIIDDKELKDSLANSKPYREWLSKVRINIDEIPGE
FT                   AQPFEKKASLLDYQQAFGYTMEDAKMLLEPMAINGEEAIGSMGNDSALPVLSSKNKTLY
FT                   NYFRQLFAQVTNPPIDPIREEMVMSLVSFIGPRPNLLNNADINPPIRLEVAQPILNAAK
FT                   IEKIRNIQQYTNGKFRSHELNICYPLAWGKEGVEARLASLAAEAEDAVRGGANILLISD
FT                   RNIDRDHIAIPALLATSTVHLHLVKKGLRTNTGLVVETGSARETHQFALLAGYGAEAIH
FT                   PWLAMETMREMANGDAAKEEKYVSNFVKAVGKGLCKVMSKMGISTYMSYTGAQIFEVVG
FT                   LKKAFVDKYFSGTPSKIEGIGLFEVAEETIRMHEAAFSADPVLIDALDAGGEYAFRTRG
FT                   EDHMWTPDAIAKLQHSTRSGKYESYKEYAKIINDQTKRHLTLRGLFDIKKAAEPVPLEE
FT                   VESAKDIVKRFATGAMSLGSISTEAHTTLAVAMNRIGGKSNTGEGGEDANRFIPVSQPT
FT                   LLSEIIGKSRIERDLELQAGDSLRSAIKQVASGRFGVTTEYLVNADQIQIKMAQGAKPG
FT                   EGGQLPGHKVSEYIGFLRHSVPGVGLISPPPHHDIYSIEDLAQLIHDLKNANPSASVSV
FT                   KLVSEVGVGTVAAGVSKAKADHVVIAGHDGGTGASPLSSIKYAGSPWELGLAETQQTLV
FT                   MNRLRGRIRVQVDGQIKTGRDVIIGALLGADEFGFATAPLVVEGCIMMRKCHLNTCPVG
FT                   VATQDPELRKRFSGQPEHVVNYFFFVAEEVRELMAEMGIRKFEDLIGRSDLLDKRAGVE
FT                   HWKAQGLDFSNVFYQPVIGADEPRLHAGTQDHALDKALDQELIKQAMPALENRQPVRIE
FT                   LPVKNINRTVGTMLSGEVAKRFGGAGLPDDTIHVTLNGTAGQSFAAFLAKGITLDLVGE
FT                   GNDYVGKGLSGGRIIVRPNADFTCNPGDNTIIGNTVMYGATSGHAYLCGVGGERFAVRN
FT                   SGATAIVEGVGDHGCEYMTGGTVVVLGQTGRNFAAGMSGGLAYVLDEDNTFATRCNLSM
FT                   VTLEKVLPTAEQSTAEPWHNDQSDEDHLKALISQHAKYTGSPRAKTILADWDAYRGKFV
FT                   KVYPNEYRRALQEMTAAPQEKEIA"
FT   gene            553317..554225
FT                   /locus_tag="Tola_0488"
FT   CDS_pept        553317..554225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0488"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: aha:AHA_1147 DNA-binding transcriptional
FT                   activator GcvA"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92117"
FT                   /db_xref="GOA:C4L9Y8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9Y8"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACQ92117.1"
FT                   /translation="MSRRLPPLNALKAFEAAARHLSFTRAAEELFVTQAAISHQIKTLE
FT                   EFLGLKLFLRRNRSLLLTEEGQGYYQDIRSIFSAVCEATERLIARSAKGTLTVTMQPSF
FT                   AIQWLVPRLMLFSQLHPEIDVRIKAVDQDDGTLVDDVDIAIYYGDGHWPELQLYKLHSE
FT                   YRIPVCAPSLLQGKTLQVPEDLAGFTLLHDGSRRDWGRWLHDTGVSIPNAGQGPIFSHS
FT                   AMVLQAAVLGQGVALGHSLLARPEIRAGRLICPLPQTLVSHNAYYLVMAPGHDTLGKVA
FT                   AFRDWIVALVQQEEAEFDSAL"
FT   gene            554308..555408
FT                   /locus_tag="Tola_0489"
FT   CDS_pept        554308..555408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0489"
FT                   /product="putative RNA 2'-O-ribose methyltransferase"
FT                   /note="KEGG: aha:AHA_1150 putative RNA 2'-O-ribose
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92118"
FT                   /db_xref="GOA:C4L9Y9"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR011224"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040739"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4L9Y9"
FT                   /inference="similar to AA sequence:KEGG:AHA_1150"
FT                   /protein_id="ACQ92118.1"
FT                   /translation="MNHLMFYCRPGFEKDMAAEIQDKAVALECFGFSRVADNCGFVLFE
FT                   CYGEQDAERLARRLPFRELIFARQMLVVIEQLNGLDLKDRITPIVEAVQKMPQFGELRV
FT                   ETADTNEAKELSTFCRKFSVPLRQALRAAGKLTPDVDPRRPVLHLFFLKNDSVWIGYSY
FT                   PNNNSPFHMGIPRLRFPSDAPSRSTLKLEEAFYMFIPPEDDEIRLCSGLTAVDLGASPG
FT                   GWTYQLVRRGMMVSAIDNGPMAESLMESGQVKHIMADGFTYRPTKKNPYWLVCDMVEKP
FT                   ARITHLIAQWFREGCCQEAIFNLKLPMKKRYAEVEHNLAVLKEWLAEIDGEYVIQAKQL
FT                   YHDREEITVHVYDERKLARRRSGAFN"
FT   gene            complement(555475..556257)
FT                   /locus_tag="Tola_0490"
FT   CDS_pept        complement(555475..556257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0490"
FT                   /product="5'-3' exonuclease"
FT                   /note="PFAM: 5'-3' exonuclease; SMART: 5'-3' exonuclease;
FT                   Helix-hairpin-helix domain protein class 2; KEGG:
FT                   aha:AHA_1153 exodeoxyribonuclease IX"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92119"
FT                   /db_xref="GOA:C4L9Z0"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR022895"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR038969"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4L9Z0"
FT                   /inference="protein motif:PFAM:PF02739"
FT                   /protein_id="ACQ92119.1"
FT                   /translation="MAHLLILDALNLIRRIHSVQSKQHPDDVAAQLAATDITMQRAVNT
FT                   ILQEATPSHVIAVFDSEAPGWRKAKYAAYKEGRTAMPDALRQGLGQLQDSLLRLGIDSL
FT                   VSETDEADDLIATLVKPLVANDHQVTLISTDKGFCQLLDSGLQIRDYFNKRWLDHAFVQ
FT                   QQYGLQPSQLVDFWALTGISGMNIKGVPGIGEKTAQQLLSEYGTLTQLLDADATDNKKL
FT                   QLVQQHREVCLLAQELVRLKDDIPLGFNLKDLRYTPPA"
FT   gene            complement(556261..557613)
FT                   /locus_tag="Tola_0491"
FT   CDS_pept        complement(556261..557613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0491"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   asa:ASA_3181 lysine decarboxylase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92120"
FT                   /db_xref="InterPro:IPR021826"
FT                   /db_xref="InterPro:IPR027820"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="InterPro:IPR037153"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9Z1"
FT                   /inference="protein motif:PFAM:PF03641"
FT                   /protein_id="ACQ92120.1"
FT                   /translation="MITYVNPVGSMELLSQLEVDSLQQAAAGEIYQLYRNCSLAVLNSG
FT                   SKTDSSKEILEKYQNFAVNIISRERGVKLELFNAPASAFVDGEIIRGLQEHLFAVLRDV
FT                   LYVSRLEAEIGLNLTSSNHITNLVFSILRNARTVRTGEIPNMVVCWGGHSINDDEYHYA
FT                   REVGYHLGVRELNICTGCGPGAMEGPMKGAAVGHANQRYANHRYVGLSEPSIIAAEPPN
FT                   PIVTELVILPDIEKRLEAFVRLGHGIIIFPGGVGTAEELLYILGILMNPANQHHPLPLV
FT                   LSGPKCSEPYFRSLDAFVRATLGDAAARHYEIIIGDAEAVGQSMKASMEHVRDFRKAIG
FT                   DAYSFNWALHIEPDFQLPFEPTHENMAQLNLHLEQPAEQLACNLRKAFSGIVAGNVKDK
FT                   GIKAIEQHGPFKLSGDKKLMSLIDQLLQDFVSQHRMKLPGSTYVPCYEIQL"
FT   gene            complement(557664..559910)
FT                   /locus_tag="Tola_0492"
FT   CDS_pept        complement(557664..559910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0492"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: asa:ASA_3179
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92121"
FT                   /db_xref="GOA:C4L9Z2"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9Z2"
FT                   /inference="protein motif:PFAM:PF00515"
FT                   /protein_id="ACQ92121.1"
FT                   /translation="MTLLPLVFLLNGLSVPVPEIDPADLSDTLQQAQQIAVSNPEQCIQ
FT                   LTESVQLLQENPLLPGRSIRSNSSGRLRDRVLLRNSRQQIQALIINGSCYALQERYTEA
FT                   LAALDNAEQIANRQHFDDLAGISLYRQIIILGLDLNKPIPAHHAWRRLNVLLQNNDLTN
FT                   SELPVYVGLLNSALAIHRQLPELAREMLSQVRTLLVTRPDPQLAIWAEMLEGDLLHITN
FT                   QDEHSLLSYHETLEQAQKNNQLLLQLQLTTRISQLFAQKQDLANAIIYAEQALELTQQF
FT                   ANESWQADAIIHLAQLKREARDTNLALALLLNASGVYKHSTRPQDLARLHLEIGKTYQQ
FT                   LHRYNEAQTYLTAAYELFQRERLPYYERLSLLSLAELYTQQDNPTQAIVLLEQMLNTPI
FT                   PEQKNLETEMYRLLSIAYENNQQFDQALLNYKLFTNSQHESATTEEPPQSDFFANYTRL
FT                   DQSQRLQELDNEKRRLDRELSWYFKVGISAALLMTILGIALLWHIRKIRRLRQEQQLLR
FT                   QLIDYDAVTNMGTSLLLQKELGKQQTSIWQPDGTAGGHPATTMLLFRASGLTDLECRVG
FT                   LKKAQSILRQVSHAIRQRMPEQCRYYLLSDRLLLCTLPEDTAAQYNEIIVRIENRLGVI
FT                   MRKYGLNERVICGKVQYPFLSKSVNALKPVQTLEVCGIALAGAMQLSEKLGKNVWVELF
FT                   AIDYQQAAFFNGELRTKTIEAITKGLVKVNSSEMQVSIDWNALLLPAQGKTETR"
FT   gene            complement(559987..560838)
FT                   /locus_tag="Tola_0493"
FT   CDS_pept        complement(559987..560838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0493"
FT                   /product="7-cyano-7-deazaguanine reductase"
FT                   /EC_number="1.7.1.13"
FT                   /note="KEGG: aha:AHA_1157 7-cyano-7-deazaguanine reductase;
FT                   TIGRFAM: 7-cyano-7-deazaguanine reductase; PFAM: GTP
FT                   cyclohydrolase I"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92122"
FT                   /db_xref="GOA:C4L9Z3"
FT                   /db_xref="InterPro:IPR016428"
FT                   /db_xref="InterPro:IPR029139"
FT                   /db_xref="InterPro:IPR029500"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4L9Z3"
FT                   /inference="protein motif:TFAM:TIGR03138"
FT                   /protein_id="ACQ92122.1"
FT                   /translation="MSHASPYENNPLLANLTLGQKTDYIAEYSPQLLQPVPRQLNRDAL
FT                   NLAGNLPFHGEDLWTLYEISWLNNKGKPVVAIGEARIDAGSINLIESKSFKLYLNSFNQ
FT                   TRFADLATVRHTLEQDLSKCAEGAIKVALYPLSEAAHHIGTFPGECIDDLDIVIDEYHF
FT                   SSDWLEQAGDNHTIVEETLHSHLLKSNCLVTGQPDWGSVVIHYKGPRINREKMLRYLIS
FT                   FRQHNEFHEQCVERIFVDLQRHCQPEKLTVYARYTRRGGLDINPFRSNWETAPANMRLI
FT                   RQ"
FT   gene            560890..561471
FT                   /locus_tag="Tola_0494"
FT   CDS_pept        560890..561471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0494"
FT                   /product="Syd family protein"
FT                   /note="PFAM: Syd family protein; KEGG: asa:ASA_3177 syd
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92123"
FT                   /db_xref="GOA:C4L9Z4"
FT                   /db_xref="InterPro:IPR009948"
FT                   /db_xref="InterPro:IPR038228"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4L9Z4"
FT                   /inference="protein motif:PFAM:PF07348"
FT                   /protein_id="ACQ92123.1"
FT                   /translation="MADQVICALSDVFARWFAYQQQRGIQVCCPEDELRPSPCRYDAQH
FT                   PERWKPWSRPEMSDLQNIASALECVFHPAIHAYYGHGYAGQITASFKGLAVTLVQPWNE
FT                   EDFERLQQNLVAHVLMLRRLKLPITLFLATVSDESRVISLDNETGEVVLEQLGKKKRWV
FT                   LADSLPAFLQRLSPLAQTAVTPAVPVNLPA"
FT   gene            complement(561437..561751)
FT                   /locus_tag="Tola_0495"
FT   CDS_pept        complement(561437..561751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0495"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: asa:ASA_3175 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92124"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9Z5"
FT                   /inference="similar to AA sequence:KEGG:ASA_3175"
FT                   /protein_id="ACQ92124.1"
FT                   /translation="MDEIFRIANQLAANGQPPSTALVKARLRQPVPMATLITAIQRWKQ
FT                   DPEAYKSLGFPGTADAESSAAPQPASPEDQLEMLQRQVEQLQQQVTMLAKRVSLLEQLG
FT                   "
FT   gene            complement(561785..562210)
FT                   /locus_tag="Tola_0496"
FT   CDS_pept        complement(561785..562210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0496"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pin:Ping_0832 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92125"
FT                   /db_xref="InterPro:IPR021732"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9Z6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACQ92125.1"
FT                   /translation="MTDLLLLFLICLIGAEAWLRRQQSELAERLIRHYCQSADLQLLSV
FT                   ARQSFGIPLFLARITQKANAFVFEFSRDGVSTEEGELYLVGLHQPVFRVNPPKQSHSHS
FT                   NETSGIVVNMPAHDENHDSPPVKSDKNNVIPFPRQRH"
FT   gene            562288..562623
FT                   /locus_tag="Tola_0497"
FT   CDS_pept        562288..562623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0497"
FT                   /product="protein of unknown function DUF446"
FT                   /note="PFAM: protein of unknown function DUF446; KEGG:
FT                   asa:ASA_3171 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92126"
FT                   /db_xref="InterPro:IPR007384"
FT                   /db_xref="InterPro:IPR023376"
FT                   /db_xref="InterPro:IPR036814"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9Z7"
FT                   /inference="protein motif:PFAM:PF04287"
FT                   /protein_id="ACQ92126.1"
FT                   /translation="MSRQVVFLLKELELTLQRLQLWQDEAPSAEALASTQPFALDTLEF
FT                   HQWLQFIFLERLRFMLTDNQPLPSSVAIYPMATEVYKKKLKEHALLLDVLARLDEALSG
FT                   KPADRLQ"
FT   gene            562620..563348
FT                   /locus_tag="Tola_0498"
FT   CDS_pept        562620..563348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0498"
FT                   /product="pseudouridine synthase"
FT                   /note="PFAM: pseudouridine synthase; KEGG: asa:ASA_3170
FT                   tRNA pseudouridine synthase C"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92127"
FT                   /db_xref="GOA:C4L9Z8"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9Z8"
FT                   /inference="protein motif:PFAM:PF00849"
FT                   /protein_id="ACQ92127.1"
FT                   /translation="MKLEILYQDEHLVAINKPAGLLVHRSWLDKGETQFAMQMTRDQIG
FT                   QHVYTVHRLDRPTSGILLFALDPDTARLLTDAFAGHRMQKEYLALVRGWAPLQKFLDYP
FT                   LKEELDRIADKFADQDKPAQPAKTHIRCLGRVELPFAVSPRHPSSRYSLVKLLPLTGRK
FT                   HQLRRHLAHLRHPIVGDTSHGDGRHNRFFRDQFSCDRLMLHHHQLSFRHPHSNELLTIR
FT                   ASLDERWQQQLQAFNWQVQI"
FT   gene            complement(563406..563741)
FT                   /locus_tag="Tola_0499"
FT   CDS_pept        complement(563406..563741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0499"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92128"
FT                   /db_xref="UniProtKB/TrEMBL:C4L9Z9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACQ92128.1"
FT                   /translation="MTHAITNYVGKIVLVKFIPGYVESAQTLIQPNDPDCSEFYVRLAG
FT                   VENAGIWVDNKQWQTQDFFSTPPDIYHAAVLIPWHQIESLVAFPEREFSHNEEPYREKD
FT                   IGFLAAK"
FT   gene            complement(563943..564755)
FT                   /locus_tag="Tola_0500"
FT   CDS_pept        complement(563943..564755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0500"
FT                   /product="formate/nitrite transporter"
FT                   /note="TIGRFAM: formate/nitrite transporter; PFAM:
FT                   formate/nitrite transporter; KEGG: ypy:YPK_0233
FT                   formate/nitrite transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92129"
FT                   /db_xref="GOA:C4LA00"
FT                   /db_xref="InterPro:IPR000292"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="InterPro:IPR024002"
FT                   /db_xref="UniProtKB/TrEMBL:C4LA00"
FT                   /inference="protein motif:TFAM:TIGR00790"
FT                   /protein_id="ACQ92129.1"
FT                   /translation="MYQDTIEKCAAVATRIKNTSANNPLSFWIGSLMAGAYVGLGIILI
FT                   FTLGNLVDPAIRPLVMGATFGIALTLVIIAGAELYTGHTMFLTFGIKTGRLNTIQATGI
FT                   LAQSWTGNLLGSIVVAYLFYLGGGGQILPVDSSLVHKVALAKTTAPALALFAKGILCNW
FT                   LVCLAIWMCQRVDGAAKFIAIWWCLLAFIASGYEHSIANMTLFALSWFGAHTPEYTLGG
FT                   IGYNLLWVTLGNTVSGVLFMGLGYWYATPRAQRPAVATETKAGVHHHA"
FT   gene            complement(564758..565087)
FT                   /locus_tag="Tola_0501"
FT   CDS_pept        complement(564758..565087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0501"
FT                   /product="nitrite reductase (NAD(P)H), small subunit"
FT                   /note="TIGRFAM: nitrite reductase [NAD(P)H], small subunit;
FT                   KEGG: ypm:YP_0162 nitrite reductase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92130"
FT                   /db_xref="GOA:C4LA01"
FT                   /db_xref="InterPro:IPR012748"
FT                   /db_xref="InterPro:IPR017881"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:C4LA01"
FT                   /inference="protein motif:TFAM:TIGR02378"
FT                   /protein_id="ACQ92130.1"
FT                   /translation="MSWTDICAVNDIIPGTGVCALLGQHQVAVFRPYADEQLFALDNID
FT                   PFYQSSVLSRGILAELHGELYITSPLKKQHFRLKDGVCLENADFSIAAYAVRVNNGRIE
FT                   LKEPV"
FT   gene            complement(565084..567633)
FT                   /locus_tag="Tola_0502"
FT   CDS_pept        complement(565084..567633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0502"
FT                   /product="nitrite reductase (NAD(P)H), large subunit"
FT                   /note="TIGRFAM: nitrite reductase [NAD(P)H], large subunit;
FT                   PFAM: nitrite and sulphite reductase 4Fe-4S region;
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; BFD domain protein [2Fe-2S]-binding domain
FT                   protein; nitrite/sulfite reductase hemoprotein
FT                   beta-component ferrodoxin domain protein; KEGG:
FT                   asa:ASA_0196 nitrite reductase (NAD(P)H), large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92131"
FT                   /db_xref="GOA:C4LA02"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR012744"
FT                   /db_xref="InterPro:IPR017121"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041575"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:C4LA02"
FT                   /inference="protein motif:TFAM:TIGR02374"
FT                   /protein_id="ACQ92131.1"
FT                   /translation="MQKHRIIVVGNGMVGHRYLEELVDKADLSQYEVTVFGAEPREAYD
FT                   RVHLSSYFSHHTAAELSLVKPGFYEKHGIKLFLNEAVKRIDRAQKVIETNQGQTLPYDT
FT                   LVLATGSYPWVPNIAGSAHHECFVYRTIEDLKAIREAAKQGKSGVVVGGGLLGLEAAGA
FT                   LKALGLETHVIEFAPVLMAEQLDRQGGEMLRRKIESLGVTVHTSKNTREIAHYQGKQGH
FT                   HQLRFADDSVLDVDLVVFSTGIRPQDTLARYSDLPIAERGGVEINDHCLTADEHIYAIG
FT                   ECAAWHGRFFGLVAPGYKMAQVAVDHLLGNDNAFTGADMSAKLKLLGVEVGSIGDAQGR
FT                   TPESLSYVYQDDAAGIYKKIVVSSDGSKLLGAVLVGDTTDYGNLLQLKLNDMPLPAHPD
FT                   TLILPAHAGAKPTLGVDALPDSAQICSCFDVTKGRIAQAVAAGCHTVAAIKAETKAGTG
FT                   CGGCVPLISQVLNAELSRQGIEVKNHLCEHFAFSRQELFHLVKVGQLKTFEEVLSKHGH
FT                   GYGCEVCKPTVGSILASCWGEYVLKSAHTPLQDTNDTFLGNMQKDGTYSVIPRMPGGEV
FT                   TPEGLMEVAAVARDYKLYTKITGAQRIGLFGAHKDDLPTIWERLIKAGFETGHAYAKSL
FT                   RMVKTCVGSTWCRFGVQDSVGLGVELEHRYKGIRSPHKMKFGVSGCTRECAEAQGKDVG
FT                   IIATDKGWNLYVCGNGGMKPRHADLLAADLDKETLIRYVDRFLMFYVRTADKLQRTASW
FT                   LDNLEGGLDYLKSVIIDDKLGIGAELEQEMDAIRSQYHCEWQETLGDEQQKLRFRHFIN
FT                   SAQPDPLVQFVSERHQHRPAKPEERIPTYNISLEEPV"
FT   gene            complement(567637..568680)
FT                   /locus_tag="Tola_0503"
FT   CDS_pept        complement(567637..568680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0503"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; Oxidoreductase FAD-binding domain protein;
FT                   ferredoxin; KEGG: slo:Shew_1070 oxidoreductase FAD-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92132"
FT                   /db_xref="GOA:C4LA03"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR001834"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:C4LA03"
FT                   /inference="protein motif:PFAM:PF00175"
FT                   /protein_id="ACQ92132.1"
FT                   /translation="MTQSPQVWQQGAQTLCCIERRQETADAVTLVFRPLQALAVSYQPG
FT                   QFLLLTVEIDGQSHSRAYSLSSSPSRSAYLAVTVKRVAGGLVSNWLLDHFHTGDTLSAL
FT                   APTGAFFLPADYSAGKILLCSAGSGITPMMSMAHWLLDNQRETEILFLHSARHAEDIIF
FT                   RDELMALAAKYPQFKLSLILDNTTDAFVCYQGFLNPVLFDQLVPDLSDCHAFMCGPTPY
FT                   MDSLESCLRDRQFPMHNSHKESFTPAVPLNTTTEAESQFRLEVPGFGASSEITNQQTVL
FT                   EALEALQLPIIGACRSGICGSCKCKVVSGSVEDISTQPGPLTEEEQQQGYILACSSRAS
FT                   SDLELEL"
FT   gene            complement(568756..570417)
FT                   /locus_tag="Tola_0504"
FT   CDS_pept        complement(568756..570417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0504"
FT                   /product="hybrid cluster protein"
FT                   /note="TIGRFAM: hybrid cluster protein; PFAM: Prismane;
FT                   KEGG: rpc:RPC_0981 hydroxylamine reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92133"
FT                   /db_xref="GOA:C4LA04"
FT                   /db_xref="InterPro:IPR004137"
FT                   /db_xref="InterPro:IPR010048"
FT                   /db_xref="InterPro:IPR011254"
FT                   /db_xref="InterPro:IPR016099"
FT                   /db_xref="InterPro:IPR016100"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4LA04"
FT                   /inference="protein motif:TFAM:TIGR01703"
FT                   /protein_id="ACQ92133.1"
FT                   /translation="MFCIQCEQTISTPTTKGCSYTMGMCGKTAEVSDLQDVLIYLLQGV
FT                   SDYAVKARSVGIVDQAIDAYVCQALFSTLTNVNFDAARIIAFINEAQQNRDSLKSRYEA
FT                   ACLLAGKAPEAATGPAALILTADKAELLAWAPNAAVNRNYKEIGEDILGLRLLCLYGLK
FT                   GAAAYMEHARVLGQQDDEVGAEFHQIMMFLGTEPTEMQPLIDCAMQIGQMNFKVMALLD
FT                   KGETETFGHPEPTRVNMKPVAGKAILVSGHDLHDLEKILQQTEGKGINVFTNGEMLPAH
FT                   AYPAFKKYPHLVGNYGSAWQNQQKEFAAFPGAVVMTSNCIINPNVGKYADRIYTRSIVG
FT                   WPGVTHIEGDDFSTVIEKALSLDGFPYDEIPHYTMTGFARNALMAAAPAVIDQVKAGNI
FT                   KHFFLIGGCDGDKQERGYYTEMAKAVPQDSLILTLACGKFKFNDLEFGDINGIPRLLDV
FT                   GQCNDAYSAIQLALALAEAFECGVNDLPLSLVLSWFEQKAIVILLTLLSLGVKGIRVGP
FT                   SVPGFLTPNLLNFLNETFDLRPITTVEQDLKDILAA"
FT   gene            complement(570591..571823)
FT                   /locus_tag="Tola_0505"
FT   CDS_pept        complement(570591..571823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0505"
FT                   /product="Peptidase M23"
FT                   /note="PFAM: Peptidase M23; KEGG: aha:AHA_0292 M23B family
FT                   non-peptidase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92134"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:C4LA05"
FT                   /inference="protein motif:PFAM:PF01551"
FT                   /protein_id="ACQ92134.1"
FT                   /translation="MKYNRVGLLVGAFFFSAVIQAEESKNVNSSLSSVREQIQQKQQAI
FT                   QVQKKDLASLQQQLKADEEAIAAANQKLQNSQSQLDKVRSKLQRLEAQRAKLEAQSRQQ
FT                   ERLLAEQFDEAYRMGQHDYLKLLLNQQDPAAVDRTMAYYGYMNQARLKVLKRLDATKAE
FT                   LLENKQETSTSSQELRALIDGQKQDQLTLQQTQQQREKTAQNINESLQSDQQQLTKLQL
FT                   AEKAMLQKIEEQRKRLEAERARKKKEALALARAKAKKEGKSQAAAERKAAAKLAETDLK
FT                   GLGKSGRMSWPVRGTVIRKFGETRTGEVAWKGILIKAGQGAPVKAAGSGDVVFADWLDG
FT                   FGNVLVIDHGRGYLSLYGNNQSLSKQVGQHVNSGEVIASAGNSGNTGATGVYFEIRRAG
FT                   KPVNPVLLLGR"
FT   sig_peptide     complement(571758..571823)
FT                   /locus_tag="Tola_0505"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.989 at
FT                   residue 22"
FT   gene            complement(571857..573395)
FT                   /locus_tag="Tola_0506"
FT   CDS_pept        complement(571857..573395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0506"
FT                   /product="phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent"
FT                   /EC_number="5.4.2.-"
FT                   /note="KEGG: asa:ASA_4104 phosphoglyceromutase; TIGRFAM:
FT                   phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent; PFAM: BPG-independent
FT                   PGAM domain protein; metalloenzyme domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92135"
FT                   /db_xref="GOA:C4LA06"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/TrEMBL:C4LA06"
FT                   /inference="protein motif:TFAM:TIGR01307"
FT                   /protein_id="ACQ92135.1"
FT                   /translation="MSTAKKPLALIIMDGWGYSEKKEGNAVAAANTPNLNALCAKYANT
FT                   LISGSGMDVGLPDGQMGNSEVGHVNIGAGRVVYQELTRVTKEIRDGDFFKNEALCKAVD
FT                   TAVSTGKAVHVMGLMSPGGVHSHEDHIIGMLELAAQRGADKLYFHAFLDGRDVAPRSAQ
FT                   ESIEKFDAAFKKLGKGRIASMVGRYYAMDRDNRWDRVQEAYDLLCEGKSEFANYADATA
FT                   ALAAAYERGENDEFVKASVIGAEAAPLNDGDVLVFMNFRADRAREITRTFVGEGFDGFV
FT                   RNKQPKLADFVMLTEYAADIKTSCAYPPTALTNTLGEWLAKHDKTQLRISETEKYAHVT
FT                   FFFNGGEETSFPGEDRELIASPKVATYDMQPEMSSGELTDKLVAAIKSGKYDVIICNYP
FT                   NGDMVGHTGDFAAAVKACEAVDASVGKVVAALQEVGGECLITADHGNAEQMTNEETGQA
FT                   HTAHTSLPVPLIYVGREATALEGGKLSDLAPTMLTLMGMEVPAEMTGKPLMVLK"
FT   gene            573597..574028
FT                   /locus_tag="Tola_0507"
FT   CDS_pept        573597..574028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0507"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; SMART: Rhodanese
FT                   domain protein; KEGG: aha:AHA_0294 rhodanese
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92136"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C4LA07"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ACQ92136.1"
FT                   /translation="MQEYIDFAMRHELLVLAWVGLATAVIASAVKARLSPVKQIDNQTA
FT                   VALINKQDAVVVDVRTQDEFARGHIAGSHHMPLAQIEQGNTTEIDKHKEKPVIVVCETG
FT                   ARAETAGSKLVKAGFQQVYLLRGGLTQWRSSNLPVTKKR"
FT   gene            574079..574552
FT                   /locus_tag="Tola_0508"
FT   CDS_pept        574079..574552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0508"
FT                   /product="protein-export protein SecB"
FT                   /note="TIGRFAM: protein-export protein SecB; PFAM: protein
FT                   export chaperone SecB; KEGG: aha:AHA_0295 preprotein
FT                   translocase subunit SecB"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92137"
FT                   /db_xref="GOA:C4LA08"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4LA08"
FT                   /inference="protein motif:TFAM:TIGR00809"
FT                   /protein_id="ACQ92137.1"
FT                   /translation="MTEAANSTPAQPEFQIQRIYVKDVSFEAPNTPVVFQKEWQPEIKL
FT                   DMDTQTQVLGQDVYEVALTLTVTCKLGEETAFLCEVKQAGIFTAANLDAQNLAHCLGAF
FT                   CPNILFPYARETVAGLVSRGSFPQLNLAPVNFDALFASHIAQLEAEQAKAGVQ"
FT   gene            574552..575556
FT                   /locus_tag="Tola_0509"
FT   CDS_pept        574552..575556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0509"
FT                   /product="Glycerol-3-phosphate dehydrogenase (NAD(P)(+))"
FT                   /EC_number="1.1.1.94"
FT                   /note="PFAM: NAD-dependent glycerol-3-phosphate
FT                   dehydrogenase domain protein; KEGG: aha:AHA_0296
FT                   glycerol-3-phosphate dehydrogenase [NAD(P)+]
FT                   (NAD(P)H-dependent glycerol-3-phosphate dehydrogenase)"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92138"
FT                   /db_xref="GOA:C4LA09"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4LA09"
FT                   /inference="protein motif:PRIAM:1.1.1.94"
FT                   /protein_id="ACQ92138.1"
FT                   /translation="MDSAVALSVLGAGSYGTALAISLARQGQPVLLWGHDPQQVARLQQ
FT                   DRCNQEFLPDVPFPDSLQMTDDLAYAVSASRDLLVVVPSHVFGEVLLRIKPFMRPDTRV
FT                   AWATKGLEPEHGRLLGDVAKEILGEQIPLAVLSGPTFARELAAGMPTAIAIAGTDEQFT
FT                   SDMSALMHCGKSLRVYTNPDFIGLQIGGAVKNVIAIGAGLSDGLGFGANARTALITRGL
FT                   VELQRLGLSLGADAKTFMGMAGLGDLVLTCTDNQSRNRRFGLALGQGKTVEQAMTEIGQ
FT                   VVEGYRNTKEVHVLAARQNVEMPICEQIYQILYQGKSAQDAALALLGRDQKGE"
FT   sig_peptide     574552..574614
FT                   /locus_tag="Tola_0509"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.837) with cleavage site probability 0.658 at
FT                   residue 21"
FT   gene            complement(575630..576208)
FT                   /locus_tag="Tola_0510"
FT   CDS_pept        complement(575630..576208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0510"
FT                   /product="IscR-regulated protein YhgI"
FT                   /note="TIGRFAM: IscR-regulated protein YhgI; PFAM:
FT                   HesB/YadR/YfhF-family protein; nitrogen-fixing NifU domain
FT                   protein; KEGG: aha:AHA_0297 putative DNA uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92139"
FT                   /db_xref="GOA:C4LA10"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR017726"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4LA10"
FT                   /inference="protein motif:TFAM:TIGR03341"
FT                   /protein_id="ACQ92139.1"
FT                   /translation="MITISESAQAHFRKLLEKQAENTNIRVFVMNPGTPNAECGVSYCP
FT                   PDAVEPEDSRQPFDGFDAIIDPNSAPFLEEAAIDFISDQMGSQLTLKAPNAKMRKVDDN
FT                   ASLAERVEYVLQSQVNPSLAAHGGRVTLTEITDDGVAILQFGGGCNGCSMVDVTLKEGI
FT                   EKQLLELFPGELTGAKDATEHARGEHSFY"
FT   gene            complement(576279..576989)
FT                   /locus_tag="Tola_0511"
FT   CDS_pept        complement(576279..576989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0511"
FT                   /product="ComF family protein"
FT                   /note="KEGG: aha:AHA_0298 ComF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92140"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:C4LA11"
FT                   /inference="similar to AA sequence:KEGG:AHA_0298"
FT                   /protein_id="ACQ92140.1"
FT                   /translation="MFSALYRIFSSALYPACQGICLFCRQPTHQPLLCHHCAEELPLLD
FT                   HHCRLCGSPMAGKEDICGHCLLQPPEWDFLHILADYQFPLTGLIHQLKYQHKTLPAALF
FT                   GRMLAELYPPDEPKPEVILPVPLHWRRQWQRNYNQAQELARPISKRLCIPCDNRLLKRS
FT                   RATKVQAGLSRELRQTNLSNAFIVNPHTYRHVAVLDDVVTTGVTATTLVRLLKESGCQR
FT                   VDVWAICRTQLHDE"
FT   gene            complement(577072..578553)
FT                   /locus_tag="Tola_0512"
FT   CDS_pept        complement(577072..578553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0512"
FT                   /product="ammonium transporter"
FT                   /note="TIGRFAM: ammonium transporter; PFAM: Rh family
FT                   protein/ammonium transporter; KEGG: dar:Daro_0054 ammonium
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92141"
FT                   /db_xref="GOA:C4LA12"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:C4LA12"
FT                   /inference="protein motif:TFAM:TIGR00836"
FT                   /protein_id="ACQ92141.1"
FT                   /translation="MKRLFAILALVGAFGLATPVWSEEATPAPTTSTEVAAPAAEATPV
FT                   AAPAEAAPAPVMTVNKGDNAWLMVSATFVILMSIPGIALFYGGLVRTKNMLSVLIQVLV
FT                   VFSLATILWVSYGYSLAFTEGNAFFGTLDKAFLSGITPDSIAATFNKGIGVSEFIYVAF
FT                   QGAFACITCCLILGAFAERIRFSAVLLFMVFWFTLSYIPMAHMVWYWAGPDAYTDADAA
FT                   AKAGATAGWLFQHGALDFAGGTVVHINAAIAGLVGAYFIGKRVGFGRESMAPHSLTMTM
FT                   IGASLLWFGWFGFNAGSSLEANGIAALALVNTWAATAAATLTWTFAEWALKGKPSMLGA
FT                   ASGAVAGLVAITPAAGFVGVMGGIVIGGLAGVICLWGVHGLKRMLNVDDSLDVFGVHGI
FT                   GGILGAILTGVFASPDLGGTGVWDYVANAVAPDYSIAGQVKIQAIGVITTIIWSGLVSI
FT                   VGYFIIDKLVGLRVPVEAEREGLDLTSHGERAYNN"
FT   sig_peptide     complement(578485..578553)
FT                   /locus_tag="Tola_0512"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            578909..579694
FT                   /locus_tag="Tola_0513"
FT   CDS_pept        578909..579694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0513"
FT                   /product="bioH protein"
FT                   /note="TIGRFAM: bioH protein; PFAM: alpha/beta hydrolase
FT                   fold; KEGG: aha:AHA_0299 putative pimeloyl-BioC--CoA
FT                   transferase BioH"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92142"
FT                   /db_xref="GOA:C4LA13"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR010076"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4LA13"
FT                   /inference="protein motif:TFAM:TIGR01738"
FT                   /protein_id="ACQ92142.1"
FT                   /translation="MNMYIERIGQGPDLVLLHGWGLNGAVWQEIVPLLQPYYRLHLVDL
FT                   PGFGYSRDVIMPDSRLATWSETVLAELPARFDLLGWSMGGLIALRMALDHPSRINRLIL
FT                   TGSSPCFLRQDNWPGIHPDVLSGFNCALQQNPRKTIERFLAIQSMGSESVKEDVKRLKS
FT                   WLQQRPDAAPAALSAGLALLSSVDLRTELSQLRCPVLGIYGRQDSLVPAAAVDPIEKLI
FT                   TGSRSVVFAQAAHAPFISHPQQFSEALRQFLEQNEIQRD"
FT   gene            complement(579785..582088)
FT                   /locus_tag="Tola_0514"
FT   CDS_pept        complement(579785..582088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0514"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="PFAM: RNA binding S1 domain protein; SMART:
FT                   Resolvase RNase H domain protein fold; RNA binding S1
FT                   domain protein; KEGG: aha:AHA_0303 S1 RNA-binding
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92143"
FT                   /db_xref="GOA:C4LA14"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:C4LA14"
FT                   /inference="protein motif:PFAM:PF00575"
FT                   /protein_id="ACQ92143.1"
FT                   /translation="MPSINQIIADELNARNEQVAAAVQLLDDGATVPFIARYRKEATGG
FT                   LDDTQLRYLEQRLSYLREMEDRRQTILSSISEQGKLTDELKADILAADTKTRLEDLYLP
FT                   YKPKRRTKGQIAIEAGLEPLAERLFANPELNPEQEALQYLNPEYQINDSKAALDGARYI
FT                   LMERFAEEAGLLEKLRSYLWHSALLRSQVIEGKQAEGAKFSDYFDHQEPIAKVPSHRTL
FT                   AMLRGRNEGFLALNLQVEQTGDIHPCEQMVASHFELTFRGRPADKWLQSVVNWTWKIKL
FT                   SLQMETELIGRLRDAAETEAIRVFASNLKDLLMAAPAGMKATMGLDPGIRTGVKVAVVD
FT                   ETSKVVAVHTVYPFEPKRQYDQAIEILYALCEQFKVGLISIGNGTASRETDRLVADMLH
FT                   RHPTCKAQKVVVSEAGASVYSASELAALEFPQLDVSLRGAVSIARRLQDPLAELVKIEP
FT                   KAIGVGQYQHDVSQNQLAHNLDTVVEDCVNAVGVDVNTASVPLLTRVSGLSKTLAQNIV
FT                   SYRDENGAFQERRELLKVARLGPKAYEQCAGFLRIRDGKNPLDASSVHPEAYPVVEKII
FT                   RQLHKPVAELIGNSSLLRALKPADYTDDHFGIPTVTDILQELDKPGRDPRPEFKTATFR
FT                   EGVEELKDLKPDMILEGVVTNVTNFGAFVDIGVHQDGLVHISAITNRYISDPREVVKAG
FT                   DIVKVKVLEVDIPRKRIALTMRLDDEASRDKPHHPKEQHEPHRKPAHRHTHDKKPADSG
FT                   NNAFAAAFANAKRK"
FT   gene            complement(582112..582597)
FT                   /locus_tag="Tola_0515"
FT   CDS_pept        complement(582112..582597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0515"
FT                   /product="transcription elongation factor GreB"
FT                   /note="TIGRFAM: transcription elongation factor GreB; PFAM:
FT                   transcription elongation factor GreA/GreB domain protein;
FT                   KEGG: saz:Sama_3509 GreA/GreB family elongation factor"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92144"
FT                   /db_xref="GOA:C4LA15"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006358"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:C4LA15"
FT                   /inference="protein motif:TFAM:TIGR01461"
FT                   /protein_id="ACQ92144.1"
FT                   /translation="MKTNLITRAGWQKLEDELKYLWKVKRPEVTQAVSEAAALGDRSEN
FT                   AEYKEGKRELRSIDRRLRFLTKRLDALKIVEYSPQQEGKVYFGAWVELENDQGDIVHYR
FT                   IVGTDEIDTKNNYITIDSPMARALIGKQVDDEVRVNTPSGEKEWFINKIQYQPFSVK"
FT   gene            582933..583391
FT                   /locus_tag="Tola_0516"
FT   CDS_pept        582933..583391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0516"
FT                   /product="MraZ protein"
FT                   /note="TIGRFAM: MraZ protein; PFAM: protein of unknown
FT                   function UPF0040; KEGG: aha:AHA_3893 MraZ protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92145"
FT                   /db_xref="GOA:C4LA16"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4LA16"
FT                   /inference="protein motif:TFAM:TIGR00242"
FT                   /protein_id="ACQ92145.1"
FT                   /translation="MLRGAHAIALDTKGRLAVPTRYRDWLREECEGQLVCTIDIANPCL
FT                   LLYPLCEWEEIEKKLKSLSGMNPVERRLQRLLLGYASECELDGNGRLLLSAPLRQHAGL
FT                   DKQVMLVGQLNKFEIWSETRWLQQVDEDIQALPEMDWTISDKLRDFSL"
FT   gene            583410..584336
FT                   /locus_tag="Tola_0517"
FT   CDS_pept        583410..584336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0517"
FT                   /product="S-adenosyl-methyltransferase MraW"
FT                   /note="TIGRFAM: S-adenosyl-methyltransferase MraW; PFAM:
FT                   methyltransferase; KEGG: aha:AHA_3892
FT                   S-adenosyl-methyltransferase MraW"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92146"
FT                   /db_xref="GOA:C4LA17"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4LA17"
FT                   /inference="protein motif:TFAM:TIGR00006"
FT                   /protein_id="ACQ92146.1"
FT                   /translation="MEHITVLLQEAVDGLAIRPDGIYVDGTFGRGGHSRLILQQLGPQG
FT                   RLYAIDRDPQAVAVAKEWQDPRFEIISGPFSSLHEYMAERGLLGKVDGLLLDLGVSSPQ
FT                   LDEAERGFSFMNDGPLDMRMDPLHGESAAEWLLHADVDDIAWVLRTYGEERFANRIARA
FT                   IVADRVTTPYTRTRQLAEMIARVVPNKEKHKHPATRSFQALRIHVNQELKEIEETLKAS
FT                   LSVLAPGGRLAVISFHSLEDRIVKQFIRQQEKGIQPPRGLPITEDQIRKTQTLHSVGKA
FT                   IKPADSEVSDNVRSRSSVLRVAERLGG"
FT   gene            584339..584650
FT                   /locus_tag="Tola_0518"
FT   CDS_pept        584339..584650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0518"
FT                   /product="cell division protein FtsL"
FT                   /note="TIGRFAM: cell division protein FtsL; PFAM: cell
FT                   division protein FtsL; KEGG: aha:AHA_3891 cell division
FT                   protein FtsL"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92147"
FT                   /db_xref="GOA:C4LA18"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/TrEMBL:C4LA18"
FT                   /inference="protein motif:TFAM:TIGR02209"
FT                   /protein_id="ACQ92147.1"
FT                   /translation="MERRLNLALLIMLDLKRHLFQGILGLAILGSALTTIVVTDDTRSV
FT                   TAELNKVQSKSDDLEVEWRHLVLEQNALAEHSRVSDIARVKLAMTRPKPLEEKMVSLP"
FT   gene            584647..586407
FT                   /locus_tag="Tola_0519"
FT   CDS_pept        584647..586407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0519"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: penicillin-binding protein transpeptidase;
FT                   Penicillin-binding protein dimerisation domain; KEGG:
FT                   asa:ASA_0392 peptidoglycan synthetase FtsI"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92148"
FT                   /db_xref="GOA:C4LA19"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="InterPro:IPR037532"
FT                   /db_xref="UniProtKB/TrEMBL:C4LA19"
FT                   /inference="protein motif:PRIAM:2.4.1.129"
FT                   /protein_id="ACQ92148.1"
FT                   /translation="MRTNTKKNNKKHDSAVAPWRFMLLLGFILVGFTGLVARTAWIQII
FT                   QPDRLRQEGDMRSLRTTADPSDRGMVTDRNGEQLAVSVPVQAVWADPKEIHAADGLKNT
FT                   AAWMALADVLGLDMRKLTSSVADPKRRFVYLQRQITPAVADYIVKLKLPGVHLRRETRR
FT                   YYPSGEISAHLVGNTNIDGSGIEGVERAFNDWLSSTPSEYKIRKDRQGRVIENIGIVKE
FT                   GKKANDLVLSIDQRLQSIAYRSLKYATEVNKATSGSLVLMDVVTGEVLAMVNTPSYNPN
FT                   NREQYQSFRARNRAVTDTYEPGSTVKPIVAMSALEHGVTSWKEVLDTRPFSIGGKVVTD
FT                   SHRMASGGLFDILKYSSNIGMAHLALRMQPQWITSKFEEFGLGQDSGTGLMGESSGMIP
FT                   LRSRWSKIELATLGFGYGLRVTPLQLTAAYAALANKGIRKPVSVLKVSQSPKGERIIDP
FT                   LIAEQVIHALESVVEEGGTGGKAAVPGYRIAGKTGTAKVATAGGYGKDYVGTFVGFAPV
FT                   SNPRFAMVVIINEPHGTSYYGGSVAGPTFAEVMSSALQLYNVPPDAPQEPKEELNTAQR
FT                   SEVKKSATRS"
FT   sig_peptide     584647..584760
FT                   /locus_tag="Tola_0519"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.498 at
FT                   residue 38"
FT   gene            586391..587860
FT                   /locus_tag="Tola_0520"
FT   CDS_pept        586391..587860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0520"
FT                   /product="UDP-N-acetylmuramyl-tripeptide synthetase"
FT                   /note="TIGRFAM: UDP-N-acetylmuramyl-tripeptide synthetase;
FT                   PFAM: Mur ligase middle domain protein; cytoplasmic
FT                   peptidoglycan synthetase domain protein; KEGG: aha:AHA_3889
FT                   UDP-N-acetylmuramoylalanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92149"
FT                   /db_xref="GOA:C4LA20"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:C4LA20"
FT                   /inference="protein motif:TFAM:TIGR01085"
FT                   /protein_id="ACQ92149.1"
FT                   /translation="MPLALKQLMAGLNIQAPEIALCDMQLDTRLLQPGSLFLALKGHAT
FT                   DGRMFMQQAEQKGAAAILFDNSDGFVPSELSIPCIPVPALAEKVSELAGLFYDSPAQKL
FT                   DLVGVTGTNGKSTCTQLIANWTELFGQRGGVLGTLGNGLFGQLHATENTTGSAISIQQE
FT                   LARFVAEKVDVAAMEVSSHGLVQHRVSALQFAAAVFTNLSRDHLDYHHTMQAYAEAKRL
FT                   IFKQTTPECCILNADDATAREWLLQMPQAVVYGIDQQLPEHPGPFVYATDVKYHPQGIT
FT                   ISIHSSWGDGVLSAPLLGKFNVSNLLAALAVMLVLQYDFETLCQTASRLQPVTGRMECF
FT                   GNQDQPLVVVDYAHTPDGLEKALQAARQHCHGHLFCLFGCGGDRDRGKRPQMAAIAEQW
FT                   ADTLILTDDNPRTEDPAAIIADMCAGLQKPEQAHIEHSRPKAIQLALAQAVPGDIILLA
FT                   GKGHEDYQIIGKEKHHYSDRETVMQLLGVMQ"
FT   gene            587857..589236
FT                   /locus_tag="Tola_0521"
FT   CDS_pept        587857..589236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0521"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate/D-alanyl-D-alanyl ligase"
FT                   /note="TIGRFAM: UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate/D-alanyl-D-alanyl ligase; PFAM: Mur
FT                   ligase middle domain protein; cytoplasmic peptidoglycan
FT                   synthetase domain protein; KEGG: aha:AHA_3888
FT                   UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92150"
FT                   /db_xref="GOA:C4LA21"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:C4LA21"
FT                   /inference="protein motif:TFAM:TIGR01143"
FT                   /protein_id="ACQ92150.1"
FT                   /translation="MIPMSLAQIAQVTDGQLLNCPDATQTVSHISTDTRTVAAGALFLA
FT                   LQGERFDAHQFVAQAVAKGAVAAVVSRPLADVSIPQILVADTRIALGQIAAWVRAQLDL
FT                   QIVAITGSCGKTTLKEMCAAILQQAAPVLATQGNLNNEIGVPQTLLRLTPDDRYAVVEL
FT                   GANHPGEIAWTTSLVKPDVAVINNVAAAHLAGFGSLRGVAVAKTEIFSGLSDSGTAVIN
FT                   ADSEFYDWWREILSVRTFSFGVENPKADFRAENITQDEQGIAAFTLISPLGQIDIQLPI
FT                   PGLHNVSNALAAAAVTTSLGLSLVQVQSGLANMLPVKGRFCVQKLSDDLTLIDDTYNAS
FT                   VQSVMAAIDTLAVMPGYRVLAFGDMGELGADAADLHRQIGEHARLKKLDAVFTVGELSR
FT                   HTAEAAAASGQHFANKDSLYQALQTLMQHQRPMTILAKGARSARMEEVVAFVKSCEEQA
FT                   C"
FT   gene            589230..590312
FT                   /locus_tag="Tola_0522"
FT   CDS_pept        589230..590312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0522"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /EC_number="2.7.8.13"
FT                   /note="KEGG: asa:ASA_0395
FT                   phospho-N-acetylmuramoyl-pentapeptide-transferase; TIGRFAM:
FT                   phospho-N-acetylmuramoyl-pentapeptide-transferase; PFAM:
FT                   glycosyl transferase family 4"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92151"
FT                   /db_xref="GOA:C4LA22"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4LA22"
FT                   /inference="protein motif:TFAM:TIGR00445"
FT                   /protein_id="ACQ92151.1"
FT                   /translation="MLVWLAEWLTPHLSFFHVVSYLTFRAIMSILTGLGFALWIGPRLI
FT                   RRLQLLQIGQVVRNDGPESHFSKAGTPTMGGIMILLSIFLSVILWARLSNPYVWVVLFV
FT                   LVSFGTIGFIDDYRKVIRKNPDGLIARWKYFWQSAAALVVAFFLYATATTDAQTVLVVP
FT                   FFKDIMPQLGLLFILMTYFVIVGASNAVNLTDGLDGLAIMPTVMVAAGFALIAWATGNV
FT                   NFANYLHIPYVANASELMVICTAIIGAGLGFLWFNTYPAQVFMGDVGSLALGAILGIIA
FT                   VLVRQEFLLFIMGGVFVMETMSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIV
FT                   RFWIITLVLVLLGLVTLKLR"
FT   gene            590319..591611
FT                   /locus_tag="Tola_0523"
FT   CDS_pept        590319..591611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0523"
FT                   /product="UDP-N-acetylmuramoylalanine/D-glutamate ligase"
FT                   /note="TIGRFAM: UDP-N-acetylmuramoylalanine/D-glutamate
FT                   ligase; PFAM: Mur ligase middle domain protein; cytoplasmic
FT                   peptidoglycan synthetase domain protein; KEGG: aha:AHA_3886
FT                   UDP-N-acetylmuramoylalanine--D-glutamate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92152"
FT                   /db_xref="GOA:C4LA23"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:C4LA23"
FT                   /inference="protein motif:TFAM:TIGR01087"
FT                   /protein_id="ACQ92152.1"
FT                   /translation="MKQVVIIGLGKTGLSCVTYFRQRGITPLVMDTRENPPGKESLPAD
FT                   CRLITGPLDAEVLCSASLIVASPGIALATPALQAAQMAGVEIVGDIELFAREAKAPVVA
FT                   ITGSNGKSTVTTLVGLMAEQAGFKVGIGGNIGTPALDLLLQPADLYVLELSSFQLETTS
FT                   SLQPAAAVILNLSEDHLDRYDGMAGYLAAKQRIFANAKHIVVNRDDAATLPPQHAYWQS
FT                   FGLNSESYGRVQQDDGLWLSVDGKPVLSVAELNIVGAHNQMNALAAMALADAVGIPQAA
FT                   QLTVLRSFTGLSHRCQFVRDVNGVRWINDSKATNVGSTLAAVAGVGESVQGRLWLLAGG
FT                   QGKGQDFSPLQPLLANQIYRMVCFGQDAGILMELADNTQRVADLDEAVRSVAAEVQPGD
FT                   WVLLAPACASLDQFRNFEQRGQRFADLVNAL"
FT   gene            591632..592786
FT                   /locus_tag="Tola_0524"
FT   CDS_pept        591632..592786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0524"
FT                   /product="cell division protein FtsW"
FT                   /note="TIGRFAM: cell division protein FtsW; PFAM: cell
FT                   cycle protein; KEGG: asa:ASA_0397 cell division protein
FT                   FtsW"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92153"
FT                   /db_xref="GOA:C4LA24"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4LA24"
FT                   /inference="protein motif:TFAM:TIGR02614"
FT                   /protein_id="ACQ92153.1"
FT                   /translation="MAAVWRWFVPERPSFYDRGLLALTFSLMGIGLMMVASASIKEGPG
FT                   GDMFYFTKRHLIFLFVCLGIGVGTLYLPLERWREWSGRLLVGALGLLFAVLAVGRTVNG
FT                   AKRWIGFGFFNIQPAELAKLALIVFIASYLVRRSDEVRGNIAGFVKPLAVVFLLAIMLL
FT                   AQPDLGSVVVLFVCTFGLLFIGGAKLVQFIAIIVAGLSALAGLIIYEPYRLRRVTSFLD
FT                   PWADPFGSGYQLTQSLMAFGRGGFFGQGLGNSVQKLSYLPEAHTDFVFAILGEELGYFG
FT                   VLVVLFLQLLLAMKALQIGRTALLRSKFFEGYMACGIGIWFSFQTVVNVGAAAGMLPTK
FT                   GLTLPLVSYGGSSLIAITMAVAILLRIDFERRLDTSHVIQREAA"
FT   gene            592783..593850
FT                   /locus_tag="Tola_0525"
FT   CDS_pept        592783..593850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0525"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /EC_number="2.4.1.227"
FT                   /note="KEGG: aha:AHA_3884
FT                   undecaprenyldiphospho-muramoylpentapeptide
FT                   beta-N-acetylglucosaminyltransferase; TIGRFAM:
FT                   UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase; PFAM: glycosyl transferase family 28;
FT                   Glycosyltransferase 28 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92154"
FT                   /db_xref="GOA:C4LA25"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4LA25"
FT                   /inference="protein motif:TFAM:TIGR01133"
FT                   /protein_id="ACQ92154.1"
FT                   /translation="MSRTMVIMAGGTGGHVFPGLAVAHRLQADGWNIHWLGTPDRMEAD
FT                   LVPAHGFPIEFINIRGLRNHGLVRKLLAPFQICKAVLQAFMILRRIRPDVVLGMGGYAA
FT                   GPGGVAAKLLGIPVVLHEQNAAAGLTNRLLAKIATRILMGFEGAFPLTERSRVVGNPVR
FT                   DEFLQLAQKPLKKYHTGNPLKILIVGGSLGARPLNQIVPHALAKLNNIDVRHQSGKGNA
FT                   SAVSDLYQSLGVTTVTVTEFITDMAAAYEWADLLICRAGALTVAEVAAAGIPAVFVPLP
FT                   HAVDDHQTRNAESLTRRGAAVLMPQKEMTADKLAELIAQWQVDPRQLQKIAQLSRAAAI
FT                   LDATDRVVSECKALI"
FT   sig_peptide     592783..592854
FT                   /locus_tag="Tola_0525"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.876) with cleavage site probability 0.819 at
FT                   residue 24"
FT   gene            593869..595323
FT                   /locus_tag="Tola_0526"
FT   CDS_pept        593869..595323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0526"
FT                   /product="UDP-N-acetylmuramate/alanine ligase"
FT                   /note="TIGRFAM: UDP-N-acetylmuramate/alanine ligase; PFAM:
FT                   cytoplasmic peptidoglycan synthetase domain protein; Mur
FT                   ligase middle domain protein; KEGG: aha:AHA_3883
FT                   UDP-N-acetylmuramate--alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92155"
FT                   /db_xref="GOA:C4LA26"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4LA26"
FT                   /inference="protein motif:TFAM:TIGR01082"
FT                   /protein_id="ACQ92155.1"
FT                   /translation="MTKVELAKLRTMIPEMRRVRRIHFIGIGGAGMGGIAEVLANEGYQ
FT                   ISGSDIANNRVTEHLASLGAEIQIGHKPENVHGASVVVVSTAIHGDNPEVMAARELRIP
FT                   VVRRAEMLAELMRYRHGIAIAGTHGKTTTTSLIASVYAQAGADPTFVIGGLLNSAGTNA
FT                   RLGTSRYLIAEADESDASFLHLQPMVAIVTNIEADHMDTYGGDFTKLRATFLEFLHNLP
FT                   FYGLAVVCIDDPVIRELLPEIGRATITYGYSEDADVQVQEFVQEGSQSQFRLRLQDGSF
FT                   LPLRLNLPGRHNALNAAATVAVALEDHIPTDAIVDALAQFAGVGRRFQQYGEFDTGAGK
FT                   VLLVDDYGHHPTEVRATLAATRAAWPERRLVLVFQPHRYTRTRDLYDDFAEVLAKVDVL
FT                   IMLDVYAAGEDPIPGADGRSLCRSIRQRGTLDPIFVATPAEVPGVLADVLKDGDVVLTQ
FT                   GAGNVGQLSRKLAELKLSINAMKTAI"
FT   gene            595500..596273
FT                   /locus_tag="Tola_0527"
FT   CDS_pept        595500..596273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0527"
FT                   /product="cell division protein FtsQ"
FT                   /note="PFAM: cell division protein FtsQ;
FT                   Polypeptide-transport-associated domain protein FtsQ-type;
FT                   KEGG: asa:ASA_0400 cell division protein FtsQ"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92156"
FT                   /db_xref="GOA:C4LA27"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026579"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:C4LA27"
FT                   /inference="protein motif:PFAM:PF03799"
FT                   /protein_id="ACQ92156.1"
FT                   /translation="MTETTNRTRGEFIFGLVFFVSVVIGVWSTAADIRRWLFDEDKIPV
FT                   SGLVVQGELEYVKTDEIRQVLAVNPQTNNFFKLDVNQLQKAVEELPWVYQSSVRKRWPA
FT                   LLYVYVVEQTPCALWGDDRLLSIRGAIFKAPRDRLKKPLVQLSGPDDMAGMIWDQYQQF
FT                   ERVLALNGYHVTSVHMTNRHSWEIKLASGLKLILGRNEMLVKLQQFIDVYPQLENREMI
FT                   DYIDLRYDTGVAVSWKQQEGSGDDQNPRQKSDSRT"
FT   gene            596233..597489
FT                   /locus_tag="Tola_0528"
FT   CDS_pept        596233..597489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0528"
FT                   /product="cell division protein FtsA"
FT                   /note="TIGRFAM: cell division protein FtsA; PFAM: cell
FT                   division protein FtsA; KEGG: asa:ASA_0401 cell division
FT                   protein FtsA"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92157"
FT                   /db_xref="GOA:C4LA28"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:C4LA28"
FT                   /inference="protein motif:TFAM:TIGR01174"
FT                   /protein_id="ACQ92157.1"
FT                   /translation="MTKTPDRNLIVGLDIGTTKIAVLVGEVLPDGEVNIVGLGTHAAKG
FT                   MDKGGVNDLESVVKSLQRAVEEAEMMAQCHISSVFLGISGKHIECRNEKGIVPISDEEV
FT                   TQDDVDNVIHTAKSVRLPEEHRVLHVIPQEYSIDYQEGIKNPIGLSGVRMGAKVHLITC
FT                   HNDMARNIEKCVERVGLKVDQIIFSALASSYAVLTDDEKELGVCVVDIGGGTMDIAIFT
FT                   GGALRYSKVIPYAGQAVTSDIAYAFGTPPVDAEAIKMRYGCALGRLVSKEDTIEVPSVG
FT                   GRPARSLQRQTLAEVIEPRYTELLGMVHDEIMRVQSELRSQGIKHQLAAGVVLTGGAAE
FT                   IEGIVECAEQVFQCQVRIGHPTNIRGLTDYVEAPAYATAVGLLQYGKLHQGQTVVDVRE
FT                   KASVTGWFKRVTNWLKGEF"
FT   gene            597530..598690
FT                   /locus_tag="Tola_0529"
FT   CDS_pept        597530..598690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0529"
FT                   /product="cell division protein FtsZ"
FT                   /note="TIGRFAM: cell division protein FtsZ; PFAM:
FT                   Tubulin/FtsZ GTPase; Tubulin/FtsZ domain protein; KEGG:
FT                   asa:ASA_0402 cell division protein FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92158"
FT                   /db_xref="GOA:C4LA29"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:C4LA29"
FT                   /inference="protein motif:TFAM:TIGR00065"
FT                   /protein_id="ACQ92158.1"
FT                   /translation="MFTFEPVGSQGDDALIKVIGVGGGGGNAVEHMLRESIEGVHFVVV
FT                   NTDAQALRNSGAETTIQIGANITKGLGAGANPDVGREAALENRDEIRQMLTGSDMVFIS
FT                   AGMGGGTGTGAAPVIAEVAKELGILTVAVVTKPFNFEGKKRMSYALQGIDELSKHVDSL
FT                   ITIPNDKLLKVLGRGVSLLDAFKAANNVLMGAVQGIAELITRPGLINVDFADVRTVMRE
FT                   MGTAMMGTGSARGDDRAEEAAEKAISSPLLEDIDLAGAKGILVNITAGLDVTMEEFETV
FT                   GNAVKAFASENATVVVGAVIDPSLEDELRVTVVATGIGNERKPDITLVKNAQKAAIERP
FT                   MRPMMHETHAPRYDDRVMQQTVNAEPQPRSEPDYLDIPAFLRKQAD"
FT   gene            598827..599750
FT                   /locus_tag="Tola_0530"
FT   CDS_pept        598827..599750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0530"
FT                   /product="UDP-3-0-acyl N-acetylglucosamine deacetylase"
FT                   /note="TIGRFAM: UDP-3-0-acyl N-acetylglucosamine
FT                   deacetylase; PFAM: UDP-3-0-acyl N-acetylglucosamine
FT                   deacetylase; KEGG: aha:AHA_3879
FT                   UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
FT                   deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92159"
FT                   /db_xref="GOA:C4LA30"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4LA30"
FT                   /inference="protein motif:TFAM:TIGR00325"
FT                   /protein_id="ACQ92159.1"
FT                   /translation="MIRQRTLKQLVHATGVGLHSGRKVSLTFRPAPVNTGIVYVRTDLQ
FT                   PEVELRADAQFVRDTVLCTALVNEQGVRISTVEHLSAALASLGIDNLYVEVDAPEVPVM
FT                   DGSAHPFIYLLQSGGIEEQSLPKQFIRIKKKIRVEDGDKWAEFAPYRRGFRMDLQIDFR
FT                   HPVFDKQNQHLVFDFSGSKFAKEISRARTFGFMKDIEYLHSQNLALGGSLDNAVVLDDY
FT                   RVLNEEGLRYEDEFVKHKLLDAIGDLYMCNHSILGQFTAYKTGHAINNKLLRALLADAE
FT                   AWEMVTFEEEAAKSPIAYFGTKLVLA"
FT   gene            complement(599747..599878)
FT                   /locus_tag="Tola_0531"
FT   CDS_pept        complement(599747..599878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0531"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92160"
FT                   /db_xref="UniProtKB/TrEMBL:C4LA31"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACQ92160.1"
FT                   /translation="MPQLAVGKDYHNQTYESAIVAGRNNKAPGGEPVLCELFSIDQV"
FT   gene            600002..602725
FT                   /locus_tag="Tola_0532"
FT   CDS_pept        600002..602725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0532"
FT                   /product="preprotein translocase, SecA subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecA subunit; PFAM:
FT                   SecA DEAD domain protein; SecA Wing and Scaffold; SecA
FT                   preprotein cross-linking region; SEC-C motif domain
FT                   protein; KEGG: aha:AHA_3877 preprotein translocase, SecA
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92161"
FT                   /db_xref="GOA:C4LA32"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4LA32"
FT                   /inference="protein motif:TFAM:TIGR00963"
FT                   /protein_id="ACQ92161.1"
FT                   /translation="MITKLFTKIIGSRNDRTVKALKKIVKQINELEPQFASLADVDLQA
FT                   KTVEFRQRLEKGEELDSLLPEAFATVREASKRVFAMRHFDVQMMGGIVLNNNQIAEMKT
FT                   GEGKTLTATLPAYLNALTGQGVHIVTVNDYLARRDAEWSRPLFAFLGMTVGCNLSGMSH
FT                   EEKQAAYACDITYGTNNEFGFDYLRDNMAFAAEQRVQRPLYYALVDEVDSVLIDEARTP
FT                   LIISGAAEDSSELYIKINTLVPLLQKQDKEDSEEYQGNGHYTVDEKARQAYLTENGQIF
FT                   VEGWLKQQGLMGEDDSLFSVANITLLHHVNAALRANTLFERDVDYIVKDDEVIIVDEHT
FT                   GRTMAGRRWSEGLHQAIEAKEGAKIRNENQTLASITFQNYFRLYEKLAGMTGTADTEAY
FT                   EFQQIYGLETVVLPTNRPMIRDDMGDLVYLTEQEKYDAIIEDIKIRVAEQRPVLVGTIS
FT                   IENSELLSNILTKEGIEHKVLNAKFHAQEAQIVAQAGRPSAVTIATNMAGRGTDIVLGG
FT                   SWQAEIDALENPTAEQIATIKSEWQVRHDAVITSGGLHIIGTERHESRRIDNQLRGRSG
FT                   RQGDPGSSRFYLSMEDSLMRIFASDRVSGMMKKLGMEHGEAIEHPWVSKAIENAQRKVE
FT                   GRNFDIRKNLLEFDDVANDQRKVVYEQRNELLESADISETIKLIRTDVLDRVIDQYIAP
FT                   HSLDESWDIAGLELRLRTDFAIDLPIAQWIKEDDKLYEEKIRERIISEIEASYAHKEEL
FT                   AGHDVLRQFEKSVMLQTLDNLWKEHLAAMDHLRQGIHLRGYAQKNPKQEYKREAFELFT
FT                   QMLEALKQQVVSVLCRIQVQEPDVDAIEEQRRQSDSAQVRTYSHEEINALAEDEAESVD
FT                   GQAVEPFVRDGAKIGRNDPCPCGSGKKYKHCHGKLD"
FT   gene            602794..603192
FT                   /locus_tag="Tola_0533"
FT   CDS_pept        602794..603192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0533"
FT                   /product="mutator MutT protein"
FT                   /note="TIGRFAM: mutator MutT protein; PFAM: NUDIX
FT                   hydrolase; KEGG: slo:Shew_3444 mutator MutT protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92162"
FT                   /db_xref="GOA:C4LA33"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003561"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:C4LA33"
FT                   /inference="protein motif:TFAM:TIGR00586"
FT                   /protein_id="ACQ92162.1"
FT                   /translation="MKQVWVAVGVIYDPLLGYFICRRATHQHQGGKWEFPGGKVEAGET
FT                   VQQALKRELQEEIGIDVSAAEPLLVIEHTYSDKAVKLDVWLVTAFNGTAQSLEGLENRW
FT                   VQLTELDQLDFPEANLPIIEALKTRAGN"
FT   gene            complement(603189..603407)
FT                   /locus_tag="Tola_0534"
FT   CDS_pept        complement(603189..603407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0534"
FT                   /product="protein of unknown function DUF329"
FT                   /note="PFAM: protein of unknown function DUF329; KEGG:
FT                   ppg:PputGB1_0676 zinc-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92163"
FT                   /db_xref="GOA:C4LA34"
FT                   /db_xref="InterPro:IPR005584"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4LA34"
FT                   /inference="protein motif:PFAM:PF03884"
FT                   /protein_id="ACQ92163.1"
FT                   /translation="MSLKVDCPTCGTPVEWSPLSQFRPFCSDRCRLIDLGEWFSEERSI
FT                   AGEEHTPSSDTARPQLSAEDLALLEQD"
FT   gene            complement(603456..604073)
FT                   /locus_tag="Tola_0535"
FT   CDS_pept        complement(603456..604073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0535"
FT                   /product="dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /note="KEGG: asa:ASA_0410 dephospho-CoA kinase; TIGRFAM:
FT                   dephospho-CoA kinase; PFAM: Dephospho-CoA kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92164"
FT                   /db_xref="GOA:C4LA35"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4LA35"
FT                   /inference="protein motif:TFAM:TIGR00152"
FT                   /protein_id="ACQ92164.1"
FT                   /translation="MFIIGLTGGIGSGKSTIAEHFSALGVPCIDADQTARDVVQPGEPA
FT                   LTAITQHFGPEVIQPDGTLDRRQVREKIFADPAAREWLNNLLHPLIRQRMVQQCQQAQG
FT                   PYCILMVPLLFENHLQSLVHRTLVIDIDEATQIRRTMLRDNTTEEQVKAIIAAQCPRQQ
FT                   RLALADDVIQNGDEVTATQRQQAVYALHQTYLQLAAQHQSHG"
FT   gene            complement(604073..604933)
FT                   /locus_tag="Tola_0536"
FT   CDS_pept        complement(604073..604933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0536"
FT                   /product="Prepilin peptidase"
FT                   /EC_number="3.4.23.43"
FT                   /note="PFAM: peptidase A24A domain protein; peptidase A24A
FT                   prepilin type IV; KEGG: aha:AHA_3871 prepilin peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92165"
FT                   /db_xref="GOA:C4LA36"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="InterPro:IPR010627"
FT                   /db_xref="InterPro:IPR014032"
FT                   /db_xref="UniProtKB/TrEMBL:C4LA36"
FT                   /inference="protein motif:PRIAM:3.4.23.43"
FT                   /protein_id="ACQ92165.1"
FT                   /translation="MLYSQYAWLYFFLLGLFSLLVGSFLNVLIHRLPIMLERSWRQEYQ
FT                   DYFAEGDNPPAQTEPYNLFLPRSACPHCGHQITALENIPLLSWLFLKGRCSSCQHPISA
FT                   RYPLVELLCALASVTVAFYYPPGWALAGALLLTWILLALTFIDFDKLLLPDQLTLPLLW
FT                   VGLLLNLSHQFVPLADAVIGAIAGYMVLWSIYWAFKLLTGKEGMGYGDFKLLAALGAWL
FT                   GWQSLPLILILSSCVGAILGITLVVMRRHQQSKPMPFGPYLAIAGWIALLWGEQLTNWY
FT                   LGLLS"
FT   gene            complement(604963..606219)
FT                   /locus_tag="Tola_0537"
FT   CDS_pept        complement(604963..606219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0537"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   aha:AHA_3870 type 4 fimbrial assembly protein PilC"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92166"
FT                   /db_xref="GOA:C4LA37"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:C4LA37"
FT                   /inference="protein motif:PFAM:PF00482"
FT                   /protein_id="ACQ92166.1"
FT                   /translation="MAVAQQSSAAATANKPKVYHAFVWRGVNRRGQKVSGEMKGETLAQ
FT                   VKADLIRQGVVVQKISKHQESIVTRYTQTIKAMDIAVLTRQIATMLTAGVPLVQTLRLL
FT                   ASSHEKRPMREMLSTICADIETGTPPSKALRQFPRYFDDLYCDLVASGEQSGALDAIFD
FT                   RIAIYREKAEALKSKIKKAMFYPATVIFVALVVSAILLIFVIPEFDKIFKSFGAELPAF
FT                   TRMVITLSNILQSYWYYVFGGLVALIFVYVHSYRRMESVRDATDKFILKLPIVGIILQK
FT                   AALARYARTLSTTFAAGLPLIDGLIAAAGSSGNAVYRHAIMSVRNEVMSGMQMNVAMRT
FT                   TNVFPEMVIQMIMIGEESGSLDDMLSKVAGIYEQQVDDAVDALSSLIEPLLMVVLGVLV
FT                   GGMVIAMYLPIFKLGSVIK"
FT   gene            complement(606238..607944)
FT                   /locus_tag="Tola_0538"
FT   CDS_pept        complement(606238..607944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0538"
FT                   /product="type IV-A pilus assembly ATPase PilB"
FT                   /note="TIGRFAM: type IV-A pilus assembly ATPase PilB; PFAM:
FT                   type II secretion system protein E; General secretory
FT                   system II protein E domain protein; KEGG: aha:AHA_3869 type
FT                   IV-A pilus assembly ATPase PilB"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92167"
FT                   /db_xref="GOA:C4LA38"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR013374"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:C4LA38"
FT                   /inference="protein motif:TFAM:TIGR02538"
FT                   /protein_id="ACQ92167.1"
FT                   /translation="MNASANGLLVSLIRAGLIQDGQSGLLQEKARNEKKTLVTYLIDNN
FT                   IISSSQLAELCELEYGIPLLDLDAFELSEIPQKYLNAKLIEKHHALPIYTQGNTLYIAL
FT                   SDPTNITALEDFGFNFNLHTEALLVDERKLQNAIQRILEPTADAFSKSIADDHIADFDT
FT                   GDMDEARLQESLETNSDDDAPIVKYINKVLLDAVRRGASDLHFEPYEKTYRIRFRIDGI
FT                   LYEIATPPVNLANRFSARLKVMSRLDIAERRLPQDGRIKLRLAKNRSVDLRVSTLPTMW
FT                   GEKVVLRILDSSAASLNIDMLGFDDKQKQLYLDTLAKPQGMILVTGPTGSGKTVSLYTG
FT                   LNILNTSELNISTAEDPIEINLAGINQVQVNPKAGLTFANALRSFLRQDPDVVMVGEIR
FT                   DLETAEIAIKAAQTGHLVLSTLHTNSAAETLTRLLNMGVPAFNVASSVTLIMAQRLARR
FT                   LCPHCKKPHHIPEHELLGMGYTPDEVTAGITLYQPVGCEECSNGYKGRVGIYEMLPMSE
FT                   NIANLIMEGGNSLQIAETAVNEGMVTLYRSGLEKARAGVTSLAEVNRVTCI"
FT   gene            complement(608024..608467)
FT                   /locus_tag="Tola_0539"
FT   CDS_pept        complement(608024..608467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0539"
FT                   /product="prepilin peptidase dependent protein D"
FT                   /note="KEGG: pin:Ping_0478 prepilin peptidase dependent
FT                   protein D"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92168"
FT                   /db_xref="GOA:C4LA39"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:C4LA39"
FT                   /inference="similar to AA sequence:KEGG:Ping_0478"
FT                   /protein_id="ACQ92168.1"
FT                   /translation="MKKQSGFTLIELMIVVAIIAILAAIALPAYQNYTREARYSELVTA
FT                   ADGLKTSMTVCYAKNGDLADCDTLGELGLPDFALTDNMLATTAPIGTIAANGTAIKITL
FT                   NGTPATGSKSCIVDGTLDNTTGKITWDFATGCEYDAAADVPAA"
FT   sig_peptide     complement(608372..608467)
FT                   /locus_tag="Tola_0539"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.924) with cleavage site probability 0.481 at
FT                   residue 32"
FT   gene            complement(608764..610050)
FT                   /locus_tag="Tola_0540"
FT   CDS_pept        complement(608764..610050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0540"
FT                   /product="phosphoribosylamine/glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="KEGG: aha:AHA_0840 phosphoribosylamine--glycine
FT                   ligase; TIGRFAM: phosphoribosylamine/glycine ligase; PFAM:
FT                   phosphoribosylglycinamide synthetase; protein of unknown
FT                   function DUF201"
FT                   /db_xref="EnsemblGenomes-Gn:Tola_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ92169"
FT                   /db_xref="GOA:C4LA40"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:C4LA40"
FT                   /inference="protein motif:TFAM:TIGR00877"
FT                   /protein_id="ACQ92169.1"
FT                   /translation="MNVLIIGNGGREHALAWKAAQSPLADKVFVAPGNTGSAREAKVEN
FT                   VNISATDVPALLAFAKQQNIGLTIVGPEAPLVIGVVDAFRAAGLKIFGPTEAAAQLEGS
FT                   KAFTKDFLARHNIPTADYQNFTEIEPALAYLKEKGAPIVIKADGLAAGKGVIVAMTLEE
FT                   AEEAVRDMLSGNAFGDAGSRVVIEEFLDGEEASFIVMVDGKNVLPMATSQDHKRIGDGD
FT                   TGPNTGGMGAYSPAPVVTQEVHDKVMQLVIWPTVQGMAAEGNPYTGFLYAGLMIDPQGN
FT                   PKVIEFNCRFGDPETQPIMLRMRSDLVELCLAACAGELDQKTADYDPRPAVGIVLAAAG
FT                   YPAEVQKGDVISGLPTSEPDTAKVFHAGTAEQDGNIITAGGRVLCATALGATVAEAQKN
FT                   AYALAETISWNGIYYRKDIAWRAIAREQK"
FT   gene            complement(610414..612006)
FT                   /locus_tag="Tola_0541"
FT   CDS_pept        complement(610414..612006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tola_0541"
FT                   /product="phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydr