(data stored in ACNUC7421 zone)

EMBL: CP001617

ID   CP001617; SV 1; circular; genomic DNA; STD; PRO; 3197759 BP.
XX
AC   CP001617;
XX
PR   Project:PRJNA32969;
XX
DT   19-JUL-2009 (Rel. 101, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Lactobacillus plantarum JDM1, complete genome.
XX
KW   .
XX
OS   Lactobacillus plantarum JDM1
OC   Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae;
OC   Lactobacillus.
XX
RN   [1]
RP   1-3197759
RX   DOI; 10.1128/JB.00587-09.
RX   PUBMED; 19465650.
RA   Zhang Z.Y., Liu C., Zhu Y.Z., Zhong Y., Zhu Y.Q., Zheng H.J., Zhao G.P.,
RA   Wang S.Y., Guo X.K.;
RT   "Complete genome sequence of Lactobacillus plantarum JDM1";
RL   J. Bacteriol. 191(15):5020-5021(2009).
XX
RN   [2]
RP   1-3197759
RA   Zhang Z., Liu C., Zhu Y., Zhong Y., Zhu Y., Zheng H., Zhao G.-P.,
RA   Wang S.-Y., Guo X.;
RT   ;
RL   Submitted (24-APR-2009) to the INSDC.
RL   Department of Medical Microbiology and Parasitology, Institutes of Medical
RL   Sciences, Shanghai Jiao Tong University School of Medicine, South Chongqing
RL   Road No.280 5#509, Shanghai, Shanghai 200025, China
XX
DR   MD5; 29dd1a86ef05735e2e6e7ab898001f59.
DR   BioSample; SAMN02603864.
DR   EnsemblGenomes-Gn; EBG00001463296.
DR   EnsemblGenomes-Gn; EBG00001463297.
DR   EnsemblGenomes-Gn; EBG00001463298.
DR   EnsemblGenomes-Gn; EBG00001463299.
DR   EnsemblGenomes-Gn; EBG00001463300.
DR   EnsemblGenomes-Gn; EBG00001463301.
DR   EnsemblGenomes-Gn; EBG00001463302.
DR   EnsemblGenomes-Gn; EBG00001463303.
DR   EnsemblGenomes-Gn; EBG00001463304.
DR   EnsemblGenomes-Gn; EBG00001463305.
DR   EnsemblGenomes-Gn; EBG00001463306.
DR   EnsemblGenomes-Gn; EBG00001463307.
DR   EnsemblGenomes-Gn; EBG00001463308.
DR   EnsemblGenomes-Gn; EBG00001463309.
DR   EnsemblGenomes-Gn; EBG00001463310.
DR   EnsemblGenomes-Gn; EBG00001463311.
DR   EnsemblGenomes-Gn; EBG00001463312.
DR   EnsemblGenomes-Gn; EBG00001463313.
DR   EnsemblGenomes-Gn; EBG00001463314.
DR   EnsemblGenomes-Gn; EBG00001463315.
DR   EnsemblGenomes-Gn; EBG00001463316.
DR   EnsemblGenomes-Gn; EBG00001463317.
DR   EnsemblGenomes-Gn; EBG00001463318.
DR   EnsemblGenomes-Gn; EBG00001463319.
DR   EnsemblGenomes-Gn; EBG00001463320.
DR   EnsemblGenomes-Gn; EBG00001463321.
DR   EnsemblGenomes-Gn; EBG00001463322.
DR   EnsemblGenomes-Gn; EBG00001463323.
DR   EnsemblGenomes-Gn; EBG00001463324.
DR   EnsemblGenomes-Gn; EBG00001463325.
DR   EnsemblGenomes-Gn; EBG00001463326.
DR   EnsemblGenomes-Gn; EBG00001463327.
DR   EnsemblGenomes-Gn; EBG00001463328.
DR   EnsemblGenomes-Gn; EBG00001463329.
DR   EnsemblGenomes-Gn; EBG00001463330.
DR   EnsemblGenomes-Gn; EBG00001463331.
DR   EnsemblGenomes-Gn; EBG00001463332.
DR   EnsemblGenomes-Gn; EBG00001463333.
DR   EnsemblGenomes-Gn; EBG00001463334.
DR   EnsemblGenomes-Gn; EBG00001463335.
DR   EnsemblGenomes-Gn; EBG00001463336.
DR   EnsemblGenomes-Gn; EBG00001463337.
DR   EnsemblGenomes-Gn; EBG00001463338.
DR   EnsemblGenomes-Gn; EBG00001463339.
DR   EnsemblGenomes-Gn; EBG00001463340.
DR   EnsemblGenomes-Gn; EBG00001463341.
DR   EnsemblGenomes-Gn; EBG00001463342.
DR   EnsemblGenomes-Gn; EBG00001463343.
DR   EnsemblGenomes-Gn; EBG00001463344.
DR   EnsemblGenomes-Gn; EBG00001463345.
DR   EnsemblGenomes-Gn; EBG00001463346.
DR   EnsemblGenomes-Gn; EBG00001463347.
DR   EnsemblGenomes-Gn; EBG00001463348.
DR   EnsemblGenomes-Gn; EBG00001463349.
DR   EnsemblGenomes-Gn; EBG00001463350.
DR   EnsemblGenomes-Gn; EBG00001463351.
DR   EnsemblGenomes-Gn; EBG00001463352.
DR   EnsemblGenomes-Gn; EBG00001463353.
DR   EnsemblGenomes-Gn; EBG00001463354.
DR   EnsemblGenomes-Gn; EBG00001463355.
DR   EnsemblGenomes-Gn; EBG00001463356.
DR   EnsemblGenomes-Gn; EBG00001463357.
DR   EnsemblGenomes-Gn; EBG00001463358.
DR   EnsemblGenomes-Gn; EBG00001463359.
DR   EnsemblGenomes-Gn; EBG00001463360.
DR   EnsemblGenomes-Gn; EBG00001463361.
DR   EnsemblGenomes-Gn; EBG00001463362.
DR   EnsemblGenomes-Gn; EBG00001463363.
DR   EnsemblGenomes-Gn; EBG00001463364.
DR   EnsemblGenomes-Gn; EBG00001463365.
DR   EnsemblGenomes-Gn; EBG00001463366.
DR   EnsemblGenomes-Gn; EBG00001463367.
DR   EnsemblGenomes-Gn; EBG00001463368.
DR   EnsemblGenomes-Gn; EBG00001463369.
DR   EnsemblGenomes-Gn; EBG00001463370.
DR   EnsemblGenomes-Gn; EBG00001463371.
DR   EnsemblGenomes-Gn; EBG00001463372.
DR   EnsemblGenomes-Gn; EBG00001463373.
DR   EnsemblGenomes-Gn; EBG00001463374.
DR   EnsemblGenomes-Gn; EBG00001463375.
DR   EnsemblGenomes-Gn; EBG00001463376.
DR   EnsemblGenomes-Gn; EBG00001463377.
DR   EnsemblGenomes-Gn; EBG00001463378.
DR   EnsemblGenomes-Gn; EBG00001463379.
DR   EnsemblGenomes-Gn; EBG00001463380.
DR   EnsemblGenomes-Gn; EBG00001463381.
DR   EnsemblGenomes-Gn; EBG00001463382.
DR   EnsemblGenomes-Gn; JDM1_rRNA01.
DR   EnsemblGenomes-Gn; JDM1_rRNA02.
DR   EnsemblGenomes-Gn; JDM1_rRNA03.
DR   EnsemblGenomes-Gn; JDM1_rRNA04.
DR   EnsemblGenomes-Gn; JDM1_rRNA05.
DR   EnsemblGenomes-Gn; JDM1_rRNA06.
DR   EnsemblGenomes-Gn; JDM1_rRNA07.
DR   EnsemblGenomes-Gn; JDM1_rRNA08.
DR   EnsemblGenomes-Gn; JDM1_rRNA09.
DR   EnsemblGenomes-Gn; JDM1_rRNA10.
DR   EnsemblGenomes-Gn; JDM1_rRNA11.
DR   EnsemblGenomes-Gn; JDM1_rRNA12.
DR   EnsemblGenomes-Gn; JDM1_rRNA13.
DR   EnsemblGenomes-Gn; JDM1_rRNA14.
DR   EnsemblGenomes-Gn; JDM1_rRNA15.
DR   EnsemblGenomes-Gn; JDM1_rRNA16.
DR   EnsemblGenomes-Gn; JDM1_tRNA01.
DR   EnsemblGenomes-Gn; JDM1_tRNA02.
DR   EnsemblGenomes-Gn; JDM1_tRNA03.
DR   EnsemblGenomes-Gn; JDM1_tRNA04.
DR   EnsemblGenomes-Gn; JDM1_tRNA05.
DR   EnsemblGenomes-Gn; JDM1_tRNA06.
DR   EnsemblGenomes-Gn; JDM1_tRNA07.
DR   EnsemblGenomes-Gn; JDM1_tRNA08.
DR   EnsemblGenomes-Gn; JDM1_tRNA09.
DR   EnsemblGenomes-Gn; JDM1_tRNA10.
DR   EnsemblGenomes-Gn; JDM1_tRNA11.
DR   EnsemblGenomes-Gn; JDM1_tRNA12.
DR   EnsemblGenomes-Gn; JDM1_tRNA13.
DR   EnsemblGenomes-Gn; JDM1_tRNA14.
DR   EnsemblGenomes-Gn; JDM1_tRNA15.
DR   EnsemblGenomes-Gn; JDM1_tRNA16.
DR   EnsemblGenomes-Gn; JDM1_tRNA17.
DR   EnsemblGenomes-Gn; JDM1_tRNA18.
DR   EnsemblGenomes-Gn; JDM1_tRNA19.
DR   EnsemblGenomes-Gn; JDM1_tRNA20.
DR   EnsemblGenomes-Gn; JDM1_tRNA21.
DR   EnsemblGenomes-Gn; JDM1_tRNA22.
DR   EnsemblGenomes-Gn; JDM1_tRNA23.
DR   EnsemblGenomes-Gn; JDM1_tRNA24.
DR   EnsemblGenomes-Gn; JDM1_tRNA25.
DR   EnsemblGenomes-Gn; JDM1_tRNA26.
DR   EnsemblGenomes-Gn; JDM1_tRNA27.
DR   EnsemblGenomes-Gn; JDM1_tRNA28.
DR   EnsemblGenomes-Gn; JDM1_tRNA29.
DR   EnsemblGenomes-Gn; JDM1_tRNA30.
DR   EnsemblGenomes-Gn; JDM1_tRNA31.
DR   EnsemblGenomes-Gn; JDM1_tRNA32.
DR   EnsemblGenomes-Gn; JDM1_tRNA33.
DR   EnsemblGenomes-Gn; JDM1_tRNA34.
DR   EnsemblGenomes-Gn; JDM1_tRNA35.
DR   EnsemblGenomes-Gn; JDM1_tRNA36.
DR   EnsemblGenomes-Gn; JDM1_tRNA37.
DR   EnsemblGenomes-Gn; JDM1_tRNA38.
DR   EnsemblGenomes-Gn; JDM1_tRNA39.
DR   EnsemblGenomes-Gn; JDM1_tRNA40.
DR   EnsemblGenomes-Gn; JDM1_tRNA41.
DR   EnsemblGenomes-Gn; JDM1_tRNA42.
DR   EnsemblGenomes-Gn; JDM1_tRNA43.
DR   EnsemblGenomes-Gn; JDM1_tRNA44.
DR   EnsemblGenomes-Gn; JDM1_tRNA45.
DR   EnsemblGenomes-Gn; JDM1_tRNA46.
DR   EnsemblGenomes-Gn; JDM1_tRNA47.
DR   EnsemblGenomes-Gn; JDM1_tRNA48.
DR   EnsemblGenomes-Gn; JDM1_tRNA49.
DR   EnsemblGenomes-Gn; JDM1_tRNA50.
DR   EnsemblGenomes-Gn; JDM1_tRNA51.
DR   EnsemblGenomes-Gn; JDM1_tRNA52.
DR   EnsemblGenomes-Gn; JDM1_tRNA53.
DR   EnsemblGenomes-Gn; JDM1_tRNA54.
DR   EnsemblGenomes-Gn; JDM1_tRNA55.
DR   EnsemblGenomes-Gn; JDM1_tRNA56.
DR   EnsemblGenomes-Gn; JDM1_tRNA57.
DR   EnsemblGenomes-Gn; JDM1_tRNA58.
DR   EnsemblGenomes-Gn; JDM1_tRNA59.
DR   EnsemblGenomes-Gn; JDM1_tRNA60.
DR   EnsemblGenomes-Gn; JDM1_tRNA61.
DR   EnsemblGenomes-Gn; JDM1_tRNA62.
DR   EnsemblGenomes-Tr; EBT00001617172.
DR   EnsemblGenomes-Tr; EBT00001617173.
DR   EnsemblGenomes-Tr; EBT00001617174.
DR   EnsemblGenomes-Tr; EBT00001617175.
DR   EnsemblGenomes-Tr; EBT00001617176.
DR   EnsemblGenomes-Tr; EBT00001617177.
DR   EnsemblGenomes-Tr; EBT00001617178.
DR   EnsemblGenomes-Tr; EBT00001617179.
DR   EnsemblGenomes-Tr; EBT00001617180.
DR   EnsemblGenomes-Tr; EBT00001617181.
DR   EnsemblGenomes-Tr; EBT00001617182.
DR   EnsemblGenomes-Tr; EBT00001617183.
DR   EnsemblGenomes-Tr; EBT00001617184.
DR   EnsemblGenomes-Tr; EBT00001617185.
DR   EnsemblGenomes-Tr; EBT00001617186.
DR   EnsemblGenomes-Tr; EBT00001617187.
DR   EnsemblGenomes-Tr; EBT00001617188.
DR   EnsemblGenomes-Tr; EBT00001617189.
DR   EnsemblGenomes-Tr; EBT00001617190.
DR   EnsemblGenomes-Tr; EBT00001617191.
DR   EnsemblGenomes-Tr; EBT00001617192.
DR   EnsemblGenomes-Tr; EBT00001617193.
DR   EnsemblGenomes-Tr; EBT00001617194.
DR   EnsemblGenomes-Tr; EBT00001617195.
DR   EnsemblGenomes-Tr; EBT00001617196.
DR   EnsemblGenomes-Tr; EBT00001617197.
DR   EnsemblGenomes-Tr; EBT00001617198.
DR   EnsemblGenomes-Tr; EBT00001617199.
DR   EnsemblGenomes-Tr; EBT00001617200.
DR   EnsemblGenomes-Tr; EBT00001617201.
DR   EnsemblGenomes-Tr; EBT00001617202.
DR   EnsemblGenomes-Tr; EBT00001617203.
DR   EnsemblGenomes-Tr; EBT00001617204.
DR   EnsemblGenomes-Tr; EBT00001617205.
DR   EnsemblGenomes-Tr; EBT00001617206.
DR   EnsemblGenomes-Tr; EBT00001617207.
DR   EnsemblGenomes-Tr; EBT00001617208.
DR   EnsemblGenomes-Tr; EBT00001617209.
DR   EnsemblGenomes-Tr; EBT00001617210.
DR   EnsemblGenomes-Tr; EBT00001617211.
DR   EnsemblGenomes-Tr; EBT00001617212.
DR   EnsemblGenomes-Tr; EBT00001617213.
DR   EnsemblGenomes-Tr; EBT00001617214.
DR   EnsemblGenomes-Tr; EBT00001617215.
DR   EnsemblGenomes-Tr; EBT00001617216.
DR   EnsemblGenomes-Tr; EBT00001617217.
DR   EnsemblGenomes-Tr; EBT00001617218.
DR   EnsemblGenomes-Tr; EBT00001617219.
DR   EnsemblGenomes-Tr; EBT00001617220.
DR   EnsemblGenomes-Tr; EBT00001617221.
DR   EnsemblGenomes-Tr; EBT00001617222.
DR   EnsemblGenomes-Tr; EBT00001617223.
DR   EnsemblGenomes-Tr; EBT00001617224.
DR   EnsemblGenomes-Tr; EBT00001617225.
DR   EnsemblGenomes-Tr; EBT00001617226.
DR   EnsemblGenomes-Tr; EBT00001617227.
DR   EnsemblGenomes-Tr; EBT00001617228.
DR   EnsemblGenomes-Tr; EBT00001617229.
DR   EnsemblGenomes-Tr; EBT00001617230.
DR   EnsemblGenomes-Tr; EBT00001617231.
DR   EnsemblGenomes-Tr; EBT00001617232.
DR   EnsemblGenomes-Tr; EBT00001617233.
DR   EnsemblGenomes-Tr; EBT00001617234.
DR   EnsemblGenomes-Tr; EBT00001617235.
DR   EnsemblGenomes-Tr; EBT00001617236.
DR   EnsemblGenomes-Tr; EBT00001617237.
DR   EnsemblGenomes-Tr; EBT00001617238.
DR   EnsemblGenomes-Tr; EBT00001617239.
DR   EnsemblGenomes-Tr; EBT00001617240.
DR   EnsemblGenomes-Tr; EBT00001617241.
DR   EnsemblGenomes-Tr; EBT00001617242.
DR   EnsemblGenomes-Tr; EBT00001617243.
DR   EnsemblGenomes-Tr; EBT00001617244.
DR   EnsemblGenomes-Tr; EBT00001617245.
DR   EnsemblGenomes-Tr; EBT00001617246.
DR   EnsemblGenomes-Tr; EBT00001617247.
DR   EnsemblGenomes-Tr; EBT00001617248.
DR   EnsemblGenomes-Tr; EBT00001617249.
DR   EnsemblGenomes-Tr; EBT00001617250.
DR   EnsemblGenomes-Tr; EBT00001617251.
DR   EnsemblGenomes-Tr; EBT00001617252.
DR   EnsemblGenomes-Tr; EBT00001617253.
DR   EnsemblGenomes-Tr; EBT00001617254.
DR   EnsemblGenomes-Tr; EBT00001617255.
DR   EnsemblGenomes-Tr; EBT00001617256.
DR   EnsemblGenomes-Tr; EBT00001617257.
DR   EnsemblGenomes-Tr; EBT00001617258.
DR   EnsemblGenomes-Tr; JDM1_rRNA01-1.
DR   EnsemblGenomes-Tr; JDM1_rRNA02-1.
DR   EnsemblGenomes-Tr; JDM1_rRNA03-1.
DR   EnsemblGenomes-Tr; JDM1_rRNA04-1.
DR   EnsemblGenomes-Tr; JDM1_rRNA05-1.
DR   EnsemblGenomes-Tr; JDM1_rRNA06-1.
DR   EnsemblGenomes-Tr; JDM1_rRNA07-1.
DR   EnsemblGenomes-Tr; JDM1_rRNA08-1.
DR   EnsemblGenomes-Tr; JDM1_rRNA09-1.
DR   EnsemblGenomes-Tr; JDM1_rRNA10-1.
DR   EnsemblGenomes-Tr; JDM1_rRNA11-1.
DR   EnsemblGenomes-Tr; JDM1_rRNA12-1.
DR   EnsemblGenomes-Tr; JDM1_rRNA13-1.
DR   EnsemblGenomes-Tr; JDM1_rRNA14-1.
DR   EnsemblGenomes-Tr; JDM1_rRNA15-1.
DR   EnsemblGenomes-Tr; JDM1_rRNA16-1.
DR   EnsemblGenomes-Tr; JDM1_tRNA01-1.
DR   EnsemblGenomes-Tr; JDM1_tRNA02-1.
DR   EnsemblGenomes-Tr; JDM1_tRNA03-1.
DR   EnsemblGenomes-Tr; JDM1_tRNA04-1.
DR   EnsemblGenomes-Tr; JDM1_tRNA05-1.
DR   EnsemblGenomes-Tr; JDM1_tRNA06-1.
DR   EnsemblGenomes-Tr; JDM1_tRNA07-1.
DR   EnsemblGenomes-Tr; JDM1_tRNA08-1.
DR   EnsemblGenomes-Tr; JDM1_tRNA09-1.
DR   EnsemblGenomes-Tr; JDM1_tRNA10-1.
DR   EnsemblGenomes-Tr; JDM1_tRNA11-1.
DR   EnsemblGenomes-Tr; JDM1_tRNA12-1.
DR   EnsemblGenomes-Tr; JDM1_tRNA13-1.
DR   EnsemblGenomes-Tr; JDM1_tRNA14-1.
DR   EnsemblGenomes-Tr; JDM1_tRNA15-1.
DR   EnsemblGenomes-Tr; JDM1_tRNA16-1.
DR   EnsemblGenomes-Tr; JDM1_tRNA17-1.
DR   EnsemblGenomes-Tr; JDM1_tRNA18-1.
DR   EnsemblGenomes-Tr; JDM1_tRNA19-1.
DR   EnsemblGenomes-Tr; JDM1_tRNA20-1.
DR   EnsemblGenomes-Tr; JDM1_tRNA21-1.
DR   EnsemblGenomes-Tr; JDM1_tRNA22-1.
DR   EnsemblGenomes-Tr; JDM1_tRNA23-1.
DR   EnsemblGenomes-Tr; JDM1_tRNA24-1.
DR   EnsemblGenomes-Tr; JDM1_tRNA25-1.
DR   EnsemblGenomes-Tr; JDM1_tRNA26-1.
DR   EnsemblGenomes-Tr; JDM1_tRNA27-1.
DR   EnsemblGenomes-Tr; JDM1_tRNA28-1.
DR   EnsemblGenomes-Tr; JDM1_tRNA29-1.
DR   EnsemblGenomes-Tr; JDM1_tRNA30-1.
DR   EnsemblGenomes-Tr; JDM1_tRNA31-1.
DR   EnsemblGenomes-Tr; JDM1_tRNA32-1.
DR   EnsemblGenomes-Tr; JDM1_tRNA33-1.
DR   EnsemblGenomes-Tr; JDM1_tRNA34-1.
DR   EnsemblGenomes-Tr; JDM1_tRNA35-1.
DR   EnsemblGenomes-Tr; JDM1_tRNA36-1.
DR   EnsemblGenomes-Tr; JDM1_tRNA37-1.
DR   EnsemblGenomes-Tr; JDM1_tRNA38-1.
DR   EnsemblGenomes-Tr; JDM1_tRNA39-1.
DR   EnsemblGenomes-Tr; JDM1_tRNA40-1.
DR   EnsemblGenomes-Tr; JDM1_tRNA41-1.
DR   EnsemblGenomes-Tr; JDM1_tRNA42-1.
DR   EnsemblGenomes-Tr; JDM1_tRNA43-1.
DR   EnsemblGenomes-Tr; JDM1_tRNA44-1.
DR   EnsemblGenomes-Tr; JDM1_tRNA45-1.
DR   EnsemblGenomes-Tr; JDM1_tRNA46-1.
DR   EnsemblGenomes-Tr; JDM1_tRNA47-1.
DR   EnsemblGenomes-Tr; JDM1_tRNA48-1.
DR   EnsemblGenomes-Tr; JDM1_tRNA49-1.
DR   EnsemblGenomes-Tr; JDM1_tRNA50-1.
DR   EnsemblGenomes-Tr; JDM1_tRNA51-1.
DR   EnsemblGenomes-Tr; JDM1_tRNA52-1.
DR   EnsemblGenomes-Tr; JDM1_tRNA53-1.
DR   EnsemblGenomes-Tr; JDM1_tRNA54-1.
DR   EnsemblGenomes-Tr; JDM1_tRNA55-1.
DR   EnsemblGenomes-Tr; JDM1_tRNA56-1.
DR   EnsemblGenomes-Tr; JDM1_tRNA57-1.
DR   EnsemblGenomes-Tr; JDM1_tRNA58-1.
DR   EnsemblGenomes-Tr; JDM1_tRNA59-1.
DR   EnsemblGenomes-Tr; JDM1_tRNA60-1.
DR   EnsemblGenomes-Tr; JDM1_tRNA61-1.
DR   EnsemblGenomes-Tr; JDM1_tRNA62-1.
DR   EuropePMC; PMC2715720; 19465650.
DR   EuropePMC; PMC4241660; 25395634.
DR   EuropePMC; PMC4393438; 25746986.
DR   EuropePMC; PMC4467070; 26077560.
DR   EuropePMC; PMC4662129; 26761868.
DR   EuropePMC; PMC4995803; 27559429.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00522; PreQ1.
DR   RFAM; RF00555; L13_leader.
DR   RFAM; RF00556; L19_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF00559; L21_leader.
DR   RFAM; RF01065; 23S-methyl.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01708; L17DE.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01767; SMK_box_riboswitch.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001617.
DR   SILVA-SSU; CP001617.
XX
CC   Source DNA and Bacteria are available from Department of Medical
CC   Microbiology and Parasitology, Institutes of Medical Sciences,
CC   Shanghai Jiao Tong University School of Medicine.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3197759
FT                   /organism="Lactobacillus plantarum JDM1"
FT                   /strain="JDM1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:644042"
FT   gene            1..1368
FT                   /gene="dnaA"
FT                   /locus_tag="JDM1_0001"
FT   CDS_pept        1..1368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="JDM1_0001"
FT                   /product="chromosomal replication initiation protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60890"
FT                   /protein_id="ACT60890.1"
FT                   /translation="MLERNDLWNLIKFSMEQDLSKITFQTFVEPAKPLQLDKAQMTIEV
FT                   PTQLHRDYWEKNLAAKFTDIAMQATNEQIRPVMITEEERQQLTRDKDSQVTTGNVAGQQ
FT                   PTTATTPTFMRETKLNPKYTFDTFVIGKGNQMAHAAALVVSEEPGTMYNPLFFYGGVGL
FT                   GKTHLMHAIGNKLLETDPTSNIKYVTSESFTNELINAIQTKKQEAFREEYRNVDLLLVD
FT                   DIQFFANKEATQEEFFHTFNALYEDDKQIVLTSDRLPNEIPQLQDRLVSRFKWGLSVDI
FT                   TPPDLETRIAILRNKADLEGIEIPDDTLSYIAGQIDSNVRELEGALARVQAYSRLNNSP
FT                   ITTSLVADALKSLHLSSKLSEVSIPVIQEKVAKYFHVTMADLKGKKRNKQIVIPRQIAM
FT                   YLSRELTESSLPRIGNEFGGKDHTTVIHAHDKITKALKTDAELQKAVGDLTGQLKS"
FT   gene            1546..2685
FT                   /gene="dnaN"
FT                   /locus_tag="JDM1_0002"
FT   CDS_pept        1546..2685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="JDM1_0002"
FT                   /product="DNA-directed DNA polymerase III, beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60891"
FT                   /protein_id="ACT60891.1"
FT                   /translation="MKFTINRSAFIKELNNVQRAISSKTTIPILTGLKLDVNTDAITLT
FT                   GSDADISIETTIPASDDNNTLVVEDAGSIVLPARFFSEIVKKLPEDTMTVNVVDGFQTQ
FT                   ITSGAASFTINGLDPENYPHLPEIDTTNTITLAGDVLKELIGQTVIAVSNQESRPILTG
FT                   VHFILANGEFLAVATDSHRLSQRRIKLPEANNANYDVIIPGKSLTELSRMIGDNNPDVQ
FT                   MRLSENQVLFVLGNTSFYSRLLEGNYPDTSRLIPKESNTTVEISAPALSAAIERASLLS
FT                   HESRNNVVRFSVNPTDKTITIFGNSPDVGEVTEQLQPTDLSGDELEISFNPDYMKEALR
FT                   SFGQAMIKISFTMALRPFTLVPTEEGENFIQLITPVRTF"
FT   gene            3210..3443
FT                   /locus_tag="JDM1_0003"
FT   CDS_pept        3210..3443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0003"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60892"
FT                   /protein_id="ACT60892.1"
FT                   /translation="MKQPIDIKTPYMTLGQLLKETAIIGSGGQAKWFLKETTVLVNGEP
FT                   DDRRGRKLYPGDTIEVEDNGSFFIRSNQETTD"
FT   gene            3444..4568
FT                   /gene="recF"
FT                   /locus_tag="JDM1_0004"
FT   CDS_pept        3444..4568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="JDM1_0004"
FT                   /product="recombination protein F"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60893"
FT                   /protein_id="ACT60893.1"
FT                   /translation="MYLENLVLHDFRNYADLTINFSQGVNVLLGENAQGKTNLLEAIYV
FT                   LALTRSHRTANDKELIRWQTTTATLQGRLHKSTGAVPLELELGRRGKRAKVNHLEQAKL
FT                   SQYVGNLNVIVFAPEDLSIVKGAPAVRRRFMDMEFGQMSPKYLYNLSQYRTILKQRNQY
FT                   LRQLNRQQAKDKVYLGVLSDQLAAFGAEIIHKRLQLLQQLEKWAQAVHSEITQEQEQLT
FT                   FHYVTQVPTADQTSVDHIYQTLQALYQQQQAKEIFQGTTLLGPHRDDLQFGVNGKNVQT
FT                   FGSQGQQRTTALSVKLAEIDLMKAETGEYPVLLLDDVLSELDAARQTHLLTAIQDKVQT
FT                   FLTTPSLDGVARKLINAPKVFEVSHGTLHEEEPH"
FT   gene            4565..6511
FT                   /gene="gyrB"
FT                   /locus_tag="JDM1_0005"
FT   CDS_pept        4565..6511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="JDM1_0005"
FT                   /product="DNA gyrase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60894"
FT                   /protein_id="ACT60894.1"
FT                   /translation="MTENEKETKLEQAREYDASQIQVLEGLEAVRKRPGMYIGTTSSQG
FT                   LHHLVWEIVDNGIDEALAGFANVIHVTVEKDNSITVTDNGRGIPVDIQEKTGKPALETV
FT                   YTILHAGGKFGGGGYKVSGGLHGVGASVVNALSSTLDVKVTRNGHVYYMDFERGKVKTP
FT                   MKIIGDAPDDAHGTAVHFVPDPDIFRETTTYDINILTTRIRELAFLNKGLRITIRDNRP
FT                   DEPTEDDFLYEGGIRHYVEYLDKNKTVLFPEPIYVEGEQNGITVEVALQYTDDYHSNLM
FT                   TFTNNIHTYEGGTHEEGFKRALTRVINDYARKNNLLKESDANLSGEDVREGMTAVVSVK
FT                   HPDPQFEGQTKTKLGNSDARAAVDRLFSEHFSKYLMENPSVARKVVDKGLLASKARVAA
FT                   KRAREVTRKKSGLEISNLPGKLADNSSKDPEISELFIVEGDSAGGSAKQGRSRLTQAIL
FT                   PIRGKILNVEKASIDKILANEEIRSLFTAMGTGFGGDFDLSKANYHKLIIMTDADVDGA
FT                   HIRTLLLTLFYRYMRPLVDAGFVYIAQPPLYQVRQGKFVKYIDSDEELSEVMGQLAPSP
FT                   KPVVQRYKGLGEMDAEQLWETTMDPDKRRLLRVRDEDAADADGVFSMLMGDQVKPRREF
FT                   IEDNAKFVQDLDV"
FT   gene            6676..9237
FT                   /gene="gyrA"
FT                   /locus_tag="JDM1_0006"
FT   CDS_pept        6676..9237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="JDM1_0006"
FT                   /product="DNA gyrase, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60895"
FT                   /protein_id="ACT60895.1"
FT                   /translation="MADSDLSNNRISDVNLSKTMRTSFLSYAMSVIVARALPDVRDGLK
FT                   PVHRRILYGMSELGVTPDKPYKKSARIVGDVMGKYHPHGDSAIYESMVRMAQDFSYRYM
FT                   LVDGHGNFGSVDGDGAAAMRYTEARMSKIAVEMLRDINKDTVDWQPNYDDTEREPAVLP
FT                   ARFPNLLVNGATGIAVGMTTNIPPHNLAEVISAIHLLMDNPDATVADLMEVLPGPDFPT
FT                   GGIVMGKSGIRKAYQTGRGNIIVRAKVDIQDQKNGKQRIIVTELPYMVNKAKLIERIAG
FT                   LARDKEIEGITDINDESDREGMRIVIDVRRDASASVILNNLYKMTLMQTNFGFNMLAIV
FT                   KGAPKVLSLKQILIYYLEHQEDVIRRRTEFDLKKAQARAHILEGLRIALDHIDEIIAII
FT                   RQSQTSEIAKNQLMDNYGLSDKQAQAILDMRLVRLTGLEREKIESEYQDLLKAIADYKE
FT                   ILASKDRINQIIYEELMEIQRKFGDKRRTELMVGEVLSIEDEDLIEEEEVAVTLTHNGY
FT                   IKRLPTTEFKSQHRGGRGIQGMDVHDDDFIEHLLTTSTHDVLLFFTNAGKVYRMKAYEI
FT                   PEYGRTAKGIPVINLLGVNSGEKIQAVVNVTGDASASDNYLFFTTVKGVVKRTPVQEFA
FT                   NIRSNGLKAITLKDDDELIGVTITDGHQNIIIGTHDGYAVSFDETTVRSMGRTASGVRG
FT                   IRLRDDDFVIGFDVLKPDSNVFIITEKGYGKQTPAADYPIKGRGGKGIKTANVTEKNGH
FT                   LAGLTTVDGQEDIMVMTNQGVMIRFNIATVSQTGRATLGVRLMRLGDDGQVATMAKVDP
FT                   EPEVDETVATDATTEAPVDDQTVNADATTTEPTTDSNDSNE"
FT   gene            9859..10158
FT                   /gene="rpsF"
FT                   /locus_tag="JDM1_0007"
FT   CDS_pept        9859..10158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsF"
FT                   /locus_tag="JDM1_0007"
FT                   /product="30S ribosomal protein S6"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60896"
FT                   /protein_id="ACT60896.1"
FT                   /translation="MSESKKYEITYIVRPDIDDAAKTALVDRFDKILTDNGAQVIDSKD
FT                   WSKRRFAYEIGGFNEGTYHIVNLTATDDAALNEFDRLSKINDDILRHMIVKRED"
FT   gene            10195..10797
FT                   /gene="ssb"
FT                   /locus_tag="JDM1_0008"
FT   CDS_pept        10195..10797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /locus_tag="JDM1_0008"
FT                   /product="single-strand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60897"
FT                   /protein_id="ACT60897.1"
FT                   /translation="MINRTILVGRLTRDPELRYTNGGAAVATFTIAVNRQFTNQNGERE
FT                   ADFISCVIWRKAAENFANFTHKGSLVGIDGRIQTRNYENQQGVRVYVTEVVVENFSLLE
FT                   SRAESERHQSANGGSGNNNYNNDNSNYNNNNNGYSNQGQNAAPQQSSANNNNPFGNGNT
FT                   GNASSAAPSSSANNNNQADPFANNGDQIDISDDDLPF"
FT   gene            10836..11072
FT                   /gene="rpsR"
FT                   /locus_tag="JDM1_0009"
FT   CDS_pept        10836..11072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsR"
FT                   /locus_tag="JDM1_0009"
FT                   /product="30S ribosomal protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60898"
FT                   /protein_id="ACT60898.1"
FT                   /translation="MAQQRRGGRRRRKVDFIAANHIEYIDYKDTDLLRRFISERGKILP
FT                   RRVTGTSAKNQRSLTIAIKRARIMGLLAFVSED"
FT   gene            11253..13265
FT                   /locus_tag="JDM1_0010"
FT   CDS_pept        11253..13265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0010"
FT                   /product="exopolyphosphatase-related protein (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60899"
FT                   /protein_id="ACT60899.1"
FT                   /translation="MKKIFSREKIPFFLQNQQLRLLALVIFSLSLIMLVTGYLMNWIFG
FT                   TVVLILIVMAVVISYNTLIELSSSANEYISDLSYRIKRGEQEALIQMPIGVMIFNSDQT
FT                   IEWINPYLQRYFGDKDVLGYRLEDIEPTLAATLNAHLDEPATIRWQDYQFDVRVQQSTN
FT                   TVYMMDVTKYAELTDQFEDEKLVIGQIFLDNYDEITQSMTDTDISNLNNYVTNELSKWT
FT                   QMFGMYLKRLDDDHFFLLGYASSLRRVEENKFRILDRIRESTSKQNFPLTLSIGIAYGE
FT                   RNMNNLADLAQSNMDLALGRGGDQVVVKSEDEPARFYGGKTNPMEKRTRVRARMISQTL
FT                   QELMNQSDQIFVQGHRQPDMDAVGACLGIRRIAEMNGKQCWIVLDEQNVHSDIQRLLDQ
FT                   LKSDENIESAIISPEEALEKATDQSLLIMADHSKPSISMSQALYERLENRVMIIDHHRR
FT                   GEEFPENPVLVYIEPYASSTCELITEMFEYQSHDAEPINKIEATAMLTGIVIDTKSFSL
FT                   RSGSRTFDAASYLRSAGADSLLVQQFMKENVDSYLQRNHLIETVEFVNQDMALCVGEDD
FT                   QVYDPVTAAQAADSLLSMSGVDASFVITRREDGRVGISARSLGEINVQVYMEKLGGGGH
FT                   LSNAATQIEGQSVEAVKQSLIDLLTATDEPTTESN"
FT   gene            13278..13730
FT                   /gene="rplI"
FT                   /locus_tag="JDM1_0011"
FT   CDS_pept        13278..13730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplI"
FT                   /locus_tag="JDM1_0011"
FT                   /product="50S ribosomal protein L9"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60900"
FT                   /protein_id="ACT60900.1"
FT                   /translation="MQVIFLNDVRGKGKRGQIKNVPDGYAQNFLIKKGLAKEATKAAIN
FT                   TLKAEQKSEAARAAEELAEAKQVKTVLEADETVVELKAKAGTDGRLFGSIPSKQIATAL
FT                   ADQYQVKLDKRKIELPEPIRVLGYTNVPVKLHPEVTAKIRVHVVEK"
FT   gene            13746..15170
FT                   /gene="dnaC"
FT                   /locus_tag="JDM1_0013"
FT   CDS_pept        13746..15170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaC"
FT                   /locus_tag="JDM1_0013"
FT                   /product="replicative DNA helicase DnaC"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60902"
FT                   /protein_id="ACT60902.1"
FT                   /translation="MNNDVLDQTPPQNIEAEKAVLGAIFLNSDALVEAMEFVEAQDFYR
FT                   RAHQIIFASMVTLNDRDEAIDAVTVSDLLTAQNQLDDVGGMSYIAELAGSVPTAANAGY
FT                   YAKIVAQKATVRRLIKTATEITQKAYTENDDVTTLLDDAERDIMNVSEQRNQSGFKSIS
FT                   DVLNASIEEIDRLYQNDDDITGLPTGFAELDKMTAGLQPDNLIILAARPAVGKTAFVLN
FT                   IAQNVATKTDTTVAIFSLEMGAESLVNRMLCAEGSIDAGHLRTGQLNEEEWEHLVVAMG
FT                   SLSKASIFIDDTPGIKMSEIRAKSRRLAKEQGNLGLIVVDYLQLIEGSNTESRQQEVSE
FT                   ISRQMKKLAKELGVPVIALSQLSRGVEQRQDKRPVLSDIRESGSIEQDADIVAFLYRED
FT                   YYDREGGDDDDGGNFGGGGDFNGGDPRDEDASEDVGEVEVIIEKNRAGARGTVKLLFVK
FT                   PFNKFSSVSYAQDPQA"
FT   gene            complement(15167..16846)
FT                   /gene="isp2"
FT                   /locus_tag="JDM1_0012"
FT   CDS_pept        complement(15167..16846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="isp2"
FT                   /locus_tag="JDM1_0012"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60901"
FT                   /protein_id="ACT60901.1"
FT                   /translation="MQDYYNMNQTTLSIALDYQPEEHHSARYINQLVESLKLKYDYQFG
FT                   RPREYNLGAMLKLVLLAYSYGIFSSRKIERFARENKPAGWLIADQIPSYRTICRFRISD
FT                   ELATLTTDSLSQLTQYLRQNGMIDDVSFIDGTKILADANKYSFVWKKNTIRFDKMNREK
FT                   LVDLLGELHEAKIVGEIPAGSELTPELLDIMISKVEDHLVVLNETVEATKQVSPNPAKQ
FT                   QRRTVKSQKRKLDKRRDKMREHQAQQAIYDQRNSYSKTDHDATFMRVKEDPMQNGQLKP
FT                   AYNVQIATSNQFITGYRLFQNPTDTRTLQPFIEHLKANNVLGHTIVADAGYGSESNYRY
FT                   LEDEFGQHTVLIPYGTMLKENSRKWQSDDRKVMNWDYHEKDDYFINPQNVRFNFNAYRQ
FT                   RTDKYGFTRDFKEYIAEKYDENHQLISAALTPKGYLKRISVNENWEYFKSKQRELLSAP
FT                   ETGQIYAQRKIDVEPVFGKMKASLHFNRFSVRGFDKVTKEAGIVILALNIMKLVTVGTN
FT                   FKNQRRKQMGRETKIRFLVPFAYTEASYVTASLITNLLIDCN"
FT   gene            17163..18386
FT                   /locus_tag="JDM1_0014"
FT   CDS_pept        17163..18386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0014"
FT                   /product="transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60903"
FT                   /protein_id="ACT60903.1"
FT                   /translation="MAQKQLIKTPWLIAGQFMNNIGMSFIWPLTTIYMHNVLGKSLTET
FT                   GIVLMLNSVANVLASTIGGRIFDRGNPYHLLLMGITLNGLANFALIFFHGWPWYPMLLV
FT                   VTGFASGWLNTMFNALAASVPRDKVRRTFTLMYLAANLGVVFGTMLVGIVYSMGMALLF
FT                   SMTTSLFVIFLIIALFEYNVDSSNVTGVDPRQGQDVHLPRANFHIVWTFFISLFIIWLL
FT                   YEQWVSNLSVYMTNLGMPLRNYSFLWTINAGLLVLIQSILSLLGNRIKNLYNQFFFGML
FT                   FVGLSFLSLVIAHDYPHFIFAMILLTIGEATWSPAMPTLVSQLSPVSAKGRYQGLVQAF
FT                   CALGRSLGPLFGGVIIDNWSYKVLFLLAFVVLLIVLAVNIGVVHFNLRKAVNYMKTDVQ
FT                   TDVSRETK"
FT   gene            18399..19205
FT                   /gene="proB"
FT                   /locus_tag="JDM1_0015"
FT   CDS_pept        18399..19205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proB"
FT                   /locus_tag="JDM1_0015"
FT                   /product="gamma-glutamyl kinase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60904"
FT                   /protein_id="ACT60904.1"
FT                   /translation="MAVVKVIRKLKAKRVVIKVGTSTLVYPDGSINLRAIDQLAFVISA
FT                   MRHRGREVVLVSSGAIGVGLNYMGLKQRPKAIPEQQAIAAIGQTELISIYKERFAIYEQ
FT                   KIGQLLLTRDIFVYPKSHHNVLNTFEALLKQNVVPIVNENDTVAVDELDHETKFGDNDQ
FT                   LSAIVATNIGADLLIMLSDIDGFYDGNPNADARAQLLGHIEKVDQHTYKLAGGSGSRFG
FT                   TGGMVTKLKAAERMIDANGQMILANGADPTIIFQILAGEPVGTLFG"
FT   gene            19224..20462
FT                   /gene="proA"
FT                   /locus_tag="JDM1_0016"
FT   CDS_pept        19224..20462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proA"
FT                   /locus_tag="JDM1_0016"
FT                   /product="glutamate-5-semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60905"
FT                   /protein_id="ACT60905.1"
FT                   /translation="MVDLEQLGQQAQQASYTLGLLSTAQKNQVLTAMATALTSHQDEIL
FT                   AANAQDLENPQVPVKFVDRLRLTADRIQDMATGLKQVVSLPDPIGNVDRAWRNEAGLMI
FT                   AKERVPLGVIGMIFEARPNVTVDASALCFKTGNAVILRGGKEALHSNQALVQVLRGALR
FT                   AEAVDENAIQLITDTSHATAAKFMQLTDYVDVLIPRGSARLIQTVLAKATVPVIETGAG
FT                   NCHVYVDKDAQLQMATDIVINGKVQRPSVCNATEKLLIHREVAADYLPSMIQALREQGV
FT                   EVRGDAATQAIVPDVVPATDADWGTEYNDLIIAVKVVDSEAAAITHINRYNTQHSEAIV
FT                   TDNYQAGKLFQQRVNAACVYINASTRFTDGFEFGFGAEIGISTQKLHARGPMGLAELTS
FT                   YKYVIDGNGQIRH"
FT   gene            20923..22539
FT                   /locus_tag="JDM1_0017"
FT   CDS_pept        20923..22539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0017"
FT                   /product="lipoprotein precursor, peptide binding protein
FT                   OppA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60906"
FT                   /protein_id="ACT60906.1"
FT                   /translation="MKKRIWISSIAIVALGLVLTGCGSQQSSQQKTLNVTATQSIATAD
FT                   PNKADDIASQAAIAQFMEGLYTTNQKGKVVPAIAKKVVKPTNNGKTYTFNLRHNAKWSN
FT                   GKKVTAADFVYSVQRQVDPNTKSQEVGHVAEIKNATAITAGKKAVKTLGVKALGKYKLQ
FT                   ITLQQRVPYFNYRLATEIYPLNKQFTEKYGNKYGTSAQRTLSNGPYVLKSWNGTNDTWK
FT                   YVKNPYYYDRKQVRIKNIKVQTVKNNSTAENLFQSNEVQVTQITGTQVSAAEQGSLKSQ
FT                   MKVTKLNQLYFMLWNQKRSALQNTDLRRAVSYALNRQSLVKNVLKDGSVAATSLVPAGN
FT                   TKNPTTGKDFNTDTGNLYPYSPAKAKQYWQKAQASLGKQKLTLQLLTNDNDINKSVAEY
FT                   IQAAIEKNLSGVTVNVKSVPLTNEISTLSKGDFDFATLSWSSDFQDPVDFLNKASITNS
FT                   VNFGKFNNAKYEQLISTITADKQSTKARYQTMQQAAKLVAQQQGVTPIYQTAAAHLISN
FT                   KVGGVHFTLLRDALYRYAYWK"
FT   gene            22870..24774
FT                   /gene="glgB"
FT                   /locus_tag="JDM1_0018"
FT   CDS_pept        22870..24774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgB"
FT                   /locus_tag="JDM1_0018"
FT                   /product="glycogen branching enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60907"
FT                   /protein_id="ACT60907.1"
FT                   /translation="MVKQTTEMNDASYLFNTGAGFNSQDYLGCHLGASGRAVFRVWAPH
FT                   AKAVGVVGDFNDWQPSALKLLGATGIWQGQVPNVHAGQLYKFQITTPTGQVQLKIDPFA
FT                   QQFERKPGDAAVVVEPMTMRWHDSLWLARRKKSRAANRPINIYEVHLGSWRRHLDGSYY
FT                   TYAELAAELIPYVKQRGYTHIELMPVMEHLLDASWGYQQLGYFAPTSRFGKRDSFLSFV
FT                   DQCHQANIGVFVDWVPGHFIRNYDALYQYDGTPTFEYADPERANNRRWGAWNFDLGKTQ
FT                   VQSFLISSAEYWLDQCHLDGLRVDAVSNMLYCDYDEGREGQANQYGDNRNLEGIAFLQK
FT                   LNTTVLTHHPDILMIAEESSAYPQVTGSVANGGLGFNYKWNMGWMHDTLDFFMMDPLYR
FT                   HDHFNLLTFAFVYMFDERFILPFSHDEVVHGKKSLMHKMPGDRYNQFANLRTMLTYMAA
FT                   FPGKQLNFMGSEWGQFLEWRDWSALEWVDLKDDLNHRMQQFTTQLNAVYRHNRPLWEQD
FT                   HDPAGIIYTHTDDPDSSTMGFIRQAKRKYSFVVAAFNFVPVERQDYRIGVPYRGRYELL
FT                   LNTEAQAFGGTWTKLETTFTAVDKPYRGQPASFTVTLPAMGALLIRPVKVIGGVKHAR"
FT   gene            24764..25903
FT                   /gene="glgC"
FT                   /locus_tag="JDM1_0019"
FT   CDS_pept        24764..25903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgC"
FT                   /locus_tag="JDM1_0019"
FT                   /product="glucose-1-phosphate adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60908"
FT                   /protein_id="ACT60908.1"
FT                   /translation="MQDEMLGIILAGGQGTRLGKLTKDTAKPAVPFGGRYRIIDFTLSN
FT                   CANSGVNTVGVITQYQPLELNAHIGSGASWGFDSLNGGVTVLQPYSSSEGEKFFQGTAH
FT                   AIYQNIEYIDQQDPKYLLVLSGDHIYKMDYDAMLKYHQEKKASLTVGVIHVTNEEAKRF
FT                   GMMNTDATDRIIEFEEKPEHPKSDKASMGIYIFNWPTLRDYLVKSYATDKSLEDFGKNV
FT                   IPSYLANNESVYAYAFKGYWRDVGTIKSLWQANMEFLSPHNRLNIGDRYWRIYSKAEVL
FT                   PPMFLTETSQVNNAMVVDSCYVAGEIDHSILSQRVSVGMGSRVVDSMIMPGATIGKNVV
FT                   IDHALIGEDAVIGDDAQIIGTTDKIAVVGYHETMGVEQP"
FT   gene            25900..27072
FT                   /gene="glgD"
FT                   /locus_tag="JDM1_0020"
FT   CDS_pept        25900..27072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgD"
FT                   /locus_tag="JDM1_0020"
FT                   /product="glucose-1-phosphate adenylyltransferase, subunit"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60909"
FT                   /protein_id="ACT60909.1"
FT                   /translation="MRREQVSAIINLLEPSDALQPLTAVRPVGMLPFGGRYRLVDFQLS
FT                   SVINAGIQNVMVTVPRSGRSVADHLRSGRDWSLNTIRGGLFLSPYNDLKLVAPEKKAAL
FT                   LHHYYDNSIQFLKCSQSEYSVVMSTRNVGNIDLKALLRYHEERNSPVTAVYKRVDPASL
FT                   IPENTILQLTAKGEATAVVPMSKAKISPKTKQVAKSMAIYLMSTVDLIELLQSANQRGD
FT                   MISLEELMRQAVIQHNANAFEYTGFQANIHDINSYFAANMAVLDEANFRALFYSSRRIY
FT                   TKVKNEIPTFFATGSQCRDSLCGTGGYIEGQLDHSVIFRDVLINRDSQVKNAIIMQGAR
FT                   IGAGCKLENVIIDKDAVIGPNLVLKGTSTTPLVISKGQHVFQQAEVAVHD"
FT   gene            27065..28504
FT                   /gene="glgA"
FT                   /locus_tag="JDM1_0021"
FT   CDS_pept        27065..28504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgA"
FT                   /locus_tag="JDM1_0021"
FT                   /product="starch (glycogen) synthase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60910"
FT                   /protein_id="ACT60910.1"
FT                   /translation="MTRVLFAAAEAAPFYKTGGLGDVSMALPRALQAEGIETRVVIPYY
FT                   PHQMPTEYQQQLVPVTHFTVQVGEHAMYCGIKTLTVAHVQYYLIDNLDYFGREGLYGYW
FT                   DDGERFAFFQMAVCEMMERIDYIPDILQLNDWHTAFIPVLLAEKYYWIEAYRDIKTVLT
FT                   IHNLQFQGVYDPIILDSLFRIGTETYTEAGVAFYDQVNWLKGGINFADAVNTVSPTYAQ
FT                   EIQTPAFGERLDGVLRANRYKLSGILNGIDMQLYDPATDLALTANYSAKDLKPKRQNKR
FT                   ALQRRLGLPVKNVPVLAVVSRLTKQKGIDLLLDALNPFLQQQDVQLIVLGTGDPALERA
FT                   LRTYQSAYPQKVVAAIQFDTQLAQQIYAASDIFLMPSAFEPCGLSQMMAMHYGTLPIVH
FT                   AVGGLRDTVIPYNRYTGQGTGFSFDDYQPAVLRKIMVLAVTLYRQHPLVWRQLQHQAMT
FT                   CDFGWEHSAQQYRATYQKLMR"
FT   gene            28524..30920
FT                   /gene="glgP"
FT                   /locus_tag="JDM1_0022"
FT   CDS_pept        28524..30920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgP"
FT                   /locus_tag="JDM1_0022"
FT                   /product="glycogen phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60911"
FT                   /protein_id="ACT60911.1"
FT                   /translation="MKLTCAQFKKDFLSEIETLYSTSLSDTSTIGQFIALGQLVRRYNS
FT                   QSWTRTAKFYRDHHQKQVYYFSIEFLPGRLLASNLLNLNLLTTVKKGLTELGLDFETIS
FT                   QAEPDPALGNGGLGRLAACYMDAMASLKIAGNGNGIRYRYGLFKQVFMDGYQVELPDDW
FT                   LHHGNVWETRRDNKSCIVQFGGNVWLQPQADGSLQPQSENTEDVLAVPYDVGIVGYHND
FT                   ITNTLRLWSAELPPSATYSSQDQRDRISEITKVLYPDDSNSAGQQLRLRQEYFFSSAGV
FT                   QSIVRDFCATHHGIKLLGKKVAIHINDTHPTLVIPEMMRLLMDEHHCSWEVAWTLTTQV
FT                   MSYTNHTILQEALETWPIDMFKNLLPRIYQIIAEIDRRYREQQTPIFGKALVDQTAPLG
FT                   NGQVRMAYLAVIGSHSVNGVAPLHTELLKTDVLRGLYQVYPERFNNKTNGIATRRWVQL
FT                   ANQPLAQLIDQTIGSDWRRQPDLLQTLLPYQQDDHFLYQLGQVKLTNKQALAAYVQRTM
FT                   GIKIRTDAIYDVQIKRLHAYKRQLLHVFEILREYFAIKDHPQQPVVPRVHIFGAKAAPS
FT                   YHYAKAIIKLINVVADMVNQDPAIGDRLKIVFIPNYGVSIAELIIPAADVSEQISTASK
FT                   EASGTSNMKLMANGALSLATYDGANIDIMQAAGAENEYPFGLKVNEVYDYYHRGNYHAA
FT                   DFYDADPELKRLLDSLIDGTIPGIPTVGREIYDSLLRYNDEFFVLADYRAYVTQQQQIS
FT                   RDFQNQPTWQQRSLANIAASGHFAADLAVARYADDIWQVPHERLN"
FT   gene            30938..32755
FT                   /gene="amy1"
FT                   /locus_tag="JDM1_0023"
FT   CDS_pept        30938..32755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amy1"
FT                   /locus_tag="JDM1_0023"
FT                   /product="alpha-amylase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60912"
FT                   /protein_id="ACT60912.1"
FT                   /translation="MQVTYNSFLPTYKTPFGAVTRQTPVQFTISVQTVTPVKQIDLCVA
FT                   HDGQWDDEQALPLHPISPTMYTATFIPTQVGLYFYYFRIETTTMTAYYGCVDGGYGGPG
FT                   VQYVLREHVQMYQLTILKAVETLPQWYREGVAYQIFVDRFNNGNADGHVNAPKPNSFIY
FT                   GQLTDRPLYVRDEHRAILRWDFYGGNLRGISAKIPYLQRLGVTIIYLTPIFEASSNHRY
FT                   DTGDYLKIDPVVGDLTDFDNLVAAVHRAGMRLILDGVFNHVGVDSKYFNQAGHYPTVGA
FT                   TQSTTSPYYPWFTFIHYPHDYDSWWGIRDLPTVDKDDPTYRDFIFGKPDSVIDYWTQRG
FT                   VDGWRLDVADELPDDFIAGIRRTLDRYPDKVLIGEVWEDASHKLAYGMRRHYLEGGGLQ
FT                   AVMNYPLRRLIIHVLNGTLTPAEWWRELMTLKENYPATTFRFNFNNIGSHDTPRILTML
FT                   AEDRQRLRLAVQLLLTLPGVPCLYYGDEALMMGGKDPDNRAFYPWQDADQAQVQFVADW
FT                   ANWRQRHPWLNTAHFVPFYLADYGIGYLYWQADQTVMVIVNVTTEPRTMTSHDLKLSGV
FT                   PIKLAQAIQRCLVTQTLGGEQLRLIENFT"
FT   gene            33088..33855
FT                   /locus_tag="JDM1_0024"
FT   CDS_pept        33088..33855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0024"
FT                   /product="HAD superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60913"
FT                   /protein_id="ACT60913.1"
FT                   /translation="MYQAVVFFDLDGTLMQDDKTVAASSVRAIQQLRANHVLPVIATGR
FT                   NVFEVQDVMTTTGIDSIVSANGSYVAYQGQFLSAHELDKELLTDITHFANRQQNALAYY
FT                   NNAGFALSHRDALTTSNYRALRQTARVAPHFYEHQHINFLLTFDPLNAAQYRQRYRGRL
FT                   HFVRNNPRALDTMQWGVSKAVGIQDILTKAHLTKVPTYAFGDQLNDIEMFRMIQTPIAM
FT                   GNGHPQVKQLARYVTADNMHGGIAQGLQHFDLI"
FT   gene            complement(34007..34678)
FT                   /gene="pgmB1"
FT                   /locus_tag="JDM1_0025"
FT   CDS_pept        complement(34007..34678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgmB1"
FT                   /locus_tag="JDM1_0025"
FT                   /product="beta-phosphoglucomutase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60914"
FT                   /protein_id="ACT60914.1"
FT                   /translation="MVKFAAIKGFVFDLDGVITDTSTFHSQAWHQIADKVGVSWNDQLA
FT                   DALKGISRMDSLNLILAQGHRENDFTPAQKQALATEKNTNYLQLVNQMTPANILPGITA
FT                   FLTELTTAGYALSLASASKNAPLVLRKLGLSDYFTKAVDPASLKHGKPDPEIFQRGAEI
FT                   LGLNPADCIGVEDAAAGVQSIKGAGETAIGIGDPTVLAAADINFTDTTQLTLANIKAQL
FT                   N"
FT   gene            complement(34696..37416)
FT                   /gene="map1"
FT                   /locus_tag="JDM1_0026"
FT   CDS_pept        complement(34696..37416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="map1"
FT                   /locus_tag="JDM1_0026"
FT                   /product="maltose phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60915"
FT                   /protein_id="ACT60915.1"
FT                   /translation="MKLIRLRIENDAMDIAYHPVSGQAATAHYLIAYNSDQTIGENLEN
FT                   IKVRLAGLQFDAAILENGLSYPFSDTIVGVNYDRIDVGLALTNLLNIPVVSQAAVDQLG
FT                   LVAAVKAKSAYLKWHLDYYGQYHGVRNNGQEAMLTIGNGYFGLRGAFLESHADKDNYPG
FT                   TYVAGVYDQTTTTVHDHQVKNEDLVNLPNAQFMTFGIDHQTPFTLNEHDLQDAYRSLDL
FT                   KTGLLTTTKLIQLASGHQLRIRSQKVANMRDWHRYSIRYQVTPLNFAGSLQIYTEIDGS
FT                   VVNSNVSRYNVFDQHHLKTMGIETAANTVYLSGQTKSSHINYTIGAKLTSPDVPAIENF
FT                   NSTQQPQGVQQTVSLAVEAGKTYTFDKNVVIATSNDHSDPQLTHVQAELDQSSFDNTVT
FT                   TSKDYWEATWRATDIKIRGDITSQRLLRVNIYHSFVSAAAIESGQLDASVGARGLHGEA
FT                   YRGHVFWDEMFILPFYTLHRPELAKQLLAYRYRRLPMARKNAEAEGYAGAMYPWQSASK
FT                   GDEQSQFTHLNPITKTWDPDNSRLQRHVSLDIAYNVWFYYHVTQDRDFLTHYGMEMLLS
FT                   IAAFWISKADYDQANGRYNISGVMGPDEFHENYPNSTTAGLKNNAYTNIMVAWLFDTIT
FT                   TLRAQMPQAAFQAAAQAAQFDSTAEQALTTISHQLTLEINRRGIIAQFEGYFNLPTLDF
FT                   QAYRQKYGDIARMDRILKAESKTPDAYQVAKQADALMAFYNFDVTTVQKIIEKMGYQLP
FT                   KEYLTHNIQYYLARTTHGSTLSRIVYAVLNQLDDNDDDAWKLFSEALASDYYDIQGGTT
FT                   AEGIHLGVMCATLNLTTRNFGGVNPLGAHLQVNPRLPEHWQTLKFKHLFRGVHYVFVID
FT                   HQRVTVTADQPSTIMIGKQHYQLQAKKPLSVTYTD"
FT   gene            complement(37804..38253)
FT                   /locus_tag="JDM1_0027"
FT   CDS_pept        complement(37804..38253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0027"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60916"
FT                   /protein_id="ACT60916.1"
FT                   /translation="MQHTTRQAALHMIQTAPVFTLATVDADGFPTMVALSPLPIKRSLE
FT                   ELYFYTSRQTSTTQNIQNWRQASLFYYQLSDYASIMLRGKLSLVGTNVFEQDWRAELTD
FT                   FQQQLNYKDPVILRFQTSSIKIRQMMTIDHLELVDQPTDGPAHLD"
FT   gene            38452..38652
FT                   /gene="cspL"
FT                   /locus_tag="JDM1_0028"
FT   CDS_pept        38452..38652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspL"
FT                   /locus_tag="JDM1_0028"
FT                   /product="cold shock protein CspL"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60917"
FT                   /protein_id="ACT60917.1"
FT                   /translation="MKNGTVKWFNADKGFGFITGEDGTDVFVHFSAIQTDGFKTLDEGQ
FT                   KVTYDEEQGDRGPQATNVQPQ"
FT   gene            38744..38974
FT                   /locus_tag="JDM1_0029"
FT   CDS_pept        38744..38974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0029"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60918"
FT                   /protein_id="ACT60918.1"
FT                   /translation="MDFVDVYGIKHENCTLVAPAREYQRVVIFMDALGRRFVAMGPDPQ
FT                   PTKYGSSSQHWHQAQPSAAPEGYFHIDQEQP"
FT   gene            complement(39443..40597)
FT                   /locus_tag="JDM1_0030"
FT   CDS_pept        complement(39443..40597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0030"
FT                   /product="prophage Lp3 protein 1, integrase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60919"
FT                   /protein_id="ACT60919.1"
FT                   /translation="MATIKKYQDKDGNTRYQFQVYLGVDPQTGKKKSTRRRGFKSKSAA
FT                   RIALSRIEVELQQEPVLPVDNNILFVNVYHEWYDQYINTVRESTWARTAGMFDNHILPL
FT                   FGNKRLRTITVNQCQRAVNLWFKEVTYNYKRWYNYLVAVFEYGLKHGYITHNPARMITM
FT                   PVKPDSWGDKPDNFWDRDQLKTFFKCIDQQKETEKYCLFRVLAFAGVRRGECLALTWQD
FT                   IDFVHKNLRVNKTLTQGKRGKQIIQAPKTKKGRRTVSLDNTTVEILQRWHKQQREYYLF
FT                   LGFNTLQPDQLVFANTKNGFKSLNTPGKWLKRIITDYHLTPSITVHGFRHSHASALFAA
FT                   GATIKEVQTRLGHEDVATTLNVYTHVTKGQNQQAANKLANYLGF"
FT   gene            complement(40676..41320)
FT                   /locus_tag="JDM1_0031"
FT   CDS_pept        complement(40676..41320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0031"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60920"
FT                   /protein_id="ACT60920.1"
FT                   /translation="MIKIDLKKLAKSKGFTLTDISKATGISMNTLSVLGRNVSTGIQFD
FT                   TLDKICRFLTCTPNDIIKVLPDDYIVQVPAQKSKDGAIYAIGVKETVIHKSIVENSMYD
FT                   ADAEENIFHVKLISYTDNEAIFFVGLPVGSGFFNTPTESEEKTTKWLVSLNERNRASIS
FT                   KQATGIYLENYWNKKIALPQKVSIVFNVPNQGSVYSFTLHEKDNHVLLEDH"
FT   gene            41511..41648
FT                   /locus_tag="JDM1_0032"
FT   CDS_pept        41511..41648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0032"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60921"
FT                   /protein_id="ACT60921.1"
FT                   /translation="MEELHIGSVNTVYKMINDGLKVTSIGRLKRIERKELDKYLASKTI
FT                   "
FT   gene            41691..41798
FT                   /locus_tag="JDM1_0033"
FT   CDS_pept        41691..41798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0033"
FT                   /product="prophage Lp3 protein 5"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60922"
FT                   /protein_id="ACT60922.1"
FT                   /translation="MIATAILWVIKFMIVSFVGNVAFKLVKNPRRYFGM"
FT   gene            41916..42146
FT                   /locus_tag="JDM1_0034"
FT   CDS_pept        41916..42146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60923"
FT                   /protein_id="ACT60923.1"
FT                   /translation="MTNSELVEQAKNLSVARDNLQMAIDYLDMVSASVNSGDTWAGQLF
FT                   FSNHRAGNVVENMQNVADSIMAVSNDICPED"
FT   gene            42160..42960
FT                   /locus_tag="JDM1_0035"
FT   CDS_pept        42160..42960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0035"
FT                   /product="prophage Lp3 protein 7"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60924"
FT                   /protein_id="ACT60924.1"
FT                   /translation="MKEFATLDKAIELAQQGYAVYPLIENTKKPPKGVAGYQAATSDQN
FT                   TIFAWFKKHPAYNLGLRLDLSDLLVVDIDMHDPTKNGRASLAQLFKQGQTLPNDTYIER
FT                   TANGGVHYFLKYAGAKARKIDVWPGIDLLSDFTVIAPSEINGKPYQAIDGRTLADIKPA
FT                   PQWLVDKLAGQKVNWTSEHACNTRQKKYTGRLLDEMVTGTTQGNRNAWLTKIAGRMFGV
FT                   GANPKTVYNMLSVINDSFIDPVLPSKEVNVIFQSILKRESKGVH"
FT   gene            42960..44354
FT                   /locus_tag="JDM1_0036"
FT   CDS_pept        42960..44354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0036"
FT                   /product="prophage Lp3 protein 8, helicase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60925"
FT                   /protein_id="ACT60925.1"
FT                   /translation="MGKAMDLPAETREAANNVIKMQRDADWQNDFKKNSDDGIKTQSLY
FT                   NIRLIMEHDEMLKGLVVFDEFSEQIVKTPQAENSLFKKGFWNDSDDTLLRSYIEDHYNL
FT                   LFSKENITDAVVTEARRKTINPVKDRIEAVEWDGQPRAERYFIDYLGAEDNHYTRTITK
FT                   KWLTGLIARAYVPGVKFEIVPILEGSQGLGKSTAGKNLYPDKFNDSLKGMGKQKDDYQQ
FT                   LQGSWIIEVAELSAMKKTDIEGIKNFISAQSDTYRNSYGRYALPHPRKCVFIGTTNQTD
FT                   YLKDATGERRFYPIKCGVNKVKLDVWHPDENYMLQVLAEAAHWFRNGEPLYLDQATMKE
FT                   AKAYQMAAETVNPMRDAIEAFLAMEVPADWENMSTGLKQSYVSDYGHHSKWLKDQVSNE
FT                   RKLLNQTTTLEIMEVVFHKTVDRYLTGRTNSEAKRIKLLMDNMDGWEAKRIRMNGKFPR
FT                   GYVRVQ"
FT   gene            44498..44917
FT                   /locus_tag="JDM1_0037"
FT   CDS_pept        44498..44917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0037"
FT                   /product="prophage Lp4 protein 12"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60926"
FT                   /protein_id="ACT60926.1"
FT                   /translation="MKVIYPSLVEQAFDIYVKQYGPVVSNRVNELKSCIYRALIKEGAL
FT                   DQNGEPTQKAKDKGLVGSFTPNEDGEYEPETVRDLKLMYPIYAQFSDDHFMKSSQGWLA
FT                   DAYVIRNVSSQVLNNPLSDEEQRKNAYKMLEQLDD"
FT   gene            44942..45124
FT                   /locus_tag="JDM1_0038"
FT   CDS_pept        44942..45124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0038"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60927"
FT                   /protein_id="ACT60927.1"
FT                   /translation="MIKTKTIMRMSVQDLDRAINRELANRIDSDNVIDIKFSSNAFGAD
FT                   LDSSSAEYCAMIIYK"
FT   gene            45134..45472
FT                   /locus_tag="JDM1_0039"
FT   CDS_pept        45134..45472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0039"
FT                   /product="prophage Lp3 protein 11"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60928"
FT                   /protein_id="ACT60928.1"
FT                   /translation="MKNYNLNRLNKRVQFGTVKSVQNPINGTTKQQFVPLFTVWCGEYT
FT                   LTISNTISLTGTTATTNQLIAVRHDDRITTALEAILDGVTYKVAGVSSDSELNAYDVVT
FT                   LTKVNGHG"
FT   gene            45465..45854
FT                   /locus_tag="JDM1_0040"
FT   CDS_pept        45465..45854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0040"
FT                   /product="prophage Lp3 protein 12"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60929"
FT                   /protein_id="ACT60929.1"
FT                   /translation="MAKPMKQCEHPGCRTLVAYDTRYCEKHRKATNKWRYHKRMYDSDE
FT                   SKYQQFYKSSAWRKLSRRFLESNPVCVQCYQDGVIRKANVVDHVIEIKDDWSRRLDESN
FT                   LQSLCHRHHNRKTRLVREQREQQTK"
FT   gene            complement(46663..47661)
FT                   /locus_tag="JDM1_0041"
FT   CDS_pept        complement(46663..47661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0041"
FT                   /product="transposase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60930"
FT                   /protein_id="ACT60930.1"
FT                   /translation="MSPYNHLTLKDRECILLGVTLNDTYQVIAEKIGCSKATVSREIKR
FT                   NGGRKAYSAVKAQENYQGRRLKSRRPRLLTDLKLRDFVLHCIVQRQWSPEQISGRLVHE
FT                   NSEWHVSYNTIYRGIERDNLGIKRKNHEARGFARKLRHRGKTRKVKGTIKERRGRFNDV
FT                   PSVHERPVSCENRSWFGHWESDTVRGKTGRSALVTLVDRKSRYLLSQRVPKVNAKNVTQ
FT                   AMIDLLHTVTPKRVRTLTPDRGTEFAGYREVSQELSIPVYFPDPHAPQQRGTNENTNGL
FT                   IREYFPKGTDLDQLTDQDIDKFVRDLNHRPRKVLGWKSPFEVFFGTKLRLI"
FT   gene            47806..48279
FT                   /locus_tag="JDM1_0042"
FT   CDS_pept        47806..48279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0042"
FT                   /product="prophage Lp3 protein 14, terminase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60931"
FT                   /protein_id="ACT60931.1"
FT                   /translation="MSQKVKALASMKKHLTNDERDQRKDAEKALFDYPSLDLTPPDWLH
FT                   DRALTEWQRVAPYLKANTPISELDRAMLASYCRAYATVQTCENDIRKNGLVQTNQDTGV
FT                   RKPNPYVALQSQAMKDLKALANDLGMSLSSRARMELNKQKDETPEDTFEAMLS"
FT   gene            48276..48683
FT                   /locus_tag="JDM1_0043"
FT   CDS_pept        48276..48683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0043"
FT                   /product="prophage Lp3 protein 15, terminase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60932"
FT                   /protein_id="ACT60932.1"
FT                   /translation="MIEYVDQVLSGRVLACQKIKWACERFKRDLSRSKDDSFPFYYDED
FT                   KAAQAVKFIELMPKTDGSQLTMQPFQKWIISELYGWREKTTGNRRYDRAFISMARKNGK
FT                   TYLASGMAANGLLRERQPARNRQVLFRQQRP"
FT   gene            48706..49980
FT                   /locus_tag="JDM1_0044"
FT   CDS_pept        48706..49980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0044"
FT                   /product="prophage Lp3 protein 15, terminase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60933"
FT                   /protein_id="ACT60933.1"
FT                   /translation="MLSSGLRQVRKQSKYMRQRIKVQKQAITDLETDSQALALASDTST
FT                   LDGYAGTTVILDEWHEAKDRKVYNVLKSGQAQEDNSLLAVISTSGLNLNVPMHAEYDML
FT                   TDVLKGKTEADRYFVAIWELDDREEVYDQTNWIKANPLFSEPHVKQRMTEKIQADVDLA
FT                   IKQNNLIPILVKNFNMWLQASEDSYISADDWAAGKLAKVPDLHNRDAYIGIDLSKSNDL
FT                   TAVSWLVPIGNGQFYCDSHSFVGTKYGLDSKIKRDGIDYRSMERAGECSITRLDSGIID
FT                   YDNLFYFVQKLVGKYNWKVKAIAYDPYNAQTLITKFEKLSYPLFEVRQGTKTLNIPTRN
FT                   FRDQLYDDKIKHNGNKILAYAVNNAILKVLNNGWQLDKARNSNRIDPIAALINAFVAGM
FT                   DYYQESEDQQHAEDYYKTATAADLF"
FT   gene            50135..51235
FT                   /locus_tag="JDM1_0045"
FT   CDS_pept        50135..51235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0045"
FT                   /product="prophage Lp3 protein 17, portal protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60934"
FT                   /protein_id="ACT60934.1"
FT                   /translation="MSFFVKSNTTSGTHDPVADALVSLSSNDPYTFVSAAVLRNSDIYA
FT                   AINIIASDIASNPIMCDTAIFNTMINQNPNSQMDGYHFKYALAANLLLNGNSFAEILPN
FT                   HTLKLISNNQLTVEQDDVSGALTYTYTPTGGNSRQIAPNNILHFKYFTKDGVSGISPLY
FT                   ALKDERQIQSAGNKLLTGFFTAGVHGTTIIKVHQSDLGPEAKGNIRNQFDEANTGDNAI
FT                   NTIVTDDTMDISNLSLNTDVLKLVNSNDWTTRQIAKAFGLPPERLGVENNHSNQEQSGV
FT                   QYLQGTLQHYFDSFTSELSFKLGHDFTFNTDKLLSLDPKTQQAQAVAGFTGGIMSRNEA
FT                   RAKIGLPPTDDGNIFLNLQKNGVTNS"
FT   gene            51232..52773
FT                   /locus_tag="JDM1_0046"
FT   CDS_pept        51232..52773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0046"
FT                   /product="prophage Lp3 protein 18"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60935"
FT                   /protein_id="ACT60935.1"
FT                   /translation="MKQDRRLTIDAELRAQMPQSETPEDGPAENSADPQSKGSQTSKGK
FT                   TISGYAIVWNSPSKDLGGFTEVVTPKALDGVDLSNVLMLNNHDYTQVLASVKAGTLTLE
FT                   TDDKGLHFTAQLPNTSFANDVYEEVQSGNVDSCSFGFDSDDDTDEWTKDDGGNITRTIN
FT                   QVKSLFDVSVVAVPAYDDTNVQVDTRSYEKCINQEKEPDNMAKQTIIDPNNNDNGNGNK
FT                   TGIPAFEQYVRTHGETRDGLKTDGASAVIPKELITPVFQLKQSNYNLAQYATVKQVSSG
FT                   SGTYPIATSQQSAVLATKDELADIADVDANMFTEVPFDVKTRAGKIALSNEVVEDAEVD
FT                   IVSEVKTQLQQLVDNTDNTQIMSLLTGTSFAKATAANIDDLKKIFNVTLDPALSKMWLV
FT                   NQSGFNYLDTLKDSEGRYLLQTNPTAPSGFTLLGAPVVMISDKLLANNADGTFPMIAGD
FT                   LSQAVAVFRRNQVTAQWDKFDQFSQGLSIIVRNDYEVIDKTAVINVALGTVTAGK"
FT   gene            complement(53042..53113)
FT                   /locus_tag="JDM1_tRNA01"
FT   tRNA            complement(53042..53113)
FT                   /locus_tag="JDM1_tRNA01"
FT                   /product="tRNA-Asn"
FT   gene            53182..53448
FT                   /locus_tag="JDM1_0047"
FT   CDS_pept        53182..53448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0047"
FT                   /product="prophage Lp3 protein 19, head-to-tail joining"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60936"
FT                   /protein_id="ACT60936.1"
FT                   /translation="MAVTVDDIKLSLRIDVTEDDPMIQSYLDAAKDYVQTAVSKNEDLT
FT                   VYKQYDFAVSLLTQFWYQNRVTDMKQTPYQVISMIQQLRGLIS"
FT   gene            53592..53960
FT                   /locus_tag="JDM1_0048"
FT   CDS_pept        53592..53960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0048"
FT                   /product="prophage Lp3 protein 20"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60937"
FT                   /protein_id="ACT60937.1"
FT                   /translation="MRQDVKKIRNLLKQYAKLKRDLTVFNQVSSPSFDGVSSHSSRNGA
FT                   ESRLINYVDLSYQLKEVDDALNAIDDPQYQFILHDYIIEKRFNRNEACNQLSVSVSKFN
FT                   YLKNRALEVFKLNYLRTL"
FT   gene            54083..54283
FT                   /gene="cspL"
FT                   /locus_tag="JDM1_0049"
FT   CDS_pept        54083..54283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspL"
FT                   /locus_tag="JDM1_0049"
FT                   /product="cold shock protein CspL"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60938"
FT                   /protein_id="ACT60938.1"
FT                   /translation="MQSGTVKWFNADKGFGFITGSDNKDVFVHFSSIQTDGFKSLDEGQ
FT                   KVSYEVEQGDRGPQATNVVPQ"
FT   gene            54370..54600
FT                   /locus_tag="JDM1_0050"
FT   CDS_pept        54370..54600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0050"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60939"
FT                   /protein_id="ACT60939.1"
FT                   /translation="MDFTDVYGIKHENCTLITPTEEYRRIIIFMDSVGRRFVAISPNPE
FT                   PTKYGSAKSHWKQGKPNDVPKEYFHIDKKNC"
FT   gene            complement(54804..54879)
FT                   /locus_tag="JDM1_tRNA02"
FT   tRNA            complement(54804..54879)
FT                   /locus_tag="JDM1_tRNA02"
FT                   /product="tRNA-Lys"
FT   gene            55203..55910
FT                   /gene="rrp1"
FT                   /locus_tag="JDM1_0051"
FT   CDS_pept        55203..55910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rrp1"
FT                   /locus_tag="JDM1_0051"
FT                   /product="response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60940"
FT                   /protein_id="ACT60940.1"
FT                   /translation="MKKILVVDDEKPISDIMKFNLTKEGYEVHVAADGEEALQKVDEVH
FT                   PDLILLDLMLPKMDGLEVARQVRKNYDMPIIMVTAKDSELDKVLGLELGADDYVTKPFS
FT                   NRELVARVKANLRRQGAPSAQPAEVEENSDIEIGDLVIHPEAYMVSKRGENIELTHREF
FT                   ELLHYLAQHIGQVMTREHLLQTVWGYDYFGDVRTVDVTVRRLREKVEDNPSHPKWLVTR
FT                   RGVGYYLRNPENE"
FT   gene            55924..57798
FT                   /gene="hpk1"
FT                   /locus_tag="JDM1_0052"
FT   CDS_pept        55924..57798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpk1"
FT                   /locus_tag="JDM1_0052"
FT                   /product="histidine protein kinase; sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60941"
FT                   /protein_id="ACT60941.1"
FT                   /translation="MLRFKRKNFFKTINFKIALVFALLLLITLEIVGAIFVKQLESKNI
FT                   QDFKQSVQIPTYIDNSLSEQLTVSSTRKANGQIKTILSNYNNTNVDEIQVVDSKGTIRG
FT                   TSDVNDQSVVGQKTTDRNVKNAIYNNRTYTKSTYDTQNNGRYYVSIVPLYSSNSAGNSS
FT                   QLVGVLYVRANMKSVYSTINNIMGIFVIASLAAMVLGLGIAIIIARAITRPIEEMKQQT
FT                   QRIARGDYAGQVRVYSDDELGQLAKAINNLSIRVEESQESTEAERRRLDSVLSHMSDGV
FT                   IATDRRGNITIINETASDFMDVTAEKAIGNSILDILKIRDDYSLRDLIENQDELMLDFS
FT                   SNERDLILNAYFSLIQRESGFISGLVCVLHDVTEQQKIDNDRKQFVSNVSHELRTPLTS
FT                   LRSYIEALSDGAWKDPEVAPGFLKVTQEETDRMIRMINELLSLSRMDSGTTRVDMELVN
FT                   INEMFNYVLDRFDMILKKDDNPAKYYTIKREFTKRDLWVEIDTDKFTQVLDNIMNNAIK
FT                   YSPDGGVVTCRLLETHNQVIISISDQGLGIPRADLGHVFDRFFRVDKARSRAQGGTGLG
FT                   LAISKEVVQMLGGRIWVDSVEGKGSTFYISLPYEPYEEEDLWDDDSQA"
FT   gene            57779..59104
FT                   /locus_tag="JDM1_0053"
FT   CDS_pept        57779..59104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0053"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60942"
FT                   /protein_id="ACT60942.1"
FT                   /translation="MTTHKLRRFILPILLTILILLSVVLSMYIWLNPSRYEHESKVSTT
FT                   SSNSSLTTRTIDDIYLPTQLIHTNSQGGQSLLINKNVSLVSQFSEQLRKWDARSISKVR
FT                   ITSAKSYRALLNGTDSYVLNFPDSITVSMFNTVFKQHLSNFRSSEFSRIVIPVNDTNHI
FT                   YFLNDDHHEIYSVRLKKKSLSSLKKVLAVDKVKRIAVKMTYEDNTTYIDYPKQVTMQHY
FT                   SYLMSKAAASEIANRLLDADGNSTVSVHNRSGKQEYTTGSYKRMTVDSKLGTVYFEDYS
FT                   DSGTTRNLSLTNQLKKSFNLLTSLGVPMDNIRYYGFDATSNSVIYRSYVEGFPIFNQTE
FT                   NGDVRIQLTSNGLDRYYFSLYSLQVPVPTTGQKQAVTLPSSTSVLKRLKAAGYKDSKIG
FT                   SIELGYEWSQNKSSKLVIDLTPTYYVYYNGTWRTYTSMLSGS"
FT   gene            59116..59970
FT                   /locus_tag="JDM1_0054"
FT   CDS_pept        59116..59970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0054"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60943"
FT                   /protein_id="ACT60943.1"
FT                   /translation="MNFRRIEWIFLLAFVVLDIFLGFMFVQTSSKSTQTTGDTATTIIR
FT                   EMRADNISFKNPDTSEGTGYYIAGSNESGLKQLLSQLTEQTARVQSGGKLVSTLRATTT
FT                   IDTRNPKADLTTFMSQRTNVIHGTEYVYDADLSSNGDYVFVQKVADGEIMTGAGQVHLF
FT                   VNKNKQLTSYTQTYVNHVKTLREKAVTISEKKALVALYQYNQVASSSRIVWAKLGYSRL
FT                   LKLKDSSVYVPTWIFAVRGKNSSNVTLHRINAFTGSSMKNGSTASDTSSLDATVGMMWN
FT                   AID"
FT   gene            60329..61144
FT                   /locus_tag="JDM1_0055"
FT   CDS_pept        60329..61144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0055"
FT                   /product="hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60944"
FT                   /protein_id="ACT60944.1"
FT                   /translation="MVLKLATDDMKVSILASGSTGNVTYIETPEHKVLVDAGLSGKKIA
FT                   NLMASIDRDINEVDSLFISHEHTDHCHSAGILARKYGMDVYANQGTWDAMAHKIGNVPA
FT                   ELCHVFDPNTTLGLGDLDVESFSVSHDAAEPQFYELHHAGKSFVIITDTGYVSEHVEGV
FT                   IKDADGYLFECNHDLEMLRMGRYPWPLKQRIIGDEGHLSNEDGANALMDVIGRHTKRIY
FT                   LGHRSQDNNLKSLAHLTVASMMTERDFGVEHDFQLYDTEPEQATKLITL"
FT   gene            61255..62517
FT                   /gene="htrA"
FT                   /locus_tag="JDM1_0056"
FT   CDS_pept        61255..62517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htrA"
FT                   /locus_tag="JDM1_0056"
FT                   /product="serine protease HtrA"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60945"
FT                   /protein_id="ACT60945.1"
FT                   /translation="MANKSLIKVAVTALVAGLIGGGVAYGGINYFQNNNIATSSTSVPT
FT                   GSNKSGSTSTTNVKVNVSSQATKVFENNKAAVVSVINLQKKSSSSSWSGILGGDDSSGS
FT                   DSSSSSDSSSSKLEEYSEGSGLIYKKSGDAAYIVTNNHVVSGSSAIRVIMSDGTKLSAK
FT                   IVGTDSVTDLAVLKINSSKVTKTASFGNSDNIKVGETALAIGSPMGSNYATTLTQGIIS
FT                   AKKRTVATTNTSGQTTGYATVIQTDTAINSGNSGGPLFNIAGQVIGINSMKLASDNSGT
FT                   SVEGMGFAIPSNEVVKIINELVQKGEVVRPALGVATYDLSNISSSDQKSVLKLPTSVTK
FT                   GVVIMKTYSGSPAKAAGLTKYDVITELGGKKVTSLATLRSALYAHSVNDTVTVKYYHNG
FT                   KLKTANMKLTETTKTLTKQSN"
FT   gene            63072..63551
FT                   /locus_tag="JDM1_0057"
FT   CDS_pept        63072..63551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0057"
FT                   /product="SPOUT methyltransferase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60946"
FT                   /protein_id="ACT60946.1"
FT                   /translation="MNIKIICVGKLKEKYFKQGIAEYAKRMSKFAKFQIVEVPDEKAPE
FT                   SLSNAEMENVKAKEGQRILEKIKDRDYVYALAILGKERSSEEFAAEIDKLTTYGHSDID
FT                   FVIGGSLGLSPEVLKRADTQISFGRFTLPHQLMRLVLSEQVYRAFMINVGSPYHK"
FT   gene            complement(63643..64032)
FT                   /locus_tag="JDM1_0058"
FT   CDS_pept        complement(63643..64032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0058"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60947"
FT                   /protein_id="ACT60947.1"
FT                   /translation="MTGFIDYVFFGLTKQQMEFKFSNNLRISQSLISKLKNTFISTNEF
FT                   SRLRTIDDKNQRWKQLLTELDKFLNSTNINVKGLLATITNIQSLEQRSSIESRQHFWER
FT                   ISNNLATPEEIKSERKKQVDQRQIK"
FT   gene            64176..64922
FT                   /locus_tag="JDM1_0059"
FT   CDS_pept        64176..64922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0059"
FT                   /product="transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60948"
FT                   /protein_id="ACT60948.1"
FT                   /translation="MLSTVYLLSMSLLAGILTGIIGMASLTLYPVLLSIGITPISANAT
FT                   ITVATVGAGVGTVASSLKELKNHWKTALIVACLSTVGSIIGAFILIHSSNSGFKRVVPF
FT                   FILLAGSMLLWPSKNSSNHKELSLWRNVVGWLSVVLIGLYNGYFGAASGLLMIAVLSKV
FT                   VGGEYATYNAIRNFESFINNIVSAIMFIIMLKIQWQVMIPLVLGLLVGGYIGPIIVRFI
FT                   PSKIIKKIVGIIALILASILMYQAYF"
FT   gene            65736..66227
FT                   /locus_tag="JDM1_0060"
FT   CDS_pept        65736..66227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0060"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60949"
FT                   /protein_id="ACT60949.1"
FT                   /translation="MLPTATILVISQAPGRIAQNTKTYFNDASGDRLRDWMGVTREQFY
FT                   QSDRIAVMPLDFYYPGKGKSGDLPPRKGFMDKWHEPLLAMMPNVQLTLLVGQYAIKAYL
FT                   GRSRQKTLTATVQNYQDYLPDYFPLVHPSPLNYGWQKKNPWFQATVVPDLQRRVKAALK
FT                   "
FT   gene            66470..67120
FT                   /gene="pnb"
FT                   /locus_tag="JDM1_0061"
FT   CDS_pept        66470..67120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pnb"
FT                   /locus_tag="JDM1_0061"
FT                   /product="p-nitrobenzoate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60950"
FT                   /protein_id="ACT60950.1"
FT                   /translation="METIKAIHTRHSVRAFKDDPIEPQLLTMIVTDAQQTPSWGNSQPW
FT                   QVYIATGHALTNIKQHYATAAEQGMTEDADLAKVHRGDFSAFASQNMGHWVGTFRPVID
FT                   SDPTTYWDSRANLYRAPAIAYLVLDANPNSWSIYDLGAFSQTLMLAATARGVQSVPSYE
FT                   LVKYPAIVRNALGMPANKVVAMGIALGYEKPEKPLNQFRTDRVATPQVLHIIN"
FT   gene            67236..67604
FT                   /locus_tag="JDM1_0062"
FT   CDS_pept        67236..67604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0062"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60951"
FT                   /protein_id="ACT60951.1"
FT                   /translation="MPTKQRTYKIKSYVNASHAVRWATGSGKKHTHTWEIVCELHTVDA
FT                   MVAFYDIEKNLHQALDELSGKFLNDLPEFKTVNPTVENVTEYLFTKIDKTLRDNGAQLL
FT                   RIEVSDSPTRAYCISVTE"
FT   gene            67561..67671
FT                   /locus_tag="JDM1_0063"
FT   CDS_pept        67561..67671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60952"
FT                   /protein_id="ACT60952.1"
FT                   /translation="MIRQHALIVLVSPNKINERGHQERQLQLFLVALIFI"
FT   gene            complement(67672..68499)
FT                   /locus_tag="JDM1_0064"
FT   CDS_pept        complement(67672..68499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0064"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60953"
FT                   /protein_id="ACT60953.1"
FT                   /translation="MPKSAVSVILFIAVAIVGHNKEMINDDGIIICTQKCCSLATLFDR
FT                   TFQRSVWFESERNYIMQPTITTYQYSYITQQVNQLISAELAVNDLQIRAVVRAQAIERI
FT                   TPLLPSDNPITANFLPHLQTDRLTRAKAPQLLETLIPLIVPFPSLTTKQLSKLFRKVKK
FT                   LKQPVWSQLALHELTYLGWNDGGNQKKYLVIPDHDRLIGIQGDLAPQTVKGVCAICQTI
FT                   GNVALFMSTTKSSGLGPYTRNGNYICRDSNQCNRQLTNPQALADFLAVVRPKR"
FT   gene            complement(68666..71035)
FT                   /locus_tag="JDM1_0065"
FT   CDS_pept        complement(68666..71035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0065"
FT                   /product="fumarate reductase, flavoprotein subunit
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60954"
FT                   /protein_id="ACT60954.1"
FT                   /translation="MKYIALIGTAAQQSYNRELLQFMKHHFSQRATIDVNEITGIPLFN
FT                   EPTQNHIPATVQALNDKISQADGVIIGVPEYDHAIPAALKNVIEWLSYQLHPFANKPVM
FT                   LVGTSLGVQGTCRAQGDLRNILNAPGVDAQVLPGNEYMLSYAAKAFDQNGQMTDAPSIK
FT                   FLERCFDNFEKYVKALNGTPALNVNWHGNYDVIVLGFGGAGASAARFAADNGAHVLVVD
FT                   AAPFGREGGNTRYSAQHVVTGESLDKLTAYYQALGAPFSTPTKTLNAYLSGMSKIPAYF
FT                   EKYLGIKAVSWKHDIKPGDAVAIKKTMAEYPELAGSDTIDFALVHKRDKDAALWKLLRQ
FT                   KVLERADNIDVWLDSRAQHLIQDPNTKAIQGVQIKRGERLLNIHANNGVVLAMGGFENN
FT                   PELKQTYLHSDHLTPLGTLYNRGDGIKMAQEVDAKMWHMTNYESHGILPGITFKEDANE
FT                   RGRQIEHWPLLKNGSIFVIADDGTRYFQEDAKHRHGHVYTHGSWLIPMNNQHPYLIFDQ
FT                   TQYDAFKQEESQAGQLPYPKFMTKLVSAPTIAQSAAKLGVPANNLQQTVTDFNHYTEVG
FT                   RDFEFGRDPQTMRQLDDGPYYAIAAANDVLNTQGGPQRNENAQILNVNDEPIPRLFGAG
FT                   ELGGIVANCYQGGGNLAECLIFGKLAGENAARPKVDSESVTANEANGINDLVDGETASN
FT                   VKLAADQYLGSSNAGLGGKVIVRVTYNDHKIQAVDVIQHHESEDVGLTAIDQIPQEIVA
FT                   ANSTSVDAVSGASASSRAIKEAVQNALKQVKDSVTN"
FT   gene            71501..72916
FT                   /locus_tag="JDM1_0066"
FT   CDS_pept        71501..72916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0066"
FT                   /product="cation transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60955"
FT                   /protein_id="ACT60955.1"
FT                   /translation="MLSEIKWKGFLLPLIFGIGLWLVTPLRPVAISIMAWHLFAIFVAT
FT                   IIACITKPLPMMAVTLIGIVVATLTGVFTMDEVATGFGNSTAWMVAMCMFMAAGFIKSG
FT                   LGKRIAYLFVSLFGKRTLSLAYALSFVDAVLAIGIPRNNARVNGIMYPIIDNLSREMGS
FT                   DPKQGTQRKLGSFLVFNEYEVNNITSGLFLTGLAGNMVAIGLAKMQGITVTWMQWFMAA
FT                   CVPGILSLLIIPWVLYKVYPPEVKQTPDAHRWATTRLAALGKMTASEKIMSITFILAIV
FT                   LWLIGTKIGIDATEVSFIAVVILLITGVLTTNDLLNEHFAWNILVWLSIIMMMSKKLMT
FT                   LGFFPWFSKTLGHLLNGMNWISVLIILFLAYFYLHYMFPSVSTQISALYAGFLSIAIGA
FT                   GVPHVLAALLLAFAGSINLSTTPYSAGPAALLSSTGYVTSAEWWRLSAIIGVIFNVIWL
FT                   GGGLLWTKLLGFW"
FT   gene            73027..73914
FT                   /locus_tag="JDM1_0067"
FT   CDS_pept        73027..73914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0067"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60956"
FT                   /protein_id="ACT60956.1"
FT                   /translation="MNERDLKYFCSLVETGNYTATATKFHVTQPAISAALRRLEEEYQA
FT                   VLLTQANHRAQLVTTAAGRTLYIKSKQLLKDVAQMALEVHHANEQQVRLGFSNVAGGIW
FT                   LPRVIKKFISVDLLDQVTTAVADSEQLLVDLRQGKLDAAVFSTLVPERATDLRVSILEE
FT                   HQMQVLANVNSPLSHLKTIRATDLQGVPIIARPKHALSRLALEQYCQRGHIQPKIVYEA
FT                   ATNALVEGLVAQNVGVGVVIADSVVLSDQVVGIPLAAQEQLHCYMQLAVRKSFLPNANQ
FT                   QRCIDVLRQIRRAN"
FT   gene            complement(73984..74409)
FT                   /locus_tag="JDM1_0068"
FT   CDS_pept        complement(73984..74409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0068"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60957"
FT                   /protein_id="ACT60957.1"
FT                   /translation="MTVAIRYQTRNGNTQAFAEQIASVAGVPAQSIDTPVEQADTLFFG
FT                   GGTYFMKPDKTASAFMKNLDPTKIKQIALFTTSGGPEMVSDKALTKIATEKGIPVIGHF
FT                   HQVMGGKGMKIIGSAGGKLKDEQIELVKEFAQKMLAQ"
FT   gene            74901..75170
FT                   /locus_tag="JDM1_0069"
FT   CDS_pept        74901..75170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0069"
FT                   /product="arsenate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60958"
FT                   /protein_id="ACT60958.1"
FT                   /translation="MGIDISDQVSKLIDLTYLNQCAVVVTLCGDARDRCPVTPATVTRL
FT                   HWPLPDPARTTGSVSDQLLVFRQVRDQIKARVIDLARTLNVSAT"
FT   gene            75490..76350
FT                   /locus_tag="JDM1_0070"
FT   CDS_pept        75490..76350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0070"
FT                   /product="short-chain dehydrogenase/oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60959"
FT                   /protein_id="ACT60959.1"
FT                   /translation="MKDFKDKVMFITGAAHGFGQVIAEGAADRGMKLTIVDIDEPALKK
FT                   TYQHILDKGAEVLMVTADVTKEASVDDAVEQAMEKFGRIDLLINNAGIALPGRIWELPT
FT                   RDWEWIMHINLMSQVYAMKRVIQIMIQQKTHADILNVASIAGLVDTPGMPSYHASKFAS
FT                   VGMTEATAYDLQRANIDIDMHVMCPGFVQTDLYHTENHRPAQYSDPTDPYYQSEAYLKG
FT                   QQFAKYVITNGKPIDTIADTVFKALEDNRFYILTHPEYNPLIEDRVKRIVTDGAPDVHI
FT                   MDGIM"
FT   gene            76382..77227
FT                   /locus_tag="JDM1_0071"
FT   CDS_pept        76382..77227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0071"
FT                   /product="acetoacetate decarboxylase (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60960"
FT                   /protein_id="ACT60960.1"
FT                   /translation="MASFIASDQDVKNFLTAPSMNDQEGIGFAYATDEAVLKALIPAPL
FT                   KLMAPVVCGYVVHMGKPTFSAPYLEESLFALVSYKDKMMGAYPINLLLHGPGAESGVIA
FT                   GREGAGIPKKLADAIELRRNDNSATATVERHGKTLLNVSWTAGELNDPSIMKQFAGQLA
FT                   LGKEAEMNSFFYKYDIDQHEDGTNHFSNVQLVATQLRSLADQVEPGNLSIQLESTDDDP
FT                   FGELKVLKPLGAAWFHFDTSVMFNTLKLDEVDAATTMPKLLTGRYDRSFFNPKAATYII
FT                   "
FT   gene            77255..77908
FT                   /locus_tag="JDM1_0072"
FT   CDS_pept        77255..77908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0072"
FT                   /product="nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60961"
FT                   /protein_id="ACT60961.1"
FT                   /translation="MSEAVKNLVNNDLADVMFNRHSVRQFDPNVKIGRDELQKMIAEAA
FT                   TAPSACNLQSWHFVVVDTPEAKAKFKQAVMKFNYPQVDSASAIVFIAGDTQSHYVYRDV
FT                   WNKVYEDGNITKERLDQILGTFLPLYENATPDFLKFDATIDCSVVGMQLLLVARAHGYD
FT                   ANAFSGIDFEKMIPTLGLDPKRYVPVMGIAIGKAAQEPLHTTRYDAKTQTDFLA"
FT   gene            78077..79612
FT                   /locus_tag="JDM1_0074"
FT   CDS_pept        78077..79612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0074"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60963"
FT                   /protein_id="ACT60963.1"
FT                   /translation="MQLKPLLRQLATTFEVTVDPTFTHNPEVTHVQFVDSAEALASHRL
FT                   YLSPDSSQLVQLAYSWHGHRQSVGLVNLGTGLTTIIAAQNQLLKLLMTLGQCLHHDVQI
FT                   QAAINQLAIQAITADFDTTLAQAVHLLENPLAIIDLNGEILTRSHTTQLNGTSIHAAVE
FT                   TNRVGRWLLDHGFAPDTPDFLTQVYVAEDQLSAGPMLITPLANGTEPIGYLVMPALNKP
FT                   LNDRQALLINSLGQVIAGSLVKNQIMPTAESQRDRLLNLLLTEHQGGTFADQFAEQHVQ
FT                   LPTAMVLIRCEPLADQAPMILQQRLQYLMMPRFKQVLVSTYQQQCVALIPISLVAYNQN
FT                   QFKLTLQQITKQADCRLIVSQHYVNPEDTFAAYTVCERTAQLKTGRGRVIFCEDQFYNL
FT                   ALARVNHLEILPFFINPALRLLLAYDQQNHTELVPTLDVYLRATCNLTRTAKQLYVHPN
FT                   TLRNRLHHITTLTGCDLRDAETCFKLAASFKLRQFLTQHQYQYRPDIPIPTQD"
FT   gene            complement(79539..79760)
FT                   /locus_tag="JDM1_0073"
FT   CDS_pept        complement(79539..79760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0073"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60962"
FT                   /protein_id="ACT60962.1"
FT                   /translation="MTIVANHTPARRSNRNGGPITAVHPEFTDLLIMTDPAIFPQTVAR
FT                   FYAPLNLGSELEYPVDTGTDAGLKIAVI"
FT   gene            79943..80614
FT                   /gene="pgmB2"
FT                   /locus_tag="JDM1_0075"
FT   CDS_pept        79943..80614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgmB2"
FT                   /locus_tag="JDM1_0075"
FT                   /product="beta-phosphoglucomutase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60964"
FT                   /protein_id="ACT60964.1"
FT                   /translation="MSKFADIKGFVFDLDGVIADTSVYHSQAWHQLADELGVAWSEELA
FT                   DNLKGVSRMDSLNLILKTGGKENDYTEAEKVAYAAKKNTNYLNLLKGMDKTAILPGIED
FT                   FLADLAKHGYRLSLASASKNSPLVLEQLGLVHYFEARVDPATLKHGKPDPEIFERGAEV
FT                   LGLKPEECAGVEDAKVGIQSINGAGETSIGIGDPAILTGADVNFTSTSELTLANLKAAL
FT                   A"
FT   gene            complement(80700..81716)
FT                   /gene="bsh2"
FT                   /locus_tag="JDM1_0076"
FT   CDS_pept        complement(80700..81716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsh2"
FT                   /locus_tag="JDM1_0076"
FT                   /product="choloylglycine hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60965"
FT                   /protein_id="ACT60965.1"
FT                   /translation="MCTSLTYTNSHGGHFLARTMDFNVDFETRIMFMPRHYRVTGDLGD
FT                   FTTTYGFIGAGRQLNHEIFTDGVNECGVSIAALYFPNHAIYQPHSNQDKIDLAPHDFVA
FT                   WVLGKITSVADLRERVKDVQLISSTAELINEIPPLHFIISDQTGETAVLEPTSGELRLL
FT                   NNPVGVLTNSPNLKWQLQNLSKYGTLTNTERPLNKFINYQPGSQGPGTGALGLPGDYTS
FT                   MSRFARTVFLKHYAQVPATTTDTVNLLQHILNAVTIPKGAKVAANGQATYTEYRSYMDL
FT                   NHQTYALELYENPGVIQQVNLTDHLLEKQTVPLEYALSRTPHVQLLTPDIATLPVAH"
FT   gene            81989..83332
FT                   /locus_tag="JDM1_0077"
FT   CDS_pept        81989..83332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0077"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60966"
FT                   /protein_id="ACT60966.1"
FT                   /translation="MNKERKSVMPLSQRHHMTIPWKDFIRNEDVPAKHASLQERTSIVG
FT                   RVGILMLSCGTGAWRVRDAMNKIARSLNLTCSADIGLISIQYTCFHHERSYTQVLSIPN
FT                   TGVNTDKLNILEQFIKDFDAKYARLTVAQVHAAIDEVQTRPKQYSPLVLGLAAGLACSG
FT                   FIFLLGGGIPEMICSFLGAGLGNYVRALMGKRSMTTVAGIAVSVAVACLAYMVSFKIFE
FT                   YNFQILAQHEAGYIGAMLFVIPGFPFITSMLDISKLDMRSGLERLAYAIMVTLIATLVG
FT                   WLVATLVSFKPADFLPLGLSPLAVLLLRLPASFCGVYGFSIMFNSSQKMAITAGFIGAI
FT                   ANTLRLELVDLTAMPPAAAAFCGALVAGLIASVVNRYNGYPRISLTVPSIVIMVPGLYI
FT                   YRAIYSIGNNQIGVGSLWLTKAVLIIMFLPLGLFVARALLDHEWRHFD"
FT   gene            83481..84221
FT                   /gene="ptp1"
FT                   /locus_tag="JDM1_0078"
FT   CDS_pept        83481..84221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptp1"
FT                   /locus_tag="JDM1_0078"
FT                   /product="protein-tyrosine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60967"
FT                   /protein_id="ACT60967.1"
FT                   /translation="MEGITNLRSLGGYRNKNQQVIKDGLIYRSGQLDQLTPAQTQYLAT
FT                   TLGITRIVDMRSADERHQFPDATWPHVQYHVLDVLAQVMTNDASLQSMISSTGAVHDRM
FT                   VQLYEQLALDPTARQSYCQFIQLLLVPDQPLLFHCFAGKDRTGVALFLKILGISDEQIM
FT                   ADYLLTNQARAAANQQILATMASQLSDEQQRAVNQALLVDADYLSHYFEVIKARYDTFS
FT                   NYLQTGLGLTSAECQQLRELYLTK"
FT   gene            complement(84294..85541)
FT                   /locus_tag="JDM1_0079"
FT   CDS_pept        complement(84294..85541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0079"
FT                   /product="4-hydroxyphenylacetate-3-hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60968"
FT                   /protein_id="ACT60968.1"
FT                   /translation="MPRTVADLQQKHRAYQEIAQSNSGMLGRTPDFLNTGMAVLAERAA
FT                   FLGQNQYTDFAANARNYAKEVKANDIFISHALQNPQLNRQKAINAIPSGYAGVHTIERN
FT                   QDGIFVSGAKMVNTMAPIADDLLIFNPPELLLENGDSSYAVAFATPLNNPGVKIICRKL
FT                   LDHPTASITDYPLSNALDEIDAYIVFDHAFIPWSKVFVENNVEMSNRFFIDSGMFSHTS
FT                   HQDEVRGITKLELATSLALRIAHILGLDGFLGVQEKLGRLTANLELIKGTITRSEDNGH
FT                   LDEFGIYTPNLQALQAVRSTLPEYYDEALRVTQHLAAGSMVGVPSFAEFDGDNATILNQ
FT                   ALTTDRATAKTRTRLLNLAFDLTSSGFGQRQLMYEYYHGGDPMRIRAQHYQRADLQAGN
FT                   QMIDRLLSADNANTHE"
FT   gene            complement(85813..86313)
FT                   /locus_tag="JDM1_0080"
FT   CDS_pept        complement(85813..86313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0080"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60969"
FT                   /protein_id="ACT60969.1"
FT                   /translation="MGAYVKLKTDHNLEVIIMDVQSFFEQAKTTLKLTQSTPLQSAYQF
FT                   GSDPDKLAQLVLTGTKTATTSAYDLYETDEPLPKVGAYDVILDAHNQPVCVTRTDQVMI
FT                   TPYLDIDATHAYLEGEGDRTYAYWRRVHDAFFKQEYQSEHQRFDPHTAQMVLERFHVVY
FT                   PVH"
FT   gene            86406..87074
FT                   /locus_tag="JDM1_0081"
FT   CDS_pept        86406..87074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0081"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60970"
FT                   /protein_id="ACT60970.1"
FT                   /translation="MRINVLQHTPNEGPGMIADWAHAHGHTMYVYHPYQFGVLPTADET
FT                   EMLVILGGPMSPNDTLPWIKQERDLIQQLLDRDIPMFGACYGAQQIAKTLGYPVTKAPA
FT                   KEVGWAPIYRQSPVIPGIPAKLSVLHWHEEMFTVPAEATLLFSSDRVTNQGFVWKHRVV
FT                   GLQFHFEPAADNVREMVVNDYRYIAGSVLNQTAAEILQTPVPRENQQVLNAILNYITAE
FT                   "
FT   gene            complement(87162..88118)
FT                   /locus_tag="JDM1_0082"
FT   CDS_pept        complement(87162..88118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0082"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60971"
FT                   /protein_id="ACT60971.1"
FT                   /translation="MSPLKSFLGVIYMNRSERLNQELIFLSYRQEFHIKELMQEFNISK
FT                   RTALRDVNSLEQLGLSIYVEPGRYGGYQIMQQQLWVPILLNSQEINALFFALKALSLLS
FT                   ATPFEKSYHTIYKKLMATLSLSNQRQVAKLQRVVNYYSIPNLDAPTHLSDLLTAILDEN
FT                   VVQLTMTTVTAGFQIFDLLYRHGIWFFSGVNLDNNAWGIYRCDTIKAFQTSEQPARYTW
FT                   KQLAQRQRSYDHHHHNIRYKCALTPLGREHVQKNNYPNMHLTHQNDQDYLIGGYNQDEL
FT                   AYMVDYLLGLGRNVRIIYPEALKTAYLQELQQIQDFY"
FT   gene            88200..88847
FT                   /locus_tag="JDM1_0083"
FT   CDS_pept        88200..88847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0083"
FT                   /product="acyl carrier protein phosphodiesterase
FT                   (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60972"
FT                   /protein_id="ACT60972.1"
FT                   /translation="MTKTLIVNAHPDFRNAAHYSVQLEQAFLQLFQTRFPNDTVDVINL
FT                   YDTVIPQATVPELLGIWEKQAQHVNLSIEEQRLFAINQQLLQQFKAHHRIVIAMPLHNF
FT                   NVPARLKDYIDNILVARETFRYTENGSVGLMTDNYRVMLLQASGSIYTRNDRYTPMEFS
FT                   RLYLDKMFTEIMGFDRFEIVRAQGLQTNGVAVSQALKQAKMDLKAAFERFYD"
FT   gene            89109..91127
FT                   /gene="fusA1"
FT                   /locus_tag="JDM1_0084"
FT   CDS_pept        89109..91127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA1"
FT                   /locus_tag="JDM1_0084"
FT                   /product="elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60973"
FT                   /protein_id="ACT60973.1"
FT                   /translation="MKRIVAGIIAHVDAGKTTLSEALLYRSGALRQLGRVDNGDAFLDT
FT                   DVLEKQRGITIFSHQANLQYKDINLTLLDTPGHVDFATQTEQVLSVLDVAILVVSATDG
FT                   VQGYTRTLWRLLARYDVPTILFVNKMDAPGTDSDQLIQQIQQTLSPGCVAFNTPGAGDT
FT                   LEDRPVIPTAAVEDIAMQNDEVLTDYLETGTLSDATIRQMIQRREVFPCYFGAALKLDG
FT                   VDALMAGLDYWTTPQLTRPEFGARVFKITHDDQGERLTWIRMTGGTLRPKDIVYDDQKV
FT                   NQLRVYNGTKYATTSALTAGSVGAITGLTGTRPGQGLGQAATSLQPVMQPVLTYALDPQ
FT                   REELHTCLAALRQLEDEDPQLHVTWSEPLQELRVQVMGTIQLEVLQQILQDRFQLTVKF
FT                   GTGSILYQETITQAVEGVGHFEPLRHYAEVHLLLKPAPRGSGLQFTTDCSLEVLGRNWQ
FT                   HQVVSNLQAKTQVGVLIGAPLTDVKVTLVSGRASNVHSVGGDFREATWRALRQGLMMLN
FT                   QRGDCQLLEPWYRFRLEIGQEQVGRAMTDIQRMNGQFDAPVANTSVATDGTGLTTITGT
FT                   APVAAMQDYSQTVRAYTHGQGQLECIVDGYRPCHNEMAVVDKAEYVPTADLENTPDSVF
FT                   CAHGAGYPVAWNQVPEMAHVPYVYSNTELAHFKASSK"
FT   gene            91145..91831
FT                   /locus_tag="JDM1_0085"
FT   CDS_pept        91145..91831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0085"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60974"
FT                   /protein_id="ACT60974.1"
FT                   /translation="MMDVTFNSTFAVTLQHELHQPVLSLPLSLQIGDLTRLTTDDPAQL
FT                   AIMSHSTDATVVKQALVTLKSQVEQGGVLRVWWSTMPDDWLGYDWLCQQLADTDAQLRQ
FT                   VMVPLSQVITRPGLALQTLSDLSEVLPADIAHYLQLAQDVSKDEQRAHSYEWQALVVEN
FT                   APLRVNLNGHLVSVPADFYDSLLERQIQPGRPIVQIIGEMLIRYSLGLPDWWYRARLQH
FT                   ILSTRG"
FT   gene            91837..92721
FT                   /locus_tag="JDM1_0086"
FT   CDS_pept        91837..92721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0086"
FT                   /product="transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60975"
FT                   /protein_id="ACT60975.1"
FT                   /translation="MKKIAPLFVGLGAISFGIPASLFKIARRQGVVNGPLLFWSFLSAV
FT                   VILGVIQILRRARLRNQQTNWKQIGLVIAAGTASGFTNTFYIQALKLIPVAVAAVMLMQ
FT                   AVWISTLLGAVIHHRRPSRLQVVSIVLVLIGTILAAGLFPITQALSPWGLMLSFLAACS
FT                   YACTMQFTASLGNNLDPLSKTWLLCLGAFILIAIVWAPQLITAPTTPATVGWGVLIALF
FT                   SMVFPLVMYSLFMPYLELGIGPILSSLELPASIVVAFVLLDETIDWVQMVGVVIIITAV
FT                   ILPNVLNMRRIRS"
FT   gene            92920..93225
FT                   /locus_tag="JDM1_0087"
FT   CDS_pept        92920..93225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0087"
FT                   /product="acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60976"
FT                   /protein_id="ACT60976.1"
FT                   /translation="MALTYRIVRAEANSDFGKIRQLYYETWQSAYRDLIPASYLQQLTP
FT                   TTWRPERRWQNMLLAMTAVGEVVGVCTFGPARHANYEGWGELYSLYVHPNYHLVSS"
FT   gene            93297..93401
FT                   /locus_tag="JDM1_0088"
FT   CDS_pept        93297..93401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0088"
FT                   /product="acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60977"
FT                   /protein_id="ACT60977.1"
FT                   /translation="MAQRFYQRNGFHDTGQIYVDHAPFGVLHERIFED"
FT   gene            complement(93431..94105)
FT                   /locus_tag="JDM1_0089"
FT   CDS_pept        complement(93431..94105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0089"
FT                   /product="intracellular protease/amidase (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60978"
FT                   /protein_id="ACT60978.1"
FT                   /translation="MKKVLIVETNITRYQGTNEPTGLWLGEAAEFVDEMQQAQIAVDYV
FT                   SPNGGFVPLDPRSMKYTDAATMAVYEDSDFINRALKNTLKPSQVDPDDYTAIYYTGGHG
FT                   VMWDFPDNPELQAIALAIYQHGGYVTSVCHGIAGLLNIKDQTGQYLIAGKTITGFTATE
FT                   ELIAGKKRIVPFLNRERATAHGAIFSQHRFYREYAITDGQLITGQNPFSARAVARQLIA
FT                   KL"
FT   gene            complement(94143..95147)
FT                   /locus_tag="JDM1_0090"
FT   CDS_pept        complement(94143..95147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0090"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60979"
FT                   /protein_id="ACT60979.1"
FT                   /translation="MKAAIITKYKQITPMVTEVPVPTIAPTDVLVKIVAASVNPIDLKT
FT                   KDGDLRLLLQYTMPLIMGSDFAGVITAVGDQVPGFKVGDAVYGRAPKDRIGTFAEFIAI
FT                   DHQAIALKPANLNFEEAAAIPLVGLTSYQALHDIMNIQPGQKVFIPGGSGGIGIIAIQL
FT                   AKYFGAYVATTTSAKHFDLVQSLGADKIIDYHQQDFTDVLSHYDAVLDTRGGQSLEAAF
FT                   QIIKPGGQIVSIAGLPNARFGKDYGLPIWKQWLLGLATRKLSRLEQQAQATYSFLFMQP
FT                   SGQQLVRLRQLIEQGVIKPVVDRIIPLTDINAALEYSHSGHATGKIIISIQPN"
FT   gene            95329..95637
FT                   /locus_tag="JDM1_0091"
FT   CDS_pept        95329..95637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0091"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60980"
FT                   /protein_id="ACT60980.1"
FT                   /translation="MAIFKKGVPIFTILQDENRQRILVMLCRTDQMTVNQITAQIALSR
FT                   PAVSHHLKLMLDAGILAVSKTGTERYYRANMTATLKLLKALTASLEADLAHTQSVDE"
FT   gene            complement(95806..97140)
FT                   /locus_tag="JDM1_0092"
FT   CDS_pept        complement(95806..97140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0092"
FT                   /product="cation efflux protein (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60981"
FT                   /protein_id="ACT60981.1"
FT                   /translation="MNDLFEKAPIPKAYFHLAFPVVLGMVASMIYNLADTFFVAQTGNA
FT                   DLVAGIALGSPLFSFMLAVGDIFGLGGSAVISRVLGRHDYHQSARISSFCFYIAIALSL
FT                   VLTALLLLFEQPILGLLGATAATRPYIADFYRILVLGSTFIIVSLVPGNIIRTEGLAQL
FT                   SMIATISGTVLTIILDPLFLFGFHWGASGVAFANVLGYAVNTSLLVFFMRRAKTLSLAP
FT                   KLAHISRPTLKAVVAVGIPASLTNLTQSFGMMILNSYLAAYGAQAVAAMGIVQKVYMVV
FT                   MMIMVGFAFGAQPLVGYTYGAKNWQRLRATLRFDLKVEGGYATICAIILMIFAPQLIKL
FT                   FMNQPAIVTMGTQMLRAMLITTPLVGFILVFTTVFQSVGAGLSALAMALSRQAILLGIA
FT                   IVILAQFFGLTGIIWAQAVADVLTCLLGWLLYRHTFKDIQVPSSN"
FT   gene            98521..98961
FT                   /locus_tag="JDM1_0093"
FT   CDS_pept        98521..98961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0093"
FT                   /product="prolyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60982"
FT                   /protein_id="ACT60982.1"
FT                   /translation="MPFNGYQTYYRIVGDRQSNKTPLVLLHGGPGSTHNYFEGFDDLAV
FT                   QTGRPIVMYDQLGCGRSSIPDDDQLWQAATWVAELQALRTYLDLPEIHLLGQSWGGMLA
FT                   IIYGCDYRPQGIKSLILASTLSSARLWAQEQHRMIRLMSPAD"
FT   gene            99034..99384
FT                   /locus_tag="JDM1_0094"
FT   CDS_pept        99034..99384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0094"
FT                   /product="prolyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60983"
FT                   /protein_id="ACT60983.1"
FT                   /translation="MTQHASGPITADDPEFLRRSKRVGTTAYNVAWGPNEYNPTGTLAD
FT                   YEYTDRLQYLQMPTLVTSGTDDLCTPLVAKTMVDQLPHATWTLFPRSRHMAFVDENTAY
FT                   MTRLRHWLAAHD"
FT   gene            complement(99566..100312)
FT                   /locus_tag="JDM1_0095"
FT   CDS_pept        complement(99566..100312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0095"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60984"
FT                   /protein_id="ACT60984.1"
FT                   /translation="MKIIIAPAKKMIIDQDAFPALTEPIYLDQTQQLLAQLQHLTYPEA
FT                   KTLWHCSDKLAQPNYDWLQKIDLTRNLTPAILSYSGIQYRYMAPDVFTQPALDYIQTNL
FT                   RILSGFYGILRPFDGIVPYRLEMQARLAVGQAKNLYAFWGNRLYQALTPRPEPIINLAS
FT                   QEYAKTIAPYLAPHQSMIDIVFASLIDGKLKTKATLAKMARGAMVRFLAEHQIDDVTAI
FT                   RTFDHPDYQFDEKRSTANRFVFIYQH"
FT   gene            100482..100916
FT                   /locus_tag="JDM1_0096"
FT   CDS_pept        100482..100916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0096"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60985"
FT                   /protein_id="ACT60985.1"
FT                   /translation="MDISLLKQVVQSTNKIALSTAVNNEADVKIVNFVWYEAQPDTLYF
FT                   SSVKTSPALKVYDQNPDIAFITIPNDGTAGNPYLRAQHVKLQRSTKTMTDLLPQYLETV
FT                   PNYQQVWDAIGSTLVVFELKLTDLFVDAGVGGEKQTLTFN"
FT   gene            complement(101019..102662)
FT                   /locus_tag="JDM1_0097"
FT   CDS_pept        complement(101019..102662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0097"
FT                   /product="extracellular protein, peptide binding protein
FT                   OppA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60986"
FT                   /protein_id="ACT60986.1"
FT                   /translation="MSLSGTHKLILTIGSVAIIGGIGFTVNAHSHPATTKQSQVINLSA
FT                   GSEIMSLDPAKMTDSVSNSQVTQVDEGLYRLNSQSQPINALATKTTVTNGGHTYTIQLR
FT                   HDARWSNGNKVTAHDFVYSWRRTLDPKNKSEFTYVFTNIKNADAIAAGKKKPSTLGVKA
FT                   NGDYQLTITLSKPVAYFKKILAVSTFYPVNQNAVNKYGKKYGTSAATTVYNGPFTLTGW
FT                   TGTNNTWTLKKNSAYYDHKLVKLHQINYQVIKSNTTAYNLYQSNKLDSVTLNGEQSVQN
FT                   KNNQELKTLAGGQISFIQYNHHDHVAANRELRTALSLAINRSQLTNKVLENGSLPAKSF
FT                   GVRNMAKNPKTGTDFVNDATVDGTVNYNLNQARAAYHKAQRQLGKKSLTLTITCGDDDN
FT                   SHQVAEFIQGQLTSHLPGLKVTIKAMPFTAMLGKVSKGAFQLNLTSWSMDFADPSQSLT
FT                   ILTGDSNSNMGHYQSKAYDQAMQAADGPDALNATKRYQDLVQAAKTALTDQAVTPLYEG
FT                   RSHLLVKSHLKGVIYNNFSGAANYRTAYVK"
FT   gene            103331..104080
FT                   /locus_tag="JDM1_0098"
FT   CDS_pept        103331..104080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0098"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60987"
FT                   /protein_id="ACT60987.1"
FT                   /translation="MSFRVVAGYFGEFSDEAKRANQDLGVIGMSFQYQCNLVYPEGAGP
FT                   NFGFRTDAQAIDVFDALKVGYDGFKVQAGLIKAMGLVDYQLVGGRYELVGHDFRELPLA
FT                   EINANLETMPGLLAQGPMPVRYVTYRRTDDPIDAVGFSGNWALGDSGGFRQLSETLAEP
FT                   MQAPVAALIKAIDQLGLTLQQINLPTPQSSTALPTHLSDDVHQANVDVWVVLTQPQGDE
FT                   QQVLQTIHNAQECNEKLCEALTRVYLK"
FT   gene            104338..105117
FT                   /locus_tag="JDM1_0099"
FT   CDS_pept        104338..105117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0099"
FT                   /product="adenylyl transferase (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60988"
FT                   /protein_id="ACT60988.1"
FT                   /translation="MMTSTPRLLQAIQQTTTAILKTNLVGIYLHGSYVLGSYNEQVSDL
FT                   DYLIVVRRSLTLAEKRQLMTATITQLWPLAPHKGLEFHVLLLSATQHFVHPCPFDFHFS
FT                   KYHYEDYQRTPLAYLKAMHGTDPDLAAHLTILQAAGQVLLGPAITTVFGPVPATAYWDS
FT                   IKSDIANAETAIVQLPMYTVLNLCRVRAYQQDQLIISKQAGGEWGLQQLPTQWHPLIRQ
FT                   ALAAYAGQQDEQVIRWSRPNLVAFARIMLAELDLKSE"
FT   gene            complement(105185..105418)
FT                   /locus_tag="JDM1_0100"
FT   CDS_pept        complement(105185..105418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0100"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60989"
FT                   /protein_id="ACT60989.1"
FT                   /translation="MLNPNTEIHRGWNRRVVTGKTLAECDERLVKYLNDQDYGSGEFVV
FT                   LHENDGSNENTGYDLPDGDNCYISFLIYNSRL"
FT   gene            complement(105439..106170)
FT                   /locus_tag="JDM1_0101"
FT   CDS_pept        complement(105439..106170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0101"
FT                   /product="cobalt ABC transporter, ATP-binding protein
FT                   (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60990"
FT                   /protein_id="ACT60990.1"
FT                   /translation="MVLIKLVNICYDYPDTCGLKNLSLTVNSGDFVCLMGPNGSGKSTL
FT                   LRLLSGLASPTSGTYQFHDQPITTTYLADAQNRQQLHQRIGMVFQNTDVQLFNTSVTEE
FT                   VAFGPRQLGLSAAMVAQRVADCLQLTDCANLADRVPYQLSGGEKKRVALASVLALNPEI
FT                   LLLDEPLNGLTIAAQQQMLTLLQRLQAAGKTIIMASHNYQQVQAVGERFIIFNSTHQVD
FT                   ADLTRADLDQQPARQAQLMTL"
FT   gene            complement(106172..106993)
FT                   /locus_tag="JDM1_0102"
FT   CDS_pept        complement(106172..106993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0102"
FT                   /product="cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60991"
FT                   /protein_id="ACT60991.1"
FT                   /translation="MKPTRPNTDIPAWLQTTTTTPTPAIKAKFWQRNQRHLRQLLSRLA
FT                   QPAPVTATSHWRVAPQFKLIQLLLLVILIALSNNLILLWGLALLVGCQLLWLPPRQLRR
FT                   FMGSWLISVGMAMLFVLPSYWLAGPTTLLFFGLKTSLMLANAQYYRLTTPFQDLLAGLK
FT                   ALHCPDLLIMTLAIAITYLRMLGQHLLLTMEALELRTVAPTAHPYRLIGALFGNLYLKS
FT                   YTYALELYAAMEARGFNGHYVRSTGRRTHWRDYLALSPAIIVWILFIFWRH"
FT   gene            complement(106968..107954)
FT                   /locus_tag="JDM1_0103"
FT   CDS_pept        complement(106968..107954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0103"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60992"
FT                   /protein_id="ACT60992.1"
FT                   /translation="MHIPDNYLSPATCGTLVTAMAPVWTVAVLKVKVQIKKHHETLPML
FT                   GIAASLAFLIMMFNLPIPGGTTAHAVGGTLLAVLIGPWAACLALTVTLLLQALLFGDGG
FT                   ILAFGANALNMAVIMPFVGYACYRLGQKWHHEKLGLAIGAYLGINMAALVAGIELGLQP
FT                   ILAHTASGAPLYCPYGLNITIPAMLTAHLLVAGWVEVVFTLLVFQFVKRVAPTNLYQTP
FT                   TRRNQRPWIALLLGLAVLSPLGLLASNTAWGEWSPQELQQRLAQQHISTHAPQGMVHGF
FT                   HFQALFSDYAIAGLPVSVGYILSAITAVLIFLLLIRGLQHETDTSQH"
FT   gene            complement(107969..108634)
FT                   /locus_tag="JDM1_0104"
FT   CDS_pept        complement(107969..108634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0104"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60993"
FT                   /protein_id="ACT60993.1"
FT                   /translation="MVLTDIEYLLSYLEAHHVPTIKKKRHTYLTYHGLAEHYTYVLKDG
FT                   IIKNSIILQDGREYNLSYIAKPDVISLLRDEVSRSTDQPFNVRIESEYATFYQVNRVAF
FT                   WKYVNSTPELQNYVKNYYRKKLSENILRLQRMVMNGKKGAICAFIYSLVDLFGRKVNEG
FT                   ILIDFVVTNDDIAGFCGISSRSSVNRMLKELRTDGVITVKNHKFIIQDVSYLLDQIAN"
FT   gene            108887..110161
FT                   /locus_tag="JDM1_0105"
FT   CDS_pept        108887..110161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0105"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60994"
FT                   /protein_id="ACT60994.1"
FT                   /translation="MVAIDLPYDKRTITAQIDDENYAGKLVSQAATYHNKLSEQETVEK
FT                   SLDNPIGSDKLEELARGKHNIVIISSDHTRPVPSHIITPILLRRLRSVAPDARIRILVA
FT                   TGFHRPSTHEELVNKYGEDIVNNEEIVMHVSTDDSSMVKIGQLPSGGDCIINKVAAEAD
FT                   LLISEGFIESHFFAGFSGGRKSVLPGIASYKTIMANHSGEFINSPKARTGNLMHNPIHK
FT                   DMVYAARTAKLAFIINVVLDEDKKIIGSFAGDMEAAHKVGCDFVKELSSVPAIDCDIAI
FT                   STNGGYPLDQNIYQAVKGMTAAEATNKEGGTIIMVAGARDGHGGEGFYHNLADVDDPKE
FT                   FLDQAINTPRLKTIPDQWTAQIFARILVHHHVIFVSDLVDPDLITNMHMELAKTLDEAM
FT                   EKAYAREGQAAKVTVIPDGLGVIVK"
FT   gene            110163..110903
FT                   /locus_tag="JDM1_0106"
FT   CDS_pept        110163..110903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0106"
FT                   /product="NCAIR mutase, PurE-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60995"
FT                   /protein_id="ACT60995.1"
FT                   /translation="MATTAEILQQVAAGQLSPTVAAQQLEAGKTAALGFANVDLDRQRR
FT                   NGFPEVIYGAGKTATQIVGIVQALSQQTLPILTTRLSAEKFAALQPALPTAVYHATAQC
FT                   MTVGEQPAPKTPGYIAVVTAGTSDQPVAEEAAVTAETFGNRVERVYDVGVAGIHRLFAK
FT                   LDVIRGARVVIVIAGMEGALASVVGGLVDKPVIAVPTSVGYGTSFQGMTALLTMLNSCA
FT                   SGITVVNIDNGFGAAYSASMINQM"
FT   gene            110934..111725
FT                   /locus_tag="JDM1_0107"
FT   CDS_pept        110934..111725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0107"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60996"
FT                   /protein_id="ACT60996.1"
FT                   /translation="MQTLYLDAFSGISGDMFLGALLDLGLDFEQLKTELAKLHVHGYEL
FT                   TQQREAQSSIYGTSFDVQVAGGKDHGFVEHHHHQHEAGHHHDHEARHLADIEALIDGSD
FT                   LSDTVKHHAKAIFMEIAQAEAAVHHMPLAEVHFHEVGALDSIVDIVGCCIGLELMQIDT
FT                   IMASPLSDGSGFINVAHGQMPVPVPAVMQMRVGSAIPIQQRLDVHTELITPTGMGLVKT
FT                   LVREFGPLPENAVPTRVGYGFGKRDTGGFNALRAVLFEKKN"
FT   gene            111764..112195
FT                   /locus_tag="JDM1_0108"
FT   CDS_pept        111764..112195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0108"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60997"
FT                   /protein_id="ACT60997.1"
FT                   /translation="MIEANLDDQTGEGLGYVMNQLLTAGAYDVFFTPIQMKKDRPATKL
FT                   TVLGNVNDKDLLTKLILQETTTIGVRYQTWQRTIMQRHFLTVATPYGDVQVKVATYQDI
FT                   EKKMPEYADCAQLAQQFHIPFRTVYQAALVAVDQLDEEA"
FT   gene            112200..112916
FT                   /gene="glpF1"
FT                   /locus_tag="JDM1_0109"
FT   CDS_pept        112200..112916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpF1"
FT                   /locus_tag="JDM1_0109"
FT                   /product="glycerol uptake facilitator protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60998"
FT                   /protein_id="ACT60998.1"
FT                   /translation="MVHQLIAEFMGTALMIIFGVGVHCSSVLKGTKYRGSGHIFAITTW
FT                   GFGISVALFIFGNVCINPAMVLAQCLLGNIAWSLFIPYSVAEVLGGVVGSVIVWIMYAD
FT                   HFKASTDEISPITIRNLFCTAPAVRNLPRNFFVELFDTFIFISGILAISEIKTPGIVPI
FT                   GVGLLVWAIGMGLGGPTGFAMNLARDMGPRIAHAILPIANKADSDWQYGIIVPGIAPFV
FT                   GAAIAAWFMHGFFGIN"
FT   gene            112941..113771
FT                   /locus_tag="JDM1_0110"
FT   CDS_pept        112941..113771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0110"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACT60999"
FT                   /protein_id="ACT60999.1"
FT                   /translation="MATLATKKATLVAALKDLQRVTVAFSGGIDSTLVLKMALDVLGRD
FT                   NVTAVVANSELFTDEEFDKAMSLAEELGANVQGTTLDYLSDDHIKNNTPDSWYYAKKMF
FT                   YSRLNDIAANNGSTAVLDGMIKNDENDYRPGLKARSEAGARSLLQEADFFKTDVRALAQ
FT                   ELGLTNWNKVASCSVSSRFPYGTTLTHDNIAQVMAAEKYLRSLGFPTVRVRFHNDIARI
FT                   ELPEARIGDFLVFNDRVNRQLQSLGFRYVTLDLGGFRSGRMNDTLTKAQLATFA"
FT   gene            complement(113778..113846)
FT                   /locus_tag="JDM1_0111"
FT   CDS_pept        complement(113778..113846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0111"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61000"
FT                   /protein_id="ACT61000.1"
FT                   /translation="MNHDHRRSAAHLRLIPTPLSLI"
FT   gene            complement(113971..114948)
FT                   /locus_tag="JDM1_0112"
FT   CDS_pept        complement(113971..114948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0112"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61001"
FT                   /protein_id="ACT61001.1"
FT                   /translation="MQALVVPDPSAQTMEQLQWQERPMPNLGPTEVLIKTQAVGLNPVD
FT                   FKLVAAGNAAWQYPHTLGLDTAGIVEAVGAEVTNFRPGERVCGHANLANNGTFAEYVSL
FT                   PAAVLAKIPTTVSFEAAAASLCAGLTAYQALLRKANLNAAQTVLIHAGAGGVGSMAIQL
FT                   AKAAGKTVFTTVSQAKQAFVAPLHPDAQIDYHHEDVTTRIQDLTQQHGVDLIINTIGHA
FT                   DADLPRLAYNGQLVCVLATPDHFPSNQVVTISKLDLGGAHRSGNPAQVADLGQMTAALL
FT                   ALVQTGKVDPLITQVLHRDQLVTGLQQLQAGQVVGKLVVTFDAC"
FT   gene            115304..116095
FT                   /gene="thiM"
FT                   /locus_tag="JDM1_0113"
FT   CDS_pept        115304..116095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiM"
FT                   /locus_tag="JDM1_0113"
FT                   /product="hydroxyethylthiazole kinase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61002"
FT                   /protein_id="ACT61002.1"
FT                   /translation="MELQLLNTLRDHNPIVFNIANFVTVQDVANGLNALGASPIMSAEV
FT                   QEAETMVQIAGAVCINLGTLTTTQIDQMRVVGKLANQYHKPVVLDPVAVGAVPYRKEVA
FT                   LALLSDFQVDVIRGNAGEIAALAGMDWQAKGIDAGSGQGDLVEIAQACTQQFQCCVILS
FT                   GPTDVITDGQRVVKVANGTPLFQRHVGSGDLLSSIVAAFTAVSPTDIYQAAQVACLVLA
FT                   GAGELVASQLTADRPATFAIDLIDRLSLVTVSEIQTIAKVD"
FT   gene            116121..116945
FT                   /gene="thiD"
FT                   /locus_tag="JDM1_0114"
FT   CDS_pept        116121..116945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiD"
FT                   /locus_tag="JDM1_0114"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61003"
FT                   /protein_id="ACT61003.1"
FT                   /translation="MDEFPQVATIAGTDSGGGAGVMADLKTMQARHVFGTAVVVAVTAQ
FT                   NTLGVQDFMAMPTKLIDEQFASLAADLDIRACKTGMLADAEHVHAVVENLKRFDFGPLT
FT                   VDPVMIAKGGAALLAADAIKTVRDELLPLATVVTPNLPEAEQLTGQSITSNQAMVKAGH
FT                   SLQGLGADNVIIKGGHGDNPDLANDFVLLADGTAFWLSAPRIDTVRTHGTGDTLSACIT
FT                   AELAKGRSMAAAIKTAKAYVAGTIQDGIQVGHGHGPLNHWATPSEQVIVYDA"
FT   gene            116935..117588
FT                   /gene="thiE"
FT                   /locus_tag="JDM1_0115"
FT   CDS_pept        116935..117588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiE"
FT                   /locus_tag="JDM1_0115"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61004"
FT                   /protein_id="ACT61004.1"
FT                   /translation="MTLKFELTQLRAYFVCGTQDVPGQDLNVVVQTALDAGITAFQYRD
FT                   KGNSQLTTAERFALGQQLRERCAQAHVPFIVDDDVKLALALQADGIHVGQKDDRVTQVI
FT                   QRVANQMFVGLSCSTLAEVQIANQLEGIAYLGSGPIFPTTSKADADPVVGLTGLRQLVM
FT                   TASCPVVAIGGITVAQLPAIAATGAAGAAVISMLTRSPDMAATVKAMLTATEGH"
FT   gene            117588..118787
FT                   /locus_tag="JDM1_0116"
FT   CDS_pept        117588..118787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0116"
FT                   /product="purine-cytosine transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61005"
FT                   /protein_id="ACT61005.1"
FT                   /translation="MKHDGIFRSQFLLWIGAAISIAEILTGTLMAPLGLTRGLAAIVLG
FT                   HLIGCGLFLVPAGYLGAKLHQSALASAQLAFGRGGVLLASGLNALQLVGWTAVMIVNAQ
FT                   LAMNSISGKLFGFRSPLLMATIVAILIIAWLLMGSQLLFKINNAVVGLLVLGTVLMLVM
FT                   VFMAPTTSQSVSTTSMTFGQAVELNVTMALSWLPLIGDYTQRVDRPLPVALVSAGGYML
FT                   GSLVMFVTGLLVVLRTGQTDITALLTRSGLGLVALLIIVFSTVTTTFLDTYSAATSLAN
FT                   LTGSRHVNRLAVGVTVVGLLIALTVAMTYYQNFLYLIGSVFTPLYAIIFVTYFVRHATL
FT                   PYWLNFCWWVVGIVAYYQLQAIDFIGGTTLLVLVGLSIAVWLTGIIVKPTELEYRELSH
FT                   "
FT   gene            118869..119609
FT                   /locus_tag="JDM1_0117"
FT   CDS_pept        118869..119609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0117"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61006"
FT                   /protein_id="ACT61006.1"
FT                   /translation="MVKPIIGIAPGVVTVNSQMFPGRVRDYVNRDYLKSVTDNGGVPLV
FT                   LPVTTDATTIERYVGMIDGLLLCGGADVASLTYGEEPQPKLGGVNPERDQYEIALIRAT
FT                   HAVGKPVFGICRGLQILNVCYGGNLYQDMSELPAGQGTLKHMQGQLAAYGMHHVKVVPG
FT                   TTLAEYLGTTSDAIAVNSFHHQAVKQVATGFQVVAQSADQVVEAIEATAGGLQLGVQWH
FT                   PEMMQQVNSVQARLFAAFVRACVA"
FT   gene            119853..121445
FT                   /locus_tag="JDM1_0118"
FT   CDS_pept        119853..121445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0118"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61007"
FT                   /protein_id="ACT61007.1"
FT                   /translation="MERIEAGMSVMTLKKQTYRVIAVINQGQELLVRAHEPETADIEII
FT                   PVTTVVQVTEQNSTDDAAVALDTVTVVGERYVDDIVATLTTLGVGMAVLLQRESGNQYD
FT                   DNAISVWTLQHAKLGYIARYQNQPYATLMDQGQRLYGIVTVLDQQKQHLELMLWRTTAV
FT                   PSPIEALQIRQRLAKPRTNLGAVPTHSLQTPLGTIVMMCNGHPIKYQQVPLSPWLTPAD
FT                   ELHVTKRYLLTPDWSQVPPDSLITCQVTAKADVVQRWQNEHISAAVLTNASSFYVVGIS
FT                   AQTKTGLNDNLVDDAAQPAVIYRVGQVSAHMQAGFMVSWAPFGDPRVQPALKLALHFSS
FT                   QPLVPYHPVTPSRTNATFTQQELAALLVSALPNYQGGQRLEPSVTAITVEKLRQTLGDQ
FT                   TYHALANYQRHVQLVAGSTEGVNETLLQALIHAVTYHELTTMHYYQPTVGMVDQVIYPI
FT                   QLFSTTTKDEDDAQLVGCLALYNYETFEIQQVPLTAIARIAIIADPEHPQTTPETESPD
FT                   WLRIFLHGWNDDF"
FT   gene            complement(121561..122031)
FT                   /locus_tag="JDM1_0119"
FT   CDS_pept        complement(121561..122031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0119"
FT                   /product="NTP pyrophosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61008"
FT                   /protein_id="ACT61008.1"
FT                   /translation="MANYIKEIRALVGHKPIILNTAAGILVNDQQQVLLNLRTDTHNWS
FT                   LPGGYLEYGETYATACVREYKEDSGIDVEVVDRIGIFDKGETAYPNGDVAQIISALFLV
FT                   KPIGGHVLTQATDETLKLDYFDFDNLPPLLNQQNADMIHAAQEYLQTHSATK"
FT   gene            122264..123628
FT                   /locus_tag="JDM1_0120"
FT   CDS_pept        122264..123628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0120"
FT                   /product="amino acid transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61009"
FT                   /protein_id="ACT61009.1"
FT                   /translation="MQRKLSTGQMQMIALGGTIGVGLFMGSSSTIKWTGPSVLIAYIVS
FT                   GAFLYLIMRALGEMLYVDPNTGSFAKFASEYIHPVFGYLTAWSNIFQFVVVGMSEMIAL
FT                   GGYCRYWWPNLPDWIPGLIAIVFLCAANLISVKMFGTLETWFSLIKVVTIILMIIAGLG
FT                   LIIFGIGNGGHPIGISNLWTHGGFFTGGVKGFVFALAIVLASYQGIELIGVTAGEAENP
FT                   QSTIVKAIRSTVARILIFYVGAIFVIVSIYPWDKLSQIGSPFVQTFAKIGITAAASIIN
FT                   FVVITASLSGTNSGIYSASRMTYTLAESHQLPRKMTLLNRHGVPFYSVIAIATGILIGV
FT                   VLNVVLPMFFKDASEIFVMVYSSSVLPGMVPWFVILVSQIAFRKQNAAKMANHPFKMPL
FT                   SPYSNYLTLAFLALTLVFMFINPETRYSILVGVVFLVIMTLIYFRKYAGNKEETL"
FT   gene            123656..124435
FT                   /locus_tag="JDM1_0121"
FT   CDS_pept        123656..124435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0121"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61010"
FT                   /protein_id="ACT61010.1"
FT                   /translation="MLLFWAFIALKLGINIIIRKSGGTMVKQGHYAKVSKQKRLRQLKQ
FT                   RRQAQEKRAIMPEMVSEFLQVRYHLTQAAKQRPAMRQMMQRFMAQWLAAGQAELSDNGQ
FT                   TTWSVVALTKQTLQTFNRQLPWQGYALVDQEMARWTAFLNKEVPAVPLSERITLTEALS
FT                   PATWQACLSEQLAINALLALTGDSRQLGQITTEQVRQLQNSIQTATGIDWEKVAQLLDS
FT                   TVIAQNTLSEAGLDDKTRQWLEKLQKLTPQDFNNHVE"
FT   gene            124460..125242
FT                   /gene="hpo"
FT                   /locus_tag="JDM1_0122"
FT   CDS_pept        124460..125242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpo"
FT                   /locus_tag="JDM1_0122"
FT                   /product="halo peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61011"
FT                   /protein_id="ACT61011.1"
FT                   /translation="MHFITSDHVQLDYTDEGQGQPIVILTGFGGAKDIWRAQIPVLIQA
FT                   GYRVINLDGRCQGLSEHTAKGLRMSRRAVDAHELIEKLQLEQPILLGNSMGAATWFAYV
FT                   SLYGDTGIKALIDVDQTPRMINTPHWQYGFKQVQWQDIPDYFRMPLGHSTFKHIDDATY
FT                   ARVKAVEAQAPFDAKLMFPLLVNHAVQDWRDVIRQLTVPFLIIAGAKSPFFNPDFAAVT
FT                   AQMALRGQSVVIPEAGHIVMAEQSAAFNKALLEFLATC"
FT   gene            complement(125438..128176)
FT                   /gene="pacL1"
FT                   /locus_tag="JDM1_0123"
FT   CDS_pept        complement(125438..128176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pacL1"
FT                   /locus_tag="JDM1_0123"
FT                   /product="cation transporting P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61012"
FT                   /protein_id="ACT61012.1"
FT                   /translation="MIKDDNQSLTSNEEQNDTQNPPDADNLWQLDESALAAKYATDPEN
FT                   GLSTAEAAERLQHNGRNELETKRTSRFVQFIKQFNNSIIYILAAAAVLTFFMHHYSDSI
FT                   VIGLVIIANAIIGYVQERQAGNALERIREMLISKNFVIRDGKKLEIDARELVVGDLVNL
FT                   EAGDAVPADMRLISADNFNVQESVLTGETNPVEKQEEPITETTPALADRKNMVYASTAV
FT                   TSGSAVGIVTATAEDTEIGHIQQSVSDVKQTTTPLMRNLNSLGVGLSIAIVVAAVLLFL
FT                   LGMVMDTYSLPTLLIAVITMVVGSMPEGLPASTSVVLAMGTRQMTKKNVIVKSLPAVET
FT                   LGAVDIVNTDKTGTLTKNEMTVTKVVTPEHTFDVTGVGYDDNGGVNFDGHLKLNGNKVD
FT                   WHQDNAMEWLVKIAGQTTDAELHFENNRWELTGEPTDGALTTLYRKMTGHDPEVEEVDS
FT                   LPFDSAFRFSARLADLDGQRLLMVKGSPATVLRLTDQANQTAYWDDAMDDLTADGLRVV
FT                   ALAYQEVDDDVTTIDAQAIGGLHLAGLVGIIDPPREEAATAIAELRQAGVQVKMITGDH
FT                   PDTAMAIANKLNLAANVKAITGPEIDAMDDQQLQAHIDDYNVFARATPNNKLRIVRAQQ
FT                   ANNHVVSMTGDGVNDAPALKQADIGVAMGIKGTEVAKESADMVLADDDFADIVAAVREG
FT                   RHVFDNIRKTICFLLPTSFAEGLVVIISILMGHELPLYPTQLLWINMVSALTIQFAFIF
FT                   EPPEAGIMARGPRNVKSGLLSKLDYFEIGYVSFLISGLGIFAYNYLTALGLPNVVGSTM
FT                   SLNIIIFGKIFYLFNLRNDHPVISKYFFQNKMAFYIIGILILLQLGIIYLPFMQSVFHT
FT                   TSINFWYGWGIPIICGIVVLIVTEVGKFIRFRWMGKDGVID"
FT   gene            complement(128575..128769)
FT                   /locus_tag="JDM1_0124"
FT   CDS_pept        complement(128575..128769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0124"
FT                   /product="stress-responsive transcription regulator
FT                   (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61013"
FT                   /protein_id="ACT61013.1"
FT                   /translation="MKIDIHRSATDRVIAGVIGGIAEHFNWNTNVTRLLFVVLAITPMF
FT                   PGIIAYLILWLLMKDPIKD"
FT   gene            complement(128835..129437)
FT                   /locus_tag="JDM1_0125"
FT   CDS_pept        complement(128835..129437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0125"
FT                   /product="oxidoreductase (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61014"
FT                   /protein_id="ACT61014.1"
FT                   /translation="MFKIAIILGSTRSQANGRALFNHLKLIIDQLPTHSTIHYQFLDLA
FT                   NYQLPLFDEPEPPMANPHRELPANQQQWLTDMASADGYIILTPEYNHAMPAGLKNAFDF
FT                   LAFEGARKPAKIISYSDNMRGGQFGAAALVPVLQRLGMVVLPKPTPIGNVPQTLQSNGH
FT                   FIDNAPLSKRYDHALHQTLTEITYYTTVLTTTPFPTD"
FT   gene            129551..130024
FT                   /locus_tag="JDM1_0126"
FT   CDS_pept        129551..130024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0126"
FT                   /product="transcription regulator (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61015"
FT                   /protein_id="ACT61015.1"
FT                   /translation="MTTPLVSQLMTELNQFLTQDSVDDQEKRWAMQQTTDPQLQAALKQ
FT                   LSTTDIKIIAYLGRRGASRAKSLPAPTELSQATISRGLTKLSRLKLATKYRDLTNNKEI
FT                   LVRLTTLGEAVADLHTQLDAAIAAKAQAIADDYSDAELRRFVSLMRRIREIKI"
FT   gene            130170..130592
FT                   /gene="hsp1"
FT                   /locus_tag="JDM1_0127"
FT   CDS_pept        130170..130592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsp1"
FT                   /locus_tag="JDM1_0127"
FT                   /product="small heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61016"
FT                   /protein_id="ACT61016.1"
FT                   /translation="MANTLMNRNDFGMLDPFERMARSFWAPLENMDQVLKTDINETDDQ
FT                   YQVKVDVPGIDKQDVKLDYRDNVLSIKVQKDSFVDHEDQDQNIVMNERHTGTLQRQYML
FT                   PNVAADKITASQADGVLTITLPKTQPSANDGQIEIQ"
FT   gene            complement(130680..131135)
FT                   /locus_tag="JDM1_0128"
FT   CDS_pept        complement(130680..131135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0128"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61017"
FT                   /protein_id="ACT61017.1"
FT                   /translation="MKRLWHTLLIGAIGGIVIGYLMALGFSTFFNTTYLFPSNPTFVSH
FT                   WSSPLAATQLSTLLWILIGEVWAFSSWLFEIETWSITKQTIAHCLCSYLGMTPLAILCG
FT                   WFPLNVRWFGFYTLVYTGAYIGLWLIEMALARIKVIQLNQQLTNHRS"
FT   gene            complement(131132..131263)
FT                   /locus_tag="JDM1_0129"
FT   CDS_pept        complement(131132..131263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0129"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61018"
FT                   /protein_id="ACT61018.1"
FT                   /translation="MRIACVKNFTLTKWGSFQVNLTTGTTTYASRRYTQQIRKAAQL"
FT   gene            131715..132947
FT                   /locus_tag="JDM1_0130"
FT   CDS_pept        131715..132947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0130"
FT                   /product="transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61019"
FT                   /protein_id="ACT61019.1"
FT                   /translation="MDDAERERGPWHRNLIVLWFCTFVAGMAFSEIMPFLSLFVSQLGD
FT                   FTKAQITFYSGLAFAADYAISAISAPLWGIIADKKGRKIMLLRASLGMAVAMGLMGFVT
FT                   NVWQLVALRALQGVFAGFISNAQALVASQTPRKYSGRALSTLITGAVSGQLFGPVIGGL
FT                   LAQLFSIRNTFFITAGLLMVAFLLSLFFVQEHFKPVAHHREPGDSRNPLAAFQNPRLII
FT                   VMLCSTAIVQFGNASIAPIISLYVRELMHYRGPITVVAGIIAALPGISNIFSAPRLGRY
FT                   GDQHGSGKVLLFGYIFAVIMYFPQGIVTSVVALGILRFAIGISDGALYPEIQTVLTKNT
FT                   PVHLTSTIFSYNQSFQAIGNMFGALLGGLVAGWFNYNAVFIMTALLLLINLGLILWLVP
FT                   DIWKNGKRAVS"
FT   gene            132972..133337
FT                   /locus_tag="JDM1_0131"
FT   CDS_pept        132972..133337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0131"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61020"
FT                   /protein_id="ACT61020.1"
FT                   /translation="MASCLFCYLSLNMMLIQCIVSFMNIEISKQDQADQQRVAIFKALA
FT                   DANRLRIIRVLYQAQREMTCSEVGAQLNISKSTVSYHFKTLRLVGLTNTRRKAQTKYLS
FT                   LQLATFDRFLPGFLATL"
FT   gene            133402..134595
FT                   /locus_tag="JDM1_0132"
FT   CDS_pept        133402..134595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0132"
FT                   /product="transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61021"
FT                   /protein_id="ACT61021.1"
FT                   /translation="MTTTHQHSRYLTLGMMLAATNMRLPITMMPGLISSLKRTLGLPSS
FT                   MAGLLTTIPLLTFAIMSPLIAHWGRRFGNELTIYVMLIFLAVGSYLRVIPTIAALFIGT
FT                   LLVGIGADGGNVLIPAIIKDNFPTKIPVATSQYTLSMLLVGSLGTGLSGVLAAHWSLPL
FT                   TMAVLSVIGLINLVVWLPNLKYNHRAPTVTMTASDGQSTATHGSVWRRPLAWVVTAFFG
FT                   LQALVYYSLLTWLPTVFVAHGFSLIVAGNLVTVMQLSGLPMSYLVPATSGHRRGVWAMI
FT                   MVVGVGFIAGIGGILLSGTNFWVAALSCVLLGLGSGAAFSLAVVFFTQKTTNGFETADL
FT                   SGMAQSAGYLLAAVGPVLFGWLGGQLGWGPVLWLAIILSALLALSGSIIFQHATIYE"
FT   gene            134839..135687
FT                   /locus_tag="JDM1_0133"
FT   CDS_pept        134839..135687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0133"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61022"
FT                   /protein_id="ACT61022.1"
FT                   /translation="MTVLTTMYQLANGVNIPKVAFGTWQIPGGEATYQAVRAALAAGYR
FT                   HIDTALAYQNEASVGQAIRDSGIPREQIFVTTKLPAETKSYQGALNDFDRSLKNLGLDY
FT                   VDLYLVHAPWPWGQVGRVYDEANLDVWQAMEAIYQSGRAKAIGVSNFAVRDLKNILNQA
FT                   TIPPMVNQIQYYLGFTEPKITKFSEEHAMLVEAYSPLATGGVLDNPQVQAYADKYGVSV
FT                   AQLALRFVLQNGVLPLPKAVNPAHIEANTQLDFAISVADMQALNDLPDAAGSYMHNPTQ
FT                   G"
FT   gene            135764..136636
FT                   /locus_tag="JDM1_0134"
FT   CDS_pept        135764..136636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0134"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61023"
FT                   /protein_id="ACT61023.1"
FT                   /translation="MTTINAANAGTYAFDDQFKVNRMGYGVMQLTGPGTWGPYADPENG
FT                   VKVVKKALEYGVNFFDTADSYGPWFADRYLAAGLKDAANRDQIFISDKVGQTRQGPNVW
FT                   TPLGEPRYLRQQVEVSMMTLGIDHEDLVFLHRIDPHYSIADQVGELKKLQDEGKIKHIG
FT                   LSQVTVDQIKEAQQVAKIDAIENLYNVANHGDDDVVDYAASQKMAFLPWFPLATGELAQ
FT                   AGSVLSTMAQKYQVSPAQIALAWLLKRSDNIIPIPGTSSIEHLRDNVAAANVDLTTADF
FT                   NGLSQLSVK"
FT   gene            136736..137212
FT                   /locus_tag="JDM1_0135"
FT   CDS_pept        136736..137212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0135"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61024"
FT                   /protein_id="ACT61024.1"
FT                   /translation="MRKRIEQMSTRLMSDEPTIYLAGPWFTEGQPERLAKIEKLMDELE
FT                   LTYYSPRLDGIDLTPDATEADRNAVFTDNVDHLKRAKLVVAVVDGFDTGTIWETGTAYG
FT                   LDIPVAYYGETLADGTFNVMLAKSGKAVIENMTDLKAFLQDPTADDFQYTGTIR"
FT   gene            137517..139226
FT                   /locus_tag="JDM1_0136"
FT   CDS_pept        137517..139226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0136"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61025"
FT                   /protein_id="ACT61025.1"
FT                   /translation="MGALFMVKSKAIMIGAGLSNMAAAVYLIQDGHWDGKDITFYGVDM
FT                   HGANDGGATTDFTNEYWNKNHPMANTTGYVARGGRMLNYRTYVDLMDLLDRIPSVTEPG
FT                   MTAAEDTRDFDAKHRTYDIARLMQGGKGIINAGKLGFNNKDRTLLTKLIMMPDSEETKL
FT                   DNVSIAEYFKDDPHMFQTNFWYMWETTFAFRTQSSAQELRRYMHQMIYEFTQIEHLVGV
FT                   NRTRYNQFESMILPLIKYLQGQGVTFIDNKIVKDWQFKDTPMQDEITVTGLVIEDAQTG
FT                   ETEEVEVDEETAVIFTNGSITDSATMGDYNTPAPENMDYGVSASLWKKATERFYNLGTP
FT                   DKFFNDRNASEWVSFTLTTKNHLFLNEIVRITTQEPGNALNSFLSTTPITPLNQKDVNM
FT                   SIVVHHQPHFTTQQPNETVLWGYFLYPRRQGEFVNKPYIKMTGKEMAQELIGQLSKVDP
FT                   GPGNIKDKEKEILDSIVNNIPVYMPYASALFNNRAKSDRPEVLPKHSTNLAFTGEFAEQ
FT                   PYQMIFTEQSAVRSGEIAAYHFAGVPMDNLVKTPRYDKDPKTLLKATKKMFD"
FT   gene            complement(139398..140210)
FT                   /locus_tag="JDM1_0137"
FT   CDS_pept        complement(139398..140210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0137"
FT                   /product="extracellular protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61026"
FT                   /protein_id="ACT61026.1"
FT                   /translation="MKKLTSVVATLALALPLAASPFAMTTTANAATVTPKATTHALTKA
FT                   THLPAITMHAKAATTLNTIHFAADQAIAFVSPAKAKLSTKKTYTVTKTITLATGKHTSA
FT                   TYYLISEHGKALGWAKATTMIKKNAPTAKLKATKKTPKTKLTIAKKTTKQAGPKATSAK
FT                   KATPKIKTSKKVIKLTKQTTTKVKSTKLTIKHPKASIKPTKKVTTLATKKTLAQPTKTK
FT                   KMAPQLIKKTAKQNAKKAPKLATKKHLTVKTTTKHTPSKLTPKAAAKI"
FT   gene            140617..141993
FT                   /locus_tag="JDM1_0138"
FT   CDS_pept        140617..141993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0138"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61027"
FT                   /protein_id="ACT61027.1"
FT                   /translation="MKPTVRNLILQDHGQWLTDCSHEWQLLASLPYVVNPNESRQAWHH
FT                   CELCHKPVRYEYHVQNKHNHRELIVGSECVKKFMNAETRYLMVITTEDNFYAVAQYQTL
FT                   TTAVPTVPTIMFAQPWLPQLPAEQAPQARKLRQTTTQTVTTYLKRRTKQLPLQELKPAE
FT                   QTYQRLVHDEQAVIEAAERAARQAIVTNQQQRQAQAQQSAVKAEQTLRQSHAYQRYLQQ
FT                   LAAIIVMRPERPMAKQQFEKITPPVTERPLVNSYQFGQMVTEYRQTGKIQVRRLAMLDH
FT                   QFVAALNQVTQQLDEQQTTRFYDDVFNSCWGWQYHQQATQRADWEHLLTTRWGQSLSLA
FT                   WFEQLAMQTTMPQTQQWLADNADAGMQAALQQRLAAHEDRQPIARDRMTRSELRQFCLR
FT                   EQPAAPTLEAFEQVFDQQYQLPVDRQATAHETLAYYYIARQYQGDHQRALQQLNWLLKV
FT                   "
FT   gene            complement(142062..143189)
FT                   /locus_tag="JDM1_0139"
FT   CDS_pept        complement(142062..143189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0139"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61028"
FT                   /protein_id="ACT61028.1"
FT                   /translation="MKGCFIVTSFNEPLKFKSGVTLRNRLMMSPMTTTQSFYNGSITHD
FT                   EIDYYTQRATGLGAVITGAANVEDLGKGWHGELSIAHDTMLPGLSALAHGIQSQGAKAI
FT                   VQIFHAGRMTHRAVLNGEQIVSASAVAALRDDAETPRAMSIDEIHATIAAFGEATRRAI
FT                   QAGFDGIELHGANTYLIQQFFSPHSNHRTDEYGGRTPQERFRFIDELLKAVFAAVDQYA
FT                   DRPFIVGYRFSPEEFEEPGIRFEDTLWLLSQLRESRLDYVHVSLNNYDRVSRDPQYQDK
FT                   SIMTYVHEALQGKLPLVGVGGVRTRDDVKTVLQTAELVAVGQQLLYDPTWAVKLAKNAD
FT                   DTMVTAPFEEAVEVTPLSRPLYEFAASRYHSVINS"
FT   gene            complement(143422..144261)
FT                   /locus_tag="JDM1_0140"
FT   CDS_pept        complement(143422..144261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0140"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61029"
FT                   /protein_id="ACT61029.1"
FT                   /translation="MQHELLIGYNDRHTFLNRLSGSTKLLCFVGLSVIGMMTYDTRYLI
FT                   GVMIFSLILFRFSKIHYRDIAFVLNVIIGFSVLNLVMVYVFAPHYGVSIYGTEHLLLGS
FT                   ADHYFNLTAEQLFYEFNLLLKYTFAVPLALIFLMTTNPSEFAASLNKIGISYRISYSVA
FT                   IALRYIPDVQADYRTISLAQQARGFEMSKKAHFMTRIRGGIQILLPLIFSSLDRIETIS
FT                   QAMELRRFGKGKRRTWYMAQRFKRNDYLALTLVALLIILGIALFKVNGGRFWNPFKA"
FT   gene            complement(144263..145963)
FT                   /locus_tag="JDM1_0141"
FT   CDS_pept        complement(144263..145963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0141"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61030"
FT                   /protein_id="ACT61030.1"
FT                   /translation="MSAPIISFKNFSFQYNSQTEPTLRDINLDIYPGEKVLIAGPSGSG
FT                   KSTLGRCLNGLIPQSYPGTVTGQARIAGQTITESSIFALSQDVGTVLQDPDSQFVGLTV
FT                   VEDMAFSLENDQQTQPAMRQATEQWAQTLDLQDLLTHRPQELSGGQKQRVAMAGVLIDN
FT                   SKILLFDEPLASLDPASGKASMALIDQLTHTQDLTVIIIEHRIEDVLQQPIDRLIVMQD
FT                   GAIVANDRPETILRQSLMTQLGLREPLYLSALKLAGVDLATCQHLDNLQALQVPDLTST
FT                   LQNWTAGVQLQSPTVHDQPLLAIEHLTFGYDPAKPIINDITVTLHQGEMISLVGQNGTG
FT                   KSTLSNLITGFLVPQSGKMRFNGHSLADQSVKERADQIGYILQDPNQMISKTMIFDEVA
FT                   AGLVLRGVADDEVKRRVQAVLKVCGLYEFRHWPISALSFGQKKRVTIAAILVLEPAMLI
FT                   LDEPTAGQDLQHYTEMMTFLTKINQEQHMTIMLITHDMHLMLEYTDRTIVLGHGNILMD
FT                   ARPADVLTNASIIQQASLAKTSLYTLAEAHHLNPTEFVAKFVQAEREAR"
FT   gene            complement(145968..146528)
FT                   /locus_tag="JDM1_0142"
FT   CDS_pept        complement(145968..146528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0142"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61031"
FT                   /protein_id="ACT61031.1"
FT                   /translation="MQNKQSNSIRTVVATGIGAAVIFVLMKFVAIPTGVPNTQVNVAMG
FT                   FLALLGAIFGPVAAGLAVFIGHALNDFVTYGSPWWTWVIVDGLIGVAFGLAKNRLKIEN
FT                   GVLGTAKLVWFNIYQIIVNFIGWVLLAPTGDIIIYHEPANKVYLQGVITWIADSISVAI
FT                   IGTILLVLYARTRTQRGSLTKER"
FT   gene            complement(146607..146825)
FT                   /locus_tag="JDM1_0143"
FT   CDS_pept        complement(146607..146825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0143"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61032"
FT                   /protein_id="ACT61032.1"
FT                   /translation="MSKLILVLRESYFWCKTMTWLVENGLEEATGAISVGAIRYDHDKS
FT                   LWENLGGNTQTRPRKHSLLGAFFYDHN"
FT   gene            147100..147852
FT                   /locus_tag="JDM1_0144"
FT   CDS_pept        147100..147852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0144"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61033"
FT                   /protein_id="ACT61033.1"
FT                   /translation="MTRPNDEGDVSSLAYKYETIADSLRQDIKSGKYTPGELMPDQNKL
FT                   AETFDTTRITIHKAIQLLIIEGMVYSKRGAGTFVRKDFGLTERRQETLVDKPLGTTQTN
FT                   AGKKVTSKVLELQARLPTKREAEQLLIDEMDPVYVIRRTRYVDGKVWAYEHTIMPTSIV
FT                   TLTKQVLEGSVYGYLEQHSGKKIAGSHRIISAARVTADDVAAMGATLNDPVLVINQISY
FT                   MDDGQPFEVSESHFPYETSTVVADVQIH"
FT   gene            147997..148326
FT                   /locus_tag="JDM1_0145"
FT   CDS_pept        147997..148326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0145"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61034"
FT                   /protein_id="ACT61034.1"
FT                   /translation="MPANFYQRLIDKYEPMTEAAFLVLVSVRQPITSEAIPAKIAEMTN
FT                   NQLQLGLGTLFTNLHAMTKDYLMTERVDENDVHTYEITGSGESVLAAERKRLQLLNQIC
FT                   ERAGL"
FT   gene            148355..149140
FT                   /locus_tag="JDM1_0146"
FT   CDS_pept        148355..149140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0146"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61035"
FT                   /protein_id="ACT61035.1"
FT                   /translation="MWRYQMAVKGSEQELRWLNQQAQRGQLLRRIRGNWYQFQKTATRY
FT                   QVFSEYVSGNVATEIDDQHTPFELLTRLQLTKPAVQVIYTGTAQTELQGARVDRQDAPL
FT                   QLKIALAQRGHLLNVMNIRLVVGLILAVIVISLNVSDNVASWGMLAWLLFTFYPAWQAS
FT                   RLHKQANALRVITQQYDDAWRPTMHVFLKNMSTELDTEKVAGLGAWVYVGQDHHGMYWY
FT                   DLKTLASAAEIKQSLQPIVGDSVSVSIVSWLGLAPIGFV"
FT   gene            149150..149977
FT                   /locus_tag="JDM1_0147"
FT   CDS_pept        149150..149977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0147"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61036"
FT                   /protein_id="ACT61036.1"
FT                   /translation="MEVVGMWRHRFLIKGSEQELAWLNAQAQRRYLLMAIHGNWYQFKK
FT                   VPTIYRVFSEYVPQAIAADMSNSNSAFQVLAQVQVQQPDVQIVYTGSDQPALQQTTMAP
FT                   TDPKIRLQVALQLRDQAMNTINLSLYAGVVVWGLFLILILHQGDTDLIGVWMLMLLVGL
FT                   LAVLGLYRTAHRLQNQISQLRRDTEQYDGAWMPTMHVFVSALTADLDTEKPALKSLGRW
FT                   TLVGHSKKGQYWYDLQTLANAAEIKQTLRPFVTTDTNVNVLSWLGLAPLGWFV"
FT   gene            150301..150801
FT                   /locus_tag="JDM1_0148"
FT   CDS_pept        150301..150801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0148"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61037"
FT                   /protein_id="ACT61037.1"
FT                   /translation="MILMRLKDLTGETFSRLTVIERAESAPNGNARWLCQCSCGRQVVV
FT                   DSYRLRKGITKSCGCLRADVSRKNIFENPQTRKNMGRSDNLPLYQGTSVDRLKPNSRNR
FT                   SGVIGVSFDRCSQKWVARLMYRGRLVLNQQFADMDDAIMARKQAEQRYVMPVLEEYAKS
FT                   SAD"
FT   gene            150970..151764
FT                   /locus_tag="JDM1_0149"
FT   CDS_pept        150970..151764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0149"
FT                   /product="short-chain dehydrogenase/oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61038"
FT                   /protein_id="ACT61038.1"
FT                   /translation="MEMGLAGKRVLVTGSTKGIGRAIAVAFAKEGADVVINGRRTDTVA
FT                   AVVDELAAAYPTTHPVAAPYDISDPQQADKMFQQIPTVDVLVNNMGIFGPMAYDEIDDA
FT                   TWERFFKVNVLSGNRLAKHYLPAMLAQDFGRIIFIASEEAVMPSGEMPQYSMTKSMNLS
FT                   LAKSLSKLTVGSHVTVNTVMPGSTLTEGVQKMLDDMYADSDLPKDQWEHDFMINHRPLS
FT                   QIQRLIRPEEIGRLAVFVASPFASSFSGEALRADGGLVPTIF"
FT   gene            152027..152944
FT                   /locus_tag="JDM1_0150"
FT   CDS_pept        152027..152944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0150"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61039"
FT                   /protein_id="ACT61039.1"
FT                   /translation="MDKEPLLRISHLQKHFGKFQALKDINFEINAGEVFGFIGPNGAGK
FT                   STTIRVLLGILKASGGQATIFGRDVWQDSVAIHKRIAYVPGDVYLWPNLSGGEIIDLFL
FT                   KLNGGQHTAKTDALIKQFELDPRKKARTYSKGNRQKVALIAALSTDADLYIFDEPTSGL
FT                   DPLNEQTFQNEVLALKRREKSVLLSSHILSEVEKMCDRIGIIREGQIVETGSLAEMRHL
FT                   TRTTVDVQTRLPLTDLTTLAGVHGVTARHGDNHVSLAVDADQLTPVVQYLASRKLISLT
FT                   TTPPTLEDLFMRYYTTEQQPVKGK"
FT   gene            152950..154566
FT                   /locus_tag="JDM1_0151"
FT   CDS_pept        152950..154566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0151"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61040"
FT                   /protein_id="ACT61040.1"
FT                   /translation="MATQLFARTGLLIRFNLRRDWKKLLIWVVVLTGLFTAIAAKFDGI
FT                   YGTQMALNEIVKTLKTPAMISLFGAFSAKSPYTTAKVFATEMVVFMAIVMIVMNIMVAV
FT                   VTTRGDEDDGLLELVRAHAVGRLAPLFAGAAELTALNGLIGFLFALGLTVAKLPGATTP
FT                   GNWLIGLGLGGLGWAFGMLTLLLAQVMTSASGTTMLSYLLLGVMYVARMGTDVNRPDLT
FT                   WWIPFGWIEKLDAYQTNDWLPIGLYVLLGLGCLSLAAALNAYRDLGAGLVEPRRGRRQA
FT                   SGLLRGPVTLLWRQAHGLIIAWLLGNFILGAAYASVFNTIGDLAKSNPMIKQLLGASAL
FT                   AAANRLIVKNFIAVLAIVMVIVALVPAVQLMLKLVNDEQKGYLHQVYATATSRWHVWAS
FT                   YTGWAIVTGLLVLLAGLSGMYLMGLTSMVKPISWVTYWHVFAAYAPAMLVMVAVTSALA
FT                   GWRPKWRYAAWIWVFYAFFSLYLGNLIDLPKWARRLTPLGFVNKVPIKPLDGTTSSWCL
FT                   LLTVLILVVAALSYRRRDLAQ"
FT   gene            154585..155247
FT                   /locus_tag="JDM1_0152"
FT   CDS_pept        154585..155247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0152"
FT                   /product="transcription regulator (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61041"
FT                   /protein_id="ACT61041.1"
FT                   /translation="MAVKQPVPKDPAKVERIMHAAMHTFAVSGYRDAKTDVIASAATVS
FT                   KGLLFHYYGSKQRLYLATVQLATATIIATINQQVFDVPDDLVTLMVRSARYKAAFGKDH
FT                   PDEMKVLIDAYGALERLPVKIQAQMKILYTKSMTISREMISQVLDKMTLRADVDRDATI
FT                   ALIMGVYNQIFMEFQTYMRENHQVESMADIEWVVSRAKTYMAILEHGFMAADLDDQQ"
FT   gene            155414..156955
FT                   /locus_tag="JDM1_0153"
FT   CDS_pept        155414..156955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0153"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61042"
FT                   /protein_id="ACT61042.1"
FT                   /translation="MELHLTARQTGLWQRLMALAREQLMGLAMQMESTGKVDRPTLTTL
FT                   AQQLALDDPLPDDRLSQRVLSALALAQSSAGLAMSFASSWQVEDAILTFGTPQQRQRYC
FT                   AQSGVFGLAALPEQVMASSTVKATPVTAGWQLSGTVKAVLNVTQATEYLVLAQTPPNAT
FT                   GAFVISADQPGVTVSQPITPLGLHGLTIADVQLTDVPVTAADQIGQLGQGQRVMQRAQS
FT                   LGQLFAGAITAGIWQHATDQARQLALTEQPPLTALAPAMAITAALQTSVYNAAQQADDE
FT                   RPFTDAAQLAAMFASQNALAPFKILMPLIGDLAYTQHSPLSALQNDVATLPLIVGTDTQ
FT                   LALTFATTSLNDEVADVPTTGPHTAPEHLVVADLHRVVKRLNLTRDVPVNVGSIATAKR
FT                   VVALGRGAMEPAVLLQAQQLAKWIGAALAVTQPLTAMEQFSIEQQIGASAVTVAPEVLI
FT                   NIGVAGDDDYLAGMAGAQHVLSVNTDEQAPIFKHSQQIFVGGAAEFLAGMVAALN"
FT   gene            complement(157128..157640)
FT                   /locus_tag="JDM1_0154"
FT   CDS_pept        complement(157128..157640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0154"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61043"
FT                   /protein_id="ACT61043.1"
FT                   /translation="MTSSLTVRRIPLLGALIAMQLILGSLLSIQLLLTKISFAFIIIGL
FT                   TARLFSPLVTAGSSAISSLLGMLLFPKFTFFPGFILTAFLTGLVFGYAFQHQTSLTRVL
FT                   VANFIVVFILNLFLNSLWLHLMYLTPWSVLLTTRMIQEVITYVCYSVILIALFKIPILN
FT                   QLTARFK"
FT   gene            157870..158388
FT                   /locus_tag="JDM1_0156"
FT   CDS_pept        157870..158388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0156"
FT                   /product="transcription regulator (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61045"
FT                   /protein_id="ACT61045.1"
FT                   /translation="MAYITKKKIAQAFHDVVLVRGFSRTSVTAIMSTADFRRQTFYDYF
FT                   QDKYELLTWFIDDTLTETVEHNLNYLPWIDIIKLVCYELDANRQFYAECINTQHEIDVT
FT                   ALVGNHLATLLTELTHANTTETAALIWLLCLGIAQSLTHNIVANHPEDYEVLSQHAIAA
FT                   IEMTLEILN"
FT   gene            complement(158385..159374)
FT                   /gene="dak1A"
FT                   /locus_tag="JDM1_0155"
FT   CDS_pept        complement(158385..159374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dak1A"
FT                   /locus_tag="JDM1_0155"
FT                   /product="glycerone kinase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61044"
FT                   /protein_id="ACT61044.1"
FT                   /translation="MQIINEPQNALSQATQGIQWAYPNLTWVPNTFGCYDSNFQDDQIP
FT                   LIAGGGSGHDPAHWGYVGPGMLTAAIMGTVFQPPTSQEIVKVTKQVTRQRRVFFIVKNF
FT                   PADVSAFTAAQQQLQKEHWQTGLCIVADDISVDHESLKQRRRGVAGTILVHKILGAAAA
FT                   QGASIAELTHIAAALVPNIHTIGVAASGARIPGQSTASFNLNPGEIYYGIGIHGEPGYR
FT                   REPFQSSERLAQELISKLRLNFKWHADDHYAVFVNSLGGTTPMELMVFNNDVHELLTLA
FT                   ALTIDFNKVGTFLTANGMHGLSLTLLSLADPDWLTALNRPVKTAAWPN"
FT   gene            159536..160534
FT                   /gene="dak1B"
FT                   /locus_tag="JDM1_0157"
FT   CDS_pept        159536..160534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dak1B"
FT                   /locus_tag="JDM1_0157"
FT                   /product="glycerone kinase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61046"
FT                   /protein_id="ACT61046.1"
FT                   /translation="MKKIINDPKNVVDEMVDGLVRAYPQYLTKLPDTEAIVRSDQDSMQ
FT                   GKVGIVSGGGSGHEPAHAGFVGPGMLSAAVAGQVFTSPTPDQIYAAIKAVDQGKGVFLV
FT                   VKNYSGDVMNFDMAKDMAELDDIQVKSIVVDDDIAVKDSLYTQGRRGVAGTIFMHKILG
FT                   AAADQGTDLDDLESLATHVLPRIKTIAVALSAATVPEVGKPGFELADDEIEFGVGIHSE
FT                   PGYRREKIKPSKQLVQELLGKLDDELHLQSDHQYAFLVNGMGATPLMDQYVFCHDLLDE
FT                   LATRHIQPAFMKVGNYMTSIDMAGISLTIFDVAESQWLDYLQYPVKTIAWS"
FT   gene            160548..161129
FT                   /gene="dak2"
FT                   /locus_tag="JDM1_0158"
FT   CDS_pept        160548..161129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dak2"
FT                   /locus_tag="JDM1_0158"
FT                   /product="dihydroxyacetone kinase phosphatase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61047"
FT                   /protein_id="ACT61047.1"
FT                   /translation="MLTVENTTVWLNKFADQIEQHQSYLSELDTPIGDGDHGGNMARGL
FT                   AAVKAALATQPADITKLFQATAMALISKVGGASGPLYGTAFLEMAKQSKIDSDLGGLLA
FT                   AALAGIEKRGGATTGDKTLIDVWAPVVQAVQAGELTQDVIDDAVASTEPMVAKKGRASY
FT                   LGERSVGHLDPGAVSSGYLFTTLLDTEGIL"
FT   gene            161126..161494
FT                   /locus_tag="JDM1_0159"
FT   CDS_pept        161126..161494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0159"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61048"
FT                   /protein_id="ACT61048.1"
FT                   /translation="MSLGIVVVSHVPEIAAGIQRLLGQVAQDVSITIAGGTDDNQVGTS
FT                   LTKITQAFDANHADELLAFYDLGSAKMNLEMAIEMSDKTVHLYDTALIESAYTAASLLQ
FT                   AAVPLADVEAQLAPLKIK"
FT   gene            161509..162216
FT                   /gene="gplF2"
FT                   /locus_tag="JDM1_0160"
FT   CDS_pept        161509..162216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gplF2"
FT                   /locus_tag="JDM1_0160"
FT                   /product="glycerol uptake facilitator protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61049"
FT                   /protein_id="ACT61049.1"
FT                   /translation="MHGFLGEFLGTMVLIVFGVGSGAAMNLKGNYARHQNWTFICLAWG
FT                   LAVTFGVYVAGQFGSDGHLNPAVTVGFALFGYLPMANVWPYLLGQFLGAFIGAVIVIIQ
FT                   YYPHFQAAKTAADGNQVGIFATGPAISNPVFNFLSETIATFFFIFVLLNLGNFTQGLKP
FT                   LMVGLLIVVVGQTLGGTTGFAINPARDWAPRLAYTILPVPNKGLANWGYAWVPMFGPLL
FT                   GGILAAGLETIIS"
FT   gene            162367..163386
FT                   /locus_tag="JDM1_0161"
FT   CDS_pept        162367..163386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0161"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61050"
FT                   /protein_id="ACT61050.1"
FT                   /translation="MATIKDVAQRAGVSPSTASRAMHGSKIISKPTRDKVIKAARELND
FT                   APDFNAQNLATKASNTIGVVLPVDHHEIFSNPFFLEMIRGINEVCSKNGAMTTLATGIS
FT                   SDELVHNIDVMIAQGHIKTFILLYSEKNDPVVERLKQFDVQYVVIGKPYQDVNKTSYVD
FT                   NDNIQAGTDAAQYLIDHGHRRIGFLYSDLSRMVQSDRMLGYQRVMMQNQLPNIMLEERF
FT                   ETHAAGVKTLHKFFEQYPDVTGFVAVDDMLALKLQQVLHNDPNWKVKQFSLIGFNNSIF
FT                   SDLAHPMLTSIAVFPQRLGEEAAKIAMADHPADELSTAVIVPHQIVKRHSVHQIKSLQ"
FT   gene            163410..164372
FT                   /locus_tag="JDM1_0162"
FT   CDS_pept        163410..164372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0162"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61051"
FT                   /protein_id="ACT61051.1"
FT                   /translation="MITLNDVAKKANVSKMTVSRVINHPEQVRPELREMILNVMTQLDY
FT                   HPNAAARALVGRRTRVVKLTIFEDMDTTEPYYMMLLAGIANELNQHQYALQIATRNSYE
FT                   VGECDGYILTGIRQADYAWVERLNQPVVFVGSNRQGYDYVDTNNYQAVWESTRYAAEQG
FT                   YTHLVFIGIAIAEPFELDRERGFREYVTTHHISAQIIRLANHSHVATAYVKSHWSGFPR
FT                   NTAFICASDRLAIGVETAIINQGGRVPIEYGIIGFDGVLLNQIAAKRLTTMKQPLEAMG
FT                   RAAARLLLANINHTDRSRGRHDQEKIIINSRLSVAESTR"
FT   gene            164389..166062
FT                   /gene="agl1"
FT                   /locus_tag="JDM1_0163"
FT   CDS_pept        164389..166062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="agl1"
FT                   /locus_tag="JDM1_0163"
FT                   /product="alpha-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61052"
FT                   /protein_id="ACT61052.1"
FT                   /translation="MSKHWYDQQTIYQIYPKSFNDSNHDGIGDIPGITAKIPYLKQLGI
FT                   TTIWLNPIYQSPQVDNGYDVSDYYQVDSSLGTMTDVETLIKTVHEHGMYLIFDFVLNHT
FT                   SDQHPWFKQALADPQSKYRDYYLWQDPAADGGRPNNWGSFFGGSVWAKDPAGGSQYYFH
FT                   LFDKRMPDLNWKNPAVQQAMRDVAEFWVEKGIDGLRLDAFIHLAKADFRQTYPNRTGDS
FT                   TPIISDMFYAHLPKVHQYLHDFVAAIKAKHPDTYVVGEASSADPHLMVDYTTPGTDECD
FT                   QVITFRTFADDNTQDDPSFSDTFQPRPMDVTAYKQNTVGIQAALADTSLPTLYWNNHDM
FT                   ARVATRYGDPDYPQASAKALATALYLQRGIPIIYYGEELGLTNIRYHDIADFEDQTVPT
FT                   FVASAQAAGKSKVEIMRMLNQTHKMAGRGPMQWDNTVYHGFSDHLPWKHGDTDDMNAQA
FT                   EIADPDSIYHYYQQLLQLKQCAPFTNGQFIMLGSAEQLFTYLIDDGQKQAAIVCNLSAQ
FT                   AQTYLLPFVGGKVLLVQGGATYRGRQVTLPAWSSLVVKSA"
FT   gene            166318..167571
FT                   /gene="malE"
FT                   /locus_tag="JDM1_0164"
FT   CDS_pept        166318..167571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malE"
FT                   /locus_tag="JDM1_0164"
FT                   /product="maltose/maltodextrin ABC transporter, substrate
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61053"
FT                   /protein_id="ACT61053.1"
FT                   /translation="MSTWKKLGMGVLATGLALTLVGCGNSKSSSSSSKMDKTLKVSADP
FT                   SYKSYMKSVIPKFEKKYNVKVKVSYKAMLDEDDALKLDGPSGKGPDVLMAPYDRVGQMA
FT                   SQGQLSTVKLTSGRYNATGKKSVTYKNKVYAAPVTIESDVLYYNKKLIKTAPKNFKELE
FT                   KLASDKKYAYANDKTKSVAFLTQWTNFYNAFGVIKGYGGYVFADGNTNAKKMGLNNSGA
FT                   VEGLTYMTKWFTKYWPSGMQNVTSNENFVTSQFTSNKTAAVIDGPWMAATYKKSNIDYG
FT                   VAVLPKLNNGKDYQAFAGGKAWAISNYSKHKTAAQAWLDFISNKTNQNKLYKSASEIPA
FT                   NTAARKEAVSTGDDMATAVSKQYDKDVPLINLPQMSEVWTPAQTMVTNAASGKMTPKQA
FT                   ANKAQKTILTNISQKYDK"
FT   gene            167681..168970
FT                   /gene="malF"
FT                   /locus_tag="JDM1_0165"
FT   CDS_pept        167681..168970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malF"
FT                   /locus_tag="JDM1_0165"
FT                   /product="maltose/maltodextrin ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61054"
FT                   /protein_id="ACT61054.1"
FT                   /translation="MQVKDVKKAQRLSIIPGLGQLYNGQTIKGVGFIIILLAFIAEFIF
FT                   GGFSAFANLVTLGSVSMEDNSLFMMIYGTLQILLTIVFIVFYIANLYDAKHVAQLINNG
FT                   KKVSHTFKELGASLVDGGFAYLLTTPAYILMVFTIVFPVLVTLLMAFTNYDFAHIPPAM
FT                   LLDWIGFKNFTSMFFLSSYRATFNAVFGWTVIWTVCATTLQIIIGIATAVIANQNFIKG
FT                   KRFFGVIFLLPWAIPAFVSIMSFSNIFNDSAGAINVQVIGLWNTLVPFAHIAPIHWMTD
FT                   TFWTKVAIIMIQGWLGFPYIYVMITGILQAIPEDLYEAATLDGATVMQKFNKITLPTIF
FT                   AIAAPIFVTQYTFNFNNFSMIYLFNQGGPGDVGANAGGTDILISWIYKLTTGTSPQYSL
FT                   AAAVTLIISVLVIGISLIVFKKTHAFEMGD"
FT   gene            168975..169859
FT                   /gene="malG"
FT                   /locus_tag="JDM1_0166"
FT   CDS_pept        168975..169859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malG"
FT                   /locus_tag="JDM1_0166"
FT                   /product="maltose/maltodextrin ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61055"
FT                   /protein_id="ACT61055.1"
FT                   /translation="MDNAQAVAPKNANSKQNSARRHRFWKEFFTYLYMVILGIIIIYPV
FT                   LITFITAFKDANVQAFVLDFGGKWTLVNFKNLFTQTLYGSWYLNTMIISVSCMVIQVIV
FT                   VTLAGYVYSRYRFAGKKFSLTFFIVIQMVPTMAALTAYYVLANMLNALDHYWFLTAIYI
FT                   GGGIPQNTWLMKGYFDNVPYDLDESAKLDGAGNFKIFWSIVLPLVKPMIAVQALWAFMS
FT                   PVQDYLMAKFLLTSESHYTVAVGLQTFINNAQNQQVVLFSAGAILVALPIAALFFYLQR
FT                   FFVSGLLAGGSKG"
FT   gene            169887..170717
FT                   /gene="malA"
FT                   /locus_tag="JDM1_0167"
FT   CDS_pept        169887..170717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malA"
FT                   /locus_tag="JDM1_0167"
FT                   /product="maltose/maltodextrin ABC transporter subunit
FT                   (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61056"
FT                   /protein_id="ACT61056.1"
FT                   /translation="MQSTKNKTTAFPVRFFGSLFSPRRMFANRDQFNWLQIIVLFIFLT
FT                   AVMVMPIPFYYNHQTNFNLSPFLPHIDKMMASDQMQTAMKTANYRDQRFKDVKHQIIIK
FT                   TKDNVAGFDLTNDDMAGRKNVINLHASTFQVKSVGSEFKAKYVPGHNLKTNAHAFLVNS
FT                   WYQSNKVMIGLFMLMALGLIIVGVNLILVNGAAFFLFLSRHNKITHIRNFREGVNLTLM
FT                   MMGIGSLLAMVIGLIHFDVTIELTVQSLSLAFVVLWVYLKTKFKDPEVDQTMLL"
FT   gene            170751..172073
FT                   /gene="amy2"
FT                   /locus_tag="JDM1_0168"
FT   CDS_pept        170751..172073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amy2"
FT                   /locus_tag="JDM1_0168"
FT                   /product="alpha-amylase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61057"
FT                   /protein_id="ACT61057.1"
FT                   /translation="MARDTQTQLRNEMIYSVFVRNYSEAGNFAGVTADLQRIKDLGTDI
FT                   LWLLPINPIGEVNRKGTLGSPYAIKDYRGINPEYGTLADFKALTDRAHELGMKVMLDIV
FT                   YNHTSPDSVLATEHPEWFYHDADGQLTNKVGDWSDVKDLDYGHHELWQYQIDTLLYWSQ
FT                   FVDGYRCDVAPLVPLDFWLEARKQVNAKYPETLWLAESAGSGFIEELRSQGYTGLSDSE
FT                   LYQAFDMTYDYDVFGDFKDYWQGRSTVERYVDLLQRQDATFPSNYVKMRFLENHDNARM
FT                   MSLMHSKAEAVNNLTWIFMQRGIPLIYNGQEFLAEHQPSLFDRDTMVADRHGDVTSLIQ
FT                   KLVTIKQLPLLRAADYQLAVVEEGIVKITYRAAGEALTAWIPLKGQVTAVATKLAAGSY
FT                   QNLLTDGPTEVVDGKLTVDGQPVLIKYATNTAVTKVADQSN"
FT   gene            172175..173281
FT                   /gene="msmK1"
FT                   /locus_tag="JDM1_0169"
FT   CDS_pept        172175..173281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msmK1"
FT                   /locus_tag="JDM1_0169"
FT                   /product="multiple sugar ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61058"
FT                   /protein_id="ACT61058.1"
FT                   /translation="MVEMNLDHIYKKYEGNDKYSVTDMNLDIKDGEFIFFIGPSGCGKS
FT                   TTLRMIAGLEDITKGDFKMNGQVMNDVEPKNRDIAMVFQTYALYPNMSVFDNMAFGLKI
FT                   RKTYSNTEIKKRVDNAAEQLGLTDYLQRKPANLSGGQRQRVALGRAIVRDAGTFLLDEP
FT                   LSNLDAKLRVDMRTTIAQMHQRLKTNMIYVTHDQIEAMTMADRIVIMNDGKIMQVGTPH
FT                   ELYNEPVNQFVAGFMGSPSMNFFNATLHDGRVTDGEGLDVAVPEGQLKVLKAQGYDQKK
FT                   MIVGIRPEDIHAEQIALEAMSDSIVKTKVVVSEFLGAESMLYCTAGKSKFTAQVDARDY
FT                   HNPGENVEVAFEMSKAHFFDSETKDVIR"
FT   gene            173308..175578
FT                   /gene="map2"
FT                   /locus_tag="JDM1_0170"
FT   CDS_pept        173308..175578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="map2"
FT                   /locus_tag="JDM1_0170"
FT                   /product="maltose phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61059"
FT                   /protein_id="ACT61059.1"
FT                   /translation="MKRIFEVDPWHVISHELVPTDKRLQESMTSIGNGYMGMRGMFEEH
FT                   YSNDTLKGIYIGGVWYPDKTRVGWWKNGYPDYFGKVINSVNFIKVNITIDGDQVDLAKD
FT                   TVSDFTLDLDMHTGILRRSFIITKGEKRVQFMIDRFVSVAQKELFDVHYSVHNLGAEPV
FT                   QIGFISQIDADVFNEDANYDEQFWQVLDKSHAITGGSMFAETKPNNFGTPRFTLGMQML
FT                   HETAFRGINAPETEKAVTNIFRGTLAPDETKNFEKRVLVVTSRDYADMAAMRTGLAELS
FT                   ETVSTQSYEDLRQAHVDGWAKRWQLSDVLIDGDDAAQQGIRFNLFQLFSTYYGEDKRLN
FT                   LGPKGFTGEKYGGATYWDTEAFGVPFYLSLAKPEVTENLLEYRYNQLAGAFHNAKMQGL
FT                   AGALYPMVTFNGIECHNEWEITFEEIHRNGSIAYAIFNYTRYTGDEIYLKTKGIDVLTG
FT                   ISRFWADRVHFSERKQQYMIHGVTGPNEYENNVNNNWYTNFMARWTLEYTLASLKKVDA
FT                   AKRAALQITDAELAKWQDIVDRMYFPYDEKLGIFVQQDGFLDKDVKPVSSIPADQRPIN
FT                   QHWSWDHILRSPYIKQADVLQGIYYFMDKFTAEQKKRNFDFYEPLTVHESSLSPAVHAI
FT                   LAADLHYEDKAVEMYERTARLDLDNYNNDTVDGLHITSMTGSWLAIVQGFAGMRVKDDT
FT                   LAFAPFVPKAWTHYQFHVNFRGRLIKVDVDQQGTTVELVSGEPLTIELNGQAIEVASTV
FT                   TTK"
FT   gene            complement(175792..178638)
FT                   /locus_tag="JDM1_0171"
FT   CDS_pept        complement(175792..178638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0171"
FT                   /product="mannosyl-glycoprotein
FT                   endo-beta-N-acetylglucosaminidase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61060"
FT                   /protein_id="ACT61060.1"
FT                   /translation="MRHGQYRYIVGTLALITTAVGLVACSKQSANQQISYRQTAEATLD
FT                   KGMDNQPEAPYWFPKQLLKWQLSKDKAAKYNTASVPLAKRIDKWQLPTVNKTQDPKMKV
FT                   VALSIMNSSTSGNAPRGINTFDANVFSNWQYIDQLVYWGGSAGEGLIVPPTADVIDSAH
FT                   KNGVPVLGTVFFPQVVSGGKLKWLNDFLKQDADGHFPMADKLVAVAKAYGFDGWFINQE
FT                   TDPEVKSFDSASTGKTATSSTSNGLSKKHAQLMQQLIKEYKQKAGSKLDLMWYDSMTKD
FT                   GKMDWQNALTKENQSYLVDANMKPVADSMFLNFWWTKKRLASQELLKKSHERAEKLGIS
FT                   PYNLFAGIDVQADGTATPVRWNLFANKQHVPYTSLGLYAPDWTHASSDTVDEFQAKEGA
FT                   LWVNDQNDPSRSIPSTTSTHWPGVSTYAVEQSAITKQPFVTNFSLGNGYNYFIKGKNVS
FT                   LRDWNNRSLQAVNPTYRWLINNGNGNALKASFDYTDAYEGGNDIKLAGKMRKDTASTIK
FT                   LYTTDLDVTADTQVSLTAKASGKSTAKLVVTLKDGRTKTIAGDRTLSKHWTTVSYDVSQ
FT                   LTKKTIKGLSLKISAAETDASYSVQLGRLAIIGKQQAAPKKVNQVTIDNRTFDEEGKYA
FT                   GVNLSWQATTKNKLDHYEIYQVNNDGSRSFLGATNTTNFYLNALKRNGQHNETNLMVVP
FT                   VDIWNQRGDASDQVTLKWPDNRKPKAAFTVNRTLAAPGNTIKFTNASSKNATSYKWEFD
FT                   GATKTTSTAKNPTVTYRKAGTYNVTLTAKNKDGQRHVTMKKLITITPKAQGALTLLSKN
FT                   AKTSASGYTNSSEAPKMAVDGKLDTKWCATGKAPHTLTLDLGRQTTVSAVKLAHAKAGG
FT                   EGADMNTRAWTIQVSTDGKRYTDVARTYNNTQATSLNTFAATSARYVRLVVDKPTQVAD
FT                   TAVRIYEMDVLGLTQTLK"
FT   gene            179225..179497
FT                   /locus_tag="JDM1_0172"
FT   CDS_pept        179225..179497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0172"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61061"
FT                   /protein_id="ACT61061.1"
FT                   /translation="MDPKRVKYLKLISKLATFTCIAMYVSYIPQIISNFSGDPVSPLQP
FT                   LVAMINGILWTGYGWFKTYKDWPVIISNVPGVIFGFITVLTVYIH"
FT   gene            complement(179575..180441)
FT                   /gene="sacK1"
FT                   /locus_tag="JDM1_0173"
FT   CDS_pept        complement(179575..180441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sacK1"
FT                   /locus_tag="JDM1_0173"
FT                   /product="fructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61062"
FT                   /protein_id="ACT61062.1"
FT                   /translation="MLLGAIEAGGTKFVCATGAENGQVSDRISIPTTTPAETMTAVDDY
FT                   FTTHPVDAIGIGSFGPIGVNPDDPKYGYITTTPKPGWGDFDFLGHLKNRFNIPLYWTTD
FT                   VNEAAYGESMIGIAKDVPNSIYMTIGTGVGAGVISQNHIFNGRTHTELGHMRLNRLPGD
FT                   DFKSNCPYHDICLEGLAAGPAVGKRTGKAGKDIPVDDPVWPIIADYIAQACVNLTVAFA
FT                   PDKIILNGGVMNQRQLFPMIREKFAAYLNGYEEVPPLDDYIVPAGLGNNSGIAGGLLLA
FT                   QAALKNA"
FT   gene            complement(180521..182680)
FT                   /gene="melA"
FT                   /locus_tag="JDM1_0174"
FT   CDS_pept        complement(180521..182680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="melA"
FT                   /locus_tag="JDM1_0174"
FT                   /product="alpha-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61063"
FT                   /protein_id="ACT61063.1"
FT                   /translation="MPVEYAPKTGLINLHNDQISYVIQILAHRYPVHRYFGRYFSKQPY
FT                   FEPMPSGSHAFANDPTERFPYSVTSLPLEYSTIGSGDYRQPAYVIKDANNQLLPILEYT
FT                   GFSVNDQPINSRQLPPTVSKHTPVTTLIIHLADSVTKLQMDLNYTIFENQPLILRSTTL
FT                   RHHGTTNLQVTALSSAQLDLPTDQYTALTLSGTHAHEANPSFNRLHPGLQTVRSLRGTS
FT                   GPQHQPFMALAEPNTTELAGTVIGCALAWSGNFDSTVEVDQYQHSRLTIGLEPDTFEWQ
FT                   LKPNSSFQTPEAVLTWTNTGFNGMSQVFHDFSYQLMPSQTNIPSVLNTWETLTFAVSES
FT                   KVQHLIEHAHQLGLQMLVLDDGWFVNRNGENGQLGDWYVDPIKFPNGLKPLAQQAHHHR
FT                   MKFGLWVEPEMITTNSQLYQQHPDWVLQYVDRTPITARHQLVLDLSQAAVRDHLVTTLT
FT                   NLVQNNQLDYFKWDMNRHLTQVGSTHLPAAQQGELYYRYVCGLYDILTRLKRACPKLII
FT                   ENCSAGGGRFDFGMLPYTNQTWISDLTDPVDRATIENGFSYLFPPRIFSNHITASPNAQ
FT                   NGRITPFETRLQLACIGQLGLELNPKQLAPSEQQLLRGALIKYQQLKSTFIKAHFYRLP
FT                   TTRHVVAWLLVTADKKQAICCYLNRLNSAVKTQHPLPLHYLDAELTYSDSSGNRYTGHQ
FT                   LNTMGIPLKPTNADFTSQLIYLRQS"
FT   gene            complement(182700..184655)
FT                   /gene="pts1BCA"
FT                   /locus_tag="JDM1_0175"
FT   CDS_pept        complement(182700..184655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pts1BCA"
FT                   /locus_tag="JDM1_0175"
FT                   /product="sucrose PTS, EIIBCA"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61064"
FT                   /protein_id="ACT61064.1"
FT                   /translation="MNHQEVADRVLNAIGKNNIQAAAHCATRLRLVIKDESKIDQQALD
FT                   DDADVKGTFETNGQYQIIIGPGDVDKVYDALIAKTGLKEATPDDIKAVAAAGQKKNPLM
FT                   DFLKVLSDIFIPIVPALVAGGLLMALNNVLTAEHLFMAKSVVEVYPGLKGIAEMINAMA
FT                   SAPFTFLPILLGFSATKRFGGNPYLGATMGMIMVLPSLVNGYSVATTMAAGKMVYWNVF
FT                   GLHVAQAGYQGQVLPVLAVAYILATLEKFFHKHIKGAFDFTFTPMFAIVITGFLTFTIV
FT                   GPVLRTVSDALTNGLVGLYNTTGWIGMGIFGLLYSAIVITGLHQTFPAIETQLLANVAK
FT                   TGGSFIFPVASMANIGQGAATLAIFFATKSQKQKALTSSAGVSALLGITEPAIFGVNLK
FT                   MKFPFVFAAIASGIASAFLGLFHVLSVAMGPASVIGFISIASKSIPAFMLSAVISFVVA
FT                   FIPTFIYAKRTLGDDRDQVKSPAPTSTVINVNDEIISAPVTGTSESLKQVNDQVFSAEI
FT                   MGKGAAIVPSADQVVAPADGVITVTYDSHHAYGIKTTAGAEILIHLGLDTVNLNGEHFT
FT                   TNVQKGDTVHQGDLLGTFDVAALKAANYNPTVMLVVTNTANYANVERLKVTNVQAGEQL
FT                   VALTEPAASSVAATTV"
FT   gene            184911..186416
FT                   /gene="sacA"
FT                   /locus_tag="JDM1_0176"
FT   CDS_pept        184911..186416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sacA"
FT                   /locus_tag="JDM1_0176"
FT                   /product="beta-fructofuranosidase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61065"
FT                   /protein_id="ACT61065.1"
FT                   /translation="MIWNRKTRYTPYEQWPATKLPQLVAQARQSKWRMQHHIQPTSGLL
FT                   NDPNGFSYFDGQWHLFYQVFPFGPVHGLKSWQHVTSKNLVDWHDEGLAIRPDTPYDSHG
FT                   AYTGTALPIDDQLFIMYTGNVRTADWQRESYQLGAWMDTDNHIKKLSRPLIAHAPAGYT
FT                   SSFRDPDLIRTDHGYYALIGAQTTTEIGAILVYFSKDLTTWTCQGELNVPANARGYMIE
FT                   CPNLVWIDQQPVLLFCPQGLSQTTTPYQNIYPNMYLVADQLDLAQAQFTEPHALTQLDD
FT                   GFDVYATQAINAPDGRALAVSWIGLPEIAYPTDRENWAHCLSLVKELTLKDGHLYQNPV
FT                   AAVDDLRMTAHDLVFEQQRATVAALNGSFELLLTVPADKTVTVNIADQQESGQLQVTVD
FT                   ANHGQVMIDRRHTGNSFAEDYGQTRQVELTAHKTIKIRLIIDVSVFECYIDNGYSVMTG
FT                   RFFLNATPSRLNVQGDTTAVTGKVWEWRQSEHTGVDNNETKIK"
FT   gene            186397..187377
FT                   /gene="sacR"
FT                   /locus_tag="JDM1_0177"
FT   CDS_pept        186397..187377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sacR"
FT                   /locus_tag="JDM1_0177"
FT                   /product="sucrose operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61066"
FT                   /protein_id="ACT61066.1"
FT                   /translation="MKPKLNDVAKLAGVSATTVSRVINNHGYLSSQTKEKVFAAMRELH
FT                   YQPNNMARSLQGKNTRLIGVIFSDISNPFFGELVSRIEKILFAKNYKVILCNSADDPQK
FT                   ERDYLQMLMANQVDGIIAGAHNLGIEEYQQYGLPIISFDRYLSDNIPIVSSDNYQGGWL
FT                   ATQTLHQAGATNVAIFTGKSHAGSPTNGRREGYEAYLTAQQLTPHVHELPFELTPALKM
FT                   MEIKTIMTQHQYDGIFCSDDLTALLVLNVARQLSLTVPEQLRVVGYDGTALIRDYHSEL
FT                   TTVEQPLADISTLLVSLLLQRIEDANCTLESKYTLPVKLIKGLTA"
FT   gene            187398..189074
FT                   /gene="agl2"
FT                   /locus_tag="JDM1_0178"
FT   CDS_pept        187398..189074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="agl2"
FT                   /locus_tag="JDM1_0178"
FT                   /product="alpha-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61067"
FT                   /protein_id="ACT61067.1"
FT                   /translation="MAATIKWWQQAVVYQVYPRSFQDTNHDGIGDLKGITAHLDYLKQL
FT                   GIDVIWLNPIYRSPNDDNGYDISDYQQIAADFGTMADFDELLQAAHDRGLKLIMDLVVN
FT                   HTSDEHPWFKRSRQDRTNQYRDFYFWRSGNGKKAPNNWDAAFGGSAWQYDEQTQQYYLH
FT                   TFSTKQPDLNWENPTLRESVYTMMTWWLNKGVDGFRMDVINQISKLPGLPNGPLKPHSQ
FT                   FGDARVTNGPRVHEFLQEMNQEVLSQFDIMTVGETHGVTPADALKYAGADRHELDMVFE
FT                   FQHLRLDNSQHGLGKWSTRKTPLVALKKVISDWQVGLEGRAWNSLFWNNHDTPRAVSRF
FT                   GDDRPAYRVRSAKMLATCLHLLQGTPYIYQGEELGMTDAHFTELASYRDIESLNAYRDL
FT                   VTERQLLSPADMMARLAARSRDNSRTPMQWDTEVNAGFSDAAPWLTVNPNYRQINAAAA
FT                   LADLDSVWYYYQHLIQLRHQYPLVTLGSFELLWADDPQVFLYERQWEGRTWLVCCNFTA
FT                   ETLSRPLDQYLTPTAKCLISNYGEQQPNKLRPYEAWVYQLA"
FT   gene            complement(189231..190145)
FT                   /locus_tag="JDM1_0179"
FT   CDS_pept        complement(189231..190145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0179"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61068"
FT                   /protein_id="ACT61068.1"
FT                   /translation="MLAYGYQKFGGPTVFEELPQSQLIPTDNQLLIKTLAVNLTEEDRL
FT                   ERLGTIQSVALPHIPGHDVIGKIIQVGAAVTDLDVGTVVAARTNHTYADQVCLDSDLAV
FT                   TMPTNLDPVTAVSLVTPGIVAYKTVRYFADIQADQTVIVKGAGSPVGLLIIQLAKRLGA
FT                   HVIAIASDRYANLIATLGVDQFVDYQHQNPVHVLADRGDVVINVAIDGVGGKDDLAMAK
FT                   FDATIASFARHLPATSKSIRFQAIQPTEVISDQAALQLLFKLLDTGQLTTTINEQLPFN
FT                   LTGFIQGHQRLDEPHVGQVVVAR"
FT   gene            complement(190366..191766)
FT                   /gene="nha1"
FT                   /locus_tag="JDM1_0180"
FT   CDS_pept        complement(190366..191766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nha1"
FT                   /locus_tag="JDM1_0180"
FT                   /product="Na(+)/H(+) antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61069"
FT                   /protein_id="ACT61069.1"
FT                   /translation="MPNSKKWRSVQLPEALLVLLIMLAIMGLGVIKFGLSPQTPVILVI
FT                   ALIILWARIRGAHWDDIHGGIIDGIKTGIIPIFIFLLIGALISVWIAAGIIPSMMVFGF
FT                   HLISAQWFVPSVFLVCAIIGTSIGSAFTIISTIGIALFGIGTTMGINPALIAGAIISGA
FT                   IFGDKTSPLSDSTNLAAAIAEADLFDHIRNLMWSTIPAFVVSLVLYAVLGAGAATQSHL
FT                   GKIQTTLTVLNNNFTISWWAALPLVVMFACALLKIPAIATLLMNIGLAIVMIFIEQPHI
FT                   ALTKIATMIETGFVAKTGNAGVDALLSRGGISAMMSTVSLILLTLSLGGLLMKFNLIQT
FT                   AMVPLTKRLKGAGATVTAAILAGIGVNIFVGEQYLSVILPGKAFKTTFNQRGLANLALS
FT                   RVLEDGGTVINYLIPWGVAGAFAANTLGVSTLAYLPFCFFSLLSPVFSIISGFTGWGLK
FT                   HQPANEAG"
FT   gene            192312..193985
FT                   /gene="agl3"
FT                   /locus_tag="JDM1_0181"
FT   CDS_pept        192312..193985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="agl3"
FT                   /locus_tag="JDM1_0181"
FT                   /product="alpha-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61070"
FT                   /protein_id="ACT61070.1"
FT                   /translation="MANQWWQSAVVYQVYPRSFQDSNGDGIGDLPGITQRLDYIKQLGA
FT                   DVIWLNPIYRSPGVDNGYDISDYYDINPEFGTMADFDQLLTTAHAKGLKIMMDIVVNHS
FT                   SDQNKWFTTSAQSKDNPYSDYYIWRDPVDGHEPNNWGGFFGGSAWKYVASRDQYYLHSF
FT                   AVEQPDLNWDNPQLRQAVYDMMNFWVNKGVDGFRLDVINLISKPDSFADGQPEAGEPYA
FT                   AIGGIIANGPHLHEYLQEMNQQVFAGHQLMTVGETPGATVADAKQLASGQGQELNMVFE
FT                   FEHMGLDGNPDPALGKWNDQPVRLVDLKQSLSKWQMGLQGTAWNSLYWNNHDQPRIVSR
FT                   FGDERPAYRERSAKMLATLLHFLQGTPYIYEGEELGMTNAHFTKLTDYQDLESLNAYHH
FT                   FVDDEQVVQPEQMLGYLAHMSRDNARTPMQWDDSQNAGFSTATPWLAVNANYPRINAQL
FT                   AQRTPGSVLSYYQRLIKLRHHLPVITTGTYHLLSPDDAAVYAYVRHMGSQHLLVICNFT
FT                   AATQTRHFAELPADAHLLISNYDEDHQDVLRAYEAKVYQF"
FT   gene            complement(194185..195099)
FT                   /locus_tag="JDM1_0182"
FT   CDS_pept        complement(194185..195099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0182"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61071"
FT                   /protein_id="ACT61071.1"
FT                   /translation="MNIKDLYYFQRLISTQSYTQTAADFHVSQPTISRAIKRLERHFQV
FT                   TLFFRQAKTKALVLTPSGQQLLLAANDIINNWQHVNESISHLRQHTLRFGIEPSVSEHY
FT                   LPALTKPIIEQDLLSSVHTVEMGANQLVKQVLAGQLDLAISGNLDQTLDERLAVTPLRP
FT                   FKFRILANVAHPLAKAEHPTFAEALKSPFVLLNATYLNKLVFRQLAEQLSIEPQVLFES
FT                   DSSTLIKGLVKENLALGFISDITTPNDGEDDGLVEIPFDDVQVPSVHINLIRRAHQFPI
FT                   GLVKQVIDIIEKTFAADNAEQKS"
FT   gene            196085..198853
FT                   /locus_tag="JDM1_0183"
FT   CDS_pept        196085..198853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0183"
FT                   /product="cell surface protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61072"
FT                   /protein_id="ACT61072.1"
FT                   /translation="MRLIDFKTWIMGTAAMLTLIVTNQTVSAADTATTATETTQTSGSS
FT                   TLANQVVLRQTTSSSSSSSSSSSSSSSSSSSTKASATGAATETATSKAVTTSESSTQSS
FT                   STTATSQTTSGVTAAQATTDSTDTTATSRATANAKADQRAASAKANNEQATTQNQQQTT
FT                   NMYSGVVTSQKDSARTATTTDQATASVATLSRMSRASLRSLAQRATVAVQGLDATDATV
FT                   TDDDGVTYSATDVLSLYANYIAKYHWSIADDVSVTAGSTATVTLPENVVFTNGTQHIDV
FT                   QKSDGTVVGTFTAETGSQTGTLTFNDYYATSDRYNRQGDLTFYVTGTSATTGSSTTGIN
FT                   KVGWADSNSLDADGNPTKMIWQVVANINSEKWQQVAIVDQLGLYQTHEGTMTMETGHYT
FT                   DGAFVKDAALGTYDFATQQFTYADGVSTPQVTVTVVGQQMTINIDQLDVAVNIFYEVGL
FT                   TVGHTYTNNAGVTYAPVIGDATDPNEGSSTGEPKSEQSNVAVRFGGSGTASDDIQSYSL
FT                   VINKTDGDGQSVAGATYQLEDSTGTVLRTDLVTDSVGQLRIGNLSAGTYMLVETAAPSG
FT                   YQIDTAKHVFTVSAVQATANVVTGSVVDKRMAKTALTVNKVWADVPAGVQTPTVEVTLQ
FT                   RNGQAYQTLQLTSANGYTGTFSDLDVTDVYGNAYTYTVIETAIAGYISSQTTSGETVTL
FT                   TNTYQTGKLTVVKTDSSGANRLAGAVFAVKNAAGTLVAQLTTDATGQAQLTGLTQGAYT
FT                   VSEIQAPDGYLINTQAQVLVLNEQSAYQGQLVFADEVEPSEPSEPSEPSEPSEPSEPSE
FT                   PSEPSEPSEPVLPGHADEDSDSDQVVTTKTETAKLVKQTNLVTTTRPTKLLGQPIKLVA
FT                   TSKPVVKVTKATNRKSAQQLPQTSEQSMDWLMILGWFLLGLTVVSRQRRFN"
FT   gene            complement(199144..199986)
FT                   /locus_tag="JDM1_0184"
FT   CDS_pept        complement(199144..199986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0184"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61073"
FT                   /protein_id="ACT61073.1"
FT                   /translation="MNIELFIARRKALGLSQKALADGICTQATLSKFENNGKAPAIRIV
FT                   AQLCQRLNLQLEDVFPTERVADAAVLKILEQVEFDLITTEYQDAEVQLEKAADMPRHDR
FT                   ETKLQYCYLKGYVAALNHHPISDVIFNFDQIITDLDEAHITIYTQLAYCGIGIAYQQNQ
FT                   DNDKAQYYFEKVRHALPNLPLETTASVWRVINLAYYTGAFYAKINDTPRSLQLLNYGIE
FT                   ICARFHVTYYAARIKFLQAQLSDEPDQIHEYLNDAAALARMNNNRQLLKNISSYSDSH"
FT   gene            complement(200174..201835)
FT                   /locus_tag="JDM1_0185"
FT   CDS_pept        complement(200174..201835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0185"
FT                   /product="lipoprotein precursor, peptide binding protein
FT                   OppA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61074"
FT                   /protein_id="ACT61074.1"
FT                   /translation="MKWKVMLTTATAAASTGLLLAACSQGQSKSDNSGNLHAGMAQKQV
FT                   LNWSENGSELTTLDTSLVTDSISADMINNTMEGLYRIGNNNKITPGIATHTVISKDKKT
FT                   YTFTLRKDAKWSNGDPVTAQDFVYSWRRTIDPKTASQYAYLYSGIKNADQITNGKAKAN
FT                   SLGIKADGKYKLTVTLDKPMAYFKLLMGFAIFFPQNQHAVQKYGKDYGTTATKMVYDGP
FT                   FTMKGWKGTNTTWSLNRNPKYWDKKHVYLEKINDQVVKSTTTGFNLFQSNKLDMATLSG
FT                   EQVKNEKNNPKLVLRKTSRLNYLEFNQKKVPALANAKLRQAMSLTIDRHQLVTDVLADG
FT                   SAVPKGFVTTGLATDPTTGEDFATENAVSAATTQDTAKAKKLWAEGLKETGKKSLTLTL
FT                   THDNIDQTKETAEYVQGQLEKELPGLKITDITLPFKNRLARETSGDFQLAISGWQADFA
FT                   DPISDLGILTSTNDYNFGKWKNADYDAAVKQAEQATDPTVRWTALGKAEKIIGADEGVA
FT                   PLTQTTLAQMVNPKLKGLIYNTSGTNYNFKDAYMAK"
FT   gene            complement(202041..203702)
FT                   /locus_tag="JDM1_0186"
FT   CDS_pept        complement(202041..203702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0186"
FT                   /product="lipoprotein precursor, peptide binding protein
FT                   OppA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61075"
FT                   /protein_id="ACT61075.1"
FT                   /translation="MQWKLFATVATLTATTGVLLVGCGQSSSSSSNAGNTTAKMARTQV
FT                   LNWSENGQDLTTLDPSLATDVISGTMISNSQEGLYRLGKNSKVTPGIATKTIVSKDKKT
FT                   YTFTLRKNAKWSNGDQVTAQDFVYGWRRTVNPKTASQYAYLYSGIKNADKIVSGKAKTS
FT                   TLGIKADGKYKLTVKLEKPMQYFKLLMGFVVFFPQNQHAVEKYGKDYGTSSSKMVYNGP
FT                   FKMTGWKGTNSTWTLKRNPNYWDKKHVYLTKIKDQVVKSTTTAFNLFQSNKLDMATLSG
FT                   QQVKNEKNNNKLVIRKSSRLNYLEFNQKKVKLLANKKIRQAMSLTLNRKQLVNDVLGDG
FT                   SVTPKGFVTTGLATDPTTGKDFATENTVKSAVTQDTTKAKKLWKQGLKETGKKSVTLTL
FT                   THDDTDQMKALAEYVQGQLEKELPGLKVQSVTVPYKTRISREIAGNFQLVISAWQADFA
FT                   DPVSDLGIMTSTNDYNFGKWTNKTFDSAINTANSTTSTTKRWQALATAEKTMATDQGVA
FT                   PLSQNVIAQMVNPKLKGLVYNTAGINYNFKSAYMAK"
FT   gene            complement(203855..204298)
FT                   /locus_tag="JDM1_0187"
FT   CDS_pept        complement(203855..204298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0187"
FT                   /product="acetyltransferase (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61076"
FT                   /protein_id="ACT61076.1"
FT                   /translation="MKIEHLQHPTTHQLDQLMTIWLSGNLTAHDFVSADYWRQQAPLVR
FT                   EAVQSAELIVGLTDGPEAYILGFIGLQNDYIAGIFICNDAQHQGLGTALLATAQADHHQ
FT                   LQLNVYVANRPAIAFYHYHGFRVIDQANDQATQQPEYTMQWQR"
FT   gene            complement(204295..205473)
FT                   /gene="serA1"
FT                   /locus_tag="JDM1_0188"
FT   CDS_pept        complement(204295..205473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serA1"
FT                   /locus_tag="JDM1_0188"
FT                   /product="phosphoglycerate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61077"
FT                   /protein_id="ACT61077.1"
FT                   /translation="MYQVKTYNAIAPAGLNTFTADYTLNQSEHPDAYLIRSVNLHTETL
FT                   PSSLKVIVRAGAGVNNIPIDQATANGTAVFNTPGSNANAVKELIIGLLIMASRNLIAAT
FT                   TYSAQHTEADISQRTEHDKTQFNGIELTGKTLAVIGLGHVGALVANAALSLGMNVIGYD
FT                   PYLSADAAWNIAKQVQRAATLPDAVKQADFVTVHVPKNADTLHLINKDALAAMPTGVQL
FT                   FNYSRLGIVDNTAVMNALATGQVAHYYTDFGEPQLANQSAVTVTPHIGGSTIEAEINGA
FT                   TQAARTIMTYLETGNVHAAINLPDLNVPFNAAYRFTVIHENVPNMVSQITAKLAAANLN
FT                   ITTMANAAKHQIAYTIIDVDDLQQPQQADLIAELSKIPAVSRVRLLKRGSVE"
FT   gene            complement(205488..206561)
FT                   /gene="serC"
FT                   /locus_tag="JDM1_0189"
FT   CDS_pept        complement(205488..206561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serC"
FT                   /locus_tag="JDM1_0189"
FT                   /product="phosphoserine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61078"
FT                   /protein_id="ACT61078.1"
FT                   /translation="MPIYNFSAGPAVLPQPVITQIQAELPSFRDSGMSILEISHRSDLF
FT                   AQVLQDAEQDLRDLMAIPDNYHVLFFQGGGTLQFTAAPLNLAPHHRIGLLDSGHWAQRA
FT                   ADEAKRVGTKVTILGSSAANHFNQLPTVVQPIDQSLDYIHLTTNNTIEGTMMTRLPVTG
FT                   QVPLVADMSSNFLGEPYQVSDFGLIFAGAQKNLGPAGLTIVIVRDDLIGQVANLPSMLD
FT                   YQLFAAKDSMFNTPPVFAIYAAGLVLKWLKAQGGLSTMTARNHAKAALLYDFLDQSQLF
FT                   TNPVKTSDRSTMNVPFVTGQADLDAAVIQGAREHGLLNLKGHRLVGGMRASLYNAMPLA
FT                   GVQALVDYLAAFEAHHR"
FT   gene            206945..207568
FT                   /gene="pgm1"
FT                   /locus_tag="JDM1_0190"
FT   CDS_pept        206945..207568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgm1"
FT                   /locus_tag="JDM1_0190"
FT                   /product="phosphoglycerate mutase (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61079"
FT                   /protein_id="ACT61079.1"
FT                   /translation="MTTFYVVRHGQTVANAQNLKQGTINTAVTHLNSVGKQQAQTLHDK
FT                   FDISFADRLICSPLDRTQATAAILNQGRQLPVSQDERLLEISYGQWDGQDNDQLLAAYP
FT                   QYFDPLLQDVLPSYVEVATDGETFEHVQQRVAAFLKTTAQAHPDEQIIVVTHGFTVKAM
FT                   ALAILKPTDPMSLPEPANTSVTKVMVDAVHGRQYLAYYNRLPQF"
FT   gene            207826..208818
FT                   /locus_tag="JDM1_0191"
FT   CDS_pept        207826..208818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0191"
FT                   /product="Aryl-alcohol dehydrogenase family enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61080"
FT                   /protein_id="ACT61080.1"
FT                   /translation="MMTYSAASTRYDELPIRRVGKTGLQLPVVSLGLWRNFGDEAPFAN
FT                   SRKVVLDAFDHGVFSFDLANNYGPSKGSAERTFGQIMQRDLKPYRDELVITTKAGYPAW
FT                   SGPYGAFGSRKTLISSLDRSLKQMHLDYVDIFYSHRPDPNIDLYETAAALDQLVRQGKA
FT                   LYVGISNYDRDQTATMVKYFNEMHTPFTVNQYSYNMLNQQAQTTGLIDYLGQHNAGLVA
FT                   YGPLAEGLLTQRYLQGIPADFPIHRTNKYLFDQGTAAVVNQLNALNRIAEQRGQTLAQM
FT                   ALAWLLRSQVVTSVIIGTTNVDHLHANLEATHNLTFSDDEVKAITAILK"
FT   gene            209320..209541
FT                   /locus_tag="JDM1_0192"
FT   CDS_pept        209320..209541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0192"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61081"
FT                   /protein_id="ACT61081.1"
FT                   /translation="MEQLKPIEASLLQAYELNCVVRLTLSDGHQPSGLIAAVDDQQLFL
FT                   NQQAGVVKPIALSDVTAIDFLKQSWWQR"
FT   gene            complement(209544..209774)
FT                   /locus_tag="JDM1_0193"
FT   CDS_pept        complement(209544..209774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0193"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61082"
FT                   /protein_id="ACT61082.1"
FT                   /translation="MPTFYWHENVIHFALFKHHFGLYPTPSAIETFHDQLITYKTSKGA
FT                   IQFPLDQPLPLELITAITEFRRHEIIAKYDL"
FT   gene            complement(209877..210749)
FT                   /locus_tag="JDM1_0194"
FT   CDS_pept        complement(209877..210749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0194"
FT                   /product="Fibronectin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61083"
FT                   /protein_id="ACT61083.1"
FT                   /translation="MTTTTDVDLVQTGLAHLIHHTRKQIESLTKALDHLPDVSDLQLKG
FT                   TLLKTYASQIEGHHHFVELPDYQGHQLSIKLDIKKSIIENAEDYFHHYHKSKRGQATVQ
FT                   QNLTTAKTELYQQLATQAAFDPNDPQAVAALKQTLIAAGAIHTHVLHSSKAPTPAHPRR
FT                   FYTHDHVLVEVGKNSRQNDHLTLTARKDYYWMHAGGEIPGSHVVIHSNHPSEQTLQEAA
FT                   VLTAYYSKGRQMNRVPVDVLTVGQMRKPKGAKAGLVTFSGPARTITVVPDATLAAELRD
FT                   QEDIHHDAD"
FT   gene            210925..212112
FT                   /gene="ack1"
FT                   /locus_tag="JDM1_0195"
FT   CDS_pept        210925..212112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ack1"
FT                   /locus_tag="JDM1_0195"
FT                   /product="acetate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61084"
FT                   /protein_id="ACT61084.1"
FT                   /translation="MQKTLIINAGSSSLKWQLFAMPAETVVASGLVERISMPGSIFTIK
FT                   YGDHQKFETTVNNLDQNHAAQMLLAELQRLAIIDSLTEITAVAHRVVAGGETFKQAVEV
FT                   TPAVLEAIKGLSDFAPLHNPMEARGIETMAQALPTVKQYAVFDSQFFTDLPEMNAIYSL
FT                   PYELTQKYHIRRYGEHGISHGYLTGRAAELLAKPKDDLNLVTLHLGSGASLAAVKNGRA
FT                   FDTSMGFTPLTGVTMGTRAGDVDPAVLPFLMKALKIDDPNEIMMMLNNQSGLLGISGIS
FT                   PDMREIRAQEATNPQAQLAVEIFVNRIVKYAGSYLTELKRADALIFAGGIGEHNATLRQ
FT                   QIIDELSIFGVTLDPKLNEAGQEGLISGADSKIKVMLIPTNEELAMVRQVAALQN"
FT   gene            complement(212167..212418)
FT                   /locus_tag="JDM1_0196"
FT   CDS_pept        complement(212167..212418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0196"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61085"
FT                   /protein_id="ACT61085.1"
FT                   /translation="MVAFPNNATPAIATTIKPNHNAILNKNNPITIMNTQPIILKPILK
FT                   ITLSNHKPITKAINKPIIYALCEESFPPYKSHHGYLAS"
FT   gene            212231..212422
FT                   /locus_tag="JDM1_0197"
FT   CDS_pept        212231..212422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0197"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61086"
FT                   /protein_id="ACT61086.1"
FT                   /translation="MIGLLIALVIGLWLLKVIFKIGFKIIGWVFMIVIGLFLFKIALWL
FT                   GLIVVAIAGVALFGNATT"
FT   gene            complement(212561..212911)
FT                   /locus_tag="JDM1_0198"
FT   CDS_pept        complement(212561..212911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0198"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61087"
FT                   /protein_id="ACT61087.1"
FT                   /translation="MLVLVGLAGAGAAVGALSRYGIMRLALPLNRWPLPIATLFINLTG
FT                   ALLLGWILTSSLPPNWQIFLGTGIMGGYTTFSTMINELVLLGRNHHQRVAWEYFGLSLV
FT                   GGLVMVYLGTLI"
FT   gene            complement(212911..213294)
FT                   /locus_tag="JDM1_0199"
FT   CDS_pept        complement(212911..213294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0199"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61088"
FT                   /protein_id="ACT61088.1"
FT                   /translation="MKKIIAITGFAMLGGGLREGLSLLVTWPQHFWITCLINIVGAFVL
FT                   SLITNLLPARLPVSEDIVIGMSVGFVGSFTTFSTFTFETLQSFQSGHSVLALSYVAASL
FT                   GLGLLAGLAGNFLSTYWLPKEEF"
FT   gene            213595..215115
FT                   /locus_tag="JDM1_0200"
FT   CDS_pept        213595..215115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0200"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61089"
FT                   /protein_id="ACT61089.1"
FT                   /translation="MTMINLKNIQKDMAGRPLFTIDRLVANAGDQIGVVGRNGAGKSTL
FT                   AHLLTGTDRDYTGQIMVDEPVSYVAQIAPTFDQSGGQAMLTRIRQALSARPTILILDEP
FT                   SSNLDETHQQWLINQLQRFRGLLLLISHDRQLLNAVTTQTWAVEHQKFTAYAGNYAYYQ
FT                   TVKAQQLATQEAAYQRQNTHQRELLAAQRQRNEKAQRIRKGNRRMSQVERAKTKATREA
FT                   TAAKMERTAKRMVARGQREPQVAKPFTTSGFKLVATDFPTFTGKTVVTGLNVTLAEYGK
FT                   TLLAHADFQIRPHDRVDIVGPNGSGKTTLLRAILGGRVSGLRLAPAARVGVFNQDMTVL
FT                   DGKQSVWQTVRQVSQLPDQTIRNVMGALGLPARFYPQLVSALSGGELVKLQLICILVGQ
FT                   YNVLMLDEPTNYLDVDALDALADYLQNYPGTVIFVSHDEPFRQAVATRVLQFETHQLVD
FT                   PDKVVKAPQPVETDLAVLQFKYDQLMADPTSSTAAIQALRQQIDRLKA"
FT   gene            complement(215236..215883)
FT                   /locus_tag="JDM1_0201"
FT   CDS_pept        complement(215236..215883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0201"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61090"
FT                   /protein_id="ACT61090.1"
FT                   /translation="MKLLLLLIIALEISFTTIVSLNVALIILALIYLLGHRTRLRTLGW
FT                   LLLIPLLPAIGLWSTQYINGSGDKTLMAWVLFTRIYAFVFTGATFTLTTDVLQLTDSLE
FT                   QNWHLPAKFSYGVLAAYNLVPRIQHEVQVIRAAGLMRGQVLSFWSPQLYFKAILVSINW
FT                   SQNLARAMRSHGFVEDAPRTHYRQIPLTKLDWTIVISGVLLLQVGAFVIPWR"
FT   gene            complement(215892..217298)
FT                   /locus_tag="JDM1_0202"
FT   CDS_pept        complement(215892..217298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0202"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61091"
FT                   /protein_id="ACT61091.1"
FT                   /translation="MASIALNNLTYTYPQASTPILDRVNLTLPRQSFILLTGPSGTGKS
FT                   TLLKLIAGLLPLTPDYGTITFDGQSLTTSTANQRAQHVAMMFQNPNQQFAMDTVENELI
FT                   FALENLQVPRDQIPARLLSALDFVGIRNLQSRLLNHLSGGEKQKVALAIIVAMDSDVIL
FT                   LDEPFASVDPTARAVLLDRLVELRNQHGKTIILADHDLTGYEQLVDQVVQIKDQHLQLI
FT                   DRTTWSELFAAFTEQPQRSWSAPQRVERPCFQLDHVTLQAGDRQLLVPTTRQLLAQHNT
FT                   LITGPNGSGKSTLFEALVRLHPYTGEIRYEGTPIDKLKRKRYARHVALLFQDAETQFLN
FT                   ITVAEELAQSKRYAYGDYFTADRIQTALVQLNLSGRDEQVIYTLSEGQKKKLQILLMLI
FT                   MQSPVLLMDEPLKGLDLHSINALVALLQTTQAATKQTLIIISHQLTGLMPLIDYQLHFE
FT                   NHHLDWVVRS"
FT   gene            complement(217328..217897)
FT                   /locus_tag="JDM1_0203"
FT   CDS_pept        complement(217328..217897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0203"
FT                   /product="ABC transporter subunit (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61092"
FT                   /protein_id="ACT61092.1"
FT                   /translation="MKWVKSWYLNDIILLALIGIFFGAIFMGTNFVYNILSAALTPFGL
FT                   SGLANELLLGLWCMPGMLAGYLIRLKGSATLGELLAATVEMFFGGQWGITTLISGVVQG
FT                   FGAELGYIVTGYKHYDWLGLTAAAATTTVVTFGWDLARNGYYKLQLWLLILYVVVRFIS
FT                   MFVFGGLLTKTITDLLDRSHVLKSTH"
FT   gene            218238..218723
FT                   /gene="gpo"
FT                   /locus_tag="JDM1_0204"
FT   CDS_pept        218238..218723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpo"
FT                   /locus_tag="JDM1_0204"
FT                   /product="glutathione peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61093"
FT                   /protein_id="ACT61093.1"
FT                   /translation="MAESVYDFTETEMSGAPLDLSQYRGQVLLIVNTASNCGLAPQFKG
FT                   LEELYQKYQQEGLVVLGLPSNQFHQEKADDDETHDYCQRHYGVTFPMTKRVMVNGDDAD
FT                   PLFTYLKQAAGHGRIKWNFTKFLIGRDGRVLERYAPTTRPATFEAAIRDALADRSED"
FT   gene            218774..219604
FT                   /locus_tag="JDM1_0205"
FT   CDS_pept        218774..219604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0205"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61094"
FT                   /protein_id="ACT61094.1"
FT                   /translation="METYTLRDGLTVPKIGFGTYKLNGAHGVQVIDSAIDRGYRLLDTA
FT                   FNYENEGAVGEAVRRSSVPRSELLISSKLPGRHHTYTEAINTIQESLYRAGLDYYDLYL
FT                   IHWPNPKEDHYVEAWQALIDAQKLGLIRSIGVSNFLPEHLERLNKETGVLPVINQVELH
FT                   PYFNQQAQRDYDQAHGVLTQDWSPLGRASEMLQNETLKEIAAHYHKNVGQLILRWELQL
FT                   GTLPIPKSSTPSRQAGNMDVFDFEISAADMATINGLSQVDGRLNNQDPAVYQEF"
FT   gene            complement(220108..220578)
FT                   /gene="greA"
FT                   /locus_tag="JDM1_0206"
FT   CDS_pept        complement(220108..220578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="greA"
FT                   /locus_tag="JDM1_0206"
FT                   /product="transcription elongation factor GreA"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61095"
FT                   /protein_id="ACT61095.1"
FT                   /translation="MEPTFNKMTATGYHAIEQEIEDLKQQRPERIRILAAAAALGDRSE
FT                   NAEYSSAKRDLGRLESRLRYLNKQLQYAQIVQPADNNQLDIGKFVTIEFLDDHDQITYQ
FT                   LVGKQEANLEQQKISFTSPIGQALANHTVDDVVTVNAPNGAYQVKVIAVKRA"
FT   gene            complement(220664..221077)
FT                   /locus_tag="JDM1_0207"
FT   CDS_pept        complement(220664..221077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0207"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61096"
FT                   /protein_id="ACT61096.1"
FT                   /translation="MKKIRDERLILQNFKNIRTTLLIENIAILLILFWQGWQKNNLQKA
FT                   FTYDNPLYIVLMIAVFTMIILSVNVSTPIEDKTKRSWRYLGLWALIELIDFTALFYFLI
FT                   AINQPFISLIAGIALTAVTSGIMLYSNHLRDRD"
FT   gene            complement(221090..221293)
FT                   /locus_tag="JDM1_0208"
FT   CDS_pept        complement(221090..221293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0208"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61097"
FT                   /protein_id="ACT61097.1"
FT                   /translation="MLTANHVKQYRLMAGFSQKELASKTGITRQTLSLIEKGTYNPSLK
FT                   LCLNLCHVLNQTLDTVFWVEPS"
FT   gene            221673..222386
FT                   /gene="gnp"
FT                   /locus_tag="JDM1_0209"
FT   CDS_pept        221673..222386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gnp"
FT                   /locus_tag="JDM1_0209"
FT                   /product="glucosamine-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61098"
FT                   /protein_id="ACT61098.1"
FT                   /translation="MKVIVVKDQAAGGKEGFKVFKNALDNGAKVFGLATGSTPVTTYKE
FT                   IVNSDLDFSDCTSVNLDEYVGIAPDNDQSYKYFMQTHLFNDKPFKESFLPNGLASDPEA
FT                   EVKRYDKVIDEHPIDLQILGIGRNGHIGFNEPGTPRDITTHVVDLTESTIEANARFFAS
FT                   ENDVPKQAFSMGLASIMKSKHLLLEAFGENKADAVKGMIEGPDTPELPASILQNHPDVT
FT                   VIIDEAAASKLSKKY"
FT   gene            complement(222476..223684)
FT                   /locus_tag="JDM1_0210"
FT   CDS_pept        complement(222476..223684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61099"
FT                   /protein_id="ACT61099.1"
FT                   /translation="METTKSISGSSKSYVSKTRIGVLAVSSMGMAALAITPSYAAIASN
FT                   FSLSNTSVQMLTSLPNLFMMLAGLIIGKLTATKLNLKTLTLSAAILVIIGGFLPLAFHT
FT                   NFMFLLFCSCLVGLGQGACTNLSQVLISQMLPETERQSTMGLTTTFTNLGGIVFIMGGG
FT                   QLAATNGWVNNYWIYLFSALILIVILTLVPMHPAAVNAANDQDTGEQIKLNKYVFYCAF
FT                   WGFCTLLLNNVLNNNISLFVAEEKLGATSQAALTSTVSLIGGMLCGLIVGVIGKRFKYS
FT                   SITISFILYGLSYLLIGLGHSLWLAFVGSFIVGAAMSIAMGQFPYLISISVGKNSVSMA
FT                   LGVYVAIYSIGGVVSPFIVNPLTKLVAGMGINVFVVSGFIALILGVLCMGFQFQKKLVT
FT                   AAQ"
FT   gene            complement(223730..225235)
FT                   /locus_tag="JDM1_0211"
FT   CDS_pept        complement(223730..225235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0211"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61100"
FT                   /protein_id="ACT61100.1"
FT                   /translation="MTNQTIDTDVLIAGTGGTGLAAAYAAVTHGLKVTVIEKQSQIGGN
FT                   TKISSGFFAINSREQREAGMHLTTQEAIAQLADYNHYLSNGTLLARIVNRSADTLAWLE
FT                   KMGMEIKLNPTANTTQFAHRNNDYRGGSYHMYQHKDESYQRIQQTLTTAGVDFHFNTTF
FT                   TDLVITNGAVTGAIAMTASGDQLTITAHAVVVATGGYGGDREKVARTMHTTHLRTLGVP
FT                   NNGEGLAAMVKAGGTDIDSHALIHAAQLAKSQVTQKTSQQHLAGFSGNPLTQLLLTPQL
FT                   WVNMQGQRFTNEDVVYDTVEWANAAWSQGGQYLFIVDQATLNTFTTNRNREEVSQAGPG
FT                   AATGSGDFTALAEEAVTGKTAFKGNTLTELATNAGMDPSTLSQTVATYNQAVASKNDSE
FT                   FSKRLQSLDYSISDGPFYAFICQAAYLGTVGGVRVNRNLAVLDDDFKPIPGLYTGGANA
FT                   GGYYEGHSYPAFEGLASGFTWTSGRIAGTSAAAYVKAKFATVN"
FT   gene            225362..226282
FT                   /locus_tag="JDM1_0212"
FT   CDS_pept        225362..226282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0212"
FT                   /product="AraC-type DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61101"
FT                   /protein_id="ACT61101.1"
FT                   /translation="MASIKTVNSNYQLKESDFIGLRRNDLSSSPNCSSEFHIRFIVSHD
FT                   FAELTLVGKYVALSPDDIVMVSSAQPINIINRGAPVKLSVFSERLHAPTPLNLVVVGDN
FT                   PMVHDLMNAGERTLRFIVYRQLRNQITQRYFDLLTELERQDLQDVFIDYQREMTVGLLM
FT                   TELLRHHEERISITGSYFPGKNIRHVNADTQSGMIFTYLVAHNADATLKETACYFGYDK
FT                   NYFSRLCRRLFNKSFSEQLTFIRIELAKRMLAFSNKRIEQIAAELGYKNNSSFFTAFKR
FT                   EVAITPNDYREQHGYRLAHQHINDN"
FT   gene            complement(226339..227754)
FT                   /gene="pepD1"
FT                   /locus_tag="JDM1_0213"
FT   CDS_pept        complement(226339..227754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepD1"
FT                   /locus_tag="JDM1_0213"
FT                   /product="dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61102"
FT                   /protein_id="ACT61102.1"
FT                   /translation="MKKDTDCTEILVGKAASMDGSTIVARNEDGYGPINPIKFIVHEAH
FT                   DQTNASYTSVTTGVTVPLPDHAYRYTATPQADQSDGQYEEAGINELNVGMSATETTATN
FT                   ARVLGYDPLVHDGVDEEAMVTLVLPYIKSAKEGVQRLGALIEKYGTGESNSIAFNDHDD
FT                   IWLFETAGGHHWGAVRMPEDTYAIVPNQTVVQEMDLNDTDNFLGASDLVDFVEKYHLNP
FT                   TPGHFNFREIFGTQSEADAYYNTPRTWYGQKLFNPEIEQNPTDQNMPLFRQPSKKLAIE
FT                   DVQFFLSSHYNGTPYDPFGTFASGNAREQTRYRSIAMDRNQCSSILQIRNDVPAKQAAI
FT                   QWIALGFFAYAPYVPFFTNINDTPIDYRNTTSTVSVDNVYWLSKTLSVLIEPHWHEFSE
FT                   TVNAYRDGCQSYARGRVAATDAAITGNPTDFLTKANSETAAEISNRTHALFDTLVKQGL
FT                   LLSKTTWEKGQNL"
FT   gene            228116..229954
FT                   /gene="pts2CB"
FT                   /locus_tag="JDM1_0214"
FT   CDS_pept        228116..229954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pts2CB"
FT                   /locus_tag="JDM1_0214"
FT                   /product="mannitol PTS, EIICB"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61103"
FT                   /protein_id="ACT61103.1"
FT                   /translation="MSENVNTNATQSAPVAKKKLGVKARVQKFGSALSNMVMPNIGAFI
FT                   AWGLITAIFMAGGWWPNAGLAKMIQPMVHYLLPLLIAFTGGTLFAGHRGGVVGAIATMG
FT                   VIVGSSIPMFIGAMIMGPLGGWCIKKWDDAISDKIKSGFEMLVNNFSAGIIGMLLAILG
FT                   YFAIGPLVAGASAAMAAGVDWIIKMKLLPLANVFIEPAKILFLNNAINQGILTPLGIQA
FT                   ASSAGKSILFLLEPDPGPGLGVLLAFALFGKGTAKASAPSAIIIHFLGGIHEIYFPYVL
FT                   MKPALFLAVIAGGVTGTATFSLLNVGLRSTPSPGSIISLLLMSPKSISNYIGLIIGVTL
FT                   ATLASFIVAAIVLKRDKSTGDDDLATAQGKMSDMKSGNAEAASATDAEPADVIASYKDV
FT                   DHIIFACDAGMGSSAMGASLLRDKVKKAGISMSVTNTAISNLKDEPGLLVITQNELADR
FT                   AAQKAPHALRLAVDNFLSSPKYDQVVVNLKARDQVSDAAPASAAPQATTAAPDDLPANL
FT                   DLSVVDEIVFVHHDGHLGTATMATSLMKDRVKKANKHVSVKNLGIDELADNNSLLVVSS
FT                   AEAAKNLKTRYTQVQVLITDDLLSSPKYDKMVSELK"
FT   gene            229991..232066
FT                   /gene="mtlR"
FT                   /locus_tag="JDM1_0215"
FT   CDS_pept        229991..232066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtlR"
FT                   /locus_tag="JDM1_0215"
FT                   /product="transcription regulator, mannitol operon"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61104"
FT                   /protein_id="ACT61104.1"
FT                   /translation="MVKFTQRQDELLQLLLANPAGLSMSQIETGLNSSRRTIYREFSNL
FT                   ELVLANADLKIVNEKHHFQLSGSQTALAKFQSQLTAERKIAPAFDSQTRQNALACRLLM
FT                   TGHSVKLKELALDFDVSVATISNDLTALATPFADYDLSIERLKSRGIQVAGTEGSIRNL
FT                   FATILNNEINDYEFFKTIGKLNQGLAISASDEQSYFLNLLDAQTLIICYQAVRSLKKKY
FT                   FSSVPDGQLQQLIITLTTGVMRLQHERRVTYLRGINRDDFLKYQRIALAIMTQLPAEIK
FT                   TVVTGAEIDFLAQQIKGLTFRIDQDASLSNYDLQLTYRVKKFIDAVATNFNWSFGTDDR
FT                   LLNNLTAHMQIALQRNGVNGPVPPTAELQEVREQYPKLYSAVVRGFATIFKDQDFTTDE
FT                   LTYLLIHFASTYEQQLSHQALKVLVLCPNGMTTARILKTRLMRLVPEITAIEVARIGNL
FT                   GQVNLQDFDMILSTTTLPGFKLNYRVVSPLLLENEVTALREYIHQYFPSTKVIDSPVDE
FT                   PTKINLDFDTVYQQMTIAKQILDRFTITPIRNDDETVAETLVKITRHIDSNLIHDPLEV
FT                   AGRLLHRLGLAPVGIPNTNLALVHTLSQEVTAPYCAIFELDQPLPFKSMDNQSIRLQRI
FT                   VLMLGPANISDFENRLMGKLSALVIESQANTQTFMTGDRQQLYQLISKAFLNELTK"
FT   gene            232081..232530
FT                   /gene="pts2A"
FT                   /locus_tag="JDM1_0216"
FT   CDS_pept        232081..232530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pts2A"
FT                   /locus_tag="JDM1_0216"
FT                   /product="mannitol PTS, EIIA"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61105"
FT                   /protein_id="ACT61105.1"
FT                   /translation="MEALDKKMIALNQQVATQEEGIRLAGQLLVDGGCVEPEYIDAMQA
FT                   RNQDVSVYMGNFIAIPHGTEDGMKYIKKTGISVVQVPMGVSWGNPDDNDDDKTVTVIFG
FT                   IAGLNGEHLNLLSQIAIYCSDVANVAKLADAQSEDEIINLLKEVD"
FT   gene            232532..233689
FT                   /gene="mtlD"
FT                   /locus_tag="JDM1_0217"
FT   CDS_pept        232532..233689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtlD"
FT                   /locus_tag="JDM1_0217"
FT                   /product="mannitol-1-phosphate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61106"
FT                   /protein_id="ACT61106.1"
FT                   /translation="MLDVHFGAGNIGRGFIGETLADNGFKITFVDVNDTLIDELNKRNG
FT                   YTIELAAEGQKHIEVHDVKGINNGKDPKAVAEEIAQADMVTTAIGPKILKFIAPLIADG
FT                   LKLRQANNNTTPIDIIACENMIGGSQSLKKSVYESLNEDEQAWADQNAGFPNAAVDRIV
FT                   PLQKHDDPLFVSVEPFKEWVIDKSQMKNPKIQLKGVDYADDLEPYIERKLFSVNTGHAT
FT                   VAYTGNMKGYKTIGEAVKDDSVVDQAKHVLGETGDLLIQKWGFDPEVHHAYQKKILSRF
FT                   ENPYISDDIERVGRTPIRKLGFNERFIRPIRELKERGRDYSALVDTVGEMFFFNYPNDS
FT                   ESVKLQQLLKDEPIEQVIRETTDLKDEDLVNEIKAAYEKHLAATK"
FT   gene            complement(233946..234497)
FT                   /locus_tag="JDM1_0218"
FT   CDS_pept        complement(233946..234497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0218"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61107"
FT                   /protein_id="ACT61107.1"
FT                   /translation="MSTQTISPEQDSELVASVAAEQLGIKAVTLRKYSTMVEKQLNDEN
FT                   RFRPADNSHRLYTAADLKTFQAAIELAEQGTTLATALGRAFGAKVPTSKQPAATTTQSE
FT                   KPAPATTTKSPLITTTIVDPSKMTPAAKPDGPTNAELYKQQEMIIRRLDSLSDRLNQVL
FT                   DQLDQQASQAAKPWWHFWEK"
FT   gene            234678..235010
FT                   /gene="trxA1"
FT                   /locus_tag="JDM1_0219"
FT   CDS_pept        234678..235010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxA1"
FT                   /locus_tag="JDM1_0219"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61108"
FT                   /protein_id="ACT61108.1"
FT                   /translation="MIEPVDKTTFATVADGTALTVVDFWADWCGPCKMQEPVLEALDEL
FT                   YDGQVKFASLDVDQHQEIAQQFEIMSIPALVIFKNGQPAEKVVGFHPQAALKKYLDQKL
FT                   AEVKPA"
FT   gene            complement(235105..235431)
FT                   /locus_tag="JDM1_0220"
FT   CDS_pept        complement(235105..235431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0220"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61109"
FT                   /protein_id="ACT61109.1"
FT                   /translation="MNSFKNPLMTTPYLLAIIATLTMLVSPLTTVVISVLIWLSGITLV
FT                   WLHRQQRWLRFFYAPVFLYTFLLEQWYFSPSTQPLTETILINLAILGIAIFSTWAAYQL
FT                   RHNA"
FT   gene            235721..236275
FT                   /locus_tag="JDM1_0221"
FT   CDS_pept        235721..236275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0221"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61110"
FT                   /protein_id="ACT61110.1"
FT                   /translation="MKKLIWALRVGIVLFGVCLVWEQVQLERHTSQRRTYHQRRLQRST
FT                   AATFKAIRQPQLSDFPAAKVEAAQVWLHLKGTRVINEATPLHIRKIAAGQRIQPDDPHS
FT                   AVYHHQMTQIYSDDLQDATNSVIYARNADNTVLVAHSRSGQRSQVGPVAQNVHTAMPAV
FT                   QKMKIPAKPSATLLKVVQLII"
FT   gene            complement(236340..236741)
FT                   /locus_tag="JDM1_0222"
FT   CDS_pept        complement(236340..236741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0222"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61111"
FT                   /protein_id="ACT61111.1"
FT                   /translation="MNIVVGPYVRRPRAVKSDPRITSKFSMFNSLRRIDECLVLIKRTG
FT                   TPGLIDSTATLGLNLTHLMGLNVIVTSRGRSFTIIVQGRQRSFTLTGCLIEDTLYNAVH
FT                   PAQPDYLISLNRQLITNSDDLIEQLYDHY"
FT   gene            complement(236983..237447)
FT                   /gene="ndk"
FT                   /locus_tag="JDM1_0223"
FT   CDS_pept        complement(236983..237447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndk"
FT                   /locus_tag="JDM1_0223"
FT                   /product="nucleoside-diphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61112"
FT                   /protein_id="ACT61112.1"
FT                   /translation="MANSEKTLVLVKPDGVSEGHIGEVITRLERKGYQIAALKVIKATA
FT                   EQLQQHYSEKVGKPYFKEIETYMMEGPLVAIIVSGTGVVKAVHRLAGSTRPAEAQPGTI
FT                   RGDFSHEYPDGILRNVIHTSDSRENAHHEIAIWFPELAVKARKADNKVKA"
FT   gene            237682..239028
FT                   /locus_tag="JDM1_0224"
FT   CDS_pept        237682..239028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0224"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61113"
FT                   /protein_id="ACT61113.1"
FT                   /translation="MPPLDLTHIRQHHTVAELIALGKARRQVTPFEKLGTFTPVKRNAS
FT                   DYLKHVREMLVPELLPLRRERMSASAFAFFRGSVELMDYDLDYQSSTEIPAVVCGDAHI
FT                   GNFGFYASPERRLVFDLNDFDEAGVHPWEWDLRRLLVSVLLAARDSNFKPKKVEKLIQA
FT                   ASASYREALKRMFDQTTLDRFYRDNEVQAVLNFGGAPEDTADLIASLVKKAQKRNSEQV
FT                   VRKFTVTNSRGERQFKENAPRSVHIDRQTYQGLKAGISEYLLNVRTDVALLLSQYEVTD
FT                   IIRHSVGVGSFGSLCYLVLLTSTDGSHMVLQIKEALPTRKVGSQSRPALTAAMELTEGQ
FT                   RIVSSQRILQATSDAFLGYFQMENKSFYVRQFRDMKESIDIPTLDWGQFQAYANTCAMI
FT                   LAKAHAQSPTAAMIRGYVGNSAKFDEAMAKWATAYVEQVDNDYQDFLDI"
FT   gene            239220..239876
FT                   /locus_tag="JDM1_0225"
FT   CDS_pept        239220..239876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0225"
FT                   /product="oxidoreductase (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61114"
FT                   /protein_id="ACT61114.1"
FT                   /translation="MILKIDRLKWLHFFSNLIYLLLVSETKKLVLKGLFDMTKYGVIVG
FT                   SIRKNSYSKGVAEAIVAGLPDDAEVTYLNIAKLPLYNQDYDADSPVEYTEFRQAVAAQD
FT                   AFIFVTPEHNRSIPAALKNALDVASRPWGQSVWGGKPALVASQSISGISGVLAHHVLRQ
FT                   SLVFLDMPTMQQPELYIGNTDKLADENGHITNEGTQSFLAGAGKQFSEFAAKFVK"
FT   gene            complement(240016..240558)
FT                   /gene="cysE"
FT                   /locus_tag="JDM1_0226"
FT   CDS_pept        complement(240016..240558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysE"
FT                   /locus_tag="JDM1_0226"
FT                   /product="serine O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61115"
FT                   /protein_id="ACT61115.1"
FT                   /translation="MFQTARAILNRDPAAINLRTVMLTYPGIHALAWYRVAHYFETHRL
FT                   PLLAALLSQHAARRTGILIHPAAQIGHRVFFDHGIGTVIGATAVIEDDVTILHGVTLGA
FT                   RKTEQAGRRHPYVCRGAFIGAHAQLLGPITIGANSKIGAGAIVLDSVPAHVTAVGNPAH
FT                   LVATQLHAYHETTSNQA"
FT   gene            complement(240563..241708)
FT                   /gene="metC1"
FT                   /locus_tag="JDM1_0227"
FT   CDS_pept        complement(240563..241708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metC1"
FT                   /locus_tag="JDM1_0227"
FT                   /product="cystathionine beta-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61116"
FT                   /protein_id="ACT61116.1"
FT                   /translation="MKFETQLIHGGISEDATTGATSVPIYMASTFRQTKIGQNQYEYSR
FT                   TGNPTRAAVEALIATLEHGSAGFAFASGSAAINTVFSLFSVGDHIIVGNDVYGGTFRLI
FT                   DAVLKHFGMTFTAVDTRDLAAVEAAITPTTKAIYLETPTNPLLHITDIAAIAKLAQAHD
FT                   LLSIIDNTFASPYVQKPLDLGVDIVLHSASKYLGGHSDVIGGLVVTKTPALGEKIGYLQ
FT                   NAIGSILAPQESWLLQRGMKTLALRMQAHLNNAAKIFTYLKSHPAVAKIYYPGDPDNPD
FT                   FSIAKQQMNGFGAMISFELQPGMNPQTFVEHLQVITLAESLGALESLIEIPALMTHGAI
FT                   PRTIRLQNGIKDELIRLSVGVEASDDLLADLERGFVSIQAD"
FT   gene            complement(241720..242631)
FT                   /gene="cysK"
FT                   /locus_tag="JDM1_0228"
FT   CDS_pept        complement(241720..242631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysK"
FT                   /locus_tag="JDM1_0228"
FT                   /product="cysteine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61117"
FT                   /protein_id="ACT61117.1"
FT                   /translation="MLIQHVQELIGHTPLMALPIEVPNHSHIYAKLEMFNPGGSIKDRL
FT                   GAYLIEDGLQRGRVNAKTTIIEPTAGNTGIGLALATQAHHLRTILVVPEKFSMEKQVLM
FT                   QALGAEIVHTPSEEGIKGAIRKAEALAATISNSYVPMQFKNPANPAAYYHTLAPEILAD
FT                   MPAPITAFVAGAGSGGTFAGVAAYLQAQDSATKAVVVEPEGSILNGGPAHAHRTEGIGV
FT                   EFIPPFFDQVRIDQTLTIADDDAFAQVRHLARDHGLLIGSSSGAALAASLQLATNLPAN
FT                   SHIVTIFPDSSERYLSQKIYTK"
FT   gene            complement(243244..244035)
FT                   /gene="pepM"
FT                   /locus_tag="JDM1_0229"
FT   CDS_pept        complement(243244..244035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepM"
FT                   /locus_tag="JDM1_0229"
FT                   /product="methionyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61118"
FT                   /protein_id="ACT61118.1"
FT                   /translation="MITLKSDREIKGMQAAGDIMVGLFHALEDYIKPGITTWDVDHFAY
FT                   EYIVAHDATPGELNFEGYKYSTCVSVNDMICHGCPSKDILVKDGDLLKVDTVINYHGYL
FT                   SDSCHAFVAGTPSPEVKKLMEVTHKALYLGIDQAVVGNRIGDIGWAIQNYAENEMGYGV
FT                   VREYIGHGIGPTMHEKPDVPHYGEAGHGTRLKAGMTITIEPMVNIGDWRSGETADDGWT
FT                   VRTLDGSLSCQYEHTLVVTDDGPKILSSFDNDFDAKYLWNK"
FT   gene            complement(244071..244364)
FT                   /locus_tag="JDM1_0230"
FT   CDS_pept        complement(244071..244364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0230"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61119"
FT                   /protein_id="ACT61119.1"
FT                   /translation="MSSWPTSHVALLHVAFPFKTTQYIVSLSWPMKRVKFQIYIELFTI
FT                   NPTAPRQFGIFGVLIFLYFFGFGLLIALSISGQNNAFCRNTMLAVYWRGTNF"
FT   gene            244397..245185
FT                   /locus_tag="JDM1_0231"
FT   CDS_pept        244397..245185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0231"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61120"
FT                   /protein_id="ACT61120.1"
FT                   /translation="MILSNYFKFLSHQLKGWPQQNYYLFYFSLGCQVMTLVSAPITALS
FT                   ILTFIGTTLGVLCVLAINAAKSVNGLLGVISAACFIVVGFSAKNYLSIGEQLAYVVTLD
FT                   IPVLLSANWNVNMVSKIRKFTGKTWIVAIIATLVVYAISGYLIGALTDDPRPWVDAISF
FT                   AICLTAGVICFLRYNNQYFWWIASGLAQMVLWFISFRQGSATLAMFINSSVYLMNDVLA
FT                   FTVSPWYNKHERARLMAEEQAASDTASADASDNQAFGLNH"
FT   gene            245384..245662
FT                   /locus_tag="JDM1_0232"
FT   CDS_pept        245384..245662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0232"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61121"
FT                   /protein_id="ACT61121.1"
FT                   /translation="MDWFVNLEREDQEFVKQLVIASGSLKQLAKIYQVSYPTVRMRLNT
FT                   IIQKINFIEDNGANTFETKVMKLVIDEKLSLEVAKQIITDFREEQHE"
FT   gene            245655..245942
FT                   /locus_tag="JDM1_0233"
FT   CDS_pept        245655..245942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0233"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61122"
FT                   /protein_id="ACT61122.1"
FT                   /translation="MSDFKGILIGMLVVAVLYMLDRYLPRWFGAIPGAGFLGFIIYIVF
FT                   TKEVSLLSIVTVLLVGEAMLNGIWIDALVNRKRKMKKEVATMKAKDLLRK"
FT   gene            246258..246977
FT                   /gene="treR"
FT                   /locus_tag="JDM1_0234"
FT   CDS_pept        246258..246977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="treR"
FT                   /locus_tag="JDM1_0234"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61123"
FT                   /protein_id="ACT61123.1"
FT                   /translation="MNKAALVYQDLLQKIDAEVYPIGSYLPSEHQLCELYGISRETGRK
FT                   ALATLAEDGYIQKIRGKGSIVIEHRQYEFPVSGIVSYKELAEKLHIKTQNIVYDYQPDA
FT                   TLPVADFTSLGTELTEAPVTAIKRVRVIDGEPAIIDKDYILKSIVPKVPKQAAEDSLYA
FT                   YFENQLGLTIGYATKEITMAPATDEDREHLAISKGAYVAVVRSVTSLTDARAFQYTESR
FT                   HRADRFSFRDFARRTKK"
FT   gene            247002..248645
FT                   /gene="treA"
FT                   /locus_tag="JDM1_0235"
FT   CDS_pept        247002..248645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="treA"
FT                   /locus_tag="JDM1_0235"
FT                   /product="alpha, alpha-phosphotrehalase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61124"
FT                   /protein_id="ACT61124.1"
FT                   /translation="MKLSEQVIYQIYPKSFYDSNGDGVGDLRGVIEKIDYLKKLNIDMI
FT                   WFNPFFVSPQNDNGYDIADYYHIDPMFGTMADFEELVAKLKANGIGVMLDMVLNHTSTE
FT                   HEWFQKALAGDEKYQKFYYLRPPKADGSLPTNWESKFGGPAWAPFGDTGLYYLHLYDPT
FT                   QADLDWHNPAVRQACAAVVNFWRQKGVQGFRFDVINVTGKAEKLVDAPKGVPSKTLYTD
FT                   TPVVHDYLKELNAASFGQDVDSVTVGEMSSTTVANSVGYTNPANHELSMVFNFHHLKTD
FT                   YVDGRKWSRMAFDFPRLKQLLDSWASGMAAGGGWQALFWNNHDQPRALNRFGDAGRYRV
FT                   KSAEMLATVIHLLRGTPFIYMGEELGMTDPDYDNMADYVDIEALNAYRALIRSGYSHHD
FT                   AFTIVKTKARDNSRTPMQWDDSAKAGFTTGKPWLTPTNQATINVAHELASGEIFDYYQR
FT                   LIKLRKTMPIVADGGYQSWRLDDPQVFGYWRTYRQQKLLVLNNFYGQSTTVTLPEEMVG
FT                   AQVLLSNYQDVNVTAQLTMQPYQAVALLLG"
FT   gene            248662..250659
FT                   /gene="pts4ABC"
FT                   /locus_tag="JDM1_0236"
FT   CDS_pept        248662..250659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pts4ABC"
FT                   /locus_tag="JDM1_0236"
FT                   /product="beta-glucosides PTS, EIIABC"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61125"
FT                   /protein_id="ACT61125.1"
FT                   /translation="MAKAQTVTILSPVNGDVIALNKVKDPVFSAGMMGLGFGVQPSSGE
FT                   VVAPVSGQVTMVAETKHAIGFTTPDDHLEVLVHLGIDTVDLKGAPFTVKVAAGDDVQAG
FT                   DVIATMDLAAIQAANRQTTVILAVTNTSDKLESLDVVTGAKAAGDVTATGRLNANTFNA
FT                   KRQNRLPKAGKYDQLAADIVANVGGVENVSSLIHCITRLRFYLKDESKANDDVVRDLKG
FT                   VIDVAKAGGQYQVVIGPAVTDVYDAIIKQIGPGFSNDSETAKAVAETAAAAQRPTTPWG
FT                   KVKWGISNLIGVITGSMIPVIGLLAASGILKGILALLTTFNLVSPTAPTYVIINAMGDS
FT                   VFYFLPIFVGFTAGKKLEADPVIMGIIGGVLTYPAIVTMASGKATSTLLGMGINANFFG
FT                   LPVHVASYTYSIFPMIAGAWLASKLEPWLKRVIPTVLRMIFVPLFEVVIVSGAILLFLG
FT                   PIITVLSTGLANIIVWVYNLSPAISGLIIGGFYQVLVIFGLHWAVIPIVANDIATTGHS
FT                   YLNAIVSATMVAQGGAVFAIALKSKLANIQELAWPATISAFCGVTEPAMYGINLKYGRA
FT                   FVTASIGAAVGGFLTGLMNVNMWGFTGSLIGFTSFVNPKGLDFSFYGFLIASAATIVVS
FT                   FALTWMFGFKDEDANAVKVAPKKRHLGATA"
FT   gene            250879..252849
FT                   /gene="pts5ABC"
FT                   /locus_tag="JDM1_0237"
FT   CDS_pept        250879..252849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pts5ABC"
FT                   /locus_tag="JDM1_0237"
FT                   /product="beta-glucosides PTS, EIIABC"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61126"
FT                   /protein_id="ACT61126.1"
FT                   /translation="MTIMGKIDEVSILAPVTGQVLSLATVPDPVFAAGRVGPGFGVQPT
FT                   AGHILAPVSGRITVVATTKHAIGMVTTTGLEVLVHLGVDTVALNGAPFEVHVKVGDEVT
FT                   AGTLLVDMDLAAIEQAHKPTTVIIVVTNAQRVLTDLTLAPLPQAVAAGAVVATAHLITV
FT                   TTTASPVVAAVPQSTTRYSALATAIVANVGGQQNINSVIHCITRLRFYLKDEALAHDAV
FT                   IANLDGVIDVAKAGGQYQVVIGPAVNDVFDAVIAQLGPEFADGVPVPPVQEASSDVNWL
FT                   SHVRNGISGVIGVMTAAMIPVIRILAGSGILKGILAALTGFKVLAVTSGTYMVFNAVAD
FT                   ATFYFLPVVLGFTAAKKLGSDPIVLAIVGAVLIYPSLITAASKGATAQITFLGVPTHLM
FT                   SYSASVFPMIVAAWLGVYVERGLKRVVPLYLRSVFIPIIEALILAIVVLVVVGPLITII
FT                   SKGLANSLVAVYNFSPALSGLVIGGLYQTMVIFGLHWGIIPIVINDIATNGHSYLNAIL
FT                   SITMVAQGGAVLAVFLKSKDKHLKEISLAAAISAFCGVTEPALYGVNLKYKRVFVVASI
FT                   ASGLGGLLTGLLRVNNYALSGSLIGFPAFITPGVGIGSNFYGYLISHYGTLVIATMLVY
FT                   VFGFSDKLLGPKENLKATNNQ"
FT   gene            complement(252891..253673)
FT                   /locus_tag="JDM1_0238"
FT   CDS_pept        complement(252891..253673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0238"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61127"
FT                   /protein_id="ACT61127.1"
FT                   /translation="MAKRRITHDPHQFVNTATDRRRLQLAVQLALPTCAHVLARNFARS
FT                   SASSYWLLMLKTPGTAAPRFLTLRIADHLLWLTNHDQLTISWEAGNFDAVQRTLRQELT
FT                   PATLQQYSYQLTTTDIMTLRLILHLEQHQLIWLVQLAPEIAKAYKNQHFDLRDDFGQAK
FT                   LLLGNMNNSSLQLVPVKQPAFQNHLGQYFGRNLLFSQFTSHHLLRLLPTNQWIRPLLKV
FT                   LPPTPNLEQQLAVLYGTDFVRIYVEAIRQQARLQAISS"
FT   gene            253920..254483
FT                   /gene="vdcB"
FT                   /locus_tag="JDM1_0239"
FT   CDS_pept        253920..254483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vdcB"
FT                   /locus_tag="JDM1_0239"
FT                   /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61128"
FT                   /protein_id="ACT61128.1"
FT                   /translation="MKRIVVGITGASGTIYAVDLLEKLHQRPDVEVHLVMSAWAKKNLE
FT                   LETDYSLAQLTALADATYRANDQGAAIASGSFLNDGMVIVPASMKTVAGIAYGFGDNLI
FT                   SRAADVTIKEQRKLVIVPRETPLSVIHLENLTKLAKLGAQIIPPIPAFYNHPQSIQDLV
FT                   NHQTMKILDAFHIHNETDRRWEGD"
FT   gene            254486..254896
FT                   /locus_tag="JDM1_0240"
FT   CDS_pept        254486..254896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0240"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61129"
FT                   /protein_id="ACT61129.1"
FT                   /translation="MATFTTEQAGYQMQATLQVIGYDLLIVVTGGTNPHIGDVTTLTAS
FT                   TVPETVKFPSHDGRFHKDNFISERMAKRIQRYLAGSCTITAGIHVNQITKAQIAAAAPM
FT                   TDDLSRQIISWLQAHPVQAEKPEYYGQDEQPR"
FT   gene            complement(255187..255627)
FT                   /locus_tag="JDM1_0241"
FT   CDS_pept        complement(255187..255627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0241"
FT                   /product="transcription regulator (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61130"
FT                   /protein_id="ACT61130.1"
FT                   /translation="MRVSTRFSDSIHLLAYIKIYADTKLTSDAIARSIETSPVVVRRLM
FT                   SKLRQAGLITTTPGTAQPALAKPLSQISLLSVFYAIEGDKPLLAVDPKTNPDCIVGGNI
FT                   QTVLKQYYQDAQTAAEARLAKTSLQDVVDNILVEQAKKDAHK"
FT   gene            255812..256501
FT                   /locus_tag="JDM1_0242"
FT   CDS_pept        255812..256501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0242"
FT                   /product="transcription regulator (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61131"
FT                   /protein_id="ACT61131.1"
FT                   /translation="MSEIETIQAYYAASLGKDGRITRTQRQILAAALDLFAEKGYEEVG
FT                   TREIAERAGVAEGTLFHNFVNKNGILDAIMQPIVQNILPTMLNTLDQAVLDSPNQTLQA
FT                   FVVALVRDRVAFVTRNRASLAVILSQFFNNAQDRAAVLGMVSPSILAQANEAMDRLKAA
FT                   RELVDWPNRMILQLVFSTIGGYLVEQVLYPQLDDLSDEQLIHYLSDFLVNGLSPRRIPL
FT                   QDDNTAS"
FT   gene            256672..258066
FT                   /gene="mntH1"
FT                   /locus_tag="JDM1_0243"
FT   CDS_pept        256672..258066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mntH1"
FT                   /locus_tag="JDM1_0243"
FT                   /product="manganese transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61132"
FT                   /protein_id="ACT61132.1"
FT                   /translation="MKSAKTKDHAKMKAAEEKAIHSTGADSKSLDEVNGSVRVPKDASF
FT                   WRTLIAYTGPGALVAVGYMDPGNWITSIAGGSQYKYALLSVILLSSLIAMLLQAMAARL
FT                   GIVTGKDLAQLTRERTSKGMGIFLWIITELAIMATDVAEIIGSGIALKLLFGFPLIVGI
FT                   LITTADVLILLLLMKLGFRKIEAIVATLVAVILFVFLYEVIISQPNIPEMLKGYVPTSR
FT                   IVSNLSMLFLALGIVGATVMPHNLYLGSSISQTRQVDRSDEKEVAKAVKFTTIDSNIQL
FT                   SVAFVVNSLLLILGAALFFGTKGDLGRFVDLYNALGDSKVVGSIASPLLSMLFAIALLS
FT                   SGQSSTITGTLSGQIIMEGFIRLKMPLWAQRLLTRLISVTPVLAFAIYYHGNEAKIEDL
FT                   LTMSQVFLSIALPFAMIPLVMFTSNRALMGNFTNRVWVKWTAWIVTVILIILNIYLILQ
FT                   TIGLVK"
FT   gene            complement(258198..258845)
FT                   /locus_tag="JDM1_0244"
FT   CDS_pept        complement(258198..258845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0244"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61133"
FT                   /protein_id="ACT61133.1"
FT                   /translation="MSQLTKAITRQLQRQYAEPVLKDLNGNWYTGADVLEDLALCETSL
FT                   QQQNVHAGQAILLSPAQVVTIPGLLLASWQLGLTVTLTPPSRQLPELAPQIYAAMVYSP
FT                   SQTNQLATKLDPHEISVLTLILNTAPNFAYLVHDHAQPLTRRSQPDLILPASQLQFTQP
FT                   QLLKMAEHGQTSAHVHDLYNLETGLLPCLTDLITATPFTIIPTKQDWPSKVG"
FT   gene            complement(258901..259206)
FT                   /locus_tag="JDM1_0245"
FT   CDS_pept        complement(258901..259206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0245"
FT                   /product="extracellular protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61134"
FT                   /protein_id="ACT61134.1"
FT                   /translation="MKNTFKKLTLTLMAAGTLFATSVSASADTTTTNPEVTSTTLVNKV
FT                   TRDTKLATGTTTHQPKHDLTPQPTKLVVKSTQNQVLATIDASSQSITKMKYLTNAK"
FT   gene            complement(259247..259498)
FT                   /locus_tag="JDM1_0246"
FT   CDS_pept        complement(259247..259498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0246"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61135"
FT                   /protein_id="ACT61135.1"
FT                   /translation="MLLDTDPKIKNITAVQLVKVTYPLVIAKTEEGEFVKVKLSDEQLQ
FT                   DPLFWDTLKNIRRSQLWVPLGRHFHQLLSNDWLMPAAQ"
FT   gene            complement(259799..261199)
FT                   /locus_tag="JDM1_0247"
FT   CDS_pept        complement(259799..261199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0247"
FT                   /product="transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61136"
FT                   /protein_id="ACT61136.1"
FT                   /translation="MKTTTRSWLAMIVIGIFTIMANLDASIINIALPIMSKSLAVPISQ
FT                   ITYTVMGYMVILSGLLVTFGKLGDIWGKGRIFTLGMYSFTIGSLMASVNFGFEFLLLAR
FT                   FVQAVGAAATLSNSYGLISELFDNHTRGTAMGINTMFISAGFVAGPALGGFLLQQFAWN
FT                   AIFMINIPLGIIAIILGHLFLPKNHGRQQATKLDGWGAGILFIIITLFFVVLEAGQTIG
FT                   FRQPLIIIGFIITLALTLYFIYLEKHRKNALLPLSIFKNRTFSLALLVGMLIPLINALF
FT                   SFIFPLYLQDYLNWSVGTTGILMLIFPLIMVIAAPLGGWLSDLFSQQLVLLTGLVLIII
FT                   TQIGFLFLDSHTSLTLIISLLISNGIGTGFFIAPNNTLLMSVVPQNQLGVAGSLQSLGN
FT                   NIGNILGVALGSLALFTTMSIDAGYRVSTYLPAHPAWFAHGLTWSFSVSLICALLGFAI
FT                   SIINRPAH"
FT   gene            261291..261683
FT                   /locus_tag="JDM1_0248"
FT   CDS_pept        261291..261683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0248"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61137"
FT                   /protein_id="ACT61137.1"
FT                   /translation="MFTITATAQKYGVSNNALRYYESVGLIGPIKRDQNGIRQFSASDQ
FT                   EMVNRIVHLRQLGASIKEIQQYSFRPEEVTLERTVALKKFLLRLNGDLEAQEARIKIEK
FT                   QYLKAKIEHLDGDILSMKSHKTTQMG"
FT   gene            complement(261835..263211)
FT                   /gene="hpk2"
FT                   /locus_tag="JDM1_0249"
FT   CDS_pept        complement(261835..263211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpk2"
FT                   /locus_tag="JDM1_0249"
FT                   /product="histidine protein kinase; sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61138"
FT                   /protein_id="ACT61138.1"
FT                   /translation="MPKNNTTPTYEQLINKAIRRLMLTITLLVSLITLLMVGTQQTINT
FT                   TREARDLMSSLNQANIKDVPSFIQWNNTTTRNTKQPAFIRVTTKKATLTTATKTKRTII
FT                   TTPSSKSFFTKQQTKLVGPLVYVRGFGFFLSYSEKDGHNTYQLWVSLRRLFNSLLILIL
FT                   LMLAVTCAALALGTWWAHRLALRLSDPTIKLLHATKYTSNNPDSDQPTLDVPASPREIN
FT                   DLGRAFNELLVTQNQRLQHERQFISDASHELRTPIAAIRGNLSLIKRRGDAHPEVIPES
FT                   LQFIDEESLRMQHLIENLLHLSRADRAKLVLTDQDLSLLMLSLAEHYQPSIDQPLTLAI
FT                   DPNIHVQGNAEMLQQIVVALLDNAHKYSPHDQPITLSLHQTDQAVELAVADHGEGIPDD
FT                   QKQAVFQRFYRVDQSRSQAIEGSGLGLAIVQQLVTLNQANIKITDNQPSGSIFTVSWQL
FT                   "
FT   gene            complement(263198..263902)
FT                   /gene="rrp2"
FT                   /locus_tag="JDM1_0250"
FT   CDS_pept        complement(263198..263902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rrp2"
FT                   /locus_tag="JDM1_0250"
FT                   /product="response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61139"
FT                   /protein_id="ACT61139.1"
FT                   /translation="MKNTILIVEDEGSLSGYLTKELQFEDFNVLVAANGLAAMETYQAH
FT                   QNELLLILLDWMLPKLDGMEVLRRIRKHDQVPVIIMTARDYVGDKVAGLDNGADDYITK
FT                   PFEIEELLARIRVIQRRIENQVEPNQVYQLDDIQLDTKAHRVTNGQEEVTLTHREYDLL
FT                   QFFLAHPDEVFTRDDLLDQVWGADFLGQQNVVDVYVGYLRNKITTTGASPLIQTVRGVG
FT                   YKLREPMSDAQK"
FT   gene            264059..264355
FT                   /locus_tag="JDM1_0251"
FT   CDS_pept        264059..264355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0251"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61140"
FT                   /protein_id="ACT61140.1"
FT                   /translation="MSDMGLFRDAMQALYHSGHYGYNINVKKSAPAVDPKEVPAIAALG
FT                   RINRTPNFKTWSVDSPYKTAEFTAKLTDAVATCDLEMQDLEIKPQIDGRWGDQ"
FT   gene            264436..265167
FT                   /locus_tag="JDM1_0252"
FT   CDS_pept        264436..265167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0252"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61141"
FT                   /protein_id="ACT61141.1"
FT                   /translation="MFSYDQVQQLKRLEIEIYKYIVGHPAEVSTMTIRQLADHSHVSAT
FT                   TILRFLKHMGYDGYAEFKFTLKEQLRQDATQPLAQTVVPMRTFFDRMNLPDITAKLHRV
FT                   AELVHQARMVVLIGSGTSAGLAAYGSHLFANFGLYSLMISDTSQPHPVQQQDLSDTVFF
FT                   ALSVSGESEDIIEQSVYYRQSGAKVVAITASSHSTLAGIADVVLTYDTPEVQAISGGST
FT                   LSQLPVVYYLEQLAMIIQPLM"
FT   gene            265469..266794
FT                   /gene="pts6C"
FT                   /locus_tag="JDM1_0253"
FT   CDS_pept        265469..266794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pts6C"
FT                   /locus_tag="JDM1_0253"
FT                   /product="cellobiose PTS, EIIC"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61142"
FT                   /protein_id="ACT61142.1"
FT                   /translation="MSENNNKSSFVNDRLVPFFGKIAGSRHLIALRDGMTLAVPMIIIG
FT                   SVFMIIAQFPIKGYQTFMANTFGSNWATIVQYPTNASFHIMGLIAVIGISYNLAKSYKV
FT                   DPISASIVSLGAWFLTIPLNTDKAGALWVPLTQLDSAGLFTALLIGLFITDFYVFMVHR
FT                   NWTIKMPDSVPPAVSNSFAALVPGFVILFLMWLLRLAVEASPMQSIPNVISFVLAKPLG
FT                   LLSNTLPGALVAEFVVCILWIFGIHGANVVSGVMQPIWLAAMSQNAEALKAGKALPNVV
FT                   TQQFFDNFVHMGGSGATLGLAFMIAFVAKSAEFKTLGKLVIGPALFNINEPIVFGLPIV
FT                   MNYRIAVPFILAPLVNVTTTYIAMSTGLVAKTVGVMVPWTTPPIISGYLATMHISGAVL
FT                   QIVNIVLDGAIYYFFFKALDRDKVKEEKTFAAKEAAGETVEA"
FT   gene            complement(266947..267258)
FT                   /locus_tag="JDM1_0254"
FT   CDS_pept        complement(266947..267258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0254"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61143"
FT                   /protein_id="ACT61143.1"
FT                   /translation="MSQPNTLHPQAYCYYIELTGSERPDLLTALTTSEQELGDWEPVQA
FT                   AKLPTWRLWTDANADTIRYTVAHVIARSALPQNAYWLLQYKGTDHGHPRMLHPQFHTR"
FT   gene            267487..267741
FT                   /locus_tag="JDM1_0255"
FT   CDS_pept        267487..267741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0255"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61144"
FT                   /protein_id="ACT61144.1"
FT                   /translation="METGILKQIDLTTTTERYFFVQVQRLADYVWIRSVQNFKPLELTV
FT                   RVSDLQVNKHQAVADRGNIKYEFNDDTGGLVTQLAGWVH"
FT   gene            complement(267896..268927)
FT                   /locus_tag="JDM1_0256"
FT   CDS_pept        complement(267896..268927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0256"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61145"
FT                   /protein_id="ACT61145.1"
FT                   /translation="MRHSASSKLRPVLIAVGIIIVIAFVAIGLIIRQAQARYQSTIYTG
FT                   NSSTKIDTTKPLSILLLGVDTGADGRIDKGNSDTIMVVTINPQTKKTLITSIPRDSLAE
FT                   MVGDQDTNVQKLNAAYNIGGSKMAKASVSKLFNVPIDYYATINMGGLKQIVDAVGGVTI
FT                   TSPLNVSFDHITVTKGKHHLNGKQALSYTRMRYQDPRGDYGRQLRQQQVMRAVLAKLAE
FT                   TKTYSRYNQLLASLKGNLQTDLSFNDLVGLATHDRANMKHIQSTQVIGSPAWINTSSYQ
FT                   ILSTKTLQQTSDRLRTQLGLSTETLTNMETKLNAKNTVYDGKTNLNYDTQGLDKITYSD
FT                   NTK"
FT   gene            269200..270594
FT                   /locus_tag="JDM1_0257"
FT   CDS_pept        269200..270594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0257"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61146"
FT                   /protein_id="ACT61146.1"
FT                   /translation="MTVFRAFSNQEVLDYLATQVTDGQVFTDEETLKKYSFSPRLTDDD
FT                   SGLALAYVEAHTTKDIQGTLKTARKYHIAVIPQDQTTSTVIGADGLTDSLILSTAKMNR
FT                   IVEISKADSIAVVEPGVINGDLDKEARKQGMFYAPDPGSKPISGIGGNVATNAGGMSTV
FT                   KYGATKDNVLGVKVVLADGREVKLGGRTLKQAFGYDLTQLMIGSEGTLGIITEVIVKLL
FT                   PIPLGTPVMGVAFFDNMTALAKAVTAIRISGVYPTMLEALDGNTVAALDRYEKTHYAKN
FT                   SAAMLIFKLDNGGQDSMAVVKKILAEQQANDVKITTEPKEQAALEQLRRDMLPAVFAGQ
FT                   NHIMEDMAVPLSQLAPLMDYIQELSKRLDVEIYTAGHAGDGNVHPTLVWPTSVTEVPEK
FT                   IIIALQEMFKKTLALGGTISGEHAVGMLKNQWNNTELGEDVDMLQHQIKALFDPMNILN
FT                   PKRKIN"
FT   gene            270741..271046
FT                   /locus_tag="JDM1_0258"
FT   CDS_pept        270741..271046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0258"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61147"
FT                   /protein_id="ACT61147.1"
FT                   /translation="MRRRPQVIPKSARIRIEFDAEVLRNEIFDVHDFASFQSFWQRFEN
FT                   FLADRMVVGHLNVLEGRGLIPSDFADVDGHLAYQVGEDAHQIAYDQIAREWTITIR"
FT   gene            271091..271783
FT                   /locus_tag="JDM1_0259"
FT   CDS_pept        271091..271783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0259"
FT                   /product="GTP pyrophosphokinase (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61148"
FT                   /protein_id="ACT61148.1"
FT                   /translation="MSTTNSQASADNDQLLPAPPELLQAVDQLKAYSLRYEVAMKLVLD
FT                   KLDYISREYELRYGYALIDSKQSRIKSPESIVGKMQRKHLPLTLNAVFNNLHDIAGIRL
FT                   IVRFLSDVKTVENLLATQADIKVLRVKDYIHHPKANGYQSLHLILGVPVYTVDGPSIIE
FT                   VELQVRTIAMNFWASLEHELNYKKNVPHQDALRASLTKKAQLITELDQEMDDIKQRMYE
FT                   PKTPPKEV"
FT   gene            complement(272039..272611)
FT                   /locus_tag="JDM1_0260"
FT   CDS_pept        complement(272039..272611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0260"
FT                   /product="transcription regulator (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61149"
FT                   /protein_id="ACT61149.1"
FT                   /translation="MVGTKNNRRSQMTERLIQDSLINLLQHQSLDEITVTAVCKAADIN
FT                   RGTFYAHYEDVKDCMQKMEQDATEELLAVIDKHLNPDSLQAILTGIFEVVKKRHAVTSF
FT                   ILTTDQDFLMSFIATTKREILAHNQAEITGIGNREKEYMFEYYLNGIVGVVRYWLKTGL
FT                   HESPEELASFINDWWYRGKPVKNLAEH"
FT   gene            272792..276745
FT                   /locus_tag="JDM1_0261"
FT   CDS_pept        272792..276745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0261"
FT                   /product="transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61150"
FT                   /protein_id="ACT61150.1"
FT                   /translation="MKGSRRRFTIQAIVWLVVMVAAIIFLPNISSLVRDKGQTKLPSSA
FT                   KSQVAQVIQNHWGRNQNNTRQVVVVFNNGDSPLTSDQKQAIDGTIQRFKVQKSKYHVKS
FT                   MTAASDNAAAKKQLISKDKSTQLLQLMVGKNQTVANMTKNITAGAKTAGVKTYVTGSDI
FT                   LNDDFTQETEAGIQKTEIITVIFIFIVLTLVFRSPITPLVSLLSVGVSFIISLSVVMNL
FT                   VNKFNFPLSNFTQVFMVVVLFGIGTDYNILLFDQFKEELSHGDSPVAATGRALKIAGRT
FT                   ILYSGSSLLIGFSALGLANFSIYKSAVGVAIAVAILLLVLLTLNPFFMALLGPRLFWPT
FT                   KKFAGGSTSKMWHGIAASSVRYPIIALVVVLGVSLPFILTYNNELNYDTLAELNDTIPA
FT                   KKGFQVVQDHFSKGTAEPSTLYIKTDHALNNEKDLKVIDSLTKQLQKVKGVKTVASVTQ
FT                   PGGSQIDQLYVGNQLGTVTSGMKSASKGLTKIGSGLDSANSKLKSADMDGSAKSAKKLA
FT                   DGADEVSSGLNTLNGKTGTLSSGASQLASGSSSLASGLVTYTNGVYTVNNGLNQLNSKT
FT                   GALASGVNQLTTGANSLFSGTNTLSSGLDTLNGYKTKISSGTGTLTAGVSQLQTGASAL
FT                   TAGLQKMQTSVNSSVSDATSTANTQKLNDLQKGLEQLNEAMKPLLSTSSTSLPDISGMT
FT                   TTASTLADNSKAVQNDAANLKTALDGLQNSASGVSSVSLSDSDIQTIVDAVNKNGGTAL
FT                   TTQQTAALTAALTAAGKQISQKVESASSSMSSSISSTQTSAQQLQKDLAVMSKTGTDLT
FT                   SDLKQLSALSSELDNLSNLQQLAKKSIEANNGSLEVISKLQSAISGMQQIQSGLNGTNG
FT                   LVDGSQQITTGLNQLQSGASSLASQLNTYTNGVSTAATGATKVNSGASQVSTGLTSLQG
FT                   QIPTLTSAISALDSGTNQLAANSATLNSGASQLASGTASLNSQVPTLVSGVSKLNSGAS
FT                   QVASGNEQMYTSIQSLVGQMQTLQDGLKTASDGTKTINTGVGSANSYLTGLKDSAAAKT
FT                   YYVPKSTLKGKTYKSALKAYMSGNNHATKLTIVLNENPSSKSAMDKVTAIQKQATNSLK
FT                   GTALDGATIAIGGQTSETNDTQAIASSDFVRTAAIMLVGILIALMVITRSVLQPFYILG
FT                   TLLLAYIMSLSITRILSNWFLGQSMLTWNTPFFGFIMLIALGVDYSIFLMMKYREFDNS
FT                   AATPSTRIVRASAVIGAVVLSAALILSGTFAALMPSGVLTLIQVAMVVIIGLIILVFAI
FT                   PTIIPSLIRLTYPLTDRMEDETTAEKQTKRNRQ"
FT   gene            276925..277488
FT                   /gene="tag1"
FT                   /locus_tag="JDM1_0262"
FT   CDS_pept        276925..277488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tag1"
FT                   /locus_tag="JDM1_0262"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61151"
FT                   /protein_id="ACT61151.1"
FT                   /translation="MQRCAWADSSPAMQAYHDNEWGRPQHNQQRLFELLCLETYQAGLS
FT                   WQTVLNKRAAFNEDFADYDVDQVAAMTTADVERLLTDARIIRHRQKLMATINNARVIRD
FT                   WPAGEDFATWLWAFVDNQPIRQAWASIDEVPATNDLAQQVSKEMKRRGFKFVGPTTIYS
FT                   YLQATGLINDHVVDCPFAPENLPA"
FT   gene            277729..279786
FT                   /locus_tag="JDM1_0263"
FT   CDS_pept        277729..279786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0263"
FT                   /product="extracellular protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61152"
FT                   /protein_id="ACT61152.1"
FT                   /translation="MKEVRFWGLLLGLFVCLGAVIPLVSKADVLDTAPAGLNLEGLFEP
FT                   GKFDRNSATMQTVSKNGHSQHVIELTNDDNQVGAMWSTPVNRFNMRVDNQVSMWVNFGD
FT                   KAVGEGLAVVLQNDPRKMSAISRYGKKSIIGENLGVYGTDTYTRRTAPATIAKTAIQKS
FT                   WALELDTKVNDGGFWGLYPRGNSFDEKPKKMHMAASYPASPDTYTQRGGLTSSYRFEQN
FT                   HGSIADKLPLADGNWHHLVLKWVASKQIMSYTLDQGPTRMTTIDTTVFGKDIRNVTWGL
FT                   TSTATTANARTLVVFDRLPQPIEIESDLNVTNLTQERTVHEGDWVHGGDELEYEYVLSY
FT                   LNGDNEWQQVKASLPLPEQVHFSHAKIRYADGTEEEINLPADDNESSVARLQHDLQRTL
FT                   SMKNPHAYITLIGEAAKVDRDTFVDDDMSYFEGHEMKTATATPHFTITTNKTVNLTIEP
FT                   LTQVKKGEPVIIKGQIKLNDGLDFDNDGMRIEYRVNGEAGEDYQLSMDDPVGYVEFEVD
FT                   AEELQIGENQITLRAHSKDNAYSEPVTVTVTVIGGELQLKKVSTESVFAPIKLTGTAQV
FT                   SRPEGLEVVVNDDTGSKAAWRLEATATPLVTNQGRTLAGNLYYQDGAKLTMLGKDAVEI
FT                   ARQKTAPGIDYDVTAHWSSQQGLVLKTTPAAVPGSYQGTITWHLSTVPEA"
FT   gene            280109..281587
FT                   /locus_tag="JDM1_0264"
FT   CDS_pept        280109..281587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0264"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61153"
FT                   /protein_id="ACT61153.1"
FT                   /translation="MNFFKRAWLNLTAKKGRSILLVLVTSAIMLFVLAGLLIRNAADTA
FT                   TSNAKKSVGATVTLSANREAAFKKMRSATSTSKSSRPKLTTSPVKLSDAKKIAKLSNVS
FT                   SYNATVSTSANAKGFDTISTSGSSTGGGMKGMGGSSSSGTGDISITGVTNTNSVSTFES
FT                   SSSKITKGRGITASDEGTNNVVIESELAKEDSLSVGDTIKLKATTGDKKTYTMKIVGIY
FT                   KASSSASTQQGPGSTDVSNSVYTSYTFANTVKGSKYKNTADSVTFAISDPAKVSSVKTS
FT                   GKQLINTSKYSLSTDDSSYQTVKSSMNNVKSFADKIVWLVAIAGTIILALIVILMIRER
FT                   RYEIGVLLSLGESRWKIVAQFFAEMVMVLIVSVVLAGFGGKFVGNKLGDQLVSQQTTTA
FT                   TTTTSSTSQQGQPGGGGGAPSGNTGGSKPSGNMPSGGGQTGNASATTDTNLDINVTVMD
FT                   LVELGGFGLAIMFLSIMLASGGILRLQPKKVLID"
FT   gene            281599..282258
FT                   /locus_tag="JDM1_0265"
FT   CDS_pept        281599..282258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0265"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61154"
FT                   /protein_id="ACT61154.1"
FT                   /translation="MLKVNDLGYWYDRQENSLFENVNLEFKSGTSYAIVGQSGSGKTTF
FT                   LSLLAGLDKPRAGQIELNGEPINKIGLTNYRKSKVAIVFQSYNLLTYMSPLNNLMTAMA
FT                   ITNSEHRGDKDYAMKMLRRLGITDDQMKKNVQRLSGGQQQRVAIARTMVCDAKLVVADE
FT                   PTGNLDEENTKYVIDQFQKIAHEQKKCVIIVTHEPDVADVCDHSYRLEKHKFVAET"
FT   gene            complement(282387..283148)
FT                   /locus_tag="JDM1_0266"
FT   CDS_pept        complement(282387..283148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0266"
FT                   /product="CAAX family protease"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61155"
FT                   /protein_id="ACT61155.1"
FT                   /translation="MSSTKRGWGAAISIFILVPILFKLIAWLPVPTLYSGLVQDLLVLL
FT                   IFLLLNHFWFKISIQWWQSQSLVRQCLQLIPGIIILLLPMTSNFIKLCHLAWTPTLILY
FT                   IGYALVIGITEEYIYRGMLLPLLRQCFPHRLMLAICIDSLLFGLTHLLINSSQLTLSYV
FT                   IPQVFYAAAGGLIFCGLYLRTNNLVWPIFLHALSDVSVVVSLATHTHTAAKLSIPVAYA
FT                   IGISVLYLVLFIIIAFIVRWQVRPQKRLLSR"
FT   gene            complement(283244..283963)
FT                   /locus_tag="JDM1_0267"
FT   CDS_pept        complement(283244..283963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0267"
FT                   /product="CAAX family protease"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61156"
FT                   /protein_id="ACT61156.1"
FT                   /translation="MRHETKLVITLWGGMLGSMLLIGLIFQLPRLTQLPSSLTTGVEEL
FT                   FFLAIALILNRDWLRQTLKFGVSATWRRQIRPIMPTLIVAALIGLYTLATAQQLTNTLT
FT                   LLFVAILISLFEETFFRGMLFQASQSTLGVGRAAVFTSILFSLTHLINLGHQTLSLTLL
FT                   QLGFTFVLGLLLCLITAQTTSLLWPLLIHTVNDFFSMMEPPINLPGITTTSFQIIEIAV
FT                   IILLILPILRQNHQWLS"
FT   gene            complement(284086..284889)
FT                   /locus_tag="JDM1_0268"
FT   CDS_pept        complement(284086..284889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0268"
FT                   /product="extracellular protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61157"
FT                   /protein_id="ACT61157.1"
FT                   /translation="MKIKNLVLSSTAALALFAISTTVANADTYTVKAGDTVSAIAQAHN
FT                   TSVSAIEKANKLANVNLIFIGDKLEVNGTTTTTTTSAATSAAPQSATSQATSSAASTAT
FT                   SASATSASSQSVASQATSSATTSSAASQATSSVATSAASSASSTQSAASQASSSAATTS
FT                   QASSSATSSAASSTASTTSTTSSYTGSNLKSYVLSQMQSRTGVSASTWNTIITRESNWN
FT                   STVKNSTSGAYGLFQNMHISSGSVEDQVNAAVSLYNAQGMAAWAL"
FT   gene            complement(285940..286575)
FT                   /locus_tag="JDM1_0269"
FT   CDS_pept        complement(285940..286575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0269"
FT                   /product="extracellular protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61158"
FT                   /protein_id="ACT61158.1"
FT                   /translation="MKIKNALLSTAAATASLFAIGATAQAATVTVKAGDTVSAIAADHN
FT                   TTIDAIQQANHLKDVNLILVGQQLEVNGDSTATTSTQTTQQTTTTQSSAQTSQTQAQPS
FT                   QASQTQSSQTQTSKPVAQTTTQTSSSTSNYSNNGSDSAAKAWIAGKESGGSYSARNGQY
FT                   IGKYQLSASYLNGDYSAANQERVANSYVASRYGSWSNAKSHWLANGWY"
FT   gene            complement(286980..287279)
FT                   /gene="gcsH1"
FT                   /locus_tag="JDM1_0270"
FT   CDS_pept        complement(286980..287279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcsH1"
FT                   /locus_tag="JDM1_0270"
FT                   /product="glycine cleavage system, H protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61159"
FT                   /protein_id="ACT61159.1"
FT                   /translation="MLYGDIWLKTKSHDRLLLGLSDQGQRNLGVVHQLDLPTKGQHLVA
FT                   GDPLVTITDGQGAHLVSTPFSGTVQKLNKDLQAAPQSLINNKQTDNWLVQLKAD"
FT   gene            complement(287364..288281)
FT                   /locus_tag="JDM1_0271"
FT   CDS_pept        complement(287364..288281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0271"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61160"
FT                   /protein_id="ACT61160.1"
FT                   /translation="MSTYYPYLRGRMYDLLALKTLCEQHQLGPHIIPVIEPVRDSKELQ
FT                   QTVTTFIEAQQPFSIIANPQVSVYGLNTVKLHPLPDLRPYPFYRPGAILAADFSRDFLT
FT                   TSPGQTSLLIAPNYPLLKAYQHTTTLQHAGHVLIPDEARLHQLLPQHAVLLTDPVATPA
FT                   HVADYQEITDAYFAPANWHQTPVGFDGFGDYSLMGRPYFDHGMPSRAIALHLIYVTVNG
FT                   DLRIHHFVSDSNANMRGQKQKFFEALTKLTDWAPAHLTGLNRTPALATLLAYAEGDKFP
FT                   GLGIIKKLAIMHHFQLMHRLLALN"
FT   gene            complement(288278..288994)
FT                   /locus_tag="JDM1_0272"
FT   CDS_pept        complement(288278..288994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0272"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61161"
FT                   /protein_id="ACT61161.1"
FT                   /translation="MKTKLTKQLESTLYQYCLEQGAYVVEEVAMPADKGIVDTLSYQQL
FT                   PDGQIEWRCYELKVTKADFHSKAKLSFIGHYNYFVLPQQLYLEVQSEIPDHIGVLIYRA
FT                   FDQRALELAPQPLRTPGFLTVAKKAQRQDLQVEQTPLISHFITSLFREVDKAKRVKKGL
FT                   QLYSDDQLFKELRKRARTGYDVYDPEQNLYDRFIDDTQNDAVTALQTELDARNAEYQAL
FT                   KLKYQALTAPDLRDQL"
FT   gene            complement(288994..291363)
FT                   /locus_tag="JDM1_0273"
FT   CDS_pept        complement(288994..291363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0273"
FT                   /product="DNA helicase (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61162"
FT                   /protein_id="ACT61162.1"
FT                   /translation="MATKIGIRQLVEFVLRQGDLNEVKNSQNTALNGAKIHRQLQSSRG
FT                   EDYDSEVYLKKIVTMNDTDYIIAGRADGIQLNDDGALIEEIKTSDQVFEDLSTNTLTLY
FT                   WGQIKVYGYLLLQEHPDLEQVTLQLTYFQVINEKITKTQQILHRAELDAFFHDLITEYE
FT                   YWLTLRADLRRQRNASIEDLPFPFPAFRPGQHELAGAVYKTIRLQKRLFVEAPTGTGKT
FT                   ISTLFPAIKAMGEDVIERLFYLTAKQSTRHVAEEAVTLMSHDGLKLKSITLTAKDQIRF
FT                   PEEQDVLPEDNPYMIGYYDRLKPALKDLLTHEDQITRSVIEQYARKHTVDPFEFSLDTS
FT                   LFCDVIICDYNYLFDPLVYLQRFFSERDDDNFFLIDEVHNLVSRSRDMYSAAVSDQPIS
FT                   ALLKLAKPDKSQPSDDLQRELKKVRRSFTRIRKTLIDDQVTEQVLPDPPDKLLRTLRTF
FT                   NEFVTDWLAQQKPGPLLDAVRDYFFACLTFVKIGDLYDGSYQTRFVLDGHHLTIKELCL
FT                   DPSDFLNRSLELGSGAVLFSATLTPMAYYQRVLGGEANSLAYQLPSPFPPKHQAILVTQ
FT                   YVQTTYHEREHNVPRIIASLHAMLTAKHGNYLVFFPSYGYLLQIKTAFEAAYPDVATTA
FT                   QASTMDATARQTFLNQFQSAPSQTLLGFCVLGGIFSEGIDLRGDRLIGVAIVSVGLPGI
FT                   NPETNLIRDYYDHQNGLGFAYAYQLPGMNNVLQAAGRLIRSAKDTGIVLLLDQRFASRR
FT                   YTDLFPAHWQYYQTIQSVPQLEATIANFWHQMEVTH"
FT   gene            complement(291783..292145)
FT                   /locus_tag="JDM1_0274"
FT   CDS_pept        complement(291783..292145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0274"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61163"
FT                   /protein_id="ACT61163.1"
FT                   /translation="MKKTFTWSVSNGFAVLLLTVGTILAITTLGISFGSPISVDAMVTA
FT                   AALWLAGVVFLHPAPVRILIPVITLVSLSLGYATYFSTSGSWLLAILATIITASIVSYG
FT                   FSLRKSIRQHHSHWYD"
FT   gene            292334..293530
FT                   /gene="ack2"
FT                   /locus_tag="JDM1_0275"
FT   CDS_pept        292334..293530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ack2"
FT                   /locus_tag="JDM1_0275"
FT                   /product="acetate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61164"
FT                   /protein_id="ACT61164.1"
FT                   /translation="MAKILAINAGSSTLKWKLFSVPEETVIASGMVDRLGLPDSVFTIK
FT                   KADGSKYSETKDQIDAKEAAAMVLTRLKSDNIVTHLSEITGVGHRVVAGGEDFKDSVVI
FT                   TSQTLKKIKDLSEYAPLHNPTQAYYIEVFRDLLPKATQVAVFDTSLYADMPKVNYLYSI
FT                   PYDYYEKFGARKYGAHGTSHRYVANRTAQLLGKPLDSLKLVTLHLGSGASITAFDHGKA
FT                   VDTSMGFTPLAGITMSTRSGDIDASIIPFLMRHLGISDVEDFVDILNHKSGLLGISGLS
FT                   PDMRDLDKTQDTRERSKLAIDIFVNRVVKYVGSYIAEMNGIDALVFTAGVGENSWMIRE
FT                   RVTKALGYFGVTVDDEKNHMHGKEQIISKDDEPVTVMVVPTNEELMIVRDVERLSKAE"
FT   gene            complement(293656..294099)
FT                   /locus_tag="JDM1_0276"
FT   CDS_pept        complement(293656..294099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0276"
FT                   /product="acetyltransferase (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61165"
FT                   /protein_id="ACT61165.1"
FT                   /translation="MWSIKTFSELTTTELYAIYELRVKTFVVEQQRIYQEVDDTDLKAY
FT                   HVFKTVNQNIVAYARIFTEDDHLSFGRVVVDKNQRGQHLGADLMAHIEQVVQEHYADLP
FT                   IQIEAQVPVQGFYQHFGFTSSGTPFLFNHTPHIKMTKPARQRQ"
FT   gene            294173..294595
FT                   /locus_tag="JDM1_0277"
FT   CDS_pept        294173..294595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0277"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61166"
FT                   /protein_id="ACT61166.1"
FT                   /translation="MIPTLRLMGTLSRIVTNEGNQRFAKYGLNNNQFIYLIRICEQPGL
FT                   FFSQLADQMKMDRTTNYRAVQNLIKKGYVIKQTHPENKKVRCLYPTSAGQALYPELHAY
FT                   EQWCADLVGEQLTPGQQQVLFESLSLVTANVTQHIE"
FT   gene            294784..295986
FT                   /gene="ndh1"
FT                   /locus_tag="JDM1_0278"
FT   CDS_pept        294784..295986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndh1"
FT                   /locus_tag="JDM1_0278"
FT                   /product="NADH dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61167"
FT                   /protein_id="ACT61167.1"
FT                   /translation="MATTLVLGGGYAGMRAVKFLQKSLPTEDEIILVDQTPTHTEKTNL
FT                   HEVAAGTIAPDRITYQIPDIIGKRVQFVQATVKSVDIEQKQVTFEDHPEMTYDYLVLAL
FT                   GFQSETFGVAGADENALPMDDLATSQAVYEHLEERFKAYRTSKDKNDLKIAVCGAGFTG
FT                   IELLGELTQTLPRLQAKYQTPAAKLVCLERMPSILPMFTQELRDYALKFMEKNNVEMRL
FT                   GAVIEAIKPGAVVYSDADKNEHEFTANTIIWTVGVSGSHVIADSGFDQRRNRVVVKPDL
FT                   SLEGHPEVFIVGDVAAVMDPESNRPYPTTAQIALAAGEQAAKNIGALRHNQATATFHYE
FT                   SSGTVASLSDRDGIGEIFSSNKPVHGYAASALKKIITDRSLLESAHLGTVFSKGRFDLY
FT                   H"
FT   gene            296118..296450
FT                   /locus_tag="JDM1_0279"
FT   CDS_pept        296118..296450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0279"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61168"
FT                   /protein_id="ACT61168.1"
FT                   /translation="MGLTILYGHPLQLRHDKGAVKMTTKSIRTPIQPWFTLVVAGSLLI
FT                   TLFSTALWWLASSAFCALLILNLQFIVFPTTADRYWLNRLSLGLVLVLVVLANIKFLII
FT                   SGLTWQ"
FT   gene            complement(296550..297620)
FT                   /gene="potD"
FT                   /locus_tag="JDM1_0280"
FT   CDS_pept        complement(296550..297620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potD"
FT                   /locus_tag="JDM1_0280"
FT                   /product="spermidine/putrescine ABC transporter, substrate
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61169"
FT                   /protein_id="ACT61169.1"
FT                   /translation="MKKLLSIIVSLLVVCGLLAFGAQRLQTSSGSTGKKVLNLYTWGDY
FT                   IDPSLLTKFQKQTGYHVNVETFDSNEAMYTKIKQGGTSYDLTVPSDYMIEKMKKAHLLL
FT                   PLDKSKLTGMKNYDPRFMNLAFDQHNRYSVPYFWGTLGIIYNDKYVQPGSIQHWNDLWQ
FT                   RKYHNKIMLIDSARDVMGFALASMNQSMNTTDPATLLAARNKLNRLSPNVKAVVADEIK
FT                   MYMIQNEAAIAVDWSGEASEMLAGNSHLHYVVPSEGSNLWFDNLVIPKTAKHFKAIYAF
FT                   LNFMSEPKNAAQNAEYIGYATPNRKAKALLPKAIRNDRQFYPDNNTIKHLQIYQDLSPA
FT                   KVGLYNDRYLEFKMHH"
FT   gene            complement(297617..298432)
FT                   /gene="potC"
FT                   /locus_tag="JDM1_0281"
FT   CDS_pept        complement(297617..298432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potC"
FT                   /locus_tag="JDM1_0281"
FT                   /product="spermidine/putrescine ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61170"
FT                   /protein_id="ACT61170.1"
FT                   /translation="MTLRNFKWRNLYLWLVFIVLYAPIIFLVVYSFSQGTTMNNFHGFT
FT                   WQHYQDLFADSRLIAIFLDTILIALLSSLLATVIGTLGALGINSMTKPITRNTLLSLNN
FT                   ILMVSPDVIIGASFLIFFTALKIPLGFGSVLLSHIAFSIPIVVLMVLPKIQEMSTSLLD
FT                   AAADLGANNWQLLSQVIVPYIMPGIFSGFFMALTYSLDDFAVTFFVTGNGFSTLSVEIY
FT                   SRARQGINLEINALSGLMFLMALVLVIGYYFINQYSSRHRRPAVRGRRK"
FT   gene            complement(298432..299265)
FT                   /gene="potB"
FT                   /locus_tag="JDM1_0282"
FT   CDS_pept        complement(298432..299265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potB"
FT                   /locus_tag="JDM1_0282"
FT                   /product="spermidine/putrescine ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61171"
FT                   /protein_id="ACT61171.1"
FT                   /translation="MQPKQRLSRNTAYFIPYMLWIILFVIAPVLLLIYQSFFNINGQFT
FT                   LGNYQTYFSSNTYLMMTLNSVWYAFLITLATLLISYPTAYLLNETKHPQLWLLLIIMPT
FT                   WINLLLKAYAFIGIFSQAGIANQFLSFIGIGPKQLLFTNFSFIFVAAYIQIPFMVLPIY
FT                   NSISELNPSYVNASRDLGATNWQTFNRVIFPLTLPGVKAGIQAVFIPSLSLFMLTRLIG
FT                   GNKVITLGTAIEEHFLTTMNWGMGSTIGVVLIIAMVIIMWLTGSSKKRARKGLTK"
FT   gene            complement(299277..300374)
FT                   /gene="potA"
FT                   /locus_tag="JDM1_0283"
FT   CDS_pept        complement(299277..300374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potA"
FT                   /locus_tag="JDM1_0283"
FT                   /product="spermidine/putrescine ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61172"
FT                   /protein_id="ACT61172.1"
FT                   /translation="MAVNTQPIIRLTNVTKSYGEHQVLKNINLDLEAGKFYTLLGPSGC
FT                   GKTTILRTIAGFTDATSGQVYFDGQVINTLPANQRQVNTVFQDYALFPHMNVAENVAFG
FT                   LKLHKVPKDEIETRVQKALAMVQLADLGEREISEISGGQQQRVAIARALVMQPKVLLLD
FT                   EPLSALDAKLRKDMQYELRDLQQRLGITFLFVTHDQEEALAMSDEIFVMNAGEILQGGS
FT                   PVDIYDEPINHFVANFIGESNIIPGKMLKDFEVEFVGKQFECADAGMQPNEAVEVVLRP
FT                   EDLDIVAADQGKLVVTVDSQLFRGNYFEIVAYDTDHNEWLVHSTNPAAEGEPIGLTFDP
FT                   QDIHVMRLNESEAAFDARLEQYEDD"
FT   gene            complement(300445..300987)
FT                   /locus_tag="JDM1_0284"
FT   CDS_pept        complement(300445..300987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0284"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61173"
FT                   /protein_id="ACT61173.1"
FT                   /translation="MDIGQRIRNLRIQKQLTQEELGERTDLSKGYISQLEHNQSSPSME
FT                   TFFAILEVLGCAPADFFAAEQPTHKVVYHPADQTTYDDEALGYRVKWLVPASNENQLEP
FT                   VTVTLAPSGRFKSFEPSPAETFIMVQTGTLSLQLGTQQYTATAGDTLYFHATKTHQIRN
FT                   LGTTSCTFTLVTTASYL"
FT   gene            complement(301455..301931)
FT                   /locus_tag="JDM1_0285"
FT   CDS_pept        complement(301455..301931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0285"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61174"
FT                   /protein_id="ACT61174.1"
FT                   /translation="MTFMPAQSAEQLWHAYNESTDTNGSSYQTRWFGQQNNPAEVTALA
FT                   DAILAGTKTATTTPLDSYTAEQIAIPQVGDYNVLLNGDMKPVAILKTVVSELIPFYRIS
FT                   AEHAYHEGDGDRTIGDWRKRKTAEFTPTLEEHGKNLSSDTPMVSEVFEVVYRAD"
FT   gene            302109..302594
FT                   /locus_tag="JDM1_0286"
FT   CDS_pept        302109..302594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0286"
FT                   /product="acetyltransferase (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61175"
FT                   /protein_id="ACT61175.1"
FT                   /translation="MEITPVKMLDLPQIMAIEKSGFSEAEAGSEAAYRERIEKLADTFL
FT                   VARDGAVVLGFIVGPAVGARYIEDEMFVETPTNLPRGGHQLVFTLAVSPLARHQQIGSQ
FT                   LLTALAEKAQADGRTSMALTCLERLIPFYERNGFINQGVANSEHAGETWYNLEKVWD"
FT   gene            302598..303125
FT                   /locus_tag="JDM1_0287"
FT   CDS_pept        302598..303125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0287"
FT                   /product="acetyltransferase (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61176"
FT                   /protein_id="ACT61176.1"
FT                   /translation="MKLATLQAQLPDFEIRLLTLADQEALLKLEQSNPRYHQYFSPKPL
FT                   TMTEVQHDLTAHPDELAAAQKQVFGFYLAHRLVAVLDVLNQYPQEQFLFVGLLMVNKAY
FT                   QRKSVGRVIVTGLMQAALQANITAIQLTRVTADEGVARFWQKLGFEDGNQLFLPLKAGG
FT                   RLAVTTMTRLLQ"
FT   gene            303219..303404
FT                   /locus_tag="JDM1_0288"
FT   CDS_pept        303219..303404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0288"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61177"
FT                   /protein_id="ACT61177.1"
FT                   /translation="MIKHWGKAETGMLIAAVLLLMVIFTFFEITASLTVSVIAFPISLI
FT                   VLMAIMEFAATELRRK"
FT   gene            303665..304018
FT                   /locus_tag="JDM1_0289"
FT   CDS_pept        303665..304018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0289"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61178"
FT                   /protein_id="ACT61178.1"
FT                   /translation="MQIDHGSRQPYYAQIVTGIEQDIAHGVLQSGEQLPSVREMARQHL
FT                   LNPNTVSKAYKRLETQQIIETVPGKGTYVKVVDSTLFRQELREQFTQIVRLAGQRGVSI
FT                   AELHGWLDQMGEK"
FT   gene            304018..304911
FT                   /locus_tag="JDM1_0290"
FT   CDS_pept        304018..304911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0290"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61179"
FT                   /protein_id="ACT61179.1"
FT                   /translation="MSLVINQLSKRIDHHQTLDGISFEIGLGQIVGVVGRNGVGKTTLF
FT                   RTINGQYLTDHGQVLVDGQEVVDQPEMRTQLCFIDPLANFFKGATIAQIQWYYQAAYPD
FT                   FDNAKFAQLLDRYHLTSKQKLRHFSKGMFGLFTIILSVATQAPYLFLDEPLDGLDVLIR
FT                   KNILGILIDEVATGNRSIVIASHNLAELEGVIDRALMLKHGRIVNDYQLEAMRRSARKV
FT                   QLVYRDKQIPAVVKQLGHIVHVSGRVIVVVFEDYNAEVQAQLATTNPVFQEDLPLSLAD
FT                   LFMANLTDEADFELLS"
FT   gene            304924..305937
FT                   /locus_tag="JDM1_0291"
FT   CDS_pept        304924..305937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0291"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61180"
FT                   /protein_id="ACT61180.1"
FT                   /translation="MTKRKLWQLLWRHYRTLLLTAGGVLLLVGIKEGYSIAHNPSRYVA
FT                   QNVSSFALMEATHLRMETVVAIIVSLVLGVALFLSDNFTNFNQYLFSLPVARKQIYRRK
FT                   IGLLIGMLVSAYMLAEAVFGLIAWRVLAKQQVRIDWLTTLYEELGILAVMLVFGLLAAT
FT                   FGLWVGHIFASALATFVFVCSLPFAYDGLINLAAGLTKLKYEQVDVLGQLPSWKPGGLL
FT                   TTWVICGVIGGGLYLLNRWAFEHLSLENSGDFFRFPQWRGAVLGFSIIYLIVAICCSQF
FT                   GNGVLGLLTDNYHAHMPLSTGIIMALVVAYLTWSLGRWFLYRPDRFRDAWTVKKLA"
FT   gene            complement(306043..307410)
FT                   /gene="acdH"
FT                   /locus_tag="JDM1_0292"
FT   CDS_pept        complement(306043..307410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acdH"
FT                   /locus_tag="JDM1_0292"
FT                   /product="acetaldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61181"
FT                   /protein_id="ACT61181.1"
FT                   /translation="MLKEMEETTVSRSIDRLVLNASLAANRLEVMDQSQVDQAVAAMAR
FT                   AAHAARGMLAAMAVEETGRGNYRDKVAKNDFAAKNVYNYIKDDKTVGIINDDPVSGVMK
FT                   VAEPVGIIAGVTPVTNPTSTVIFNAMLALKTRNPIIFGFHPFAQKSCVETGRIIRDAAI
FT                   AAGAPKDWIQWIKTPSLEATNTLMNHPGVATIIATGGAGMVKTAYSTGKPALGVGPGNV
FT                   PCFIEQTADIQQAVSDVVTSKSFDNGMICASESNLIVADQIYDQVKRELSHNGVYFVGT
FT                   ENFKALEATVMNLDKQAVDPKVAGQTPWQIAQWAGFDVPSDTKVLAVELPSIGGDQVLS
FT                   REKLSPVLAVVHAKDTEAGFNLMKRSLALGGLGHTAALHTTDEAVMNKFALEMTACRAL
FT                   INVPSSQGAIGYKYDNVAPSLTLGCGTWGHNSISHNLEDWDLLNIKTVAKRLTKIR"
FT   gene            307836..308699
FT                   /gene="fba"
FT                   /locus_tag="JDM1_0293"
FT   CDS_pept        307836..308699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fba"
FT                   /locus_tag="JDM1_0293"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61182"
FT                   /protein_id="ACT61182.1"
FT                   /translation="MSFVNAVDMTQDAYKNHYAIGAFNTNNLEWTRCILKGAQDTNTPV
FT                   IIQVSMGAAKYMGGYKLVMDLVADEMESMNITVPVVMHLDHGNYEAAKECIEVGYSSVM
FT                   FDGHDLPFAENLEKTKEIVKLAHAKGISVEAEVGSIGGEEDGIIGEGELADVEEAKTLA
FT                   ATGIDILAAGIGNIHGKYPENWTGLHFDRLQEISEAVKMPLVLHGGSGIPKDQIVKAVE
FT                   LGISKVNVNTENQVAFANATRAYIESGADQIGKGYDPRKLLAPGKKAIVDVVTSRIGWF
FT                   KTPAVK"
FT   gene            complement(308992..310308)
FT                   /locus_tag="JDM1_0294"
FT   CDS_pept        complement(308992..310308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0294"
FT                   /product="sugar transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61183"
FT                   /protein_id="ACT61183.1"
FT                   /translation="MKQPWQTAWPERISYGLSDAADNLVFQMMTTYLLFFYTDVYGLST
FT                   SAAAILFVVARLADVVESLIIGVMIDHTHSRFGKSRPFFLWYALPYVLFAVLTFVTPNF
FT                   GATGKLAWAYVTYLGLGFFYTAVNLPITSILPALSQNERELTLLGVIRQFFGSSVQIIV
FT                   AVFTLPLVALFGQGDQQRGFLLTIVLFGIISLVLILNTFFQVKERFSQPERPHQSLSAV
FT                   WGMLKQNQPWFILSSVILLYWLTTAIKNQTTIYYFKYLIQLEDLVPVVNGFTFASLIGV
FT                   ILIVRLANHHGKKNTMLAGIAIAAVGQLILGLGTAINQLAFVFGGTLINAVGNGLIIGL
FT                   VSIMIADTIRYGTALGIQAEGILASTDDFGVNVGLGLGGLVTAGLFHLSGYTANHAQNI
FT                   ATQHMITLNYAWLPLLLYVVMFIVLIFYNEQQLQDAINV"
FT   gene            complement(310478..311380)
FT                   /locus_tag="JDM1_0295"
FT   CDS_pept        complement(310478..311380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0295"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61184"
FT                   /protein_id="ACT61184.1"
FT                   /translation="MVGIIVAIIVILLVVLVLIASIRIITQPNQGVVLTFGKFERVISS
FT                   GFHFIKPFISRVITVNTAQTPVDLNQQVVITKDNAEISVKISLKYHVTNIEDFVFKNED
FT                   SVRSMIQDTRAALRGIIGNKELNEVLNGTQEINAALFKEISSVTAGYGLNVDRVNIDSV
FT                   NPSADIQASMNKLLQATRERDATIATAEGKSKSITLENEANNRALLATNKAQNEALVNS
FT                   AKAKATAVQTEADADAYRTRILNEALAQSSENYFIFQNTEAVKALADGNANTVVLPNQT
FT                   LDSLGLIPALTKVSKLTTK"
FT   gene            complement(311393..311593)
FT                   /locus_tag="JDM1_0296"
FT   CDS_pept        complement(311393..311593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0296"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61185"
FT                   /protein_id="ACT61185.1"
FT                   /translation="MQEGYLDQRLIGQRLIIKPTDLTDGVAFYGILYHLHAATPLHTGD
FT                   TVEITAVSAHGLTVTIIAPQQ"
FT   gene            312276..313688
FT                   /gene="pepD2"
FT                   /locus_tag="JDM1_0297"
FT   CDS_pept        312276..313688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepD2"
FT                   /locus_tag="JDM1_0297"
FT                   /product="dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61186"
FT                   /protein_id="ACT61186.1"
FT                   /translation="MYEQACTTILVGKKATVDGSTMIARNDDTFMPITPQKFIVHPAVH
FT                   GRNETLTSGKNGFTAPLPADGYRYQAVPNIEVAEKGVFEENGFNEKNVGVSSTESVYGN
FT                   EHTLTFDPFVPNGLAEDSLPTMLTPFIDSARGGVEYLGQLIAKYGSPEGNGVLFNDKDD
FT                   VWYMEIVTGHHWVAQRIPDDAYAVAANQVAIQWVDFDDPDNFMWSDGIQEFVAEHHLNP
FT                   DKEGFNFRHIFGTDNEKDRHYNTPRVWYGQRYFNPEIEQDPQSSELPFICHAAKKISVA
FT                   DVEFVLGSHYNETKYDPFLNTPEAKKFRPISMNRTQNSHVMQVRNDVPAEQSAIMWMTF
FT                   GVPAFAPYLPFHANVSETDPSFANTPLKHDMNSAYWLYRTLSMIVESHYADFVQDDIDY
FT                   LKECRIELGQFVAATDEQAAKLSGDELTAFLTEQDKVMVAKMRDKAQALIGQLVTKGLT
FT                   LSKLTYNVDINL"
FT   gene            313754..313999
FT                   /locus_tag="JDM1_0298"
FT   CDS_pept        313754..313999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0298"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61187"
FT                   /protein_id="ACT61187.1"
FT                   /translation="MDENVLFNPGDAISESHDYNEALRSADIYNARHGRKRGLMIARPL
FT                   EQDHGYSVFYADDLLTADTPRPEARQYHVEKRIPKE"
FT   gene            314128..314691
FT                   /locus_tag="JDM1_0299"
FT   CDS_pept        314128..314691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0299"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61188"
FT                   /protein_id="ACT61188.1"
FT                   /translation="MTNRQTIKHLTQTAMVTALIIVLGFFPGIPVGFIPVPIVLQNMGI
FT                   FLAAELLGRKYGTIAVGLFLGLVALGLPLLSGGRGGAAIFLGPTGGYLVAWLLAPMLIG
FT                   TLIKITRAMTSGYWWLEVGIVWLAGILFVDVIGASWLAVQSHMTLTAALLSNVAFLPGD
FT                   IIKGTLAVFIARRVRAIVDFGLPA"
FT   gene            314729..315700
FT                   /gene="birA1"
FT                   /locus_tag="JDM1_0301"
FT   CDS_pept        314729..315700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="birA1"
FT                   /locus_tag="JDM1_0301"
FT                   /product="biotin-(acetyl-CoA-carboxylase)ligase and biotin
FT                   operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61190"
FT                   /protein_id="ACT61190.1"
FT                   /translation="MTTKEQVLTILLRHHGEWQSGDQLAQSVGCSRESIWKAINALRKQ
FT                   GHQIESRKNRGYCYLGSRNLDAKAIQIYGQRQFTGPLEVVAQTPSTQILAKSFLSHHQP
FT                   QFAAFFADEQTAGYGRLGRDFYSPAKTGLYFSLVVPNPTNALVNVGLLTTGVAVSVLNV
FT                   LQQFYPNKNFGLKWVNDIYLDQHKVGGIITEASLELESTSATAFIVGVGLNLTTTDFPR
FT                   ELQARAQAVDPSMSVDRNRLAAALLSALVALSKRYATADFLPAYRAKSLVLGQQVTLQV
FT                   GDSVVNGVAEDIDEHGGLVIRMLTGERRTFTSGEVIRVGLPV"
FT   gene            complement(315689..315964)
FT                   /locus_tag="JDM1_0300"
FT   CDS_pept        complement(315689..315964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61189"
FT                   /protein_id="ACT61189.1"
FT                   /translation="MAGDSAGIAPHDTDQPSFDNDKHHTSRLNPSERWPQKYAGTTYHG
FT                   TGNTRNSVDIADTTMPRYQFQGDNVGTDRQRLNRCRKSLVPTQSYW"
FT   gene            316435..317253
FT                   /locus_tag="JDM1_0302"
FT   CDS_pept        316435..317253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0302"
FT                   /product="amino acid ABC transporter, substrate binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61191"
FT                   /protein_id="ACT61191.1"
FT                   /translation="MLALGGIIVVLVAIVGFSRASSSQASQGKLTTVKIGVAPGPYGDM
FT                   ATKVIGPLLEKKGYKVVTKEFNDYVQPNKALNSGEIDANLFQHTLYLKTFAKANHLKLS
FT                   AIGETPTLGMGIYSKKITALSDLKSGDTVSLPNDPSNLARALQLLAAQKLITLKKNINV
FT                   ATASTADIVTNPHQLKIKTLDAAQLPQSMSNVTIALIPGNYSWNAKLKPSKALALEKLK
FT                   EDYKEVFVVKTSQRNSKFGKAVKAVLKSAAFKQAIAKSEFKDFDKPASWQ"
FT   gene            317266..318294
FT                   /locus_tag="JDM1_0303"
FT   CDS_pept        317266..318294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0303"
FT                   /product="amino acid ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61192"
FT                   /protein_id="ACT61192.1"
FT                   /translation="MSQIELKHIDVTFQQKKRTVHAVKDVSLTIEKGEIFGIVGLSGAG
FT                   KSTLVRTINYLQSPSQGQVIVDGHDLTKANARQIASVRRKIGFIFQNFNLIGNRTVAQN
FT                   LAFALTAGGYPEKAQPARIQDLLTLVGLADRQDNYPAQLSGGQKQRVGIARALANDPDV
FT                   LLCDEATSALDVETAEEIIQILKDINQRLHITIVFITHQLEVARSLFDRVAVMEAGQLV
FT                   EQSSTYDLFAAPQSDMGQRLVNRFLDTQLPTRVAAQLARADGQLLALRYRGSDSLTPII
FT                   TEIAKATDIDINIIQGRIEFIQERAIGVLAVYLTGTTQAVKQAIALFQRRVDYVEEVQV
FT                   NE"
FT   gene            318287..318949
FT                   /locus_tag="JDM1_0304"
FT   CDS_pept        318287..318949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0304"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61193"
FT                   /protein_id="ACT61193.1"
FT                   /translation="MNETWTILQQNLGTALWDTAKMVFISGFIGIVFGTIIGLGLYYYS
FT                   NPLFAPHPLINSVAGFIINAIRSLPFLILMVVLIPFAKLVAGDPYTPLGGAVSLSVAAI
FT                   PFFARLAEGAFAEIDAGVVEAARSTGASFWLTFQEVLFPEALPALIRGVVLTLISLLGY
FT                   SAMVGTIGAGGIGDLAIQYGYNRYNTGVLVSVIVILIVIVQIVQWCGDRLADHYTRS"
FT   gene            318970..319953
FT                   /gene="panE2"
FT                   /locus_tag="JDM1_0305"
FT   CDS_pept        318970..319953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panE2"
FT                   /locus_tag="JDM1_0305"
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61194"
FT                   /protein_id="ACT61194.1"
FT                   /translation="MKYTVLGAGAMGLRYGVLLQAAGYQVDFVDTWDQQVQTIQQQGGV
FT                   YVARDGQNRHLVPIRISTPENYHGQPDVLIIFTKQMGLAEILSRSAHFFNDQQYVVTAM
FT                   NGMGHIEKINQYFKPEKVLGGTALIGTVLKQAGDVDFIGAANAGSMNIANQTEQPDEMT
FT                   HQIVAEFTKAHLNPTLTTNFLGTLLAKVIFNSVINTLCTMFQIQMGEFIQSPVAQKLGR
FT                   QLIDEAFDVCERAGITLLNTREEEWQTIEYVSRETNPLHFPSMYQDITKHRPTEVDYIN
FT                   GYLYDLGVQYHYEAKTHDFLRNLVHLAEFAGTFDITSLKPLTEGKH"
FT   gene            319956..321131
FT                   /locus_tag="JDM1_0306"
FT   CDS_pept        319956..321131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0306"
FT                   /product="transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61195"
FT                   /protein_id="ACT61195.1"
FT                   /translation="MKFEESKILQQLPKQFFANLVKKVNAKVAAGADVINLGQGNPDQP
FT                   TPEFVVKAMQTATANPADHKYSLFRGLPRFKQAAADFYEREYGVKLDPETEIAVLGGSK
FT                   IGLVELPFALLNPGDTMILPDPGYPDYLSGITLAQVKLALLRLTADNHFLPDYQQVDPQ
FT                   VAAAAKLLYLNYPNNPTGAVATSQFFQDTVDFANEHQIGIVHDFAYGAIGFDGQRPVSF
FT                   LQASGAKDVGIEMYTLSKSFNMAGWRVGFAAGNADMIEALNLIQDHLFVSVFPAIQDAA
FT                   IAALNSDQQTVHELVGLYERRRNQFFTAARKIGWEPYPSGGSFYAWMPVPEGYTSEAFA
FT                   DLLLDKAAVAVAPGNGFGAGGEGYVRVGLLIDEPRFTEACQRIAKLHLFDR"
FT   gene            complement(321307..322473)
FT                   /locus_tag="JDM1_0307"
FT   CDS_pept        complement(321307..322473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0307"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61196"
FT                   /protein_id="ACT61196.1"
FT                   /translation="MSSIIENLQLAAQQVHLINLYQANSEVVYTGYIDRLAPDGVVVNT
FT                   YDDAGLQDGAVFMRYDVIDEVEMMSEDLDNMAFRLENATTEGLNSVPQPTVALDDQRPV
FT                   LTQLVTQAPTDHQVVLLVLEDNENYLEGQVQQVTDQTITFKTFDKFNFKNNGQQEIPLA
FT                   AIQILEFCGNELLLESAFVKTIHTHRATVKVSEFDDVDHTLNNALNEHQLIAIRSADGS
FT                   DMFFVGFINALNADSVLLNLIDMTGQFGGYTLCRRSLIESVTTQSDYLQTMRGFIELNR
FT                   QYELNVQPVLNDERLFDATTDLFDSILRQAATFNNLVHITTENPMLPAMTGYPGTLTNG
FT                   HFIFYNVDDDNQINHVGTMIELDQVVELSFGYMDAYLLEKRLKSTGNL"
FT   gene            323068..323883
FT                   /gene="tagG"
FT                   /locus_tag="JDM1_0308"
FT   CDS_pept        323068..323883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tagG"
FT                   /locus_tag="JDM1_0308"
FT                   /product="teichoic acid ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61197"
FT                   /protein_id="ACT61197.1"
FT                   /translation="MFTMFKTIGDQFANFKIIRRMAKYDDRATYQSHYLGLAWEFLNPL
FT                   IQIGIYYLVFGVALKRGDPMPGIPYLPWMVVGIAPWLYMNKTTLDASSSIYRQVGLVSK
FT                   MKFPVNVLPSIKIYGNLYSFWTMIAFGIFLMFVNGIWPSVSWIQFIYYFGCMIVLMYSL
FT                   GIFNATVSVLIRDWHITLQSVLRMLFYMSGVLFNFTTSNFPAVFVRLLELNPFYYVLNG
FT                   MRESLLNRGWIWQQPNITLTIVFWLFNLVVILTGTYLYNKFRSNFVDLI"
FT   gene            323896..324987
FT                   /gene="tagH"
FT                   /locus_tag="JDM1_0309"
FT   CDS_pept        323896..324987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tagH"
FT                   /locus_tag="JDM1_0309"
FT                   /product="teichoic acid ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61198"
FT                   /protein_id="ACT61198.1"
FT                   /translation="MENQYKVELHNVTKEYDLYRSNNDKLKHFFNIGNVDVPRFWSLKG
FT                   VSLNVKPGEALGIIGINGSGKSTISNIISGIIPQTTGTVDVHGDTSIISIGAGLKWNLT
FT                   GDENIRLKGLMQGLSIKEIQAVRDDIVDFADIGDFIGQPVKDYSTGMRSRLGFAIAVHI
FT                   NPDIMIIDEALSVGDDTFYQKCVDKIMEFKKQGKTIIFVSHNLRQVELLCDRVAWMHFG
FT                   DLLEVGETKETVDHYRKFSKDFKAQTAAYRKKYQVGKKKEQADFDIVAYERQLVEEKAK
FT                   DSDKSKQAVSRQVHRTLYKQILPEKMTIATKLVMLVAIVLFVFFALVNVSGHSVTSAIE
FT                   NPTVLLHPVNHYIKSQSVLFNSK"
FT   gene            325366..325638
FT                   /locus_tag="JDM1_0310"
FT   CDS_pept        325366..325638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0310"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61199"
FT                   /protein_id="ACT61199.1"
FT                   /translation="MDTPLFLNVVAYVLLILVLQYIKFKFPDSTFIRFFQKYGWWLIGL
FT                   CFVAILVILAGPQFQNPFNALDVPAIGVMLVFGYFFIKDKKSKHK"
FT   gene            325865..326407
FT                   /locus_tag="JDM1_0311"
FT   CDS_pept        325865..326407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0311"
FT                   /product="transcription regulator (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61200"
FT                   /protein_id="ACT61200.1"
FT                   /translation="MYELFILGQLMDHPMTGYQLRKALVNVVGSELTISFGALYPLLDK
FT                   LAAAEELTLAFKRTTNKRPQKLATITAAGRTQFWQLVMTPVALNKQTQLTFQIKLNFLH
FT                   LLSCDQQQVILLDFQQFAQGQVARLTAQHKRVMTNTHMLAADIQDALMVNELQRVRAQA
FT                   QLDWLDRQLRNGGEVKG"
FT   gene            326404..327849
FT                   /locus_tag="JDM1_0312"
FT   CDS_pept        326404..327849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0312"
FT                   /product="transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61201"
FT                   /protein_id="ACT61201.1"
FT                   /translation="MKTMSFATDPQIQKHRWWILVAVCLFTFMSTLDGSIVNIALPVMS
FT                   KDLAIPMNQAEWVVSIYLIVICALLLLFGKLGDIYGKIRVFKIGSLLFIIGSLLSGFSV
FT                   GLPFLLIARSIQAVGAAMTMSTNNGIITEVFPFKERGRALGMIGSFVALGSIAGPGIGG
FT                   LILAHLSWGYIFWINVPVGILAMILGAMILPKDVTTTQQPLDKTGAGLFAVLMVALFAG
FT                   VFIGQQIGFLQPVILALFAVAIVTLIIFVRVELRHENPLLALQLFKNARFSISILCALL
FT                   IFIANFFFNVIAPFYLENARGLAANYAGYALMVFPIVQVVVAPIAGTISDKIGPELLTF
FT                   VGLVLISISQVGYMVVGLATPLWFFLLFVGLVGFGNGIFMAPNNSIVMSSVAVKDLGVA
FT                   GGINALARELGMIVGISVATTVLYSAMSQSAGYKVTSYLPAHPEIFIDGMHIAFMVSLG
FT                   ICLVATVITGGRLLKHRRTAPAK"
FT   gene            complement(328177..329493)
FT                   /gene="amtB"
FT                   /locus_tag="JDM1_0313"
FT   CDS_pept        complement(328177..329493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amtB"
FT                   /locus_tag="JDM1_0313"
FT                   /product="ammonium transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61202"
FT                   /protein_id="ACT61202.1"
FT                   /translation="MNAANSTFLVLSSILVLFMTPGLAFFYGGLVSKRNVVNTMLSVFM
FT                   ICGLAILLWLAFGYSLSFSGDLGGFVGNLKATWLHGVDLTALTATKIPNGLYLIFQMMF
FT                   AIITPALFVGAVVGRIRFKFLLTFIIFWSLLIYYPMVHMVWDNGLLAKLGVIDFAGGTV
FT                   VHINAGITALVLSAFLGARHKYGKDMTQHYNILWVLLGTAILWIGWYGFNAGSALAMND
FT                   IAIQAFLTTTVATATSMMTWMVVDMLTKGKPTLVGVCTGTLCGLVAITPACGYVTISGA
FT                   FWIGLIATLTSYGFITFIKPRLGIDDALDAFGCHGVSGMVGSIMTGLFASKAVNNTISL
FT                   NGLFYGGGFKLFGLQLLATIFTIGFTTIVCIVIIVLLKRVIRMRVDEQEEELGLDQGEH
FT                   GEVADYTVQMSHDLTNIQHHSDEFRGQLAQLLDKQQRFR"
FT   gene            329990..330949
FT                   /gene="hicD1"
FT                   /locus_tag="JDM1_0314"
FT   CDS_pept        329990..330949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hicD1"
FT                   /locus_tag="JDM1_0314"
FT                   /product="L-2-hydroxyisocaproate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61203"
FT                   /protein_id="ACT61203.1"
FT                   /translation="MRKYAIIGVGHVGATIAYTLVCKGIADELVLIDTNAAKARAEQLD
FT                   LQDAQARLDSRTIIKINDYHELDDTDILFVTSGNIHALDHASGNRWAEFEYTKQIVQDI
FT                   APKVKATKFNGVVIDTMNPCDAITHYFQRATGLSRQQVFGTGTFLDTARMQKVVAEAFD
FT                   CDPKNISGYVYGEHGESQFSAWSTVQVNGIPITSLVDKYDLDLDALEAAARHGGWAVHS
FT                   GKGYTSFAIATCAVKLSEAVFANARLACPVSAYSETFGTYVGQPAIIGKDGVESVTMLA
FT                   LTADEQAKFRNSADTIIEKFHAFDDVLSDQSVKKRQQA"
FT   gene            331052..331321
FT                   /locus_tag="JDM1_0315"
FT   CDS_pept        331052..331321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0315"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61204"
FT                   /protein_id="ACT61204.1"
FT                   /translation="MRRQLTNRQRWFVIVIATILGVGCALLGQWGQFFGVIAATFALML
FT                   LTSGCLTFCHRRGWQPGSGMLLALVTATGYVLVILGSYGYLLHS"
FT   gene            complement(331551..332114)
FT                   /gene="zmp1"
FT                   /locus_tag="JDM1_0316"
FT   CDS_pept        complement(331551..332114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zmp1"
FT                   /locus_tag="JDM1_0316"
FT                   /product="extracellular zinc metalloproteinase (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61205"
FT                   /protein_id="ACT61205.1"
FT                   /translation="MKNKYSAKLGLTTLTVIFGLGLTPIANAKSIATPYSRSRWPHAQV
FT                   TYVIQASSYERHVYQAAIQAWNATGHFKFVPGTTAHHQITLGTSNATSGQYYRLAGITF
FT                   STGYTNGYYTKAQVYLLTRNFVRYHYSYTDQVHVAEHELGHTIGLEHSRDRHSVMLADN
FT                   RYNGISAADSAAVRLRYRLPVGRL"
FT   gene            332308..332976
FT                   /gene="rpiA2"
FT                   /locus_tag="JDM1_0317"
FT   CDS_pept        332308..332976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpiA2"
FT                   /locus_tag="JDM1_0317"
FT                   /product="ribose 5-phosphate epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61206"
FT                   /protein_id="ACT61206.1"
FT                   /translation="MTIKQAIVQQALTLIKPQMVVGFGGGSTVGELVKEAANHVNDITV
FT                   VTPSPTTRQLATVLGYTVVDTAYCDRVDIAFDGCDQLDHHGNALKSGGGIHANEKIIAS
FT                   LADEYWLLTMQDRLVDQFDIKTPLVLEVLPAALSLVMRTVSDLGGQATIRTANNRDGFT
FT                   LTDSGNLLIDCHFPTYAKLTDLNVELATLAGVVETSYFDHLVTNAWLGDATTNTVKALF
FT                   "
FT   gene            333126..334631
FT                   /gene="sufI"
FT                   /locus_tag="JDM1_0318"
FT   CDS_pept        333126..334631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sufI"
FT                   /locus_tag="JDM1_0318"
FT                   /product="cell division protein SufI"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61207"
FT                   /protein_id="ACT61207.1"
FT                   /translation="MAKKVYTDYFFDEPAYNTHDGGYIPLVTPKVEPQPLAIPPLLKPD
FT                   RQTDTDDYYTVTAQESETQFLPGKKTKTWGYNAGFLGQTIVFRNGKQTHIDLENKLPEL
FT                   TTFHWHGLNVPGPITDGGCHAPVYPGETNHIDFKVHQPAATTWLHAHPCPSTATQVWKG
FT                   LATMVIIKDDVEDQLPLPRNYGVDDIPLVLQDREFHDDNQFDYRADYDPDGVQGHTALV
FT                   NGTVNPYFDVTTQRVRLRILDGSNRREWRLHFNDDLEFAQVASDGGILPAPVYMTKVMM
FT                   TCAERDEIVVDFGQYQPGDEVTLMTDDTPLCRFRIKSFVPDDTKLPEHLVDIPDETPTP
FT                   DLPVRTITMDGMDDEVALDGKKFDMSRIDARQKVGDVAIWEIRNTNSTENGMVHPFHVH
FT                   GTQFRVLARNDGPVYPNEHGLKDTVGVNPGETVRIKVKFELTGVYMYHCHIIEHEDGGM
FT                   MAQIESYDPQHPQTYHLMDMDTLRNAFAKEQGIKPEDVWMPGM"
FT   gene            334896..335264
FT                   /locus_tag="JDM1_0319"
FT   CDS_pept        334896..335264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0319"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61208"
FT                   /protein_id="ACT61208.1"
FT                   /translation="MHVAAMIMAILVAVEHLFILWLEMFNADSEMAAKAFGIPRQTLQS
FT                   PSVQLLFKNQGLYNGFLAVGILYSLFVIPAVASAGATLFFLACVMVAAVYGSITVSRAI
FT                   VVIQGLPALIAFILMYFA"
FT   gene            complement(335377..335886)
FT                   /locus_tag="JDM1_0320"
FT   CDS_pept        complement(335377..335886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0320"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61209"
FT                   /protein_id="ACT61209.1"
FT                   /translation="MQLSIPTINGALAATYSKQAAVAQTYKGHPIISFPVDISDVPAGT
FT                   HSLAFTFVDHDAIPVGGFAWIHWIAANLPATTTHIPENASQTGAIPMVQGNNSTAGAYV
FT                   HETDPKVSQHYVGPYPPDKDHRYSFKLFALDTELDLQPGYWLNEFHDAIAGHVLATAKT
FT                   TVIGKV"
FT   gene            complement(335917..337113)
FT                   /locus_tag="JDM1_0321"
FT   CDS_pept        complement(335917..337113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0321"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61210"
FT                   /protein_id="ACT61210.1"
FT                   /translation="MSSTISAATFKLNDQAALSPAQQSLEHQLLTFIRTHRQQKQPSLF
FT                   VIHGDAGTGKSAVLAAAFARLQALNRSLTPNDLQATDNYLVVNHNEMLKIYKRLAGEDP
FT                   VLRKKDFQKPTPLINRLAKEHRQADVVFIDEAHLLLTQPDRYNRFTGHNQLTELINHSR
FT                   VVVLVFDTRQVLKLKSYWHSNDLKPFLDQYPHANYNLDEQFRVTGGADVVDWIDGFTRG
FT                   QLQPKPVSDNFDLRFFDDGQPLYDLIKQRDQQYGLARMVATADFPYVVNHGTWYVTAGQ
FT                   LKLPWDKVNLTDDPWALRPETLNEVGSIYTIQGFDLNYAGVILGPSVGYDEDHDRIVVR
FT                   PERYEDQEAFKNRTDLGDLRPLKQQIIFNSINVLMKRGRYGLYIYAVDPALRQRLLAL"
FT   gene            337208..337693
FT                   /locus_tag="JDM1_0322"
FT   CDS_pept        337208..337693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0322"
FT                   /product="transcription regulator (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61211"
FT                   /protein_id="ACT61211.1"
FT                   /translation="MGGSNMKLDFSVAVHSILYLDAHRDSKVASRELAQSLHLNPVMIR
FT                   NILSVLHKHGYLTGTVGKNGGYQLDLALADMNLGDLYDLTIPPTISYARFITGPSKTDE
FT                   QADQSPIAANISETLTDLFTVADRQYRAYYHQFTMADLQADLNHHGTFLRHEQDSES"
FT   gene            337712..338167
FT                   /locus_tag="JDM1_0323"
FT   CDS_pept        337712..338167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0323"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61212"
FT                   /protein_id="ACT61212.1"
FT                   /translation="MKNKAIFVNNLNLKRVCHSGLSGLIIGAILDVIMKVALRLKGALA
FT                   MTARLVLIHEVGRYRELSEQRYWLESADFWGVDGRGATVNEAVGNFLTNLVQYCRDYYQ
FT                   RGLWQLDDRLLQLDHVDTVLAYAQAGKSPAPLFLFKLVPADHELASA"
FT   gene            338271..338843
FT                   /gene="accB3"
FT                   /locus_tag="JDM1_0324"
FT   CDS_pept        338271..338843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accB3"
FT                   /locus_tag="JDM1_0324"
FT                   /product="acetyl-CoA carboxylase, biotin carboxyl carrier
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61213"
FT                   /protein_id="ACT61213.1"
FT                   /translation="MELDKIYQLMDKFEQSSLTSFEYRDQDFEIQMGKKGHGKTTVTPQ
FT                   PAPLPNQPVIDPTPVTPTPVSTVSTPVVAEAEPTPVATSTASNPTSVVTPDPEPEPAPI
FT                   DPKECVTAPVVGIYYPAHSSEEAPYVKLGDHVSVGQQVGLIQAMQMMRPVVAKQAGTVK
FT                   AFLVKNGEEVNFGQPLIQLIPDTPDDI"
FT   gene            complement(339009..339929)
FT                   /locus_tag="JDM1_0325"
FT   CDS_pept        complement(339009..339929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0325"
FT                   /product="ribonucleoside hydrolase RihC"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61214"
FT                   /protein_id="ACT61214.1"
FT                   /translation="MSTKIIMDTDPGIDDAAAITFALNHPDLDLQLITTVAGNVTVDKT
FT                   TLNALKLTRFFNSDVPVAGGAAQPLIKPFEDAVRIHGVSGMPGYDFPTDLAEPLPETAV
FT                   EALRDYIMAAEQPITLVPTGAYTNIALLFKTYPEVMPHIKEIVAMGGALGKGNMTSAAE
FT                   FNVFTDPHAAEIMYQSGVPITMVGLDVTMKALLTRESIEQLPTLGKTGEMLHALFGHYN
FT                   DRNQTGVAMHDVNTLFYLLHPEAFTTEKMWIDVQTEGPANGETVGDIRGAYHDGKTNAT
FT                   VCVDIDAAAFNKWFLETVAAIDQPK"
FT   gene            340066..340965
FT                   /locus_tag="JDM1_0326"
FT   CDS_pept        340066..340965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0326"
FT                   /product="short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61215"
FT                   /protein_id="ACT61215.1"
FT                   /translation="MSQPRVILITGASSGIGKATALKLQAQGNIVYGAARRIEKMTDLA
FT                   AAGVHVLKVDVTDEATLIAAVKTIQVEQGRIDVLINNAGYGSYGSLEDVPVAEGEYQFK
FT                   VNVFGVMRLTQLVLPLMRAQHRGRIINVSSIGGKIYQPLSAWYMGTKHAIEGMSDSLRM
FT                   EVAPFGIDVVIVEPGGIKTEWAGIAEKKLLAVSGETAYHEQAVKVGAMLSLFDQFASNP
FT                   GVIAKLMVRAVNDVKPKTRYHAGMGAGVSLTARQWLSDRQFDRMMNSAVNGAAKLSKVT
FT                   RRKDRRTGSRHYRHGKIG"
FT   gene            341405..343285
FT                   /locus_tag="JDM1_0327"
FT   CDS_pept        341405..343285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0327"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61216"
FT                   /protein_id="ACT61216.1"
FT                   /translation="MVIVGGLVSILTVGISYCCYLVKHAGVTNLLTIILSLGCVMATLG
FT                   LTIMMPDLPEKIGVIGVVILAATMNYLMFWHEKRTAREDDTQFDWIDSGNQHMGFQHII
FT                   QNHGEAFAAQGVSQTAIPKLVAKAVNSYYRSGGHFDKWQPYHRVLLTIHYRYRKHLLAV
FT                   TLSRDQYIISAYPAPLLDKYPRVKKIRIMLEYGCYPIWLYDEKGNLISNDLPQVLRKDA
FT                   TLNKKLLVLQKQYDSLFTNNQHDFSYNGFATAADEQQFLRAFMVIHKDLKRRLGGKYAV
FT                   LNKITGKVDKVFPTATTVASSQAIPSEAELNSAIVNKPKPVVDKKAKTHVRTYPGLKAD
FT                   LLKVYQNFDIENLGPTYDALVDITKLYRRRFTKYTGQVTLKTVQQSTAKDYILGHTDKN
FT                   LSEIVANNKDMVAKNIGNAAMCRQVMQLIDIMSRYTLDELCFKCHLARLQLSTTNAHKR
FT                   LLKTCPDCGAVFVNNKLTNITITGLPANKLQVKMYLRKTGVVSMAAATESIDTTMPKRK
FT                   IRLFMEWGSSFIWVYNEDNELIKNGLPDELYPDSGLVAKVNVLNRQYSELFTNNGYEFR
FT                   YNGFKTHEDENAFERDFNAIYEEIAERTRGKYRVINEYYFTSNTEDVRDL"
FT   gene            complement(343457..343903)
FT                   /locus_tag="JDM1_0328"
FT   CDS_pept        complement(343457..343903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0328"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61217"
FT                   /protein_id="ACT61217.1"
FT                   /translation="MATIHLYLASTNHQSTNITATTPAAWVVILRYADHQKALNDGGYG
FT                   HTETSLALSALTTALATLKRHDLPVHVHTTTEQVAAVISEQRYLSWRQNNWDVPEADQP
FT                   DLPQWQTLIPIIEEFPNLTITYHPVDDPAMTTATTTLTAVMTKL"
FT   gene            344141..345667
FT                   /gene="choS"
FT                   /locus_tag="JDM1_0329"
FT   CDS_pept        344141..345667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="choS"
FT                   /locus_tag="JDM1_0329"
FT                   /product="glycine betaine/carnitine/choline ABC
FT                   transporter, substrate binding and permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61218"
FT                   /protein_id="ACT61218.1"
FT                   /translation="MQTLIQTFMDRRGDLLTALWQHLGISLASLVIAMVIAIPLAIWVV
FT                   RRPRWAEGLLQLTSVLQTIPSLALLGLLIPLVGIGTVPAVIALVIYALLPIFQNTYLGI
FT                   SEIDASIEEAADAFGMSRMRKLFKVELPIALPQIIAGIRTALVLIIGTATLAALIGAGG
FT                   LGTFIMLGIDRNDTSLLLIGAISSALLAILLSALVRWFQTAKPRHALIVFVGILALLGG
FT                   GGAYSVYANRVETITIAGKLGSEPEILINMYKQLIEAEDEHVHVTLKPNFGKTTFLFSA
FT                   LKNNQVDIYPEFTGSVLETLVKGNNPAGQTANQTYQLAKQRLAKQEQMTYLKPMQYNNT
FT                   YALAVTKKFQQEHHLKTISDLTQVESILKPGMTLEFIDRNDGLKGIKKTYGLDVTAKSM
FT                   EPALRYEAISKGKINLVDAYATDSELRQYHLALLKDNKHFFPTYQGAPLMKTSFANKHP
FT                   KVVKALNKLAGKISETDMQEMNYEVNVKKQSASTVAHRYLVKHGLLKEGR"
FT   gene            345668..346639
FT                   /gene="choQ"
FT                   /locus_tag="JDM1_0330"
FT   CDS_pept        345668..346639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="choQ"
FT                   /locus_tag="JDM1_0330"
FT                   /product="glycine betaine/carnitine/choline ABC
FT                   transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61219"
FT                   /protein_id="ACT61219.1"
FT                   /translation="MTTAIEFQHVQKDFNGQTVIPDLNLTIDQGELFVLVGTSGSGKTT
FT                   SLKMINCLEPLTAGKILVNGTDTTTIPVRSLRWQMGYVLQQIALFPTMTVAQNIAVIPE
FT                   MKGTAKKEINQTIDELLAEVGLDPKEYRDRMPSELSGGEQQRIGILRAIAAQPDIVLMD
FT                   EPFSALDPISRQQLQDLVLRLHARYHNTIVFVTHDMNEALKLGDRIGVMQHGQLIQVDT
FT                   PAALAQHPVNDFVRNFFGASRAKNVYDVYVGRVGLIQGYLTEKPSVASGRIQSLDVQAT
FT                   LRTAFTALTDHDYVAVTEENRVVGYLDRQRIVAYLSQHEEVS"
FT   gene            346717..348048
FT                   /gene="gshR1"
FT                   /locus_tag="JDM1_0331"
FT   CDS_pept        346717..348048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gshR1"
FT                   /locus_tag="JDM1_0331"
FT                   /product="glutathione reductase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61220"
FT                   /protein_id="ACT61220.1"
FT                   /translation="MAEQYDVVVIGGGPAGNAMASGLKAQGKTVLIVEADLWGGTCPNR
FT                   GCDPKKILLSAVEARQAAQHLQGQGLIGAPKIDWPALMAHKRGYTDGINDGTLNGLKGQ
FT                   DIATLHGQAHFQSDNQLAVGDRVVSATDYVIATGQRPAILPITGHEYFKTSTDFLDLDQ
FT                   MPKRVTFVGGGYVGFELATIANAAGADVHVIHHNDRPLKAFDADLVKDLMAAMTADGIT
FT                   FDLNTDVQAITKTATGLQLTADNFELTTDLVISSAGRIPNADQLGLANVGVTFDRHGIQ
FT                   VNDHLQTANPHIYAIGDVSDTPVPKLTPVAGFEARYLVGELTHPGAAIKYSVVPTQVFA
FT                   APKLAQVGISAAAATEHPDEYRVNTLDMTKWFTYYRFGAQQAQAKVVVAKASGQVVGAT
FT                   LLSDVADEMINYFTLLIEKHVTLPDLQRLVLAYPTPASDLQYLY"
FT   gene            348514..350031
FT                   /gene="glpK"
FT                   /locus_tag="JDM1_0332"
FT   CDS_pept        348514..350031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpK"
FT                   /locus_tag="JDM1_0332"
FT                   /product="glycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61221"
FT                   /protein_id="ACT61221.1"
FT                   /translation="MTDKYIMAIDEGTTSTRAIIFDHAGHKVADSQREFPQYFPQPGWV
FT                   EHNANEIWNAVLSTIANAFIESGIKPAQISGIGITNQRETTIVWDKQTGLPIYNAIVWQ
FT                   SRQTAPIAEKLVKDGYGDLIHQHTGLVTDAYFSATKIRWILDHVKGAQERAEKGELLFG
FT                   TIDTWLLWKLTGGATHVTDYSNASRTMLFNIHDLKWDDQILQLLNIPAAMLPEVRTNSE
FT                   VYGKTKDYHFFGSEVPISGMAGDQQAALFGQLAFEPGTVKNTYGTGAFIVMNTGEKPQL
FT                   SDNNLLTTIGYGINGKVYYALEGSIFVAGSAIQWLRDGIRLVESAPDSERAARESHNEN
FT                   EVYVVPAFTGLGAPYWDSEARGSVFGLTRGTTREDFIKATLQALAYQTRDVVETMKKDS
FT                   GIEIPVLKVDGGAARNDWLMQFQADILDTQIMRAANLETTALGAAFLAGLSVGYWQDLE
FT                   ELKASYKPGTSFDPEMGPAERTNLYEGWQAAVKATQVFKHTPYHAGK"
FT   gene            350046..351875
FT                   /gene="glpD"
FT                   /locus_tag="JDM1_0333"
FT   CDS_pept        350046..351875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpD"
FT                   /locus_tag="JDM1_0333"
FT                   /product="glycerol-3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61222"
FT                   /protein_id="ACT61222.1"
FT                   /translation="MAFSATTRQQNIERLQNETLDLLVIGGGITGAGVAIQSTAMNMKT
FT                   GLIDMQDFAEGTSSRSTKLVHGGIRYLKTFDVGVVADTVKERAVVQGIAPHIPKPDPML
FT                   LPIYDETGATFDLFSVKVAMDLYDKLAEVKDPKFTNYTLSREEVLQREPQLNPKHLVGG
FT                   GVYLDFRNNDARLVIENIKKAHENGGIMASHVKATGLLHDDDGRINGITAEDLLTGASF
FT                   EIHARIVINTTGPWSDTIRKMDHTEKYQSQMRPTKGVHLVVDAEKLPVPQPTYFDSGDQ
FT                   DGRMIFVVPRENKTYFGTTDTDYHGDLKHPTVTQEDVDYLLEIVNRRFPTAKITLDDIE
FT                   ASWAGLRPLIAANGSSDYNGGNSGKISDKSFKEVIKVVDQFESQEASREDVESVLNDLE
FT                   TSLAEDKLSPSAVSRGSSLTSSPDGLLTLAGGKITDYRKMAAGAMALIAKILADKYDAH
FT                   FNEINSKNLPVSGGDIDPHNVDATIAFYAKQGTDNGLTNDEALRIANMYGSNAARVFSL
FT                   IGKVEPTHGLSLAETISLRYALDEEMTLTPVDYLLRRTNHLLFMRDTLDGLKDGVIATM
FT                   ADYLGWDAATVKAQTELLNQTIAESDLTALKQG"
FT   gene            351890..352612
FT                   /gene="glpF3"
FT                   /locus_tag="JDM1_0334"
FT   CDS_pept        351890..352612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpF3"
FT                   /locus_tag="JDM1_0334"
FT                   /product="glycerol uptake facilitator protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61223"
FT                   /protein_id="ACT61223.1"
FT                   /translation="MMKDPLALQLLGEFLGTFILILLGDGVVAGVTLNKSKAQNAGWVA
FT                   ITLGWGFAVTMGVYASSFMRPAHLNPAVSLGMAVAGKFPWAYVIPYSAAQIAGGVIGGL
FT                   VVWLHYYPHWQATKDAGAILGIFATGPGIRRYFWNFISEVIGTFVLVFGLLAFTKGQFT
FT                   AGLNPIVVGILIIAIGLSLGGTTGYAINPARDLGPRIAHAVLPIANKGTSDWAYSWVPI
FT                   AGPLVGGALGALLFNVLP"
FT   gene            353199..356882
FT                   /locus_tag="JDM1_0335"
FT   CDS_pept        353199..356882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0335"
FT                   /product="cell surface protein precursor (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61224"
FT                   /protein_id="ACT61224.1"
FT                   /translation="MYTENTGKHHRNGLLVWLLPLLVVISFWGVSQNIMVVDASSAVTV
FT                   LPGNGGTLPLVNQLVIKQNDTALQGITNNAGDRGSLTPKNGAQRVLIHKVKDSDTITST
FT                   YGTVGTFHGQEVTAKVTISHIKVHDDSHKAPSGMKQTDGAFQIGPGFSSDTTMSNVAQF
FT                   NVSYEFYYADTHAAVNIQNAFITLSSLDGPVAGTSTGFEYTAYLGAGKIYTVENSIVKQ
FT                   IANPLGGGQLVMAGQTARDASWPYTSSTAATFGVSGTKLEFIYGTTRVNSGNSWLQPVY
FT                   NVSTITLGTPAIATPTLSATQSATDKQNRTLTYDLQQKVNVLDQDLMTKYKDWSENITI
FT                   PANAKYAKGEVVNDAGQALPSTAYQVSYDEKTHQVKWHLTDAGIKSLPFKGETYHFKAQ
FT                   VQFSDDVDDQTKVTATGQTAIDKQTKTSNTVTNTIDNQATITVHHYMTDSTDKVAPDET
FT                   VKVGYGKAYDVTKQVKTITGYKRNATLDEHTRGTASKTTKEAVMYYDPLPYNIHVNYLL
FT                   TDGQKLDELDVTGLYGDTYTTEATDFEDLYTVDTDRLPTNAQGTVTEKPTTVNYYYQPT
FT                   TGQWVDVGNQSSVLVRQDTKHNVRSVSQIYANDSGFTVKYNQDAAQVAIAASDTNGTQD
FT                   NSLVFDYNSKYTFELSKNETVTFKVDDQGQVTATRVLGAEQTVTTFDKSGQLKTVTTVT
FT                   NANGTKSQQTNTVDGLKSMVTGEQYDLGLLNGLKVTAQKEINPSQAATTESKTTTDTSQ
FT                   SGSNQSTSTTATDQTETNESTAGSSTNATNASSSVDASSANSQGDTEATSQSGTSASAD
FT                   SKTDSSAASSTSQTTDGETTNTGDTTTGTTTDSGLGFKSPFTEDQNTSSALGSAQTSSS
FT                   LNSDTSAAVQALIAEPNSTPVVLGEDASFEEGVPVNDPVFSNDEGVSPNNNPSSTATPL
FT                   AQATNTRARLTQNGKLLYEGTLQADQGEQNLYVSPDTTVEVDGGADGDGFYLDTYDGDK
FT                   GMAYTLGSGYAWAAENNDVTAAPASSATTSSESAASESNTNSSDSSRTASSAADHSTSS
FT                   ASTSDASQSSHSTSSGESSHPESSSGSSTTSDSADVDKQAAARSSQTQSNSVNGSSQAV
FT                   SASTVTSQSSVPTKANTKQASSTPTTKANRATVAAATSSTAPRQSRATTASASVPSVTS
FT                   ASAAAASRDKQRSAFKKQHPILNQILPKTNSAVATWLVWLGVGLLLLTVAITMVIKKRG
FT                   RD"
FT   gene            356884..358758
FT                   /locus_tag="JDM1_0336"
FT   CDS_pept        356884..358758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0336"
FT                   /product="extracellular protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61225"
FT                   /protein_id="ACT61225.1"
FT                   /translation="MIKLRQVLKKILIVLMVFVLVFTAFSSSVDTVSAHRRGVTHTRKH
FT                   KVRHSASGHAKKSHRAHRKAKRRVVHRKAPHRRKVAVRHKKKTPKRHKKAHKKKAAKKH
FT                   KQAHKKKAAKKHKKSHKKKTAKKHKKSHKRKSSKKHGKSHKKKSSKKHGKSHKKKSSKK
FT                   HGKSNKKKSSKKHGKSHKKKSSKKHGKSNKKKSSKKHGKSHKKKSSKKHGKSNKKKSSK
FT                   KHGKSHKKKSSKKHGKSNKKKSSKKHGKSSKKKSSKKHGKSNKKKSSKKHAAKGSAVIA
FT                   TLSRKTGISKGIISLLTDLVGYNDIYTMITGKDAATGKKRSRLVGAAWTALNFVPVSKV
FT                   AKLAKAAKVLATAKKAEKVAKNGGRIKRAARATKLATKRAAEKLAKRKPARKTTKKAAT
FT                   KSHKTTKTKHGTKAKYQKSKPKKTSHATKHKTKKQQKRYNKKKAAGKARKASYARKKGG
FT                   NKKKPGKRKSGKRKASQRKQSSQNKDSHGKKEKSSKEKSSKDGKDKKTNNVPLENGPYI
FT                   RNGKPYGRPTLTGKKKLEFEQEVYNRQVKDGVLIDRNTKQVIHWKPGQPRKGKVDFGHL
FT                   PGKSYKEMFNLYKNRKITLKELKDFQFNPKNYRLETPSANRSHKYETR"
FT   gene            358764..359306
FT                   /locus_tag="JDM1_0337"
FT   CDS_pept        358764..359306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0337"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61226"
FT                   /protein_id="ACT61226.1"
FT                   /translation="MLVYNAFSAVRDGTFDQFKNYYSGNVDETDEFEGLNLLCMAMTND
FT                   DNPEEKLKIVHFLLQAGINVNFVTKSEHRNALHYFYNCVWRPDPKFAMEITKLLVENGI
FT                   DVNSVDKYGHVPLFYAVFDNDLDTKENEELYFYLLKAGSDYRLRDPFGKSIIDYARETN
FT                   ERTDFLDIVKEYENGKK"
FT   gene            359321..359584
FT                   /locus_tag="JDM1_0338"
FT   CDS_pept        359321..359584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0338"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61227"
FT                   /protein_id="ACT61227.1"
FT                   /translation="MATIIIIGVVIIGITLGLGYWSYLLGKRNQSNLVGTIIPVAYFVV
FT                   RAILAWMTQTTTHGLVSSLVGSLLFSLIYYGLFVWGKHRANK"
FT   gene            359696..359971
FT                   /locus_tag="JDM1_0339"
FT   CDS_pept        359696..359971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0339"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61228"
FT                   /protein_id="ACT61228.1"
FT                   /translation="MLVFIVIGLITAVITIGLGYWSYILGKRNKSNIVGSVIPVGYFIV
FT                   RLVFVLVLGEGVRELITSLVGNLVITVIYVLLFVWGRQRFNRQKTK"
FT   gene            complement(360354..360971)
FT                   /gene="thgA1"
FT                   /locus_tag="JDM1_0340"
FT   CDS_pept        complement(360354..360971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thgA1"
FT                   /locus_tag="JDM1_0340"
FT                   /product="galactoside O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61229"
FT                   /protein_id="ACT61229.1"
FT                   /translation="MTNNNDRLHTGELYLPNDPELEKRQFGYLDQLYDFNQTRPSELTK
FT                   RQILLSKMFAEIGPKCYIEPPFHSNFGGHHVHFGKGVYANFNLTLVDDTHIYVGDYTMF
FT                   GPNVTIATAGHPILPSLREQAYQYNMPVHIGRNCWFGAGAIVLPGITIGDNVVVGAGSI
FT                   VTKDLPDNVVAVGNPAHILRHINDHDRQYYFKDRQIDPSLLN"
FT   gene            complement(360975..362129)
FT                   /locus_tag="JDM1_0341"
FT   CDS_pept        complement(360975..362129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0341"
FT                   /product="transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61230"
FT                   /protein_id="ACT61230.1"
FT                   /translation="MQPRLTTTISILSLSTVTGITTVITGIIPQLKRAFPTVPTTLIEW
FT                   LVTIANCSALITLLLNPRLTSRWGLRPIVISGLLISAIMGLIPAITTNFTVIMVSRLGL
FT                   GLGVGLFSPHAISLLTHSFTGDLRARLLGYQTGLSALGNAILLGLAGLLISLSWHAVFW
FT                   LYGLLVIVAGGVAWFVPEPTVPSTTTNHARTEKTQLPRHQWTLLGLTFITYLLIWGVQL
FT                   KLPSYFSARHFGNAATINLTLAAMNIGGLLAGLTFGYLYRYLHRFTLTLGYAGAAISVL
FT                   VLWLASNATVAIGAAVFFNFIYSYTGPYLVFTSNTGLDTIQVNVLSSYLTIATIISAFF
FT                   APLVWNSLGQLGPQTLTANVLIWIMLILGGLALITGSHHPRKEV"
FT   gene            complement(362133..362924)
FT                   /locus_tag="JDM1_0342"
FT   CDS_pept        complement(362133..362924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0342"
FT                   /product="HAD superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61231"
FT                   /protein_id="ACT61231.1"
FT                   /translation="MIKLMATDMDGSFLRDDMTYDEAQFALLYQQLQLRGVRFVIASGN
FT                   QYFQLKSFFKDYPEMIYLAENGAYIRDADHVYALNAFQPDAIQTILNKIQTIPDLKLLV
FT                   CGAKSAYTLTTTNPEHVAQMRHYYHHLAVVESYDQLDDDIMKFAITCPPERTTAIVTQL
FT                   RELLTGVAEPTSSGHGDIDIIQPGMNKAAGLAQLGQVLGIDLADMAAFGDGGNDLEMLR
FT                   EVGCGVAMANAQPAVTAVANATTGTNQEQGVLQWIKNWLEA"
FT   gene            complement(362995..363867)
FT                   /locus_tag="JDM1_0343"
FT   CDS_pept        complement(362995..363867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0343"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61232"
FT                   /protein_id="ACT61232.1"
FT                   /translation="MKILHETVQTIPRLPFKYYEHDPLTDINVAPHWHQGIELNYLVSG
FT                   TTLKFVTDGQTNEYRPGDLWTTNRRVVHSASGPTEVDWVEFGLIIDDDFLQTQIPASAN
FT                   WQLTLNGAASSKTHPQAYADVRQQLVTIHDLLTTPTTDLLRLQILSHFYQLLVTLGQTF
FT                   TVPLTATTVSPNLTLTDTVMTAINQHYAEPIDGNTLAEQFHVSLTTLNQQFNANVQLSV
FT                   NRYLRLIRLMNARRLLLETDHKIEYIAMQCGFPNSKTFNRNFKSWKGMTPTDYRQAYAR
FT                   YHRIDTSCL"
FT   gene            364027..364842
FT                   /locus_tag="JDM1_0344"
FT   CDS_pept        364027..364842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0344"
FT                   /product="HAD superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61233"
FT                   /protein_id="ACT61233.1"
FT                   /translation="MTIKLIAIDIDDTLLDSKGQLLPSTIAAVKEAHDQGIKVVLCTGR
FT                   PLAGAQHYLDALGLAGDDQYVITYNGAVIESIAGRIVAKHLVDNAHYRQLTAFGKQHHV
FT                   PFNVLDADSTIYTADRDVNWVTVVQAWENKAGLLIRDPDDLPADFQIAKGVFVGEGPQL
FT                   DAVEAQVKTTFGRDLYVVRAATNFLELMHIGVNKGQAVQDLAAALEIQPDEVMALGDEQ
FT                   NDLPMFAFAGTAVAMGNGSDIAKAHADHVTATNDANGVAAAIRQWALSD"
FT   gene            365368..366744
FT                   /gene="brnQ1"
FT                   /locus_tag="JDM1_0345"
FT   CDS_pept        365368..366744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="brnQ1"
FT                   /locus_tag="JDM1_0345"
FT                   /product="branched-chain amino acid transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61234"
FT                   /protein_id="ACT61234.1"
FT                   /translation="MQITRKLTIKHYIIIGSMLFGMFFGAGNLIFPIHLGQLAGANWLT
FT                   AGWGFLLTGTLLPLLGIIAISVTHSSGIYELARPIGKRYATIFMVLTCATLGPLFATPR
FT                   TATTPFQIGIASHVSSAQAQWYLLAYSLIFFSITYWAARRPTRIVDTIGKLLNPAFLIL
FT                   LALIFGIAFSRPLGTTNATPTAAYQHGAFLNGFLQGYNTMDALAALLFGIAVVTTIRGL
FT                   GQRDAGAIAKTAAKSSLLSISLEAVIYLGLIWIGATSLSQFKLSADGGIAFGQIANAFM
FT                   GTPGAIVLAIMATLTCLTTAVGLATSFAEALHAKFPKISYRAWNRLACGASFLIANIGL
FT                   DQIIAWSTPMLMFLYPLAITLIILAIASPLFHRDPLVYRWTTALTLIPAFIDGLGAAPA
FT                   LITRLGWVQTILAWDQRYLPLAKLGFDWALPAIIGLLIGLGWHYARRFQNAHAYKMSQD
FT                   "
FT   gene            366789..367973
FT                   /gene="napA1"
FT                   /locus_tag="JDM1_0346"
FT   CDS_pept        366789..367973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="napA1"
FT                   /locus_tag="JDM1_0346"
FT                   /product="Na(+)/H(+) antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61235"
FT                   /protein_id="ACT61235.1"
FT                   /translation="MDFLGILCLLILATTLAGHFAHRAGIPAVIGEILVGVILGPALLN
FT                   WVHLTTLVQTFSDIGVVVLMFIGGLESNLALLRKYLRPAIIVAIIGVIFPVVIMGLASR
FT                   FFQFSWFESLFIGVIFSATSVSISVEVLKEFKVLDTKEGATILGAAVADDIIGVILLSI
FT                   MIAMMGGQSGVAQTNLGIVLLEQVGFFIGIFIVIKWVAPYLMRLSDHLLMAASPTIMAI
FT                   IICLALAWLAELVGLSGAIGAFFAGVAIAQTDYQHVVDVSIEPVGYTTFIPLFFVSVGL
FT                   NMTFKGVWQSLPFIVVMTVLGVLTKLWGCGLGAKLNGFSRHSNYLVGAGMISRGEMALI
FT                   TAQIGFSAHLLSNDYYSDIILVIIVVTMIAPFVLKNAIHRAGQVTATHSIIEEH"
FT   gene            368361..368564
FT                   /locus_tag="JDM1_0347"
FT   CDS_pept        368361..368564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0347"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61236"
FT                   /protein_id="ACT61236.1"
FT                   /translation="MDEIISFEFSNGSKLLDSNVYEYKVGKEGIIKIDFPDSNGFVAVH
FT                   KNNNETAYIKAPYMKFCTGRHA"
FT   gene            complement(368936..369604)
FT                   /gene="plnL"
FT                   /locus_tag="JDM1_0348"
FT   CDS_pept        complement(368936..369604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plnL"
FT                   /locus_tag="JDM1_0348"
FT                   /product="immunity protein PlnL"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61237"
FT                   /protein_id="ACT61237.1"
FT                   /translation="MIEIDFKKKYYPLVLVLFVAGYMGAIFLNIYFDWLAMLTAGIISL
FT                   VMLYGFSNLKLFFQPLPSPKWRIVVKYVLLLFILEVIAIVVIAIINSHALLSFHNTTLT
FT                   TSLTGRDYPLIERVWIAFTLLVSLVGEEVGMASISIPLIRLLSQTKLKKFAWPIINILG
FT                   CIVFACLHLPHYHFNWIYPLIVGITRYPITASWRSANTLRIGIYVHWISDAVLIIGTLI
FT                   "
FT   gene            370348..371688
FT                   /gene="plnB"
FT                   /locus_tag="JDM1_0349"
FT   CDS_pept        370348..371688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plnB"
FT                   /locus_tag="JDM1_0349"
FT                   /product="histidine protein kinase PlnB; sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61238"
FT                   /protein_id="ACT61238.1"
FT                   /translation="MLDFGVVDTFYQGFTSILVVLLWYYFLSGLFNWKNILKILVLAFF
FT                   WGVLSVFVADFILLIMVLINFASQFIQKNLLDYDKSGILLLVVIIQVLIGNIAMFLGRM
FT                   SVRGLYNVSNLMGVQYYTHELLIVYVIFVIAINYVVLFFYRRYSHKIASVSQKIKELNL
FT                   SKSLFELVLIFYVAIESIMLISLNENITATIQLTLITSFIVMLLMMLWQMVFFIRSYMK
FT                   KQEASHQAKQNTQLNEYLKSVEQQYLELRRFKHDYKNIMLSLQDSIFNGSSSEQLTYFK
FT                   ELIAQRAVNTSLDNGKIAKVQHVGNETLRGLIIQKFFDAQTKGIELSLELDRSEFIIKH
FT                   NLVDVVRIVGNLLDNAIDAAQSIPDKKVICAFNSLHETKEISVRNSTNKKLDVNKMFKL
FT                   GASTKGSQHGFGLSNVQQLVDKQKNFFLDVDNKNDRVIITLTILEEE"
FT   gene            371689..372432
FT                   /gene="plnD"
FT                   /locus_tag="JDM1_0350"
FT   CDS_pept        371689..372432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plnD"
FT                   /locus_tag="JDM1_0350"
FT                   /product="response regulator PlnD, repressor"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61239"
FT                   /protein_id="ACT61239.1"
FT                   /translation="MFPIYLYEDNAEQRDNYRKTINNTIMINEFAMALRAATDDQKIIL
FT                   ADLNQQQDGLFFLDMEIGEDKQAGLELASRIRAAIPLAKIVFITTHDELSFVTLERRIA
FT                   PLDYILKDQSADLITQRIIKDINVVQNELKKTNSQRKDVFNYKLGTRYFSLALDDVILL
FT                   STSKLRPGSVQLHAINKVAEFPGNLNALEEKYPQFFRCDKSSLVNLNHLRSFDYKEKEL
FT                   LLDGEIRCKASFRKSRELNKLLRDN"
FT   gene            complement(372726..373499)
FT                   /gene="plnI"
FT                   /locus_tag="JDM1_0351"
FT   CDS_pept        complement(372726..373499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plnI"
FT                   /locus_tag="JDM1_0351"
FT                   /product="immunity protein PlnI"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61240"
FT                   /protein_id="ACT61240.1"
FT                   /translation="MPLIKVIITAIYYLIVLFLMNPLTDIMGIKDGPFQFMLTESIILI
FT                   AVIILNRRYVKQPIHWLPVNIMSILRKNSLPLSLAIIFLLIFFRNHMYQFLISLLLSLI
FT                   VAITEEYAFRGMIFRTLLALSLKKFATLQATIASMMTASLIFAAMHLVNLLSQPVWSVL
FT                   CQVLYVIGLGILLAAIYLKTGSLLAAISVHWLIDFSSFYSQGIDPTQSPINGPMEALLK
FT                   GLFLNILFIGIATFILSSKHWKLLSILNIEDKIDE"
FT   gene            complement(373598..373756)
FT                   /gene="plnF"
FT                   /locus_tag="JDM1_0352"
FT   CDS_pept        complement(373598..373756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plnF"
FT                   /locus_tag="JDM1_0352"
FT                   /product="bacteriocin precursor peptide PlnF (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61241"
FT                   /protein_id="ACT61241.1"
FT                   /translation="MKKFLVLSDRELNAISGGVFHAYSARGVRNNYKSAVGPADWVISA
FT                   VRGFIHG"
FT   gene            complement(373781..373951)
FT                   /gene="plnE"
FT                   /locus_tag="JDM1_0353"
FT   CDS_pept        complement(373781..373951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plnE"
FT                   /locus_tag="JDM1_0353"
FT                   /product="bacteriocin precursor peptide PlnE (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61242"
FT                   /protein_id="ACT61242.1"
FT                   /translation="MLQFEKLQYSRLPQKKLAKISGGFNRGGYNFGKSVRHVVDAIGSV
FT                   AGIRGILKSIR"
FT   gene            374218..376368
FT                   /gene="plnG"
FT                   /locus_tag="JDM1_0354"
FT   CDS_pept        374218..376368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plnG"
FT                   /locus_tag="JDM1_0354"
FT                   /product="bacteriocin ABC-transporter, ATP-binding and
FT                   permease protein PlnG"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61243"
FT                   /protein_id="ACT61243.1"
FT                   /translation="MHWRNYVAQVDEMDCGVAALAMILKNYGSTTSLAYLRNIAKTSLE
FT                   GTTALGLVKTAEKLGFETKAIQADMSLFEVQDLPLPFIVHVTKNGDLQHFYVVVKTSKT
FT                   HVVIADPDPTVAVISMSKERFESEWSGVALFFAPKSEYKPVKQDKGSLWGFIPSLLKQR
FT                   RLVINIVLAAVLITIISICGSYFLQAVIDTYIPNNMHSTLAVVGIGLIVFYTFQAIFTY
FT                   AQNFLLAVLGQRLSIEIILGYIRHVFELPMSFFATRRTGEIVSRFTDASKIIDALASTI
FT                   VSLFLDVSIVIIMGAILVIQNMTLFWITLLSLPIYAVVILAFNKSFERLNQKEMESNAI
FT                   LSSAIIEDLHGIETVKALNGETERYQKIDSEFVDYLRKSLAYLKADTLQQALKLFIQLV
FT                   LEVVVLWVGANLVIHNQLSVGELMTYNALLAYFVNPLQNIINLQTKLQSAKVANNRLNE
FT                   VYLVASEFEASRPIHNESQLNGDIKLQGVSYRYGYGENVLDDVNLTIRQHDKVAIVGMS
FT                   GSGKSTLVKLLIDFYQPNSGDVILNGFNVKNIDKHTLRTHINYIPQEPYIFSATIEENL
FT                   RLGNRSGITEKDIAKACQLALIDTDINKMAMQYQTKLDENGNTLSGGQRQRLTIARALL
FT                   SPAQVLIFDESTSGLDAITEKQLIDNLVAMTDKTIIFIAHRLSIAKRTNHIIVLHDGRV
FT                   AEEGTHAALLNEHGYYYDLINS"
FT   gene            376384..377760
FT                   /gene="plnH"
FT                   /locus_tag="JDM1_0355"
FT   CDS_pept        376384..377760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plnH"
FT                   /locus_tag="JDM1_0355"
FT                   /product="bacteriocin ABC transporter, accessory factor
FT                   PlnH"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61244"
FT                   /protein_id="ACT61244.1"
FT                   /translation="MRKDLLESGEFYGIRFQNFSTLLIIPVTLLLIGTILFSLVAKREI
FT                   VINGTGTVQPTGTVPVIQATVNSAIKKNYLVEGARVKKGQKLLVYTNVFNRNKLREDNV
FT                   SKRQLQRQVTALDHFKDGINTDSDVFPTTDEFGYRELLQSYLKQRQIYLTENQMLAAKS
FT                   SAASTKKATLTKTAQQVVSNTKTSLDAYQALYNAVANGSKYANSAKYGSVFNEYVAKSR
FT                   EANNANDKKEVKSATLADIQQQIDTLQDSLSSAKVQLEELQDFDDTKYSVETNNTKLAM
FT                   LKNDQLSEVAEKRMKAEQDLRTVKADIDSLTTQSKSYTIKATKAGVLHVADNYRGAKYV
FT                   SSGAEIAKILPIIKQQRRVNVKLYISTADISSVKVKQAIRFKVTRNVPKPIILDGVVTK
FT                   IGVSPVEESKATFYEVTAAVPITADQAQLLRYGMIGQTAIITGKVTWFDYYKDKVLDNN
FT                   "
FT   gene            377850..378539
FT                   /gene="plnT"
FT                   /locus_tag="JDM1_0356"
FT   CDS_pept        377850..378539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plnT"
FT                   /locus_tag="JDM1_0356"
FT                   /product="integral membrane protein PlnT"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61245"
FT                   /protein_id="ACT61245.1"
FT                   /translation="MAHSNKQFIINLVIASLISLALVSFSMAPAYLFLIKNNWLMITIG
FT                   FVIYALEAWGLYWLYRHTARVRHYQVATLKSRVNIAQLGTVIIAMLTMVVLIIVDLKLS
FT                   AMLNIPETSNSRSLAWMLGEAPLPMIVSVVIFSPICEELIFRGIFFSYALTNQYNHRNY
FT                   QMIAVVINSLIFASVHVDANWEPWIYYTLMGGILGTTYLLAKRDIRLNILVHMGTNLAV
FT                   FALAAMS"
FT   gene            378820..379275
FT                   /gene="plnU"
FT                   /locus_tag="JDM1_0357"
FT   CDS_pept        378820..379275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plnU"
FT                   /locus_tag="JDM1_0357"
FT                   /product="integral membrane protein PlnU, membrane-bound
FT                   protease CAAX family"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61246"
FT                   /protein_id="ACT61246.1"
FT                   /translation="MPVLLGPFSWSMMGLTALVAVVVVVIQMGISGLLVSPTETQNDEI
FT                   MALIHSPLGLLTLVCTNIVSPVLEELLFRGIVQNTLRRYLPVLGAIMLTNAVFALGHGY
FT                   QLASTVGIFITGCGFSWLVLKTKQLSTAMGCHILVNWLVTIINMMWG"
FT   gene            379362..380042
FT                   /gene="plnV"
FT                   /locus_tag="JDM1_0358"
FT   CDS_pept        379362..380042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plnV"
FT                   /locus_tag="JDM1_0358"
FT                   /product="integral membrane protein plnV"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61247"
FT                   /protein_id="ACT61247.1"
FT                   /translation="MVHQNAKFIGRLLLASLLGAIVMGLSTAPIDILTLKYNWITVAIF
FT                   LVVYLFAIYLFYRIYLESVTNNHFKITKIAAKPSARQLVITVLAMVVMLILAAVQVKFV
FT                   SDAVYPIAENVADLQALSQRSPILMALALGVFAPICEELIIRGNFFSYALAERFDRPRY
FT                   QLVTVIVNGVLFGLLRGGFSWVQLSYYTVMGLVLAATYILSGRDIRVNSVVHVTANLSL
FT                   MLMA"
FT   gene            380136..380810
FT                   /gene="plnW"
FT                   /locus_tag="JDM1_0359"
FT   CDS_pept        380136..380810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plnW"
FT                   /locus_tag="JDM1_0359"
FT                   /product="integral membrane protein PlnW"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61248"
FT                   /protein_id="ACT61248.1"
FT                   /translation="MLQKNLRFIGNLLIVSVLSVIIVNISSLPVYIYLITANWFTLLVS
FT                   FSLYAVIIVFLYNIYKTTAELRQFDFRPWRTRLNKRALLLMVIGAVIIVALAFGYAKLT
FT                   AVWHITESGNERALDLLLRKNPVAMTLDAVIFGPIAEELSFRGFFFSYVLSDQYLDREY
FT                   QAATIVINGLLFGYLHSGNSLVPLAYYTLFGMVLGTTYLLSKRDIRTHMLANLGILWLV
FT                   PS"
FT   gene            381021..381248
FT                   /gene="plnX"
FT                   /locus_tag="JDM1_0360"
FT   CDS_pept        381021..381248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plnX"
FT                   /locus_tag="JDM1_0360"
FT                   /product="plantaricin biosynthesis protein PlnX (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61249"
FT                   /protein_id="ACT61249.1"
FT                   /translation="MPPTIQRLALRKLLMIDHAETINDLSLPPANHLEKLSHDRQGQYS
FT                   IRINNQYRICFAIRNGNEFYDVEIVDYHHG"
FT   gene            381260..381553
FT                   /gene="plnY"
FT                   /locus_tag="JDM1_0361"
FT   CDS_pept        381260..381553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plnY"
FT                   /locus_tag="JDM1_0361"
FT                   /product="plantaricin biosynthesis protein PlnY (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61250"
FT                   /protein_id="ACT61250.1"
FT                   /translation="MNEIPTPKISEILEEEFMAPLHISAYFLAQQIGVPTSRIQDLLHD
FT                   RRQVTVDTSLRLGRFFGVSDRYFLELQNDIEIRNLKQIHGAEYAQIKKYQVS"
FT   gene            complement(381843..384152)
FT                   /locus_tag="JDM1_0362"
FT   CDS_pept        complement(381843..384152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0362"
FT                   /product="DNA helicase (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61251"
FT                   /protein_id="ACT61251.1"
FT                   /translation="MATSDQEQQREQQRVDRVIEQVKERAQQTDDLLAKAHHETDVIQK
FT                   NYGDNNSVNTFEVDDRIETNAELQQQKQMVERAVESEAILKRQVGVLKDLSNSPYFGRI
FT                   DIQDSPDEEAERLYIGTASFVDAEQNFLVYDWRAPISSVYYNGTLGQVQYQTPAGQQTT
FT                   ELIKKRQFQINHGQIKNMFDTNETVGDEILQAVLGEQNDAYMQNIVATIQKEQNDIIRD
FT                   TTSDLLVVQGVAGSGKTSAILQRIAFLLYHSRASLEADQMVLFSPNRLFSHYISEVLPS
FT                   LGERNMRQVTLAEFLSARFQGLTVESLFERYESDRQREQLTPAIRDFQESADFMRQVDQ
FT                   YCHQLPADQLRFTNIVFNGEIFFAKEIITKIAAALPAAMQPADRFLAIKNTLIKRLKHR
FT                   IDDEAQADWVNDIIDQLSDESYHDLLGSKRRGDFQSLDDEVFYIGKQIVTKRLRQVYDA
FT                   IYNGYFLDTYEQYNDFLAQVDRPTTVTPDQWQQRIAAYQAAVEYHRIALVDCAPLLLLR
FT                   DVLTGSGQNRRMQYIFVDEMQDYSLAQLLYIKHAFPLAKFTLLGDSEQALFKGIELPQQ
FT                   LLERLKDAFNVRRANLITLNKSYRSTEQITNFAKALLPDGDQIQAFTRKGDLPKVMIRY
FT                   GEDAALSSLRSEVEHQLKATNTVAVLTKDLAESKQVYQYLKRYTVTTLMADSDRTMPQG
FT                   VIVMPIYLAKGLEFDAVVAYDVSATNYPDADSVGILYTIASRAMHHLTLLSIGAVSPLI
FT                   AQLDPTLFTIEHQVRV"
FT   gene            384411..385187
FT                   /locus_tag="JDM1_0363"
FT   CDS_pept        384411..385187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0363"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61252"
FT                   /protein_id="ACT61252.1"
FT                   /translation="MRVALAQLNIQFGDPDANYEQIEVAIQRAAEQTVDVIVLPEMWNT
FT                   GYALTRLNVLADDDGQRTLQLLSKLARQFRVNIVGGSVAVARDGHYYNEMLVVDRQGQL
FT                   LSRYDKVHRFGLMAEDRYITAGETENVFELDGTVAMGAICYDIRFPEWLRKQAARGPQV
FT                   IFVSAEWPTVRQMQWRLLLQARAIENQAFVVAVNRVGSDPDNQFGGQSLVIDPLGQIVA
FT                   IGGAHAQLITAELDLTQVDQARGQIPVFEDRRPELY"
FT   gene            385626..386642
FT                   /gene="trpS"
FT                   /locus_tag="JDM1_0364"
FT   CDS_pept        385626..386642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpS"
FT                   /locus_tag="JDM1_0364"
FT                   /product="tryptophanyl-tRNA synthetase II"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61253"
FT                   /protein_id="ACT61253.1"
FT                   /translation="MTKKVFLTGDRPTGKLHIGHYVGSLRNRVALQDSGDYDSYIMIAD
FT                   NQALTDNAHDPEKIRKSLLQVAMDYLAVGIDPQKSTILVQSQIPALTDMMNQYLNLVTV
FT                   ARLNRNPTVKTEIKQKAFGESVPAGFFVYPVSQAADITAFKATTVPVGDDQEPMLEQTR
FT                   EIVRSFNKTYQTDTLVEPEGYFPPKGLGRIPGLDGNAKMSKSLGNAIYLSDDADTLKKK
FT                   VMSMYTDPDHIHIEDPGKVEGNVVFTYLDIFDEDKTKVADLKAAYQHGGLGDVKIKRYL
FT                   MDVLDGVLRPIRERRAIYEADPAQVLQILKDGTAKANVVADQTWREMQDAIGINYFK"
FT   gene            387048..387758
FT                   /locus_tag="JDM1_0365"
FT   CDS_pept        387048..387758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0365"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61254"
FT                   /protein_id="ACT61254.1"
FT                   /translation="MYQAIAQAIIKSIMADEYPTKLPTEKVLMAQYNASRNTIRKAIDV
FT                   VFRHGLLRRVQGSGNFIIKQPQNTKKVLNLSIGFDQSAMVEGGPLVSKVVTFDKVTADE
FT                   TLAQQGNIALGDEVYRVVRLRYLNDILYDLEESYFPRTVVPFLSSESVQHSIFAFLREA
FT                   YGITGSTTENYVHQVRVDAQRAELIGCPDGDKTLCLEAINYLANGTVFNFSRTFFVYPD
FT                   LELYYHTENIDLQN"
FT   gene            387831..389192
FT                   /gene="pts7C"
FT                   /locus_tag="JDM1_0366"
FT   CDS_pept        387831..389192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pts7C"
FT                   /locus_tag="JDM1_0366"
FT                   /product="cellobiose PTS, EIIC"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61255"
FT                   /protein_id="ACT61255.1"
FT                   /translation="MNSFIEWLNKHLVPVAAKIGAVRWLIALRDAFIAIMPAMMAGSIA
FT                   TVLNALVRDIPTKFGWMGIVNSMQWLIGINAMVWTGTLAILGLIFSFTFGYQLAIQYKV
FT                   EPVTGGIVTLGTFIMSLPQNFTGTLTSTLSKGATKILTDSGMAVAGKKVTAWGYFNFNT
FT                   YFGSYGFFTVMILGAIASAVYIALMKKHITIKMPDSVPPAVANAFTGVIPAAAAFYVVG
FT                   IINWIFSKFNTTVIEWIAKIIQEPLLNMSQGYGAVLLMTLLVQVFWFFGIHGSNVLAPI
FT                   LDGIWLTAQLANVNAYQAGKALPYVWTRNCFDLYAWIGGAGSTLLLLVAILVFSKRDDQ
FT                   RSVAKLAIGPGFFNINEPVMFGMPIVLDPIYFIPFVLAPVVTVSIAYAALSAGWVAPIT
FT                   NNIVWSMPPIMNALVATMDWRSVVLQLFNAAVAFAIYVPFVKAANKIKPAAIGE"
FT   gene            389199..389387
FT                   /locus_tag="JDM1_0367"
FT   CDS_pept        389199..389387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0367"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61256"
FT                   /protein_id="ACT61256.1"
FT                   /translation="MKSLKQCLLIGMNLGLLAVILSPLAGTTGQWVTLGLGLAVSAALF
FT                   VVYRRVGQIERSHQNAD"
FT   gene            389377..389799
FT                   /locus_tag="JDM1_0368"
FT   CDS_pept        389377..389799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0368"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61257"
FT                   /protein_id="ACT61257.1"
FT                   /translation="MQIKLTLNAPVDYLYQQLIDSARADIQQQTGRPAPRQSLQGYEYA
FT                   KQWSNGLTGNLKITHAQPGVRYAYELETPRDHYGVDYQFAPDTDGHQTVLEYAETFLGK
FT                   DKKTNANNKLGVLFLGWFRKRRFKKMMNQMAASYNQ"
FT   gene            390022..391377
FT                   /gene="pts8C"
FT                   /locus_tag="JDM1_0369"
FT   CDS_pept        390022..391377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pts8C"
FT                   /locus_tag="JDM1_0369"
FT                   /product="cellobiose PTS, EIIC"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61258"
FT                   /protein_id="ACT61258.1"
FT                   /translation="MNGFNVFMEKHIVPFAVKLNEQRHVAAIRDAFMYTFPITMAASLV
FT                   ILINNLVFSKTGFIAQILFLPKFFPHLENAQKLLTSVTNGTMNILSIFIAYLVARNLAK
FT                   YFKADDMLVGMTGIACFMILYSPSIIKDGVTYLPTTYLGAQGLFVAMIVGGLVGEFLPR
FT                   LTRIKKMQIKMPEMVPPAVARSFNGLIPIVIMIMLFSMLNYGLSLISPQGINDIIYKSI
FT                   QTPLTHIGVNLFGVIIIAIVQNLLWLVGIHGPNTLNALRSIIFTEADLKNQTFINAHGT
FT                   AWGVPNRATWSVLNDVFANMGGSGMTLGLIIAIFLVSRRKDYREIAKLALVPGLFNINE
FT                   PLMFGLPIVLNPIMAIPFVLTPVINILVGYTVTVIFNWIPTPAFGLTWTTPGPLMPFLG
FT                   TGGNWLGLIIGFVCLGISVLTYMPFVLAANKMMAADSQSKQDTDTTTETVKA"
FT   gene            391395..392831
FT                   /gene="pbg1"
FT                   /locus_tag="JDM1_0370"
FT   CDS_pept        391395..392831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbg1"
FT                   /locus_tag="JDM1_0370"
FT                   /product="6-phospho-beta-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61259"
FT                   /protein_id="ACT61259.1"
FT                   /translation="MTIKGRAFPEGFLWGGAVAAHQLEGGYKEGGKGLSTADIMTLGTN
FT                   ERPREITDGVVAGKYYPNHQAIDFYHRYPEDIELFAEMGFKCFRTSIAWTRIFPNGDES
FT                   EPNEAGLQFYDDLFDECLKNGIQPVVTLAHFEMPYHLVKQYGGWRNRKLIQFYLNFAKV
FT                   CFERYRDKVTYWMTFNEINNQTNFESDGAMLTDSGIIHQPGENRERWMYQAAHYELVAS
FT                   AAAVQLGHQINPDFQIGCMIAMCPIYPLTAAPADVLFAQRAMQTRFYFADVHCNGTYPQ
FT                   WLRNRFESEHFNLDITAEDLKILQAGTVDYIGFSYYMSFTVKDTGKLAYNEEHDLVKNP
FT                   YVKASDWGWQVDPVGLRYAMNWFTDRYHLPLFIVENGLGAIDKKTADNQIHDDYRIDYL
FT                   TDHLRQIKLAVLEDGVDLIGYTPWGCIDLVAASTGQMSKRYGFIYVDENDDGSGSLKRY
FT                   KKDSFTWFQHVIATNGAEIE"
FT   gene            392952..393848
FT                   /locus_tag="JDM1_0371"
FT   CDS_pept        392952..393848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0371"
FT                   /product="sugar kinase and transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61260"
FT                   /protein_id="ACT61260.1"
FT                   /translation="MTMYIGIDIGGTSIKCGLVDAHGHISRKVTRPTATAKVDIMADLV
FT                   AMIQGLQADGQVAGIGVSMPGVVQSDGFLTTAGAVTAFEKINLQAELHAQTQLPVIIEN
FT                   DANAAAIAEQWLGVAQNVPNYLSLVLGTGVGGALVINNQIYRGAHARSGEFGWMVVDDD
FT                   EIDTEMGTLNFRGATVIGLIRRYNQFSAMPVTDAREIFDRADAGEVLAQHVFHSYYYSL
FT                   AKGIINLMVAFDPELVVIGGGISANMTFMTDLNATIADLQANHNSINHLTLASVVPAKL
FT                   RNDAGMIGAVYQLIKRG"
FT   gene            393998..394744
FT                   /locus_tag="JDM1_0372"
FT   CDS_pept        393998..394744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0372"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61261"
FT                   /protein_id="ACT61261.1"
FT                   /translation="MAFFGYKDIDKLSGVDLAIYRFIVEHDEQIPYMRVRELARGAHVS
FT                   NSSVMRFIRKIGYDSFPEFKVSLRSETPIQKPDAPGIQFVQPSAFPADITKIIRLAAQL
FT                   MVNADNIVFVGIGASAALGEYASRQTSSLGFNSYVVKDPFYPLLPQLRNTSNNVLVAVS
FT                   VSGQTSELVEMLNDFVNNPEVNIISITSNLESTIARMSRYALTYRATEERIHQYYDLTS
FT                   QVPCLYIIEALLRELRHQEVVQHRFE"
FT   gene            394857..395870
FT                   /locus_tag="JDM1_0373"
FT   CDS_pept        394857..395870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0373"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61262"
FT                   /protein_id="ACT61262.1"
FT                   /translation="MTATPFWSQIAAQAKADGRPFFTMAPMEAVSNTVFRQVISHAAAP
FT                   DTFFSEFVYAKSITNPNTKFPVHGRLYVAAAESQKPVVQLWGNEAADFASATAELRDRG
FT                   FEAVDINMGCPDGTVIKNHGGSDLIRNPQWAEDVIAAAKTSGLAVSAKTRLGYSKVAEY
FT                   HDWIATLLSQHVAVLTVHLRTKQEMSKVPAHFEVIDDLIKMRDAIAPETLLQINGDVAD
FT                   YQAGVALAKAHPGLDGIMIGRGVFANPFAFESHPQSHDLHELLGLLNMQLDLFDDFATR
FT                   YDVPRFPSLKRFFKIYARPELGATDLRNTMMDAKSTDDVRKILAAYQAKMRVTNHS"
FT   gene            396312..397229
FT                   /gene="ppx1"
FT                   /locus_tag="JDM1_0374"
FT   CDS_pept        396312..397229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppx1"
FT                   /locus_tag="JDM1_0374"
FT                   /product="exopolyphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61263"
FT                   /protein_id="ACT61263.1"
FT                   /translation="MRNLAIVDLGSNSARMAVSRLHANGTAQEIKRVKEDTRLSEGMGT
FT                   AHVLQPAAIERTIKALLNFRRLYEKMPNTDVIGITTAAVRMAQNQAEFLNQVKQEVGLD
FT                   LRVLSGDDEAYYDYLGVANSLVIHDCLILDTGGASCELILVKNGRKQQLISIPFGAVTL
FT                   SEQFGLDDLVPSASLFRAQMFLRNRLADIWWLSEAVHFPIILLGGANRTLARINRRRQQ
FT                   KLKVEDIHGYRLKTETVFHTFLDLLSRSKKGRQEISGMEYDRADIIVGGMLPLVTLLQM
FT                   LDSDRVIFSESGVREGIISEHLNQ"
FT   gene            397275..398549
FT                   /gene="mvaA"
FT                   /locus_tag="JDM1_0375"
FT   CDS_pept        397275..398549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mvaA"
FT                   /locus_tag="JDM1_0375"
FT                   /product="hydroxymethylglutaryl-CoA reductase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61264"
FT                   /protein_id="ACT61264.1"
FT                   /translation="MTADFRHFYQKNWAERTAIVAQQAHLTPAEQALFKQYYLPQHHEI
FT                   IENYLTDYPLPMGLAVNLVVDGVDHIVPMVTEEPSVIAAASNGAKIVKRAGGFTTVLNQ
FT                   REMIGQIVLEQLSDPAATAAVIEAHAAALLKVADAAHPSLKKRGGGARRLRTRVLGQGY
FT                   LSIDLFVDVQAAMGANMLNSMLEAVAKSIGVMTKQDALMSILSNYATASLVKAICDIPV
FT                   GLLQAGRYAGKLVAQKIASASTVAQLDPYRATTHNKGIMNGIDAVAIASGNDWRALESG
FT                   AHAYAVKDGQYRGMSTWTSDGRMLHGELELPLPVGIVGGSIKINELAQLNQRILGIQTA
FT                   GDLERIMVAIGLAQNLAALRALVTTGIQQGHMHLQLKSLAMAAGATPEELPVILQRLEL
FT                   ASQQDLATTQQLIAELRQTKEETDD"
FT   gene            398542..399501
FT                   /locus_tag="JDM1_0376"
FT   CDS_pept        398542..399501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0376"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61265"
FT                   /protein_id="ACT61265.1"
FT                   /translation="MTEIKLNQTVTDLLSTANSLYPGNISVRFGDTKAGYVRHDQAQQV
FT                   LDDGDLTVRVSDITAPNYTASHELLHLLLLLQGFPQITFNLTTRDQQLDEQLMAIAMEL
FT                   YDMVSHVLVVRKQREHNLIDEQIETLYMQGVAATIEPEPAGKADAMMTLRLLTLTDLLV
FT                   FFNGELPADDLQKVTTAYPQAWPAAQKLYAVISQKPVDTPFAMRRAVVKLFKAFDDQMT
FT                   AWHLPVLHGTEFVTVQSVLSERQERLEVRQLFDVYHSDLLDKNKHTRAYIGLYKSDRQN
FT                   AFVLPAPAQKKSDAFFKEVYDKTVKELFQEMNLPYTLR"
FT   gene            399523..400227
FT                   /locus_tag="JDM1_0377"
FT   CDS_pept        399523..400227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0377"
FT                   /product="NAD-dependent deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61266"
FT                   /protein_id="ACT61266.1"
FT                   /translation="MSDITAAQTTLQQAQHIVFMTGAGVSTPSGIPDYRSKNGLYTEHH
FT                   NAEYYLSHAFLAEHPLEFYQYLQSNLYYPDAQPNVIHQKMAALTQQGRASVITQNIDNL
FT                   YGVAKTAQLVEFHGNLYQVYCTKCGQHVDWHEYLKSPYHQTDHGYLRPNVVLYDEGIAS
FT                   ANIERAVQYLQQADLVVICGTSFRVYPFAGLIDYRNPKAQVLAINAEPLQLPFAFTMVQ
FT                   QDAVDFFEGVQV"
FT   gene            400227..401069
FT                   /locus_tag="JDM1_0378"
FT   CDS_pept        400227..401069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0378"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61267"
FT                   /protein_id="ACT61267.1"
FT                   /translation="MITIGLTTWTEHPSLLGGTEKLTLTEYSGVLPVVEVDTPFYGIPK
FT                   VTTVAKWQKAVPDKFQFILKANQVMTLHDTYDEGVSMDALKTAYREYRAMLKPLTQHQQ
FT                   LKAVLFQFPPFFERSNRNFHYLQRMVEWLPGVPIAVEFRNQSWYEESVKDAVFSFLKDL
FT                   GITHVIVDEPHALNDGVSFEPVVTNSKLALLRLHGRNQQGWSAKGANWRSQRTLYRYSD
FT                   QELAEFKQTVEQLQQQADEVCVIFNNNSGGDAADNAMALKELLGVSFGDLGPHQLDLF"
FT   gene            401667..402056
FT                   /locus_tag="JDM1_0379"
FT   CDS_pept        401667..402056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0379"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61268"
FT                   /protein_id="ACT61268.1"
FT                   /translation="MQPDIICANGVFCADGKVLLTRESKNTAYYFPGGKVGVGEKLTQT
FT                   LQRELKEELSLVVSPDRFKWAFTHRGTAYNQPGKIVELNCFLVAGSGALKVDSEVYDYK
FT                   WCRPDDSRIAEVVREALARYSWVVE"
FT   gene            402378..404429
FT                   /gene="metS"
FT                   /locus_tag="JDM1_0380"
FT   CDS_pept        402378..404429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metS"
FT                   /locus_tag="JDM1_0380"
FT                   /product="methionine-tRNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61269"
FT                   /protein_id="ACT61269.1"
FT                   /translation="MAETKPTYYITTPIYYPSGKLHIGNSYTTIACDTLARYKRAMGYD
FT                   VYFLTGTDEHGLKIEEKAEKLNTDPKSYVDGMAKQIKDLWQLLEISNDKFIRTTDDYHE
FT                   RAVQEIFDRLLKNGDIYLGEYEGWYSVDDEEYFTETQLAEVFRDDNGKVIGGKAPSGHE
FT                   VELVKEQSYFFKMSKYADWLLDYYQSHPDFIEPANRMTEMINNFIKPGLEDLAVSRTSF
FT                   TWGVPVKSDPKHVVYVWIDALTNYITALGYATGDSEDLFNKFWPADVQMVGKEIVRFHT
FT                   IYWPIILHALGLPLPKKVFGHGWLLMKDGKMSKSKGNVIYPETLVERYGLDALRYYLVK
FT                   AMPYGNDGLFTPEDFVARVNYDLANDLGNLLNRTIAMINKYEDGQLPAFKAGVTEFDAD
FT                   LEATAATTIKNFNACMDSLHLSDALAEVWKLVSRTNKYIDETAPWQLAKSDDANDADKL
FT                   ASVMAHLAASLRVIASLISPVMTHAPKEIFTQLGLDPATLAIADLQLADLPAGAQVVAK
FT                   GTPIFPRVDMDAEVEFLKGKMTKSDKQKGRKAMENAKHEAEVEQGWNPAETNLNLTKPA
FT                   ITIDDFDKVELKVAEVITVQKLKGADKLLQFRLDAGDADHRQILSGIAKWYPEPEELIG
FT                   KKVIIVGNLKPRKLRGEMSQGMLLSAEHDGQVQLITVPDNMVNGSLIS"
FT   gene            404662..405459
FT                   /locus_tag="JDM1_0381"
FT   CDS_pept        404662..405459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0381"
FT                   /product="transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61270"
FT                   /protein_id="ACT61270.1"
FT                   /translation="MKNVQKQVPSLLLLITLVGFPQISESIFTPILPALSQAMHVSASH
FT                   SQLTMSSYFVAFAVGVLFWGQYADYRGRRDAMLGGLAFYLIGNLGLYLSPGFTWLLVCR
FT                   LIQAFGASAGSVVTQTIMRESFTGVTGAKIFAKVSAAMALSPALGPLIGGGVQTVFGYQ
FT                   HVFSVLIMMAVVILLYAGCCLPETRPETVKVASWRQQSVVVSRLLHDPVVWCYGLLISG
FT                   INGILFSYYAEAPFIFETHFGFSAVQYGSLGLVLAAPVCWAHC"
FT   gene            405459..405845
FT                   /locus_tag="JDM1_0382"
FT   CDS_pept        405459..405845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0382"
FT                   /product="transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61271"
FT                   /protein_id="ACT61271.1"
FT                   /translation="MNWLVNYWSPMQVALSGLGLSLVAAVGLVMTAVGNHVIGMLIGIF
FT                   LAFLGLNITLPNALNRALIGYETVMGSASGWFSLGYYLLVSVLTYLISWLHHGSIVTLP
FT                   VYMLGVVVVMTVVYAGLYWRRVRH"
FT   gene            complement(405879..406769)
FT                   /locus_tag="JDM1_0383"
FT   CDS_pept        complement(405879..406769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0383"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61272"
FT                   /protein_id="ACT61272.1"
FT                   /translation="MSNSASIGATVKMVQHAKRLSVNDVTNNKRIISKSTYYRFINGHS
FT                   NISAVCFLQLLERLELTLQEFDFILHHYQIPPVEQLLQQIQNAVAKEDIGELWKLKKQI
FT                   DKLFNATHAHRYQQLLTLTHLALHHLETPQQALDSTLRAALDGLIQDLLNLQLWSKYDL
FT                   MLCRQIFTTLTPEQQIILLTSANKSFHKYQRLTDEALTFMTFLANQLFVAVHDKQPKLI
FT                   TKIYPIMTTINFPSDQLVPALLLKFCQGITDYVTKPNQPLNACSQALDIVHCLHIQYWD
FT                   TIFQNVLLDLKTMPI"
FT   gene            407332..407820
FT                   /locus_tag="JDM1_0384"
FT   CDS_pept        407332..407820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0384"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61273"
FT                   /protein_id="ACT61273.1"
FT                   /translation="MKRWNRLLQRIQVKYGSLSEQQLLKINYWLLAIYLVLCGVAYIRR
FT                   RHSHSAMLQVVPELIITLLAFGLLRIIRWRKTTPKSRFKFATEDYSPEEQLVMVAIVFI
FT                   ENFPISAMLEMVSNILIVLIGIRKFFQYKLDRLSAYRTLNIILVFETVMVSWIVLFGG"
FT   gene            408072..408848
FT                   /locus_tag="JDM1_0385"
FT   CDS_pept        408072..408848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0385"
FT                   /product="DNAse (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61274"
FT                   /protein_id="ACT61274.1"
FT                   /translation="MRIFDSHTHLNSEEFIQEVPRYLQQAADLDVTRMAIVGSNTQLNA
FT                   DAIKLAETYPQLVAIVGWHPEDAKNYDQAAEKLLIEQVQHPKVVALGEIGLDYHWDTSP
FT                   QDVQRQVFARQVAIAKEMQLPISVHNRDAFEDTYKILKAADIRDTGGVMHSFNGDPEWL
FT                   KRFLDLGMHISYSGVASFKNAREVHESVKQTPLTQMLVETDAPYLTPEPYRGKQNEPGY
FT                   TRYVVEAIAKLRETTPEIIAAQTYQNAEEFFKIEKD"
FT   gene            408835..409398
FT                   /locus_tag="JDM1_0386"
FT   CDS_pept        408835..409398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0386"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61275"
FT                   /protein_id="ACT61275.1"
FT                   /translation="MKKIKEVIVVEGKDDTKRLALAVDADTLETNGSAISEATLAQIKT
FT                   LQASRGVIVFTDPDFSGERIRKTISAAVPGVKHAFLPRKAGVPTKAGGSLGVEHASPAA
FT                   IQTALAHLYTEQIDEPQQLISHHDLIAAGLLAGPTARQRREQLGERLGIGYVNGKQLPK
FT                   RLQLFQIQPADFWAAVDQLTTEEK"
FT   gene            409395..410285
FT                   /gene="ksgA"
FT                   /locus_tag="JDM1_0387"
FT   CDS_pept        409395..410285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="JDM1_0387"
FT                   /product="dimethyladenosine transferase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61276"
FT                   /protein_id="ACT61276.1"
FT                   /translation="MMSRDLDIANPARTRAIMHTYGLQVKKSLGQNFLTDQNVLHNIVA
FT                   TADIGTNDNVIEIGPGIGALTEYLARAAHHVLAFEIDDRLLPILDETLADYDNVTVVNQ
FT                   DILKADLAAMISEHLDNERPLKLVANLPYYITTPILMNILAGDVAFENIVVMMQKEVAD
FT                   RLAAEPGTKAYGALTIAVQYRMAAEMAMVVPRTVFVPSPNVDSAIVKLTALPPRTHVPF
FT                   DEAAFFKVVKAGFAHRRKNLWNNLQSLFGKQPETKTAIQQALDIATIDPKIRAERLTVD
FT                   EFITLTDALHQADLL"
FT   gene            410390..410641
FT                   /locus_tag="JDM1_0388"
FT   CDS_pept        410390..410641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0388"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61277"
FT                   /protein_id="ACT61277.1"
FT                   /translation="MPISLAAIKDKLDSRIGQRMKVVAQAGRKKTTERHGILKETYRSV
FT                   FVVDLDQQENAFERVSYSYTDVLTKNVQIAFDDETTEA"
FT   gene            410774..411640
FT                   /gene="ispE"
FT                   /locus_tag="JDM1_0389"
FT   CDS_pept        410774..411640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispE"
FT                   /locus_tag="JDM1_0389"
FT                   /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61278"
FT                   /protein_id="ACT61278.1"
FT                   /translation="MQIVEKAPAKINLGLDTLFEHPNGDKEWDMVMTSVDLADYVMLES
FT                   LHTNRIEVVTDSGFLPNDRRNLAFQAVSVLKRYCHVDRGVRIKIRKAIPVAAGLGGGSS
FT                   DAAAVLRGLNRMWNLHLDLATLARLGLQVDSDVPYCVYSQTAHVTGKGDVVTPLPKLPP
FT                   MWIILAKPKVSVSTPNILRQVNYERIDQHPNIEVLLTGIQRQDFAKIFANMGNVLEPIT
FT                   AKRYPEILQIKRQLLTFGADAAQMSGTGPTVFGVCRKQSRAQRVYNSLKGFCREVYLVR
FT                   PVNLNEH"
FT   gene            complement(411722..411859)
FT                   /locus_tag="JDM1_0390"
FT   CDS_pept        complement(411722..411859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61279"
FT                   /protein_id="ACT61279.1"
FT                   /translation="MKATTIFVCQPASKAAATRIPVPIALLHHLWLDTGRDSKWLSATI
FT                   "
FT   gene            411950..412894
FT                   /locus_tag="JDM1_0391"
FT   CDS_pept        411950..412894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0391"
FT                   /product="cell surface hydrolase, membrane-bound
FT                   (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61280"
FT                   /protein_id="ACT61280.1"
FT                   /translation="MKQSTKFGLKLAGVIGAATYAGTLLGGLAAYQVAMHVSDAQKQQG
FT                   RERSRAENTEIENFWYFKQPKQQWMIQSFDGLNLVATYIPNPKTIGRLAILAHGLGHSR
FT                   EQMIPYARIFMSLGYDVLMPDARSFGDSQGHTIGYGWLDRLDYECWITMALSQLGLDID
FT                   IVLMGISMGAATVMATSGEPLPENVKAIVEDSGYADLYDEAKFRLTHKFHLPAYPIMPV
FT                   ADRLAHVRAGYGFKDGRILQRVIDGGLPILMIHGSKDQTVPVCNAHTLYDQLPQQKGLY
FT                   IDPDAGHVEAIRTHPDRYQEVLDEFLHEQAGLA"
FT   gene            413162..413860
FT                   /locus_tag="JDM1_0392"
FT   CDS_pept        413162..413860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0392"
FT                   /product="zinc/iron ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61281"
FT                   /protein_id="ACT61281.1"
FT                   /translation="MTEPLIAVQHLGIGFPNNQVFKDLNFNIEQGDFLTVIGENGVGKT
FT                   TLIRALLGMLKPTAGQIKYYPNKKAIKIGYVPQFRNLDQEYPLTIEDFVGLNLKGWQPW
FT                   LSRAEHRQVATALAVTNLKKLRQRPLGMASGGEKQRAYLAQAIVQQPQLLILDESTASL
FT                   DNEMKYELLDLVQNLNQTSNITVFFVTHDLPLAKQYAKHYLALKPGHQQFGNIADMSVE
FT                   QLKEATNVNV"
FT   gene            413847..414650
FT                   /locus_tag="JDM1_0393"
FT   CDS_pept        413847..414650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0393"
FT                   /product="zinc/iron ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61282"
FT                   /protein_id="ACT61282.1"
FT                   /translation="MSMFSLVFMRNAYLAGTFIAIICGTIGVFVIARNLSFLTHTLSEI
FT                   GFAGAAFGIFMGWTALSGMLIFTVISSVIVGQMSVKQSRREASISAISALFIGLGILFL
FT                   SLSNQTSSYATSILFGSVIGIASADVIRVAILSAIVLLVMLGLYRPLKFDSFDAIGARV
FT                   SGLWTTGISVVFLVLVAMSVSVAAQIVGSLLIFILLTLPAAAARYFVHTVSKMIFLAIG
FT                   FALIGVWLGLYLSYVTNLPVSFFIAAIECIFYFAALGYQRLRVGS"
FT   gene            415006..415842
FT                   /gene="purR"
FT                   /locus_tag="JDM1_0394"
FT   CDS_pept        415006..415842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purR"
FT                   /locus_tag="JDM1_0394"
FT                   /product="purine operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61283"
FT                   /protein_id="ACT61283.1"
FT                   /translation="MKVRRSERLIDMTRYLLERPHTLVSLTYFAERYASAKSSISEDLT
FT                   ILKKVFQARGTGILETIPGAAGGARFIPYILKEEAQEFIDEMTTKVADKSRVLPGGYVY
FT                   LSDILGQPDILRQVGRVIATQYLNQKIDAVMTVATKGIPIAQSVATYLNVPFVIVRNDS
FT                   KITEGSTVSVNYVSGSSERIKKMELSKRSLTEGANVLIVDDFMKGGGTINGMKTLIEEF
FT                   DANLIGITVFAEASFVGNRLIDDYTSLLRVTNVSDSDKAIKVVAGNYLEKVFGAEV"
FT   gene            415911..417293
FT                   /gene="glmU"
FT                   /locus_tag="JDM1_0395"
FT   CDS_pept        415911..417293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmU"
FT                   /locus_tag="JDM1_0395"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61284"
FT                   /protein_id="ACT61284.1"
FT                   /translation="MTTKNAIIMAAGKGTRMKSKLVKVLHQVCGKSMVDHVLTQVEATH
FT                   MANIVTIVGHGAKDVEAALGDRTEYAVQTEQLGTGHAVLQAESLLKDADGMTLIVSGDT
FT                   PLFKAETFEELFEYHQAKGAAGTILTSKAPNPQGYGRVVRNRLGIVEKIVEQKDATKEE
FT                   QEIHEINTGVYCFDNQKLFAALHEVTNDNAQGEYYLTDVIQIMKNQGDVVAAYQMDDFD
FT                   ESMGVNTRAALAQATKVMQQRINAQHMENGVSIINPDDTYIDAGVKIGADTIIEPGVLI
FT                   KGHTTIGEDCFIGAHSEIHDMVIEDRVRVTASFLEDSIMHADSNIGPYSHLRPQAEIGE
FT                   HVHLGNFVEVKKAKIGNRTKVGHLTYVGDATLGQDINVGCGVVFVNYDGVNKHHTNVGD
FT                   SAFIGSNSNIIAPVEVADHSFIAAGSTITDDVNFHDMAIARARQTNKPDFWGRLPHEPE
FT                   NM"
FT   gene            417529..418353
FT                   /gene="bla1"
FT                   /locus_tag="JDM1_0396"
FT   CDS_pept        417529..418353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bla1"
FT                   /locus_tag="JDM1_0396"
FT                   /product="beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61285"
FT                   /protein_id="ACT61285.1"
FT                   /translation="MQTKKWIRGLVCGLALLGGWSLALPVHATSVKSEQTAVKKIAQRD
FT                   LKSLGGRWSVKVTRLGRRKLTVQTGNQRMTRQRSASTIKVYVMLTIYRRVQQRKLRLTQ
FT                   QDQNDLKLMIHNSDNSAANRLIKRAGGFRGVNAAIKHYRFKQTVLQRYMLDTNALRWGR
FT                   DNYTSVADLTRFLTLTYQHKLLGKTYDKKMLTLLKGCRNHSKLPYLVKHVTVYNKTGEY
FT                   PDKGVQNDAAIFKTKQGTYSIVVMAQNGKQYQQYQGMNRLGRDVVTYLNQHH"
FT   gene            418719..419699
FT                   /gene="prs1"
FT                   /locus_tag="JDM1_0397"
FT   CDS_pept        418719..419699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prs1"
FT                   /locus_tag="JDM1_0397"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61286"
FT                   /protein_id="ACT61286.1"
FT                   /translation="MSEQYFDPKLKIFALNSNKPLAEKIADAVGVKLGKTSVDRFSDGE
FT                   IRINIEESIRGDQVYIIQSTSAPVNDNLMELLIMIDALRRASAKTINVVIPYYGYARQD
FT                   RKARSREPITAKLVANMLETAGATRILALDLHAAQIQGFFDIPLDHLMGAPLLADYFLN
FT                   HHLDENAVVVSPDHGGVTRARKLAEFLKAPIAIIDKRRPRANVAEVMNIIGDVKGKRAI
FT                   MIDDMIDTAGTITLGAQALVDAGATEVYASCTHPVLSGPAIERIEKSPIKKLVVTDSIE
FT                   LPAAKRIDKIEQVSVGQLMGQAIKFIHENKPVSPLFKNRFHNEEN"
FT   gene            419988..421010
FT                   /locus_tag="JDM1_0398"
FT   CDS_pept        419988..421010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0398"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61287"
FT                   /protein_id="ACT61287.1"
FT                   /translation="MTPFYWGSLALASALTLQLTDRRHWLTGHLFLIAVIGILLSAYHR
FT                   FSAQASPTWQFMLVGAKILAYTLLPIVILIVGISFVRYSYRLIRKEGWAFHYSLLAIVG
FT                   GVLVIMLILSVINLGVWHSRRLWQFLGLALLLTAYFAFSFFAYLLACVTTRLGRHRQID
FT                   YMIVLGAGLMPNGQPTRTLAYRLQAAAKYYRAQRARYHQPITIVVSGGQGPDEVMAEST
FT                   AMRQYLVDQGVPRDAIQEENQSTSTIENLKFSHALIVRQQPFYRAVIVTSGYHVLRANI
FT                   FARQLHLNLTGIGAHTPLYYLPFAMFREYLALIVMYRWANLVAVLGLTAYYVAALVRLI
FT                   "
FT   gene            421093..422079
FT                   /locus_tag="JDM1_0399"
FT   CDS_pept        421093..422079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0399"
FT                   /product="lipoprotein precursor (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61288"
FT                   /protein_id="ACT61288.1"
FT                   /translation="MDHAYRSSWPLFVIVLIGLITLSGCAKNTGGVTASSATTATGNST
FT                   TAVLTKADQQISQQKIAAAQKTLAGASESTPAIKKLALGLKYYQEAEEALDNNQLSLAK
FT                   GYFDTLSSYDGTTDASFIAARQKLVKQYQAVKLANGYYNAARDELSIHDLATAKANIDK
FT                   LDDVQATHPVIKKLQKKALAMKQAIMNYEASQSTSSGSDSSTVVSSSSAASASDSRTSS
FT                   SSTSSTSADSSTMTSSSNSSASASSSSSELTTSAIIKQFQDASGVTFTSDTEFNITKET
FT                   SAYYQITAIYATNESSSSASKTVTDTYRYYPDSGSVTKENSATGSFE"
FT   gene            complement(422249..423058)
FT                   /locus_tag="JDM1_0400"
FT   CDS_pept        complement(422249..423058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0400"
FT                   /product="HAD superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61289"
FT                   /protein_id="ACT61289.1"
FT                   /translation="MSVKLIAIDMDGTLLNEHSELNPATVQAINAANAQGIKVVICTGR
FT                   PLSGVTPFLKQLGIAGEDNYVITFNGSMVQTITGKIITGLTLSHDDYIDIETLSRKLNI
FT                   HCHVESEDHIYTANRNISPYTVGESALVNMPIRFRTPEEMRPDLPIVKCMFIDHGPLLD
FT                   AAIKQLPASFSKRFTIVRSEAYFLEFMNPAASKGNALATLTDHLNLTADEVMAIGDQGN
FT                   DLSMLRYATNSVAMGNAIDEAKQIARYETKTNVEDGVAYAINTWALA"
FT   gene            complement(423078..424430)
FT                   /locus_tag="JDM1_0401"
FT   CDS_pept        complement(423078..424430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0401"
FT                   /product="hydrolase (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61290"
FT                   /protein_id="ACT61290.1"
FT                   /translation="MAYRQQLLPMEKVFRDPVHDYIYIQHQVILDLINTSEFQRLRRIK
FT                   QLGTTSLTFHGAEHSRFGHCLGVYEITRRICDNFERNYPTQAPGDGGWDDHERLVALCA
FT                   ALLHDIGHGPYSHTFEHIFHTDHEALTVQILTSPETEVNQVLQQVSPDFPAQVAAVIQK
FT                   TYPNPQVVQMISSQIDADRMDYLLRDSYFTGTNYGNFDLTRILRVMKPYQGGITFAMEG
FT                   MHAVEDYIVSRFQMYMQVYFHPVSRSMEVILDRLLERANDLYQSHAVDAEATPVMLLPF
FT                   FNNNFTLHDYLRLDDGVLNTYFSHWRDSRDQILADLATRFLDRRPLKSARVDATTQPLI
FT                   PTLQKLIEQAGFDTHYYTDINDSYDLPYDAYDPKMKKPRTQIELQQKDGSLLELSTVSD
FT                   LVRAITGKVSGDQRFFFPKEMLSKNAENDLFKPIYQEFQQYILNDRLVVPH"
FT   gene            complement(424445..425377)
FT                   /locus_tag="JDM1_0402"
FT   CDS_pept        complement(424445..425377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0402"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61291"
FT                   /protein_id="ACT61291.1"
FT                   /translation="MSKPMQRYHFSSIISDDTDNGGGFIMRHPSCPITTDNGVAFLTKS
FT                   TIATLSQKYEPAAMLDSFAYTNALLWLTAARQQPIVHFWQLQPTVILGLLDQRLPRLTA
FT                   GLAHLHAAGYQVMLRNSGGLAVVADPGVLNVSLFLPATRERYSITAAYQLMVDYVQAVW
FT                   PQLNITTGEITRSYCPGDYDLSIAGRKIAGMSQRRTAEALVIMLYVSVDGDQMARSQLI
FT                   QRFYQVSLAGHHDARFPDVDPQVMTTVADALAAPTDTTATQARFIAILAQHGTVDTTSL
FT                   PLVTEEPEFQAHLNQAYQQMQRRQQRLHH"
FT   gene            425686..426180
FT                   /locus_tag="JDM1_0403"
FT   CDS_pept        425686..426180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0403"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61292"
FT                   /protein_id="ACT61292.1"
FT                   /translation="MIVDGRSACDFEILGGPNMDDLTTGVPVAIHLETQARQDDDTANY
FT                   ALDVDGQLVQMGDAFYLRYKEVNDDAPEPIPVTIKLAANGDVVLTRSAENRLRLHFSNG
FT                   KRVRAHYQTPMGMLPVETVTPMLRVRLRERPFSGEVNVDYDLYAGEQLLGNYKLRLQFT
FT                   A"
FT   gene            426225..426833
FT                   /gene="rpoE"
FT                   /locus_tag="JDM1_0404"
FT   CDS_pept        426225..426833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoE"
FT                   /locus_tag="JDM1_0404"
FT                   /product="DNA-directed RNA polymerase subunit delta"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61293"
FT                   /protein_id="ACT61293.1"
FT                   /translation="MELKQFDGQKKSELSLIEVAHAILSQHGDVMAFADLTNAVQSYLG
FT                   KSDEEIRERLSQFYTDLNIDGSFISLGDNMWGLRAWYPFESIDEAVIHTDDDEDEDRPK
FT                   RKKRKKVNAFLADAGDDDDVIDYDDDDPEDDDNYDDDDDQDDDTDDSASSKYDELAGVD
FT                   DTDDDVADETLPDGIEGQLSELNDDDDDDDYDDEDDESK"
FT   gene            427006..428619
FT                   /gene="pyrG"
FT                   /locus_tag="JDM1_0405"
FT   CDS_pept        427006..428619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrG"
FT                   /locus_tag="JDM1_0405"
FT                   /product="CTP synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61294"
FT                   /protein_id="ACT61294.1"
FT                   /translation="MTKYIFVTGGVVSSIGKGIVAASLGRLLKNRGLKVTIQKFDPYIN
FT                   VDPGTMSPYQHGEVFVTDDGTETDLDLGHYERFIDINLNKYSNVTTGKIYSEVLQKERR
FT                   GDYLGATVQVIPHITNAIKEKIMRAGTTTDSDIVITEIGGTVGDIESLPFIEALRQMKS
FT                   DLGSDNVFYIHTTLIPYLRAAGEMKTKPTQHSVKELRSYGIQPNMLVVRTEQPITREMR
FT                   NKIASFCDVEPEAVIESLDVKTIYSIPLNVQKQNMDQIVLDHFDVQAPKADMSEWIDLE
FT                   HHVQNLSRTIKIALVGKYVALQDAYISVTEALKHAGYTDDADIDLKKISAEDVTPENVE
FT                   ELLGDADGILVPGGFGDRGIEGKITAIKYARENDVPFLGICLGMQMASVEFARNVLGLK
FT                   DANSAEIDPKTPDNIIDLMADQEDVEDMGGTQRLGAYPCKLKPGTVAAKAYHNEEVVME
FT                   RHRHRYEFNNKYREAMAAKGMVFSGTSPDNRLVEVIELPKKRFFVASQYHPEFLSRPNR
FT                   PEGLFKAFIDAANQTGKVKA"
FT   gene            429086..430357
FT                   /gene="serS1"
FT                   /locus_tag="JDM1_0406"
FT   CDS_pept        429086..430357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS1"
FT                   /locus_tag="JDM1_0406"
FT                   /product="seryl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61295"
FT                   /protein_id="ACT61295.1"
FT                   /translation="MLNPKFVRNNPELVKTKLQTRKVDPAEVDEYLQLDQQNRDAITKV
FT                   EGLKKQKNQLTEQIGQSDPQSEAGQALIQQVKQLNGDIKSTEAAQTEVNDRLHYLAIRF
FT                   PNLPADDVPVGPDEDSNVEMRKHGDIPTFDFKPKAHWELGESLGILDFDRAAKVAGARF
FT                   VYYKDAGALLERAVYSFMLDLHTQKQGYHEIIPPYLVNAQTMYGTGQFPKFKEDVYTVE
FT                   SSGMTLIPTAEVPLTNYYANEILSEDQLPTYFTAMTPCYRSEAGSAGRDTRGLIRMHQF
FT                   HKVEMVKYCKPENSYDELEKLTDNAEEVLHELGLAYHVIKLSTGDTGFSSAKTYDVEVW
FT                   MPEQGVYREISSCSNCLDFQARRAMIRYRKSDGTVDYVHTLNGSGLAVGRTVAAILENY
FT                   QQADGTVKIPKVLQPYMHGMTEIK"
FT   gene            430709..431989
FT                   /gene="sdaC"
FT                   /locus_tag="JDM1_0407"
FT   CDS_pept        430709..431989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdaC"
FT                   /locus_tag="JDM1_0407"
FT                   /product="serine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61296"
FT                   /protein_id="ACT61296.1"
FT                   /translation="MTNIFKGWRKNDTFWMLSLFGTAIGAGVLFLPIGVGTAGILGIIM
FT                   ILILALPTTFFAHRGLSRFVLSAKNDGDDITDVVEQHFGFKIGLLFTIIYFFSIYPILL
FT                   VYSVSITNTVSKFITDQMHMQTPPRWLLSLVLVGILIGIARFGTSLITKVMSGLAFPFI
FT                   IVIVLFSFYLIPHWNGAILSTFSSSVSGGHLVGTLGNLWLLIPVMIFSFNHSPIISSFS
FT                   VAERKEYSGEGKDKVDKKISTILLSAETLMVIVAMFFVISCTLALTPDQILEAKNENVS
FT                   ILDYVATAFNNPIIKYVSPVIAFIAIAKSFLGHYLGTSEGLRGIIRKMEEKSNKTLSSR
FT                   TVSTIVDLVLLLSAWIVAWVNPSIMGMIETIIGPIIAFILFLMPMYAIHKSPKLQQYAG
FT                   KHSNVFVVVIGLIAVSGILFNIIKLFI"
FT   gene            432359..433012
FT                   /gene="sdhB"
FT                   /locus_tag="JDM1_0408"
FT   CDS_pept        432359..433012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhB"
FT                   /locus_tag="JDM1_0408"
FT                   /product="L-serine dehydratase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61297"
FT                   /protein_id="ACT61297.1"
FT                   /translation="MTVNYKSVFDIIGPIMIGPSSSHTAGACAIGRAANSIFQEKPTDI
FT                   VIHYYESFAQTHKGHGTDYAIISGILGFDPDDSRVPYAIGLARDQGINITFIEEPGDSP
FT                   INHPNTAIIDLKNDDKQVTVAGCSIGGGTIEIREIKMDGFDVKPKGPLPILLVQGGEND
FT                   HQHVTKQLADLTKVNDQQQYKTARGNLYEYDLDRRLKQDEIKKLAQGHANLVYL"
FT   gene            433031..433930
FT                   /gene="sdhA"
FT                   /locus_tag="JDM1_0409"
FT   CDS_pept        433031..433930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhA"
FT                   /locus_tag="JDM1_0409"
FT                   /product="L-serine dehydratase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61298"
FT                   /protein_id="ACT61298.1"
FT                   /translation="MYMSVAELVTAAKETKKPIYELMIEQEMETSQTSREEIWHTMGRN
FT                   LDVMEAAVNKGAAGDGVYSTTGLTGGEAVLLKKYRQKGHTLSGDTMMQAVQNAISTNEV
FT                   NASMGVVCATPTAGSTGTLPGVIFTLKDRMNLNRDQMIQFLFTAGAFGMVIANNAGIAG
FT                   ATGGCQAEVGSASAMGAAAAVEVAGGTPEQSAEALAMAISNLMGLVCDPVAGLVELPCV
FT                   KRNAIGVGNALIAADMALAGCTNKIPADEVIAAMDKVGKGLPKALRETGLGGLAATPTG
FT                   IRMKEKIFGRSTNSQVHA"
FT   gene            434081..434809
FT                   /locus_tag="JDM1_0410"
FT   CDS_pept        434081..434809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0410"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61299"
FT                   /protein_id="ACT61299.1"
FT                   /translation="MQKPLTAEQEYVREFIPFVDFLADILGPSSEVVLNDLLDLNHSVV
FT                   AIRNSHISHRQVGDPATDLALRTMKAGKAEKRDYLANYKGVSQGKHSLRSSTYFLRLDG
FT                   EIVGMICINTDDSALDDLQEQVLKVMASYKHLNSPTINQLKGTPANEKAHDTPVAPEHL
FT                   TTSITDLAREVTQAVCAKYGVSVEYLKQNEKLEIVRSLYHQGYFLLKDSVSEAAKVLKV
FT                   SDPSVYRYLQTVKDEDLQQD"
FT   gene            435391..435585
FT                   /locus_tag="JDM1_0411"
FT   CDS_pept        435391..435585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0411"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61300"
FT                   /protein_id="ACT61300.1"
FT                   /translation="MLTPNEIRRRLRRDLVTIAEAYQIGFESRLYTEAEYENLKQTLLQ
FT                   LRELNMKPQHMEQLLAING"
FT   gene            436126..437406
FT                   /gene="murA1"
FT                   /locus_tag="JDM1_0412"
FT   CDS_pept        436126..437406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murA1"
FT                   /locus_tag="JDM1_0412"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61301"
FT                   /protein_id="ACT61301.1"
FT                   /translation="MKKMIIHGGKRLSGELTIGGAKNSTVALIPAAILADTPVQFDTVP
FT                   HILDVHNLRLILESMNVHSTFENDVLTIDPTNIEESELPSHAIKSLRASYYFMGALLGR
FT                   FNRATVTFPGGDNIGPRPIDQHIKGFKALGANVVEENDSVFISTGTEGLHGARIFLDVV
FT                   SVGATINIILAAVKAHGTTTIENAAKEPEIIDLATFLNNMGAKIRGAGTDVIRIEGVPA
FT                   LHSRATHTIIPDRIETGTYLSLAASIGDGILLKNVIPEHMESFTAKLVEMGVDLQINED
FT                   SIYVPRSNDLDPIRVKTMTYPGFATDLQQPITPLLLRANGSSVVIDTIYPQRTQHVEQL
FT                   RKMGADIRVQDNLIVVGHSSHLQGAHVEAGEIRSGAALMIAGLAASGVTEISRADNILR
FT                   GYDRVIDKLHTLGADVEIAADEEVPEN"
FT   gene            437436..438728
FT                   /gene="rho"
FT                   /locus_tag="JDM1_0413"
FT   CDS_pept        437436..438728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rho"
FT                   /locus_tag="JDM1_0413"
FT                   /product="transcription termination factor Rho"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61302"
FT                   /protein_id="ACT61302.1"
FT                   /translation="MEKILTMHDLEQKTLKEIYNYAREYKISYYSQMNKKELSLAVLRE
FT                   QDKKRGFVQMEGVLEIISQEGYGFLRPINYGPSQEDIYISQSQIHRFGLRNGDYVAGQA
FT                   RPPRPNERYYGLMRVGTVNGKDPNEAKQRPHFPALTPLYPQRQIKLSTTAAVLATRLID
FT                   TFVPIGFGQRGLIVAPPKAGKTTLLKNIANGIVANYPDAKLIMLLIDERPEEVTDLERS
FT                   IKGEVVSSTFDQQPQNHVRVAELVLERARRLVEDKQDVIILLDSITRLTRAYNLVIPSS
FT                   GRTLSGGVDPTAFYKPKRFFGSARNIEEGGSLTILGTALVDTGSRMDDMIYEEFKGTGN
FT                   SELQLSRELAERRVFPALDLKQSSTRKEELLVSRKNLEPVWQIRRSMTGNALEYTEQLL
FT                   QFLKHTKTNTEFVRDLASLKFTGQSTRRSRR"
FT   gene            438855..439100
FT                   /gene="rpmE"
FT                   /locus_tag="JDM1_0414"
FT   CDS_pept        438855..439100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmE"
FT                   /locus_tag="JDM1_0414"
FT                   /product="ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61303"
FT                   /protein_id="ACT61303.1"
FT                   /translation="MQKGIHPDYHLVVFQDSTTGFKFISGSTATSAETVEWEDGNTYPL
FT                   IRVEITSDSHPFYTGKQKFTKADGAVDRFNKKYGLK"
FT   gene            complement(439233..440369)
FT                   /locus_tag="JDM1_0415"
FT   CDS_pept        complement(439233..440369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0415"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61304"
FT                   /protein_id="ACT61304.1"
FT                   /translation="METMVKNDLNQLMQQREDGPYIAIYLNTAVVLNDLNRRRLQFKQL
FT                   VNEAETQMAHHFPKTEFAPYATQLEQLINDNAFWLQHTGPQTGIITNSRDLHIFDLQYP
FT                   TDNHVSVNSMPAIRPVLADRQHQFDFDLLALNEDSMALYAQRDGSFVELDLPAEAPRTL
FT                   TEALGTEKRGGDLNFNASPVHGANYHGHNAKAEERDIDQRNYYQQVAQYVQAHSQKTRR
FT                   PLILMGLPHNQAVFRAVNKNPYLSQHLMINKSPKNLTVGAMQTATEPVQTMWHTQLADI
FT                   LLERYDQAKSRQLALADPFDMIKPALSGRIDTLIVAADANVAGSLPAADVQLNDPIAAP
FT                   DNLIDDLVDVVIAMNGQIRIIPADRMPVETAALAIMRY"
FT   gene            440568..441263
FT                   /gene="srtA"
FT                   /locus_tag="JDM1_0416"
FT   CDS_pept        440568..441263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="srtA"
FT                   /locus_tag="JDM1_0416"
FT                   /product="sortase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61305"
FT                   /protein_id="ACT61305.1"
FT                   /translation="MKSKQHPGLKWLGRGVFVLLVLVSLALIFNEQIKSWLVSSYSPTV
FT                   TAKTVKQNTKKKSDFNFSKVKSLDFQTVAKARMNKNAINVIGSIAIPSVDLYLPIGNGV
FT                   SNETLALAAGTMKANQKMGQGMAGHHMIKHGALFSPLYYKSKVGQMIYVSDAKKIYAYK
FT                   TSQRTFIKATDVQVIDDVPGQKLITLITCDKTGAGRLMIRGKYEQQWSFKSAPTQVQKA
FT                   FTSHFNNKY"
FT   gene            441372..441932
FT                   /locus_tag="JDM1_0417"
FT   CDS_pept        441372..441932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0417"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61306"
FT                   /protein_id="ACT61306.1"
FT                   /translation="MIALIIVAVVLVLIAIYVVIYNGLVKSRMYTQEAWSQIDVQLKRR
FT                   TDLIPNLVNTVKGYAKHEKSTLAEVISLRNQLTQVPSGDHQQAMAVSDQLTNSLKSIFA
FT                   LAESYPDLKANQEFGKLMEELTNTENKIAYSRQLFNSSAASYNMKLQQFPSNIIAGIHH
FT                   FKNVEFLTVPEAEKAAPTVSFED"
FT   gene            441944..442843
FT                   /gene="htpX"
FT                   /locus_tag="JDM1_0418"
FT   CDS_pept        441944..442843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htpX"
FT                   /locus_tag="JDM1_0418"
FT                   /product="heat shock protein HtpX"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61307"
FT                   /protein_id="ACT61307.1"
FT                   /translation="MLFEQISRNKRHTLYVMAAFVILLAVIGLAVGYVFFNSAIAGLLV
FT                   ALIAAVFYMVLMISQSTDIVMSMNHGRELHQADDDPELWHIVEDMALVAKVPMPRVFII
FT                   DDESPNAFATGNDPEHAAVAVTTGIQARLTREEMEGVIGHEMSHVRNYDIRLQTIALAL
FT                   TAAISLLVNWGMNAFWWGGGRRSRDNDRDGNGAQVLLMILAIVVIILAPLAASLVQMAL
FT                   SRNREYLADAGSVELTRNPLGLISALEKIDDSQPMQAADPSSAALYISDPFKAKKSWMH
FT                   LFDTHPPMADRITRLKNM"
FT   gene            442904..443692
FT                   /locus_tag="JDM1_0419"
FT   CDS_pept        442904..443692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0419"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61308"
FT                   /protein_id="ACT61308.1"
FT                   /translation="MRRLQRKYIYANLEKLDNLVFAYGIDQSDFVHGIKRLPANLVSLV
FT                   GVDDNEHAVNAHTGLNVINDENEIRRYLLQSHALPVKWLDYDEVGDLDFLTATEIAELL
FT                   YLGHMDRPIRSPFNYKLRNHYVFLEQRNGGIKVYFYYISAFSHILSAAIVRHTLAAYRG
FT                   RRMFMRSLSVPRVPEAILKQLVQLMPDGLFIYFDQSMVRQRQLLVPVHTETTGNEIEVF
FT                   DPARGGENRRTHHVATLTFNLNSGVWDLQVQDQAAFEEHL"
FT   gene            443914..445302
FT                   /gene="murF"
FT                   /locus_tag="JDM1_0420"
FT   CDS_pept        443914..445302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murF"
FT                   /locus_tag="JDM1_0420"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diamino pimelate--D-alanyl-D-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61309"
FT                   /protein_id="ACT61309.1"
FT                   /translation="MKMQVAEIAKAVQAVNAEQAWPDVNVTGVAFDSRKLQAGDLFIPL
FT                   MGANDGHQYIQSAIEHGAVATLWASDHADDVPEDLPVIMVADTLTALQQLGQYYLQKIN
FT                   PKVVAVTGSNGKTTTKDMIASVLSTQFNVTKTHANFNNQIGVPVTLLSMEPNTEVVVVE
FT                   MGMDHFGELDFLSRLVQPDVAVITMIGEAHIEFFGTRDRIADAKMEIVHGLKEDGTFIF
FT                   NGDEPLLQERAKEVSQHQRTFGLDDTNTLAGSDITTSRAQTQFKTSLWPDNTYTIPMMG
FT                   AYNVNNALAALLVADTFHIRPAAAQQAIASFVPTENRTEWLTGYRGEAILSDVYNSNPT
FT                   AARRVLAAFAAVPTKGQRIAVLGDMLELGDQSDALHMSLASELDPATIASVYLNGEHMR
FT                   ALAEVLQEKYPAGAVHYYQTDQQPQLIADLTATVSADDQVLLKGSHGIHLEKVLTALEA
FT                   APEK"
FT   gene            445557..447143
FT                   /gene="rhe1"
FT                   /locus_tag="JDM1_0421"
FT   CDS_pept        445557..447143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhe1"
FT                   /locus_tag="JDM1_0421"
FT                   /product="ATP-dependent RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61310"
FT                   /protein_id="ACT61310.1"
FT                   /translation="MKFTELGLSDSLLKAVNRAGYEEATPIQAETIPMVLEGKDVIGQA
FT                   QTGTGKTAAFALPILQRLDFDNHNIQALVVSPTRELAIQTQEEIFRLGKDERAKVQVVY
FT                   GGADIRRQIRNLKQNPQVIVGTPGRLLDHIRRGTVKLDHVKMLVLDEADEMLNMGFLED
FT                   IESIIKQVPDERQTMLFSATMPPEIKRIGVQFMKEPHHVKIKSKEMTADTVDQYYVKAK
FT                   EFEKFDIMTRLFDVQAPELTIVFGRTKRRVDELSKGLEARGYNAAGIHGDLSQQRRTQI
FT                   MRQFKAGKLDILVATDVAARGLDVSGVTHVYNYDIPQDPDSYVHRIGRTGRAGHKGVSL
FT                   TFVTPNEMEYLRVIEKLTKKRMLPLKPPTESEAFAGQLAAAEANVDSLVAKTSTEKYAD
FT                   QAAELLQKYDATDLVAALLNDLTKDDASAVPVKITPERPLPRHKGGGGNNRRGGYRGGN
FT                   RNRNNSHGNGRGGYSHNGRNRDRDRNGGRGDRKSNGYKGRSRDDNRSSNRNHDEGRKQS
FT                   SKRSYTIRTND"
FT   gene            448119..448481
FT                   /gene="acpS"
FT                   /locus_tag="JDM1_0422"
FT   CDS_pept        448119..448481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpS"
FT                   /locus_tag="JDM1_0422"
FT                   /product="holo-(acyl-carrier protein) synthase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61311"
FT                   /protein_id="ACT61311.1"
FT                   /translation="MIYGTGIDLTELSRIEAILAKGLRLPEKILTPAELAVFSRYPVKR
FT                   QIEFMAGRFSAKEAYSKAYGTGIGAAVGFQDIEILDNAQGKPEVTRHPFDGPAWISISH
FT                   TDTLVMTQVILERGNL"
FT   gene            448481..449608
FT                   /gene="alr"
FT                   /locus_tag="JDM1_0423"
FT   CDS_pept        448481..449608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alr"
FT                   /locus_tag="JDM1_0423"
FT                   /product="alanine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61312"
FT                   /protein_id="ACT61312.1"
FT                   /translation="MVVIGEHRHTQVTVDLQAIKTNISNEMAQKDELTELWAVVKANGY
FT                   GHGIIQVAQAAKEAGATGFCVAILDEALALRAAGFAEPILVLGITEPEYAPLVAEKDIS
FT                   LAVGTQDWLTTAAAILAANQVTTPLHVHLALDTGMGRIGFQTPEELATAVTTLRQPQSP
FT                   FDFEGIFTHFATADQADDTYFTHQLNNWKHLIAVVDELPRYVHVSNSATSLWHQACNGN
FT                   MVRFGVALYGLNPSGRELSAPYPLQPALSLTARLTFVKRLARGKSVSYGATYTAAQDEW
FT                   IGTVPIGYADGYERRLQGFHVLVDGEFCEIVGRVCMDQLMVRLPHEVPVGAKVTLVGTD
FT                   GARTISLQDIADYCGTIHYEIACGLAPRVPRVYID"
FT   gene            450009..450401
FT                   /locus_tag="JDM1_0424"
FT   CDS_pept        450009..450401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0424"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61313"
FT                   /protein_id="ACT61313.1"
FT                   /translation="MAAADIKRGDIFYADLSPVVGSEQGGMRPVLIVQNNVGNHYSPTV
FT                   IVAAITAKVQKAKMPTHVNINAAHTGIEKNSVVLLEQIRTIDKQRLKDRVTHLDDQTMR
FT                   RVDNALQISIGLADRTRRRPQRTFQS"
FT   gene            450694..452676
FT                   /gene="kup1"
FT                   /locus_tag="JDM1_0425"
FT   CDS_pept        450694..452676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kup1"
FT                   /locus_tag="JDM1_0425"
FT                   /product="potassium uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61314"
FT                   /protein_id="ACT61314.1"
FT                   /translation="MSKQAQFNKHRVAGLLVAMGVVYGDIGTSPLYVMKAIITGQGGMQ
FT                   AVDEKFMLGAVSLVFWTMTLLTTVKYVLIALNADNRGEGGIFSLFALVRHRARWLVIPA
FT                   MIGGAALLADGALTPAVTVTTAIEGLRDVPAYVQLFGASQNTIILITLGIITLLFMLQR
FT                   FGTNTIGKLFGPIMLGWFTFLGVSGFVNLVQDWTILRALNPYYAWLLLISPANKVGILI
FT                   LGSVFLATTGAEALYSDLGHVGKTNIRLSWPYVKVCLLLSYFGQAAWILGPGQAIQGHV
FT                   NPFFAMLPASLTMAAVIFATLAAIIASQSLISGSFTLVSEAIRLKLFPRLLTTYPGKAV
FT                   GQMYLPVVNWGLWGVTSMLVIFFQTSERMEAAYGLAITLTMLMTTTLIYAFLRQKRLPL
FT                   IGAGLLTGFFATIEVIFLIASAAKFWHGGYVAVGLALLIFLVMAVWYRGEQIVRQHNHP
FT                   LSLRQYQDQLAKLRDDQTVDKFQTNVVFLTSRMDGDQVERKVLYSILDKWPKRADVYWF
FT                   VNVTITDEPYTAEYTVDTLATDYLVTVKLYLGFRVRQDINRYLRTIVRDLMATGRLAAQ
FT                   KQTYSVTSGRDVGDFRFVIIEEKLENGSRLSRLDRLVIETKLMIKKYATTPAKWFGLEF
FT                   SEVTLETVPILFNEIPALPITERQR"
FT   gene            complement(452783..455845)
FT                   /gene="carB"
FT                   /locus_tag="JDM1_0426"
FT   CDS_pept        complement(452783..455845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carB"
FT                   /locus_tag="JDM1_0426"
FT                   /product="carbamoyl phosphate synthase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61315"
FT                   /protein_id="ACT61315.1"
FT                   /translation="MPKNNAIHSIAVIGSGPIKIGQAAEFDYAGTQACLSLKAAGYHVI
FT                   LINSNPATIMTDTATADEVYLEPLTLTSVTKILRATHPDALLPTLGGQTGLNLAMALDQ
FT                   AGVLNELKIQLLGTSLATINQAEDRAAFKTLMKRLHQPIPASTTVHHVTSALSFAEKIG
FT                   YPVIVRPAFTLGGSGGGIANNAAELTQTLQRGLTMSPVTECLIEQSIAGFKEIEFEVMR
FT                   DNQGTKIIVCSMENFDPVGIHTGDSIVYAPVQTLTDTEYQQLRTAALTIVEALDIRGGC
FT                   NVQLAQDPNSRQYYVIEVNPRVSRSSALASKATGYPIAKIAADIAIGLNLSEIKNPVTQ
FT                   TTYAAFEPALDYVVAKIPRFAFDKFPTADAHLGTQMKATGEVMAIGSTLEEATLKAIAS
FT                   LEIDPKTQASLTPDHHVTTTEYIDQLTHPTDQRLFYLLAALQAGWPLAKLATLTQITPF
FT                   FLSKLQHIAQLIRNIKQVPTSQHLLSAKKYGVSLATMAHYAQTSVATIAAMTADLPFVY
FT                   KMVDTCAGEFASVTPYFYSTAFGQTNESHPLGHSILVLGSGPIRIGQGIEFDYTTVHCV
FT                   KAIQQAGYHAIIVNNNPETVSTDFSTSDKLYFEPLTIERLMPIIALEQPAGVIVQFGGQ
FT                   TAINLAHQLTKLGVTVLGTSVSATDLTEDRQSFADCLRLLKIAQAAGTTVTELSGARQA
FT                   AHAIGYPLLVRPSFVLGGRAMAIVHNDHELTPVIKSAVAAGHGAPILMDQYLAGTECEV
FT                   DVLSDGTSCFIPGIMEHIEGAGVHSGDSITVYPPQHLSPAVQDKIVTIATKLAQHLHCV
FT                   GMMNIQFVVTDDVYVIDVNPRASRTVPYMSKVTHLPLAQLATRLILGQSLATLGLVPGL
FT                   LTPAPQQIAIKAPVFSFNKLPQSPVVLSPEMKSTGETLGIGPTFTTAWHAAMADSYHLE
FT                   TWQTVDGLITDIATVAQPAVQELFAANHLTVTTIANTTDWPAKTKAVGFTLNDQPDNPV
FT                   AIAALNHGQPLITAIDTLKTLLAVTPTPATI"
FT   gene            complement(455838..456905)
FT                   /gene="carA"
FT                   /locus_tag="JDM1_0427"
FT   CDS_pept        complement(455838..456905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carA"
FT                   /locus_tag="JDM1_0427"
FT                   /product="carbamoyl phosphate synthase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61316"
FT                   /protein_id="ACT61316.1"
FT                   /translation="MNKYLTLADGTQWIGTAIGDCQLEVAGRIVFNTGMTGYQETLTDP
FT                   SYLNQMIAFTYPLIGNYGIDPTVAQAPTIGAQAIIVHELTTFNDHYTSRQSLASFLTIH
FT                   HVAGIEGVDTRDLTIHIRQTGAQMAILSNHPITDFEAQLATFAPQVLTATPLPVATTTI
FT                   RPRVAILNFGEKAAITAELQARGADVVVLPPTASLKAVAAYHPDGILLSNGPGDPTDYH
FT                   TYLATIRQLAQRYPLAGICLGHQLIALAYGAQTYQLSFGHHGLNHPVQACADGRIIMTS
FT                   QNHDYAVDPASIKGTPLIVTHTELNDGSIEGLRLPHQAVMSVQFHPEAHPGPQEAGQFF
FT                   DDFLLTIQKEAVVNA"
FT   gene            457173..458198
FT                   /gene="argC2"
FT                   /locus_tag="JDM1_0428"
FT   CDS_pept        457173..458198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argC2"
FT                   /locus_tag="JDM1_0428"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61317"
FT                   /protein_id="ACT61317.1"
FT                   /translation="MQVALVGVTGYSGMVLYRLLKQHPEIDRIQLYGHVGATTVALKTV
FT                   AAMYQKETAVIRPFDATAIMRDNAIVFFATSAGITRQLALPFIAAHFPVIDLSGDFRLH
FT                   DPEQYQRWYQRDPAPATALAQASYGLADMPAPLSTYIANPGCYATATLLGLAPLAQQQL
FT                   VEPTSIVVDAKSGLSGAGKRATAASHYVAVNDNLSLYKLNQHQHIPEMMQQLQQWWSAI
FT                   SAIEFTTTLIPATRGIMTTIYAKAKSALTTTQVRAAFTATYHEQPFVQVLPTGMPTLKD
FT                   VVGSNNCALGVDYNPVTNTIVVVSVIDNLMKGAAGQAVQNFNRYFDFAVTAGLPTLPVF
FT                   P"
FT   gene            458223..459437
FT                   /gene="argJ"
FT                   /locus_tag="JDM1_0429"
FT   CDS_pept        458223..459437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argJ"
FT                   /locus_tag="JDM1_0429"
FT                   /product="bifunctional ornithine
FT                   acetyltransferase/N-acetylglutamate synthase protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61318"
FT                   /protein_id="ACT61318.1"
FT                   /translation="MQMQVLTNTKFETVAFQWPAGFYSDGIHIGLRRHKKDFGWLFSKV
FT                   PASAAGTYTTNQFQAAPTKLTKQMIDQGHQLQGLLLNSAIANSCTGEQGWQNALQEQAW
FT                   LANKLNVAPNLIGVASTGLIGAQLPMDKIKNGLPQLTPTKSDAVTYAVLTTDQHPKTVC
FT                   VQCELSGQLVTLTGFAKGSGMIHPKMATMLGFVTTDAQIDGPVLQDMLSTNVDQTFNQI
FT                   TVDGDTSTNDMVVTLANGLADNPSLQAGTTDYDIFNQALHYVLGQLAKQIAADGEGATK
FT                   LVECNVVHAATTFDGQQIAKAIVGSNLVKAAIFGEDPNWGRIISTIGATDADIDVATVD
FT                   IEMNGVLLVQQSLAVDFDMAAVQATLRDNQIMIDVDLHHGTASGQAWGCDLTYNYVKIN
FT                   ASYHT"
FT   gene            459453..460199
FT                   /gene="argB"
FT                   /locus_tag="JDM1_0430"
FT   CDS_pept        459453..460199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argB"
FT                   /locus_tag="JDM1_0430"
FT                   /product="acetylglutamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61319"
FT                   /protein_id="ACT61319.1"
FT                   /translation="MTKLIVIKIGGQAISQLSTTFFDQIAQWYQQQYQILIVHGGGPMI
FT                   NRLTTQLALPVHKVNGLRVTDAATLVLTKLALLGDAQPALLAKLTQHHLPVLGLNAADN
FT                   QLLTGELIDYRQLGYVGRLTAVNQVQLMQLLAHHIGILAPLALTETGQWLNVNADMAAT
FT                   VLAQQLHAEKLVLLTDVPGIIHHGNVMTSLSPQQAQQLIRTAVITAGMQPKVQAAIAAI
FT                   QTGVKQAIITNAIDQPGTAIIQEVAV"
FT   gene            460196..461365
FT                   /gene="argD"
FT                   /locus_tag="JDM1_0431"
FT   CDS_pept        460196..461365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argD"
FT                   /locus_tag="JDM1_0431"
FT                   /product="acetylornithine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61320"
FT                   /protein_id="ACT61320.1"
FT                   /translation="MTMQHVFPTYQRFPFAITDGQGVHLTDNHGKTYLDFTAGIGVCNF
FT                   GYHQPQIQAAVTQQLTHIWHTSNLYENELQDAVAGLLANGEERLVYFANSGTEANEAAL
FT                   KLARKYTGKTGILAFQHSFHGRTYGAMSMTGNPHIQAGYAPLVPGITFATYNDDAALDK
FT                   ITPELAAVILEVVQGEGGVFAGQTAWLQAVNAKCQATGVLLIIDEVQTGIGRTGYRMAY
FT                   EGYGLDPDIYTVAKGLANGLPVGAMVGRRQLATAFGPGSHGSTFAGNAVAMAAAKRVLT
FT                   QLTPALLTTVRAHAKLVWQSLATQVEPIPVVKQITGKGLMIGIHLDEQIPVNQVITRLQ
FT                   VEGLLTLSAGDNTLRLLPPIVMQPADLLAGIALIAKVLTTLTTEVTTNE"
FT   gene            461358..462380
FT                   /gene="argF"
FT                   /locus_tag="JDM1_0432"
FT   CDS_pept        461358..462380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argF"
FT                   /locus_tag="JDM1_0432"
FT                   /product="ornithine carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61321"
FT                   /protein_id="ACT61321.1"
FT                   /translation="MNNQFEGRSFLKEIDYTPTELAYLIDFASHLKTLKAHHIPHPYLQ
FT                   GKNIALLFEKTSTRTRSAFTVAANDLGANPEFLGKDDIQFGTKESVVDTAKVLGSMYDG
FT                   IEFRGFKQSTVEDLATYSGVPVWNGLTDEWHPTQILADFLTLKEHFGHLKGLTLAYVGD
FT                   GRNNMANSLLVAGAMLGINIAIGAPVALQPAPAVVALAQQYAQAAGSTVVITADPQQAV
FT                   TQADALYTDVWVSMGEQVDYGERIKQLLPFQINTTLLAATGKSSTIVMHCLPALHDLKT
FT                   QLGAKLGEQYGMTAFEITDDVFQSKQAVVFEEAGNRMPAIKAVMAATLGNLFIPTSIFN
FT                   "
FT   gene            462489..462995
FT                   /locus_tag="JDM1_0433"
FT   CDS_pept        462489..462995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0433"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61322"
FT                   /protein_id="ACT61322.1"
FT                   /translation="MTQSKIRPWIINALVAAMYVVLCLGPAAFSLASGAIQFRVSEGLN
FT                   HLAVFNRKYIWGIVAGVILFDAFGPGASLLNVLFGGGQSLLALLVLTWLAPKLKTVWQR
FT                   MLLNIALFTVSMFMIALMITMMSSGVAFWPTYLTTALSELIIMSITAPIMYSLDRVLHF
FT                   SDRIQ"
FT   gene            complement(463273..463911)
FT                   /locus_tag="JDM1_0434"
FT   CDS_pept        complement(463273..463911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0434"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61323"
FT                   /protein_id="ACT61323.1"
FT                   /translation="MLLKTLVKPKERLVTITADATLEDALKVLEDSGFRCIPILDETGH
FT                   IFRGNIYKMHIYRHKSRGGDMSLPVTTLLKNATKTIQVDSAFYNIFFSIKDLPYIAVLD
FT                   EHGYFYGILTHTRLLDMLSQSWNVNVGSYVLTVVSVGERGDLAAMAKIITKYTSIAGCL
FT                   TLDVQNGTLGYRTLFTLPENVDSEKLKRIIDNLNRKQFKVIEVEDLQAE"
FT   gene            complement(464066..465460)
FT                   /locus_tag="JDM1_0435"
FT   CDS_pept        complement(464066..465460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0435"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61324"
FT                   /protein_id="ACT61324.1"
FT                   /translation="MKHKRGLMIGGSILGLLVIGYVATSLIWQHQQTFLSNTSVAGVDV
FT                   SGKTAAQAAPKVNRALEHRTYRIIENGQTKYSFTSKSAGITINTKKDLTKLVTKQNYWR
FT                   WPLALLQSAQADDSSAVGQLTINHTDLKTLLQKITTTANQTKRTKTENAKLVYQHNQVE
FT                   IKKEVQGTELDQAKLKTVVTKAISNGDSHITLKDAYVTPTVTSTSASLKTAKAKSAKYA
FT                   TEKATYNINGHKFTIPHDLILSWIKVDKQGKVSLDQNAVLTYVKQLNDKYHTYHTTRQF
FT                   KSTARGTVSVSGGFYGWTIKTEAEAKALATEILKGKDFTRSPITSGSGYNNKGTDIGNT
FT                   YVEVDKENQHMYVYVDGKLKVSTDIVTGKPGKHATTTGVWYIWNKEKNATLKGDNDDGS
FT                   SYSQPVSYWMPFDDTGEGIHDSSWQTQYGGTWYKKHGSHGCVNTPPSVMKKVFAAVPVG
FT                   TPVIVF"
FT   gene            complement(465679..466641)
FT                   /gene="ldhL1"
FT                   /locus_tag="JDM1_0436"
FT   CDS_pept        complement(465679..466641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ldhL1"
FT                   /locus_tag="JDM1_0436"
FT                   /product="L-lactate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61325"
FT                   /protein_id="ACT61325.1"
FT                   /translation="MSSMPNHQKVVLVGDGAVGSSYAFAMAQQGIAEEFVIVDVVKDRT
FT                   KGDALDLEDAQAFTAPKKIYSGEYSDCKDADLVVITAGAPQKPGESRLDLVNKNLNILS
FT                   SIVKPVVDSGFDGIFLVAANPVDILTYATWKFSGFPKDRVIGSGTSLDSSRLRVALGKQ
FT                   FNVDPRSVDAYIMGEHGDSEFAAYSTATIGTRPVRDVAKEQGVSDEDLAKLEDGVRNKA
FT                   YDIINLKGATFYGIGTALMRISKAILRDENAVLPVGAYMDGQYGLNDIYIGTPAVIGGT
FT                   GLKQIIESPLSADELKKMQDSAATLKKVLNDGLAELENK"
FT   gene            466973..467530
FT                   /gene="pth"
FT                   /locus_tag="JDM1_0437"
FT   CDS_pept        466973..467530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="JDM1_0437"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61326"
FT                   /protein_id="ACT61326.1"
FT                   /translation="MKMIVGLGNIGRQYAQTRHNVGFMIVDELASKLNVTFQTSKFEAQ
FT                   VATAFQDGEKILLVKPATYMNDSGRAVGPLMSYYNVDPADLLVIHDDLDLPLGKVRLKQ
FT                   KGSAGGHNGIKSIISHVGDQHFKRVKVGIDHPQKMSVVDYVLGKFTPAEVAKFDDAKIT
FT                   ALAAVEAWLANDDFAAVMNQYN"
FT   gene            467550..471077
FT                   /gene="mfd"
FT                   /locus_tag="JDM1_0438"
FT   CDS_pept        467550..471077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mfd"
FT                   /locus_tag="JDM1_0438"
FT                   /product="transcription-repair coupling factor"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61327"
FT                   /protein_id="ACT61327.1"
FT                   /translation="MDIETIVEQTPDFQTILAGISPRSRQLITGLNGSARTVYLSALFH
FT                   QLTHSLLIVTDNGFHASQLVDDLTSLLDEDQVFLFPAEEMITTEVATSSPESRAQRVQA
FT                   LNALLRDSPAVVVTSVAGARRFLPPVAQFQAATLPVAVGQDIDLEDLQRQLHDMGYVKE
FT                   KLVARPGDFAVRGSIVDIYPLDADYPLRLDFFDTEVDTLKYFDPETQRSVENLDEYTIL
FT                   PATDFILTSAMLQAGAQRLKTAIAAESKKLKPAERQTLADNLAQPLADMEKGIIGNDLL
FT                   LYGDYLYDRKTSIFDYVAADGLVIFEEYSRLLDSEQQLLTQEADWVTDQLAHHRVLATA
FT                   SYGNDIRDLLRDDQHAQLLISLFQKGIGNVKLAQVTNVRTRPMQEFFGQLPALKTELDR
FT                   WHKLKQTVVLMVSEAERLTKVSDTLDDFEIEAVMTKATNLQPGAVQIVQGSLQNGFEFP
FT                   DGKLVIVTEQEMFKKVAKKRPRRQTLANAERLKSYTDLKPGDYVVHVNHGIGKYVGMET
FT                   LEVDGVHQDYITIAYQNNAKIFIPVTQLNLVQKYVSSESKTPRINKLGGTEWTKAKRKV
FT                   AAKIEDIADELVDLYAKREAEKGYAFPPDDSYQDDFDNDFPYPETPDQIRSINEIKHDM
FT                   ERPKPMDRLLVGDVGYGKTEVALRAAFKAIEAGKQVAFLVPTTILAQQHYETMLNRFEG
FT                   YPINVGMLSRFRTTKEMKETVQQLKSGEIDIVVGTHRLLSKDVAFADLGLLIIDEEQRF
FT                   GVKHKERLKALKASVDVLTLTATPIPRTLHMSMLGVRDLSVIETPPTNRYPIQTYVMEQ
FT                   NFGVIKEGIEREMQRNGQVFYLHNRVHDIDKVVAQIKDLVPDAAVAHIDGQMPESQLEG
FT                   ILYDFIRGEYDVLVTTTIIETGVDIPNVNTLFVENADRMGLSQLYQLRGRIGRSSRVAY
FT                   AYFTYQQNKVLTEVGEKRLQAIKDFTELGSGFKIAMRDLSIRGAGNLLGKQQHGFIDSV
FT                   GYDLYTQMLSEAVAKKRGQAAKVKTDATVELGIEAYLPTSYIEDERQKIEIYKRIRQLE
FT                   NNDQYMEVQDDLMDRFGDYPVEVAGLLAVGKLKLLADDALIEKIQRDDSELHLTLSKQG
FT                   TAKLDTKDIFKALAKTKLKATVGIDDDKMKVKLVIQPKMQQDEWLAQLTQFVEQLSLIL
FT                   AEDDVASAS"
FT   gene            471252..472856
FT                   /locus_tag="JDM1_0439"
FT   CDS_pept        471252..472856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0439"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61328"
FT                   /protein_id="ACT61328.1"
FT                   /translation="MPKDHLNTVFKGALILSISSLVAKILSAVYRIPLQNMVGNTGFYV
FT                   YQQIYPLYGIGMTFALNGFPNFISKLVAEQPDETSKSLIARRAFHILSGLSLVVFFGLQ
FT                   LGATWIAAHMGDVNLAPIISAVAWMFVFMPWLATGRGYYQGKFLMGPTAVSQLIEQVVR
FT                   VAIIIMAAYFSVRLGWDNYRMGTWAMSSAPLAAICSSLIFTVFGLRYLLAPAPAPTHPL
FT                   PSYRKLTKRFVIEGGTLCLVAAVVILLQLVDSFTVMRGLVHQGQLPEVAKALKGVYDRG
FT                   QPLVQLGLVVATAFSATLLPALTDALAKRQPIEFKRQTQAMVHVSLALSMAATVGLVAL
FT                   MPQINRLLFGSLEGTTALRIYIISILFAALITTYTSVLQSLNEYTAMIIGIIAGLATKV
FT                   LANYIFVVHYGINGASAVTVLSLAVMFAVMWLGSPEDLQQVLLESGYLIKLLALSAVMG
FT                   IVVILSCHQITALVGPILANTRGMAGIITVIGVLIGVLVFVAGAVYARLFTIREWLVLP
FT                   YGKRLIKAVAKGKEHHS"
FT   gene            472853..473140
FT                   /locus_tag="JDM1_0440"
FT   CDS_pept        472853..473140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0440"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61329"
FT                   /protein_id="ACT61329.1"
FT                   /translation="MSMRLDKFLKVSRIIKRRSVAKEIADKGRIQINGKVAKSSSNVSV
FT                   DDELIISFGNKTLTVKVTQLLETTKKNDAELMYDIISEDYKTDYRQPFSD"
FT   gene            473261..473659
FT                   /locus_tag="JDM1_0441"
FT   CDS_pept        473261..473659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0441"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61330"
FT                   /protein_id="ACT61330.1"
FT                   /translation="MTNGSRNKIKQLDNDYIRQVATDEHGQAQRVAQVRRRRFILIVAV
FT                   FGALILFFGFQLINTRSNLHQVNRQVATSQVKLKKVQQKNNQLESQIKQLNNKDYLQKL
FT                   LRSKYDYTKSGETVYSLPNDNAADVTAN"
FT   gene            473784..474323
FT                   /locus_tag="JDM1_0442"
FT   CDS_pept        473784..474323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0442"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61331"
FT                   /protein_id="ACT61331.1"
FT                   /translation="MAIEVGTKVTGKVSGITNFGAFVNLGNNQTGLVHISEVSDGFVKD
FT                   IHDVLSVGDDVTVKVLSVGDDGKIGLSIRKAVDKPQGEHEHHGNHQGGNRPNNHQGNNH
FT                   GHGERQSNGNHHDRSNNFHSRGGNGGGRYQSRQHEPKKQDFDSLMSGFLKDSEDRLATL
FT                   KRNTEGKRGGRGGRRS"
FT   gene            474607..475953
FT                   /gene="mesJ"
FT                   /locus_tag="JDM1_0443"
FT   CDS_pept        474607..475953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mesJ"
FT                   /locus_tag="JDM1_0443"
FT                   /product="cell cycle protein MesJ"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61332"
FT                   /protein_id="ACT61332.1"
FT                   /translation="MTPIQKFNRQLAAAKLLSPQQTVVVAVSTGVDSMVLLHLLQRLPA
FT                   AERPRVVVAHVNHHLREQSQMEADYLRQYCQQQNLKLVMADWLPAAHPKSGIEAAGRQF
FT                   RYHVFAKVMRENRATAVLTAHHANDQVETYLMKLARGGDISQLTGIATSRPFATGRLIR
FT                   PLLTWSKDQLRNYAAEQHVVYFEDVTNQDVALTRNRIRHRVVPELMTVNPQLLKHVADY
FT                   QQQLTTLLTAKKQMVTVLLSQVVTTTGALVVDQWGALPSQWQLAVFATWLEQQMQQLFT
FT                   ESKLQPLVSWGQRTRPATSRLTVNAAWELYRNAGIIEALPIKKRGKKLMPREKIMVDLN
FT                   QWQKITATQTVGIFTRVPNVVSQPFWLTEADWPLVWRPWQAGDRIVLKGGGHQLVRRLL
FT                   IDRKVPAERREQVQVLVNAQGNVLWVVGHKFSYRTTGTQTVFLALKHES"
FT   gene            475973..476515
FT                   /gene="hprT"
FT                   /locus_tag="JDM1_0444"
FT   CDS_pept        475973..476515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hprT"
FT                   /locus_tag="JDM1_0444"
FT                   /product="hypoxanthine-guanine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61333"
FT                   /protein_id="ACT61333.1"
FT                   /translation="MNNDIERVLYSREDIHQVAQKLGKELTTAYAGKNPLIICVLKGAV
FT                   LFTTDIIREMDIYADLDFINLSSYGNETISSGEVQLTKDLDADVTGRDVLVIEDIIDTG
FT                   RTLKFLIDLLKRRDVNSVKVCTLLDKPAGRLVDIKADYIGFEVPNEFVVGYGLDYAERY
FT                   RNLPYVGILKPAIYEHK"
FT   gene            476595..478832
FT                   /gene="ftsH"
FT                   /locus_tag="JDM1_0445"
FT   CDS_pept        476595..478832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="JDM1_0445"
FT                   /product="cell division protein FtsH, ATP-dependent zinc
FT                   metallopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61334"
FT                   /db_xref="GOA:C6VKW6"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6VKW6"
FT                   /protein_id="ACT61334.1"
FT                   /translation="MNNRRNGLFRNSLFYILMFLSLMGIIYFFFGGNSGSQTQNIRYSE
FT                   FVKQLDKNNVKNVSIQPSGGVYKVTGSYRKARTTSSANALGIKSASTKTTSFSTTMLEN
FT                   NSTVDQVSKLAAKHDVKVTAKAEESSGIWVTLLMYIAPVILMLFLFYMMMGQAGQGGGN
FT                   NRVMNFGKTKAKPADSKQNKVRFSDVAGEEEEKQELVEVVEFLKDPRKFVSLGARIPSG
FT                   VLLEGPPGTGKTLLAKAVAGEAGVPFFSISGSDFVEMFVGVGASRVRDLFEQAKKNAPS
FT                   IIFIDEIDAVGRQRGNGMGGGHDEREQTLNQLLVEMDGFTGNEGVIVMAATNRSDVLDP
FT                   ALLRPGRFDRKILVGRPDVKGREAILKVHAKNKPLAADVDLKEIAKQTPGFVGADLENL
FT                   LNEAALLAARRNKKQVDAADLDEAEDRVIAGPAKHDRVVNKHERETVAYHEAGHTIVGL
FT                   VLNDARVVHKVTIVPRGRAGGYAIMLPREDQMLMSKRDAKEQMAGLMGGRAAEEIIFGA
FT                   QSSGASNDFEQATQIARAMVTQYGMSEKLGPVELENANQQAAYQQGMGASAFSQHTAQL
FT                   IDDEVRRLSQEAHQTATDIIESHREQHKLIAEALLKYETLDEKQILSLFKTGKMPEKDS
FT                   NEFPSEKAATFEESKRELERREAEKHAQNQSADDKQADSADTTTNVSVAEPSFPSESDA
FT                   SSEVSADSSVNSTANSATESATDSDVATSATGLPNAESATPSSQDDTNSQA"
FT   gene            478981..479868
FT                   /gene="hsp33"
FT                   /locus_tag="JDM1_0446"
FT   CDS_pept        478981..479868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsp33"
FT                   /locus_tag="JDM1_0446"
FT                   /product="heat shock protein HSP33"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61335"
FT                   /protein_id="ACT61335.1"
FT                   /translation="MADYLVKSVAGNEMFRAYAVSATGVVAEAQRRHDTWSAASAALGR
FT                   SLVGTLLLASSVLKGEEQMTVKINGNGPVGGIVVDGNAKGTVKGYLQHPHVHLPLNDKH
FT                   KIDVKAAVGTDGFLSVTKDQGVGDPFTGTVALVSGELGEDFTYYLAQSEQIPSAVGLSV
FT                   FVNDDNSIGVAGGFLVQVLPNATDEAISSLENKLKDMPLVSQLMRDGKSPEDILDLLFD
FT                   GDVKVLDKMPVKFECDCSKERFAEALMALPKHEVQAMIDEDHGATAVCHFCGDQYQFSE
FT                   RELEAVLSRSKGDA"
FT   gene            479868..480875
FT                   /locus_tag="JDM1_0447"
FT   CDS_pept        479868..480875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0447"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61336"
FT                   /protein_id="ACT61336.1"
FT                   /translation="MNQEWQIGDVTIPNRVVVAPMAGVTNAAFRVICKDFGAGLVVCEM
FT                   ISDRGIMYHNRKTLEMMFVDPKEHPMSIQIFGGSKATLVQAAQFVDQQTNADIIDINMG
FT                   CPVNKVVKTDAGAKWLLSPDKVYEMVAAVTAAVNKPVTVKMRTGWDAEHVYAVENARAA
FT                   ERAGAAAVAMHGRTRKQMYQGHADWDVLKRVADALTIPLMGNGDVQTPQDAARMLDEVG
FT                   ADAVMIGRAVEGNPWMLTQTVHYLATGELLTPPTPMAKMQTAMEHLQRLVVLKGERGGC
FT                   HEFREQAPYYLKGIPRSARTKVALMEASSLAEMMRILTQFQEQTATYLASHAVK"
FT   gene            480979..482478
FT                   /gene="lysS"
FT                   /locus_tag="JDM1_0448"
FT   CDS_pept        480979..482478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="JDM1_0448"
FT                   /product="lysyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61337"
FT                   /protein_id="ACT61337.1"
FT                   /translation="MARQEQTMNDQLKVRREKMDELREEGIDPFGHRFERTDLAQDLQD
FT                   KYGDMDKDELDAKQVVATIAGRMLAKRGKGKVGFADIWDRSGKMQLYIRKDVVGEDTYH
FT                   IFKRSDIGDFLGITGQVFKTDFGELTIKVTGLTFLSKALRPLPDKFHGLQNVEQIYRQR
FT                   YLDLISNRDSFDRFLKRTKIISAIRHHLDDQGFTEVETPMLHNQAGGAAARPFVTHHNA
FT                   LNIDLYLRIALELHLKRLIVGGMEKVYEIGRVFRNEGMDREHNPEFTMMETYVAYFDFH
FT                   DVMAETEGIFKAAAQAVTDDGIVTYHDQKVDFNQPFKQIHMVDAIKEKTGIDFWQPMSI
FT                   EDAQKLADEHHVKYEPYWKVGHIINAFFEEFVEDTLNEPTFVYGHPVEISPLAKKNEED
FT                   PRFTDRFELFILGNEYANAFSELNDPIDQRQRFEAQAAERTAGNDEAEHIDEDFVEALE
FT                   YGMPPTGGLGIGIDRLVMLMTDADSIRDVLLFPTMRPEEDK"
FT   gene            482642..484312
FT                   /gene="isp2"
FT                   /locus_tag="JDM1_0449"
FT   CDS_pept        482642..484312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="isp2"
FT                   /locus_tag="JDM1_0449"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61338"
FT                   /protein_id="ACT61338.1"
FT                   /translation="MQDYYNMNQTTLSIALDYQPEEHHSARYINQLVESLKLKYDYQFG
FT                   RPREYNLGAMLKLVLLAYSYGIFSSRKIERFARENKPAGWLIADQIPSYRTICRFRISD
FT                   ELATLTTDSLSQLTQYLRQNGMIDDVSFIDGTKILADANKYSFVWKKNTIRFDKMNREK
FT                   LVDLLGELHEAKIVGEIPAGSELTPELLDIMISKVEDHLVVLNETVEATKQVSPNPAKQ
FT                   QRRTVKSQKRKLDKRRDKMREHQAQQAIYDQRNSYSKTDHDATFMRVKEDPMQNGQLKP
FT                   AYNVQIATSNQFITGYRLFQNPTDTRTLQPFIEHLKANNVLGHTIVADAGYGSESNYRY
FT                   LEDEFGQHTVLIPYGTMLKENSRKWQSDDRKVMNWDYHEKDDYFINPQNVRFNFNAYRQ
FT                   RTDKYGFTRDFKEYIAEKYDENHQLISAALTPKGYLKRISVNENWEYFKSKQRELLSAP
FT                   ETGQIYAQRKIDVEPVFGKMKASLHFNRFSVRGFDKVTKEAGIVILALNIMKLVTVGTN
FT                   FKNQRRKQMGRETKIRFLVPFAYTEASYVTASFLLGQIE"
FT   gene            484838..486408
FT                   /locus_tag="JDM1_rRNA01"
FT   rRNA            484838..486408
FT                   /locus_tag="JDM1_rRNA01"
FT                   /product="16S ribosomal RNA"
FT   gene            486614..489533
FT                   /locus_tag="JDM1_rRNA02"
FT   rRNA            486614..489533
FT                   /locus_tag="JDM1_rRNA02"
FT                   /product="23S ribosomal RNA"
FT   gene            489604..489722
FT                   /locus_tag="JDM1_rRNA03"
FT   rRNA            489604..489722
FT                   /locus_tag="JDM1_rRNA03"
FT                   /product="5S ribosomal RNA"
FT   gene            489727..489799
FT                   /locus_tag="JDM1_tRNA03"
FT   tRNA            489727..489799
FT                   /locus_tag="JDM1_tRNA03"
FT                   /product="tRNA-Asn"
FT   gene            489845..489917
FT                   /locus_tag="JDM1_tRNA04"
FT   tRNA            489845..489917
FT                   /locus_tag="JDM1_tRNA04"
FT                   /product="tRNA-Thr"
FT   gene            490560..492032
FT                   /gene="dtpT"
FT                   /locus_tag="JDM1_0450"
FT   CDS_pept        490560..492032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dtpT"
FT                   /locus_tag="JDM1_0450"
FT                   /product="di-/tripeptide transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61339"
FT                   /protein_id="ACT61339.1"
FT                   /translation="MDKEQKLDRSFFGQPRGLRTLFFTEMWERFSYYGMRALLIYYMYY
FT                   SVAKGGLGFDQVTAASIMSIYSALVYVSSVLGGFLSDRVWGSRKTVFIGGVFIMLGHIV
FT                   LSTPFGVGALFVSIALIVIGTGLLKPNVSDMVGQLYTVEDTRRDAGFSIFVFGINLGSL
FT                   VAPALVGRIGLNVNFHLGFSLAAIGMFFGLLQYYFDGKKNLSSASLYPTDPLEPGDLKK
FT                   IMRWTILGIVGIGLILLLMQLMNALTLANVISLISTLVILTPIVYFILMLTSDKTNATE
FT                   RSRVRAYIPLFIAAALFWAIEEQGSSVLALFAANRVNLDLGFTHLAASDFQMLNPLFIM
FT                   IYTTPFVWLWTKWGKKQPSSPTKFAIGLLFAGASYLVMAVPGALFGTAGKVSPWWLVAS
FT                   WAVVEIAEMLISPIGLSVTTKLAPKAFASQMMSMWFLTDSVGSALNAQIVRFYSTQTEV
FT                   PYFAITGIVSVVLGIILFMMVPMIKRSMQGIR"
FT   gene            492087..492929
FT                   /locus_tag="JDM1_0451"
FT   CDS_pept        492087..492929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0451"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61340"
FT                   /protein_id="ACT61340.1"
FT                   /translation="MEGLTIVRIAFSSDNHFDVNRVDATAMMRSQATYLLQNGVQIYLI
FT                   AGDLFNDFQRSQQFVVDLQALLGAQTRVYWIAGNHDMVHGISFDELETGHFDGYLHNRY
FT                   IDISGTDWRVIGHNGWYDYQYAAQVPDTTAADFLHWKNAFWIDRAIKQPMSDQERTDLM
FT                   LNQVKAQLNLAAVDHKQVIFMTHFVPRIDYLRFSDDNRFWNMANALMGTPRLGQLLEQF
FT                   NVAHVLFGHLHVHPQPRVFGQTTYYDQAVGYGLKRINEWQANNFMAEWYQDTQILDLK"
FT   gene            493005..493087
FT                   /locus_tag="JDM1_tRNA05"
FT   tRNA            493005..493087
FT                   /locus_tag="JDM1_tRNA05"
FT                   /product="tRNA-Tyr"
FT   gene            493097..493168
FT                   /locus_tag="JDM1_tRNA06"
FT   tRNA            493097..493168
FT                   /locus_tag="JDM1_tRNA06"
FT                   /product="tRNA-Gln"
FT   gene            493491..493949
FT                   /locus_tag="JDM1_0452"
FT   CDS_pept        493491..493949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0452"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61341"
FT                   /protein_id="ACT61341.1"
FT                   /translation="MTAIIIIMSRSYKSTPIFKAHMGYGKKRANHAVRNRMNRGEFDDL
FT                   PANSHAWYKRCYEQYDVVDYCSRETYSQVQLELETMRLEITRNGGIIRRIPQHLVVTYT
FT                   FDPVISDIVHMQRTEELIPAQDVQMFVGTFEQWCRERRNCWAKAYYRK"
FT   gene            494129..494653
FT                   /locus_tag="JDM1_0453"
FT   CDS_pept        494129..494653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0453"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61342"
FT                   /protein_id="ACT61342.1"
FT                   /translation="MAHIWMQRHLPARDDVVIKYMTSSQLFRIIRCLFNRTSKIEFVSV
FT                   KLNLRNHTIMNNVSDHDDDQGGFEMAVTKIDLKTTMTYREHAITSKSFARKLGIELPFA
FT                   MYAMAAGESISAEQSTLTRLFEVVDGTLTVRLATETDQEVHAGEMLVVPAHTVHTLVAE
FT                   QPCQFIQLETK"
FT   gene            494684..495019
FT                   /locus_tag="JDM1_0454"
FT   CDS_pept        494684..495019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0454"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61343"
FT                   /protein_id="ACT61343.1"
FT                   /translation="MSLINKIDHAKVLNLTEQIPLDDDQVNSRTLVQRDDLSMTLFSVA
FT                   TDQEIGGHSAQGDAMVNILSGEAEITIEGTIYHLTAGQSIVIPKDARHALYAVQGFQML
FT                   LVVVKPD"
FT   gene            495054..495896
FT                   /locus_tag="JDM1_0455"
FT   CDS_pept        495054..495896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0455"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61344"
FT                   /protein_id="ACT61344.1"
FT                   /translation="MPLYTFIGDIHSAADDLAVLLADPEVAATRLIFLGDYIDGTAARY
FT                   FGHATESAPLAPLKVLTMVRKRVREYGDVALLGNHDEFWLRTAHGDDNATATWVLNGGH
FT                   RTWRKLGIYSSNPNHVRRALNGALLKPDTDFLAHLPLMWQHGRLLAMHAGVNWQYPLTQ
FT                   QTTTDLLWIRDDYYDDFTTGSHRWHRNLFNKVIITGHTPVQTLTGSHTGYLKMQADAQD
FT                   VPRYLIDAGSRSGLFDGGICALTLTVDGEFVRAKRVIKGHRYDGQQIVTPAMLVDQAH"
FT   gene            complement(496055..497161)
FT                   /locus_tag="JDM1_0456"
FT   CDS_pept        complement(496055..497161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0456"
FT                   /product="cation transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61345"
FT                   /protein_id="ACT61345.1"
FT                   /translation="MVTVVRRTLHDKIFIIALICAGLSLFIGTPQLTAINWATIGTLFA
FT                   LMISVQLLRAMHLLDTLRDWLLVKSHDTRQMCQLFILLAFGGSMILTNDVAILTLIPIF
FT                   LTLARRQHLAIAYPATLIIMAANLGSAFTPIGNPQNLFLVTFYHVNLFTFFKLSTPLML
FT                   ASLALLVALSWRLPRLPLTVTPTKSTPISRSQIGLAGGLLSFIMLGIFNLVPISLVIIG
FT                   TIVVGLMINRRVFQYVDYALLLTFICFFIFVSAISHNPAITHWLNQLTQTAPSVYITGL
FT                   ITSQVISNVPAAILLANFTPHLSALFLGVNIGGLGSLVASLANLLALKQLLPFNDEQPL
FT                   HHFLIVFTALNGLGLFILGLGGWFYLHL"
FT   gene            complement(497354..498175)
FT                   /locus_tag="JDM1_0457"
FT   CDS_pept        complement(497354..498175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0457"
FT                   /product="transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61346"
FT                   /protein_id="ACT61346.1"
FT                   /translation="MNQNNHFRLTLSTLLQQCQQDITSLPTAMRAVFSWQRGLNELKTL
FT                   RRTTKLMMGTMLIVTIIGFILGRDYSLHGWIGLLTGITVVINLILVDQGRLTNYSWGII
FT                   ACAAWLTTAITNRLIGDIASQSFYLIMQFVGITVWHRKMAAQPDASELTGRKLSKLAGC
FT                   SWFALAILVYAIVLHFSKQLNGNQIYLDATLLPLGIVGSVLMVNGYRSQWVAWITLDVI
FT                   NVIIWFNQLKGFSPAAASMLALQLVMLANALYGAYLWFFGQNTQQDKLDTH"
FT   gene            498536..499327
FT                   /gene="proC"
FT                   /locus_tag="JDM1_0458"
FT   CDS_pept        498536..499327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="JDM1_0458"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61347"
FT                   /protein_id="ACT61347.1"
FT                   /translation="MKIGFIGAGNMGRAIIDGWLKQQAVVPADIYIHSAHAASYQPYAQ
FT                   KNGLQACDTNLAVAQAADVIVLAVKPNIALAALKEVQAALTGKWVITMVSGLSLADYAT
FT                   VVPDLPVLRIMPNVNVAIGAGMTALVGNDALTPEQYAAGQQLFDAIGATSAIAEKDFPT
FT                   FSALAGSSPAYIYFFIDAMARAGVKHGLSKDAATKIAAQATLGSAQNVLASDKIPFDLI
FT                   DQVSSPGGTTVAGLLAMEEAGFMTAVVKGIDATIAKELGES"
FT   gene            499406..500542
FT                   /gene="nagA"
FT                   /locus_tag="JDM1_0459"
FT   CDS_pept        499406..500542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagA"
FT                   /locus_tag="JDM1_0459"
FT                   /product="N-acetylglucosamine-6-phosphate deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61348"
FT                   /protein_id="ACT61348.1"
FT                   /translation="MSKVLKHAIIYTGLEKIDDGYIRFGKEIEAVGPMDDYVAQPDDDI
FT                   EFVSGKTIVPGFIDVHSHGGYSFDSMDGNPAEINEMVNDMVAREGITSYFCTTMTQSNE
FT                   NLDHSMAGINKAADENPVIQGVHLEGPFISATFKGAQPEKYIKNPNVDLLDNWNKLSGG
FT                   RVKLITYAPEDPGSREFEKYCLENGIVPSVGHSNATREQLLASKATHVTHLYNAQREFK
FT                   HREPGVTGHAMLENNMYCELICDGFHIVPDMIKLAYEQKGVDRIELVTDSMRAKGEPDG
FT                   ISELGGQKVIVKDGQARLEEGNLAGSVLTFINAFKNIQKFTGCGIAEAVKMASVNQARE
FT                   FGLTKKGTLEAGKDADINILDGNQDLVATYSYGKKAAK"
FT   gene            500557..501267
FT                   /locus_tag="JDM1_0460"
FT   CDS_pept        500557..501267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0460"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61349"
FT                   /protein_id="ACT61349.1"
FT                   /translation="MSTMSSPIYIQIHNQIKQAIEAGRWAVGDRIPSERELATQFDVSR
FT                   MTLRQAIQTLVDEGILERRVGAGTFVANQKVQEKMSGVTSFTDLMLAQGKVPSSKTISY
FT                   HVTSPSLSESEKLALGANEQVLRMERIRYGDDVPICFEVATVPERLVKQFTKDEITSSL
FT                   YRTLEEKASLVPGKAQQTVSAMSASERIAEYLSVRRGDALLRLRQISYLQTGEPFEYVR
FT                   TQYVGNRFEFYLEK"
FT   gene            complement(501437..502174)
FT                   /gene="tagA"
FT                   /locus_tag="JDM1_0461"
FT   CDS_pept        complement(501437..502174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tagA"
FT                   /locus_tag="JDM1_0461"
FT                   /product="teichoic acid biosynthesis protein A"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61350"
FT                   /protein_id="ACT61350.1"
FT                   /translation="MSVPFDTVNILNVPFIKTTNAGFVQQLQTDILAHRNRFVVTANPE
FT                   ILMYAREHPDYQQVLTQADYITPDGIGVIQGAQILGTPLPERITGYDTLLTLLEWGSQQ
FT                   HQRIFLLGAKPAVLKQVTTIVQRDYPGIVVAGARDGYYDDEQTVVDQIVAAQPDMVFVA
FT                   TGFPKQEFFIAEHRQRLDALWMGVGGSFDVIAGAVKRAPLFWQKHHVEWLYRLIQEPSR
FT                   FKRMLVLPRYLRLVKKIARQQAH"
FT   gene            502331..503809
FT                   /gene="nadC1"
FT                   /locus_tag="JDM1_0462"
FT   CDS_pept        502331..503809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadC1"
FT                   /locus_tag="JDM1_0462"
FT                   /product="nicotinate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61351"
FT                   /protein_id="ACT61351.1"
FT                   /translation="MTQIYPDDSFTLHTDAYQINMIQTYWEQGIHNKHAVFEVFFRKMP
FT                   FQNGYAVFAGLERVVNYINHLHFTATDIAYLRELGGYSDGFLDYLANFKFDATIRAVRE
FT                   GDLVFNNEPLLQVEGPLATCQLIETALLNIINYQTLIATKAARIKSVVGEDGLLEFGTR
FT                   RAQEFDAAIWGTRAAYIGGFDATSNVRAGKIFGIPISGTHAHALVQTYRNDYQAFKAYA
FT                   ETHHDCVFLVDTYDTLRSGVPSAIRVAKEMGDKINFQGVRIDSGDMAYLSKRVREQLDE
FT                   AGFPDAKIYASNDLDEKTIQNLKMQGAKISVWGVGTKLITAFDQPALGAVYKMVSIEND
FT                   HHQMVDTIKLSNNAEKVSTPGQKQVWRITKRADGKSEGDYVTLYDEDPRNEESIYMFHP
FT                   SYTYINKTVSDFDARPLLVPIYDRGQQVYTLPTLDEIKEYSFESLDALWDEYKRDLNPQ
FT                   DYPVDLSQKLYDHKMNIINTVRDHVNHKDEEEAY"
FT   gene            503809..504636
FT                   /gene="nadE"
FT                   /locus_tag="JDM1_0463"
FT   CDS_pept        503809..504636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadE"
FT                   /locus_tag="JDM1_0463"
FT                   /product="NAD synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61352"
FT                   /protein_id="ACT61352.1"
FT                   /translation="MRPLQAEIIKALHVAPTIDPEVEIRRSIDFLKAYLTKNTFLKTYV
FT                   LGISGGQDSTLAGKLTEMAITEMRQETGDDRYQFIAVRLPYGNQADEADAMAAIDFMQA
FT                   DVTDRVDIQPATDAMVTALEANQLTIHDFNKGNIKARQRMIVQYGIAGEMHGAVVGTDH
FT                   AAEAVTGFYTKYGDGGADIVPLWRLNKRQGKQMLAALDAPKHLYDKVPTADLEEDRPAL
FT                   PDEVALGVRYDDIDDYLEGRTVSDAAAEKIEAWYLKTAHKRHAAITVFDDFWK"
FT   gene            505092..507746
FT                   /gene="pacL2"
FT                   /locus_tag="JDM1_0464"
FT   CDS_pept        505092..507746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pacL2"
FT                   /locus_tag="JDM1_0464"
FT                   /product="cation transporting P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61353"
FT                   /protein_id="ACT61353.1"
FT                   /translation="MSTKPKYQQALSAVYEELGTDEHGLQQSAASQRLEQYGPNALNQQ
FT                   KATSLLQKFIAQFKDFMIIVLLVAALIAAFTGEAVDAVIILLVVVLNAIFGVFQESKAE
FT                   EAINALKEMSAPDATVLRDGQLQTVKSDALVPGDVVSLEAGDIVPADLRLIESASLKVE
FT                   ESALTGESVPVEKQAEMIADGELPIGDRLNMAYMNSNVTYGRATGIVVATGMQTEVGRI
FT                   AGMIEAADETTTPLQANLTQLGKSLTILILVIAAVVFGIGMLRGQESLINMLLTAISLA
FT                   VAAIPEGLPAIVTITLALGTQRMAKRHALVRKLPAVETLGSTDIIASDKTGTLTQNKMT
FT                   VEKLVVNQELVDARATELPLDSHLAQVMILSNDTKIMPDGLAGDPTETALIQYNLDQGY
FT                   PVDQLLTDRPRVTEVPFDSERKLMSTVHPLEDGRFLVAVKGAPDELLKRVTQIESNGDV
FT                   QPLTKTSRDQILTVNHELATQALRVLAFAYKVITTVPTTVNTETLENDLVFAGMVGMID
FT                   PERPEVEQAVAEAKSAGIRPLMITGDHRDTAEAIAVRLGIINAGEDDAVITGAELDAMS
FT                   DAEFGKKVGDYSVYARVAPEHKVRIVNAWQKRGKVVAMTGDGVNDAPALKAADIGIGMG
FT                   ITGTEVSKGASDMVLADDNFATIVVAVEEGRKVFANIQKAIQYLLSANLGEVLTLFVMT
FT                   MLGWQILAPVHILWINLVTDTLPAIALGVEPTEKNIMQHKPRGRNSNFFSGGVFSSIIY
FT                   QGLLEGGITLLVYWLALTYPVHATASLAHADALTMAFATLGLIQLFHAFNSKSIHESLF
FT                   TVGLFRNKFFNWAILIAFVMLAMTIVVPGLNGLFHVSHLDAYQWGIVALASLSMVVIVE
FT                   IVKFFQRRHMRRA"
FT   gene            507801..508235
FT                   /locus_tag="JDM1_0465"
FT   CDS_pept        507801..508235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0465"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61354"
FT                   /protein_id="ACT61354.1"
FT                   /translation="MKKATIQTYMPVLSKVIESTEKMGEELNPSFEKLRQAIDNDAVAK
FT                   MVPAEFNDIQLEFSDGTEQYQQNLAQLKKVAVPARLMGRHRNLLAAYEAYTNACAAMTA
FT                   SMNIDDQTIDVAAFNQAETDQETEMGRVSNNVQRIMNTVM"
FT   gene            508529..510700
FT                   /gene="tex"
FT                   /locus_tag="JDM1_0466"
FT   CDS_pept        508529..510700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tex"
FT                   /locus_tag="JDM1_0466"
FT                   /product="transcription accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61355"
FT                   /protein_id="ACT61355.1"
FT                   /translation="MDNQILTLVDQTLTKFKPQQIKAVLGLMDEGNTVPFIARYRKERT
FT                   GNLDEVEIREIKDNYDRLASLESRKADVMKLIAEQDHLTPALKQAIEKADKLQDVEDLY
FT                   LPYKQKRRTKATIAKDAGLEPLAAWLLRFPASGIQEHAAQFVNEAQDITDANNALAGAH
FT                   EILAEAFGDNAGLRNWVRNYTRDRGLLVAKVKPKGKAADEQGVYQQYYDFNSPIKQMVP
FT                   YRVLAINRGEAEKVLKVSIDVDRAGIDRYCHFRFIGQHHGPAIELVEAAYQDAYKRFIG
FT                   PAIERELRNELSAAANEQAIKVFGDNLYHLLMQAPLKGRVVLGFDPAYRTGCKLAVMDA
FT                   NGKFLDKLVIYPHKPAPTAKRKAAAGEFKAFLEKYHVEMIAIGNGTASRESEEFVAQVL
FT                   KTMTRPVYYVIVNEAGASVYSASAKARAEFPELHVEQRSAISIGRRLQDPLAELIKIDP
FT                   KSVGVGQYQHDVPQKELTTQLDTVIETAVNQVGVNLNTASSELLTHISGLSSTIAQNVI
FT                   TYRDENGEFTSRPQLKKVPRLGPKAYEQAVGFLRIIDGKNVFDNTDIHPESYPAAKALL
FT                   AAAGLKTTDVGTTKAQQLNQLDLAQLATSTGVGELTLKDIISSLQKPGRDVRDTMPAPL
FT                   LRQDVLKMSDLKPGMQLQGTVRNVVDFGAFVDIGVKQDGLVHVSKLTDKFLKDPRQAVA
FT                   VGDIVTVWVEEVDEQRQRIALTMIAPAEA"
FT   gene            510700..511146
FT                   /locus_tag="JDM1_0467"
FT   CDS_pept        510700..511146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0467"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61356"
FT                   /protein_id="ACT61356.1"
FT                   /translation="MTDLELQQLVATISMHDFHRPFQHRAYFNARLRTTGGRYQLASHD
FT                   IDINPKMLTDFDEATLIGVIKHELCHYHLHLTKRGYRHRDADFKRLLAQVGGSRYAPAP
FT                   KQATARPYRYIYECQRCGQRYYRKRRMDTRRYTCGRCQGPIKLV"
FT   gene            511212..512498
FT                   /gene="hom2"
FT                   /locus_tag="JDM1_0468"
FT   CDS_pept        511212..512498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hom2"
FT                   /locus_tag="JDM1_0468"
FT                   /product="homoserine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61357"
FT                   /protein_id="ACT61357.1"
FT                   /translation="METIKIGVVGLGTVGTGVVKMLQAHQEKISEITGRKLELACVVVH
FT                   NLKKHEQVDLGDVQMTDQIATLLDDPSIQIMVEVMGSIHPAKEYITQALQAGKHVVTAN
FT                   KDLIAQYGRELVQIARENHRDLFYEASVAGGIPILRTIDNSFAADRIQRVMGIVNGTTN
FT                   YIMTQMLTKHWSYDQALSSAQDLGFAESDPTNDVEGLDAAFKMIILTQFAFGMSLSLDY
FT                   VQVQGITKISPEDIAEAHQLGYTIKLLGIAEEIDDRIAVSVGPVLVSDQHPLATVQNEN
FT                   NAVMVTGTAVGNTMFYGPGAGELPTANSVLSDITTVAKNIALNTTGNTFNSYRQETVLA
FT                   TPEDVVYPHFIALKMRDVPGMMMKLTAIMTRAEVSFSRIIQNQLGDGNARVVIITHAMN
FT                   DQQLADITREIGEQENMQLLASYKVLKNA"
FT   gene            512507..513382
FT                   /gene="thrB"
FT                   /locus_tag="JDM1_0469"
FT   CDS_pept        512507..513382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrB"
FT                   /locus_tag="JDM1_0469"
FT                   /product="homoserine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61358"
FT                   /protein_id="ACT61358.1"
FT                   /translation="MLTISVPATSANLGPGFDSIGLALDMQLTLQVLQPSDHWQIDHPF
FT                   GADVPTDERNLIIKTALHLVPDLQPQHLQMASKIPLARGLGSSSTAIVAGLVLANELTG
FT                   ATHSSAELLEVATQLEGHPDNVAPALLGGLVVATNTDERVRAVKLQLPMLFASVYVPNE
FT                   PLLTTASRQALPTELAYHQAVTGSSVANTLVAALATQNWDVALPLLEQDQFHEQYRAKL
FT                   VPALQTVRDHAHALGLTGTYLSGAGPTVITLGDYGQLATLQAQLSRDATLTGQLFLLPM
FT                   DATGVKVQKS"
FT   gene            513438..513522
FT                   /locus_tag="JDM1_tRNA07"
FT   tRNA            513438..513522
FT                   /locus_tag="JDM1_tRNA07"
FT                   /product="tRNA-Leu"
FT   gene            complement(513673..514830)
FT                   /locus_tag="JDM1_0470"
FT   CDS_pept        complement(513673..514830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0470"
FT                   /product="prophage Lp4 protein 1, integrase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61359"
FT                   /protein_id="ACT61359.1"
FT                   /translation="MKITHKMIGSKRVYDVRGYLGKYTDINGNTKTKTYHHGGFSSSKA
FT                   AKLAFDRAKVEFDHRKNNPAAIMDNPTFDEVYEVWLKTYKLGVKESTLNRVEGIFKHHI
FT                   TPSFGGMRINTITWQKCQEEALKWRESVKQFNKLAQYAALVFRTAQKMGVITTNPMKLV
FT                   DVPKIAVDYSKDKAADNFWTAEQLATFLAVVDATDGHRTQPRYDRSALFYLLATTGMRK
FT                   GEALALTWSDIDLKNGLVTINKTISRSIDNHQIISTPKTRNAYRTLSLNSSTIDRLKKY
FT                   RKSLVVIPRAKDLIFTNQKGQIMSVMTPNHWLEALIGETDLPTITVHGLRHTFASIQVA
FT                   NNINVKALQMQMGHSDIKITLNIYAHLSQQELSAQVYDMSKILAQ"
FT   gene            complement(515000..515668)
FT                   /locus_tag="JDM1_0471"
FT   CDS_pept        complement(515000..515668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0471"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61360"
FT                   /protein_id="ACT61360.1"
FT                   /translation="MSNEDYGFVYALENKSFPGYIKVGQTKNLKQRLLQFNNTGIPDGK
FT                   PTLLLFAAFLNNYKKAERILHRSLSDKRESSSKEFFKATYNQVKAEFELLIFNDSNAEL
FT                   IRPEKYNSLITGKTYIVSKRQIGSRPNRTFQYLSIPAGAQLTFKEDSSIKVTVIDKKNH
FT                   VLCRCGKEHTLSRAAICCYDFFHNVSIEQQGKDRNGFAWFKYENTIISDIKPMVNQELE
FT                   "
FT   gene            complement(515781..516212)
FT                   /locus_tag="JDM1_0472"
FT   CDS_pept        complement(515781..516212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0472"
FT                   /product="nucleotide-binding protein, UspA family"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61361"
FT                   /protein_id="ACT61361.1"
FT                   /translation="MKNGNVILVAIDNSASAFKVTDYAIKIANALHKSLYFIHVINEST
FT                   PKIQRNQQDSVEGPTIQSLSEFYLKECTKTAINNDVDHAFHSIIYGVTKRKLVAMSNTK
FT                   NVAFTIIGATGYDDLYHNRIGHIAQYVSSWSKSTVTIVR"
FT   gene            complement(517037..517705)
FT                   /locus_tag="JDM1_0473"
FT   CDS_pept        complement(517037..517705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0473"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61362"
FT                   /protein_id="ACT61362.1"
FT                   /translation="MLDLLSIVIILGLGAFIVGIILFIIDYAKQNPKRVAVTVMVSGIA
FT                   VSAIAFATFGGIVSHNDKVAEQEAEKQALIRKKKEKRFKSAYSDLKVEATEVGMSSEKI
FT                   GNKLSQVWHDAIWEDDGVKIDGKYYTDFNKAINKQYSIYVSDGTITELTSEESAMDSSY
FT                   TTLKKNKTAKNNSKFKQATKIRSEAKKFSNLVTDPNGNYSTFTDNITEVDNALSSDVED
FT                   "
FT   gene            complement(517797..518228)
FT                   /locus_tag="JDM1_0474"
FT   CDS_pept        complement(517797..518228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0474"
FT                   /product="prophage Lp2 protein 8"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61363"
FT                   /protein_id="ACT61363.1"
FT                   /translation="MNSYKLYLQVHQLADKLGTFDPFVIADSLGYRVEYASLGNLKGIC
FT                   TTASSGDVYIGLSDELQEVPEKYVVMAHELKHGLDHTSCAALYTIGNNWEGKMEREANL
FT                   FACSELTALYKEQYGDRPQSFNEIQMAYGLPDKFYELMF"
FT   gene            complement(518238..518615)
FT                   /locus_tag="JDM1_0475"
FT   CDS_pept        complement(518238..518615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0475"
FT                   /product="prophage Lp1 protein 8"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61364"
FT                   /protein_id="ACT61364.1"
FT                   /translation="MALFDRIKFLANKQGKSVNDVESELGYSKNTLYRLKKTNPSAKKL
FT                   EEIADYFDVSTDYLLGRESKAPTWATEDDKIDLDEWLKSNVPMGFQGMDMDDETKIKVR
FT                   AFLEGVFWEDKQKHRNDDNKK"
FT   gene            518928..519137
FT                   /locus_tag="JDM1_0476"
FT   CDS_pept        518928..519137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0476"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61365"
FT                   /protein_id="ACT61365.1"
FT                   /translation="MPTTLAGRELIKKYIDDREISITSLAATFGVGKMYMTQVLAGTRK
FT                   SAAANELVLKIIETFKIRPHEGDE"
FT   gene            519141..519356
FT                   /locus_tag="JDM1_0477"
FT   CDS_pept        519141..519356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0477"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61366"
FT                   /protein_id="ACT61366.1"
FT                   /translation="MTEKLVLRKQHLNGNNGTKPIFVDVSILDSIREIKEETGIPMRRI
FT                   VEQFLCYAMKNVQTFVFYKNIRSEKL"
FT   gene            519607..519879
FT                   /locus_tag="JDM1_0478"
FT   CDS_pept        519607..519879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0478"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61367"
FT                   /protein_id="ACT61367.1"
FT                   /translation="MDGVTLNLPSESLAPIKQELTRLITDVFKQIAKREALPYWMKKQE
FT                   AQIYMNVSDKTLDKFIVDGLKVSIIDGTQRISKKSADEYYEDHEL"
FT   gene            520018..520467
FT                   /locus_tag="JDM1_0479"
FT   CDS_pept        520018..520467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0479"
FT                   /product="Gp40 protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61368"
FT                   /protein_id="ACT61368.1"
FT                   /translation="MSKETVEINGVKFEVDMDTAKRIDTFKVGDNVRLLDKRYNSSEIY
FT                   TGVILGFYNFKELPTIQVAYFKDSFSGATIDFVNINSKSDDFELLPSNKYEADFDRDTV
FT                   VGSLNQQIESKTSEMKSLEAKKAWFLKYYGKYFVNDGEEDANEEG"
FT   gene            520623..520808
FT                   /locus_tag="JDM1_0480"
FT   CDS_pept        520623..520808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61369"
FT                   /protein_id="ACT61369.1"
FT                   /translation="MNNYKTQAKHWYRKLMKTPVGYVCLATYRFKQWQLYKHLARQSAM
FT                   DHLRGEDHADIQPENN"
FT   gene            520885..520950
FT                   /locus_tag="JDM1_0481"
FT   CDS_pept        520885..520950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0481"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61370"
FT                   /protein_id="ACT61370.1"
FT                   /translation="MGVLSPEAVLDKIGVQEKVRE"
FT   gene            521271..521522
FT                   /locus_tag="JDM1_0482"
FT   CDS_pept        521271..521522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0482"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61371"
FT                   /protein_id="ACT61371.1"
FT                   /translation="MKITDIRDKHEQVLEYKLGQVFNDGDYTYMVTASRESKYQLTQLP
FT                   DGVALSSSESSLEGLYEATDHYEEQLVATELIIRGVKL"
FT   gene            521519..521998
FT                   /locus_tag="JDM1_0483"
FT   CDS_pept        521519..521998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0483"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61372"
FT                   /protein_id="ACT61372.1"
FT                   /translation="MNLYEMATNYRDLTNRDDLNPDTIADTLDALTDSMNVKVDNIASW
FT                   IDENAADIDFLDKRMKSLREEKQRLKSLNDRLNHYLADTLDQAEIKKLTTDQHLVSVRN
FT                   YRASTVVSEPDKLTADYVKEVHEYQPDKTAIYKALSAGKNVPGAHLEPNRKAVIK"
FT   gene            522150..523409
FT                   /locus_tag="JDM1_0484"
FT   CDS_pept        522150..523409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0484"
FT                   /product="Helicase-like protein:Type III restriction
FT                   enzyme, res subunit:DEAD/DEAH box helicase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61373"
FT                   /protein_id="ACT61373.1"
FT                   /translation="MADIARRATAKGNRVLFIVNRREILEQAENTFKSDDVNMSLCKMG
FT                   MVQTITRHIDELTKPAIIMIDEAHHALSKSYQRIIQAFPDALKLLFTATPWRMDGKGLN
FT                   VIADDLIMGKPISELINQGFLAPVDYYAPSEIDVTQLKTKRNGEFDEKSIDQAVKPKIY
FT                   GNAVRHYLKLAPGKQAIAYAYNVASAERLAEAFNQAGITARAVSGKTDRAARKRIVADY
FT                   RAGKIQVVTNAELFTEGLDLPNVDCVIMLRPTQSLSLYLQFAMRSMNPREGKRAIIIDH
FT                   VNNVERFGLPTIDRQWILSGRDKHSKSSNGSPIKSVSVCPECFATFYRKGKTCPFCGAE
FT                   LGEEKIIETDESIKLKKIEANKRLALAKEIAENNAAKAVADKSPGELTTYAEIKAYAKL
FT                   HGYKPGWSYFQAKMKGLIRK"
FT   gene            523406..524122
FT                   /locus_tag="JDM1_0485"
FT   CDS_pept        523406..524122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0485"
FT                   /product="phage NTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61374"
FT                   /protein_id="ACT61374.1"
FT                   /translation="MSILPKNEPHKPAGTPRNFFIWGATMSGKSYLAEHFPNVLVLNTD
FT                   GNSAMGTRPSIQLRNVRNPDGSLKSSVIDQLQEVILELGTTQNTYETVTLDVIDDVCQL
FT                   IEQAICLKAGVESLADMGYGRGYALFNTVLQSLVMDLKALPINVVYISRENDFTDDDGN
FT                   TKTVPSLKTKFYNVVNGNCDLVIHTQHVGKNYLRNVTEIRRRYKASEINDSKILSILKA
FT                   IPNALAPEVQTTKAGK"
FT   gene            524125..524724
FT                   /locus_tag="JDM1_0486"
FT   CDS_pept        524125..524724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0486"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61375"
FT                   /protein_id="ACT61375.1"
FT                   /translation="MSLLDIAANTLDNFDPKNDSVNAGSTGLPDGDYLTAVESIEHRSF
FT                   DSGWDCLQVVFTVLDGDHAGEKEYDRISFATKSKAGKAIPDFILSRSIKFVIKLGSLLG
FT                   VEMKPEYFASENETDTHEMLANVLAPEKGKSVILHVKHRPNKKDPDNPYVEYDLDATEQ
FT                   PETADITDADLPGDLGGAPMPTDADAPADPTDEAPF"
FT   gene            524738..525292
FT                   /locus_tag="JDM1_0487"
FT   CDS_pept        524738..525292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0487"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61376"
FT                   /protein_id="ACT61376.1"
FT                   /translation="MSLNFYAGIDSFKNDNKDNTAITLKVGGGGLDNLLDKLRELKSDE
FT                   VVNITIESARIHYDKITDAETGQSMYYYSRNNEGVWEEHQTDDTHLELEGVDNTVTTAE
FT                   TITADIVDRFLMNENYDYKPKSKFNPRKALVMISEGYSFDEVAKAQSFTTTKMLDELNM
FT                   ARDKFAPYAATWWQIEQALKD"
FT   gene            525366..526160
FT                   /locus_tag="JDM1_0488"
FT   CDS_pept        525366..526160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0488"
FT                   /product="prophage Lp3 protein 7"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61377"
FT                   /protein_id="ACT61377.1"
FT                   /translation="MRNLVNYAVRYAQAGFSVLPMIGKKPMIKFADQPALTIDQIQSYW
FT                   RSHPYAQLALRTTNFFVIDIDEHPGGADGFKSIADYPNPEYLRDTLSQATAGGGRQLFY
FT                   LKRDDCAIQQRIGWLPGVDIKAHVNNYVMVAPSERNGKLYQWENHNPIVTAPRELVQAI
FT                   NANRDDTVDVFTDLNIDYTEKSGTATLFETIVDGLGATGGRNNALASFAGGLLFRGVDP
FT                   RAVIQLGLLANANTDDSLTQREAKTTIESMIKKEIRRREANQ"
FT   gene            526157..527431
FT                   /locus_tag="JDM1_0489"
FT   CDS_pept        526157..527431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0489"
FT                   /product="prophage Lp3 protein 8, helicase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61378"
FT                   /protein_id="ACT61378.1"
FT                   /translation="MSAEEEADKLRKLEEQQKVVPLKNRINFMETAKGGIKANSLENVC
FT                   LILEHDPLLKGKFAYNEFSYETEFMEDSAELMLEHGPLQDEFTPAVQRYIERKYKVMFT
FT                   PKLIDAAVTEVSRRNVFNPVINYLNECYKKWDGVTRVADFLPVYLGVEKSPVTTLQTKL
FT                   FFVGAVAKVFKPETKFDFVLDLVGGQGTGKTTLLKRMSNGWYTDQFTDFENKDNYGNMM
FT                   RAWIVNDDEMTATSHSSFEILKKFISAEIVEYRPAYGRYTVRRYKNFVMARTTNEVTYL
FT                   KDKTGERRFMPVMVNSALQKKSPITDLPQGTIDQLWGEFASYYRDGFRFGLTQDQEQMM
FT                   ADNREQFMYIDAEEDAIEQSLAQIKGDFVTSSEIAFKMGVPDIVKNRKLANKIKYVMDN
FT                   KKEWHATQRRIKGVPKRGYTRVKSE"
FT   gene            527689..528021
FT                   /locus_tag="JDM1_0490"
FT   CDS_pept        527689..528021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0490"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61379"
FT                   /protein_id="ACT61379.1"
FT                   /translation="MREQEIQNQIRVAVSKNKCTIFRANVGKVEMKNGRWFDTGLPQGF
FT                   PDLFGFRHSDGSIFFIECKNETGRPRADQIKFHKFLMKQHTIHGIARSPEDALKIINEG
FT                   LVGYGF"
FT   gene            528041..528265
FT                   /locus_tag="JDM1_0491"
FT   CDS_pept        528041..528265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0491"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61380"
FT                   /protein_id="ACT61380.1"
FT                   /translation="MQYEQVAVTEPKVLESTLGIQNNHDGTYTVTAIKKFIRKNDQVVS
FT                   MLFTKNGLAALTGYLRMLTDNGDDDDNQV"
FT   gene            528291..528677
FT                   /locus_tag="JDM1_0492"
FT   CDS_pept        528291..528677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0492"
FT                   /product="prophage Lp2 protein 26"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61381"
FT                   /protein_id="ACT61381.1"
FT                   /translation="MADYVSAIQNGDTQGTPSSVNVIVNGKNETWDIKNDDVELLQFTG
FT                   LKDVNGKDIYVGDIVNVWSNMSELKMEPKVNEIVSEDLFGTPGMFLKSLKAHFIEPCLH
FT                   DYWSNQFEVIGNVHENPELLEEDK"
FT   gene            528674..529135
FT                   /locus_tag="JDM1_0493"
FT   CDS_pept        528674..529135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0493"
FT                   /product="prophage Lp1 protein 31"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61382"
FT                   /protein_id="ACT61382.1"
FT                   /translation="MKFYRKQPLEAEQFDGSQKLVFGYSVIPSGIIDAITGKPVYYSML
FT                   VDDVCQDSDDDTGVVLEVSDWIVKEADEIEVIADDVFKKTYAELPVIPENVACLIKQDK
FT                   EWDYNLGMAFDDAFSGYIWKSGVGKWIIAHSDTFARAWLDGYVVEGKHD"
FT   gene            529262..529573
FT                   /locus_tag="JDM1_0494"
FT   CDS_pept        529262..529573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0494"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61383"
FT                   /protein_id="ACT61383.1"
FT                   /translation="MEKRIDHEKLNSLVCEVEDRHKNGIIDASSKEMAPIWKMTKATMK
FT                   SGYLAVSLRQYNLIEAYATKSSHTTEEKNQTLKQLHKKYSWLNRRVTEYRHGNLIIRS"
FT   gene            529585..530016
FT                   /locus_tag="JDM1_0495"
FT   CDS_pept        529585..530016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0495"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61384"
FT                   /protein_id="ACT61384.1"
FT                   /translation="MGDFETNKKFLRRYRPYFRQIKRLETKLFVIDDRIESTHSPSMTG
FT                   QPGGGKRRELADDLIQREEIEGRINRLIKKSRPIKAEITDCLDELTNSLEASILEQYFI
FT                   EDIQLDTIALQMSYSFRQVKRLYGDGVKHAKIPRNCDTL"
FT   gene            530195..530902
FT                   /locus_tag="JDM1_0496"
FT   CDS_pept        530195..530902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0496"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61385"
FT                   /protein_id="ACT61385.1"
FT                   /translation="MSKSEVIQNLLDELNNQNQIYIAIIGTILAVLGLAFTIFSFMQRR
FT                   FSDKQIQKMEDDFKHDFKQDFKIEENNEVLRDMRATLAEVRKSEKLLKQEIITATDLNF
FT                   ENSSFLLSQVDGDTHTLELNNMLINFNTTFDKAISTHKLNLSTLQHVIVNLINCLQRIR
FT                   RYKIRYDEEAYYKINSLFDKLSRQSTISIQANSDMNRYFTQHSLLKCLKSLKSELKECD
FT                   KYMNNELEDHDID"
FT   gene            530971..531186
FT                   /locus_tag="JDM1_0497"
FT   CDS_pept        530971..531186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0497"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61386"
FT                   /protein_id="ACT61386.1"
FT                   /translation="MEQPEFNATQAINETCYGLVKQGYSLHDIYSGLGNVMNGIEPKHL
FT                   TKQELVIDLNIDTSKATCKLRHALDK"
FT   gene            531649..531762
FT                   /locus_tag="JDM1_0498"
FT   CDS_pept        531649..531762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0498"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61387"
FT                   /protein_id="ACT61387.1"
FT                   /translation="MMTATIILLSERDYKPIQHVVFINQQTGKVFYQSTDW"
FT   gene            531796..532047
FT                   /locus_tag="JDM1_0499"
FT   CDS_pept        531796..532047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0499"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61388"
FT                   /protein_id="ACT61388.1"
FT                   /translation="MRSRTDNTKQVVVYVVMRDQQANVLFAHRVYFSERRAKNYCKRMN
FT                   NAKEFTGYYYINKAIFFDWKAFISKFTEAPGVKKIGEK"
FT   gene            532158..532445
FT                   /locus_tag="JDM1_0500"
FT   CDS_pept        532158..532445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0500"
FT                   /product="gp1 protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61389"
FT                   /protein_id="ACT61389.1"
FT                   /translation="MQRIDKKSAVEKEKVDRYISLLDAFYQLDESIQQHGVMVKIENGK
FT                   QIYWKTNPAVSEKNRINSALITLEKDFKPVKATPKVSNTATTSDEKGGLV"
FT   gene            532442..534124
FT                   /locus_tag="JDM1_0501"
FT   CDS_pept        532442..534124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0501"
FT                   /product="Terminase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61390"
FT                   /protein_id="ACT61390.1"
FT                   /translation="MIQQKYVESYLQAYKDGSIRLNKRRIKLVELIEKTVLTNENYYFD
FT                   EEKIEDCLTFADKWFFPFTPWEKFLTAFVFLYDHTTERRAIRKFMVVVGRGAGKNGWVS
FT                   VISSFLLSRLHGVRNYNGSIIANSEEQAKTSVDEIHDAVDLHSELKGEFYATNSQVHSK
FT                   STNSTLRYRTSNGNTKDGLRDGFVIFDEIHAYQNNQNVKVHISGLGKVRDSRVFEIGSQ
FT                   GYVRDGYLDKELAKADAILNGKAPIESMFPFVCELDNLKEMDDPANWELANPSFSKPMN
FT                   GYAKDVYQETMDDYNDLELDPSGYDEFVIKRMNYQVEDLEKSVAPYEQIKATNRPILLD
FT                   DLQGMEAIGSVDFASIRDFTADGLTIKREGKQYFISHQFARRQFVDKFYAYSAKPQDRP
FT                   QSAPPIAEWEERGLLTVVDTPTIDPQAVVDWFLEQRKRFIIKKVVMDNFRADLLRKFFE
FT                   DAGFEVVVIRNPTAIDGLLAPRIETGFANHQYIWGDNPLLRWNTQNVLVSTDSHGNKRY
FT                   GKKEEIRRKTDGFKAFEYGQYLVDQLPDYSVNESLDMLADIDF"
FT   gene            534143..535285
FT                   /locus_tag="JDM1_0502"
FT   CDS_pept        534143..535285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0502"
FT                   /product="phage portal protein, HK97 family"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61391"
FT                   /protein_id="ACT61391.1"
FT                   /translation="MSVINSFFDLFTRRKDSSFIYDLDLFQDIKNRAYLKRMAIDTVIN
FT                   YVGRAVSQSEFRVMNKGLPVKDAMYYKLNVRPNTDESASDFWQHFIYQLIYYNEVLVIQ
FT                   DDDGDLLIADDFSRHEFAVYEDAFDNVTVKEYTFKRSFPMSDVIYLRYSNDQLEHYLTG
FT                   LWGDYGELFGRMYELELRNNQIRATVKADMTAGVNDGKANKLQMFIDKIFQSFSKNSVA
FT                   LVPITNGFEYNEVSNGVGKNQTFDESNSVLMAFIDHVARLVGVPPALIHGETAESSDNQ
FT                   ELFNKQCLSALLNKIQSELNAKSFSQRDYLKNGKQVEVIGINRPTLIELAEQIDKLGSS
FT                   GMVTQNEVRSAVGLPPREDGDQIVMTKNYTMKGGENNEED"
FT   gene            535272..536015
FT                   /locus_tag="JDM1_0503"
FT   CDS_pept        535272..536015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0503"
FT                   /product="Clp protease domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61392"
FT                   /protein_id="ACT61392.1"
FT                   /translation="MKKINVKGPIISNDDKWIYDMLEMDSTAPKDVIDALPDDGSTVEV
FT                   DINSGGGLMDAGTEIYTALMAYQGKVMVNIVGMAASSASLIAMAGNPTRISPVGQIMIH
FT                   NVAGGLRGDYRDQAKLSEILKQSSEAIANAYHLKTGLSMEDLQAKMDSETYLNADQAKE
FT                   LGFVDEIMFDDQIELVADGGLPKPAIDKITELMKQNNSGMTTARSINPFKLSDSDIDRI
FT                   TTAVTQKLNVKPKVQTEKTFNPFAF"
FT   gene            536036..537214
FT                   /gene="cps"
FT                   /locus_tag="JDM1_0504"
FT   CDS_pept        536036..537214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cps"
FT                   /locus_tag="JDM1_0504"
FT                   /product="major head protein Cps"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61393"
FT                   /protein_id="ACT61393.1"
FT                   /translation="MIKFDTNVFKNFTDAREKYAQLVKNAAKPEEQQQGFTDMMDALGE
FT                   DTLSEIKNQVHAQTEDYLDARRHDPKMSNEEVKFFNEIKTDTGFKEPKLLPETVVTEVF
FT                   DDMVQAHPLLQAIGLQNQGISLKIIQSDASGVIGWGNIFGEITSQLDAKFKETKADQSK
FT                   ATAFLVLPKDLSDFGPSWIKQYVITQITEAFAVGAETAFLTGDGNQKPIGLNRSVKEGV
FT                   AVTGGVYPEKESAGTLTFADTKTAAKELAGMIKELSTKENGKPVVAKGKTVMVMGPGES
FT                   LDVEAQFMVQNLAGQFVTALPFGLTIIESEFAPENKVIAFVQGRYDAFQAGPLKIQPYD
FT                   QTLALEDMDLYTAKQFFYGKAKDDKAAVVYDLKLATPGTTTTEPTTGGDTGK"
FT   gene            537354..537659
FT                   /locus_tag="JDM1_0505"
FT   CDS_pept        537354..537659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0505"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61394"
FT                   /protein_id="ACT61394.1"
FT                   /translation="MADEKMNPLLDQFKLRMKIYHKAEDANLSRILNASQRRITDITGI
FT                   ASNASDDVYDELVLERARYAYNDQVEFFDANFLDDLLSASLVSYEPGDDEGESTRV"
FT   gene            537640..538029
FT                   /locus_tag="JDM1_0506"
FT   CDS_pept        537640..538029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0506"
FT                   /product="gp8 protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61395"
FT                   /protein_id="ACT61395.1"
FT                   /translation="MNRPEFEYKAPSVRTNQLNTPVRFFRTVKNLGPEPGRGQTEQAFE
FT                   CLGLAYDPSTKDREVLNVNEAKYGVTIKIRDTFGEFDPTTKDTVVIDDRRYLDATGQPI
FT                   VWDILQVAPDLENNQFVKIVLGVTK"
FT   gene            538026..538433
FT                   /locus_tag="JDM1_0507"
FT   CDS_pept        538026..538433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0507"
FT                   /product="gp9 protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61396"
FT                   /protein_id="ACT61396.1"
FT                   /translation="MTEVTVKFKGVDEVINKLAEKFSPAKLNRIENDALRVAGRRVAVE
FT                   LKNAVASYRDTGQTVLQVSVGNPHSRGGVRTIKIGWHAGSRWRLVHLNELGYTRFGKTY
FT                   HPRGMGKVQGAFDSSRGPAKALEEAELRKLL"
FT   gene            538430..538852
FT                   /locus_tag="JDM1_0508"
FT   CDS_pept        538430..538852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0508"
FT                   /product="gp10 protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61397"
FT                   /protein_id="ACT61397.1"
FT                   /translation="MTETKDMLATIYTALLANATIAKLTLAGDGSHRISYFESPETADH
FT                   DNLFVVITPVGPPVPAAVGSDDYLNVQFTFQVNVESISRPARNAVAREIQNEMLALGFS
FT                   RLAGAQNELDEFMTETNRFVDVRRYRGNTKLYDTNY"
FT   gene            538867..539478
FT                   /locus_tag="JDM1_0509"
FT   CDS_pept        538867..539478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0509"
FT                   /product="putative major tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61398"
FT                   /protein_id="ACT61398.1"
FT                   /translation="MFVGYKRLKIQPFAEDGTKKGDLIIVEGQAHKGATTTAEISGLAK
FT                   DPVKVPGSNIDYYLSRQGLGDAKVALGILDLPEASADLLAGFRVDDDKISYGGEDTLPP
FT                   YCSIEMESKEDTGEIALVGFFKGTFTRDKISLSTLDSSKSFTPEADAWTFTPISSIATA
FT                   TNGEVMQKFVGDATKDATTVTKFEKQLFDPAGSDTTPSNG"
FT   gene            539571..539885
FT                   /locus_tag="JDM1_0510"
FT   CDS_pept        539571..539885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61399"
FT                   /protein_id="ACT61399.1"
FT                   /translation="MSTPLKMELLIDGKKQTFTESFIPAGRILDALDLIETDNSDRKLR
FT                   DVFEERVAFLSKVFTNPLVTTETIWNGFNAIGFEDHIFELICKVANVNPKKLQMATTPE
FT                   "
FT   gene            540072..543977
FT                   /locus_tag="JDM1_0511"
FT   CDS_pept        540072..543977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0511"
FT                   /product="tape measure protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61400"
FT                   /protein_id="ACT61400.1"
FT                   /translation="MADEVLGRMVIELGLDHAAFGKGLTGAKREVKYAMAEMKSSMAVL
FT                   GQSGRQFDVLSAKSKGLSQVMMSQQRVVEKLGKAYKDSLVDGKPTAQTAKLATQLQNAN
FT                   AKLASLQTQYKNNAAAMAKARVEQTGFTGGLNKVSKAAVATGTSMKNIGSTMTSKVSAP
FT                   IAAGLAIATKSAITFDSQIKSMGPLLTNGGAVTAKYRSQLDQLGDASKKMSMKYGVSTT
FT                   EINNGMAELIRRGYTTNQVLGSMPSILDATMASGEDMGTVMNATASIVEQFGLKTNSTA
FT                   GTMKNTQRVTDSLTYAANATAAGFGDMSDAMSYVGPVASSLGLSVEQTAAAVGELSNQG
FT                   IEGQKAGTNLRGMLTSLIKPTKQNTEGFKSMGISSKQLAHDSHDLPQLIDDITHGTKGW
FT                   SNAERGKALAQAFGRENQAAANALVKAGSKSLRDLTKDTENAGGATKKVAEQMSNTSAN
FT                   NVKKLIASLQVLGIEIGEKLIPKLTPLVKKATDMVQGFSKMDDATQNTIIKFALLAAAG
FT                   GPVLSMLGNIVGGFGTFGGGIVKVISATAQWHAKNQAAKESLAMLKGATDATSGGFKAF
FT                   KGSVDTVNGSASTAKSTFGLLKGAFTTAEAGAGVLGTSLSVTGAAVTGVGLAAVAGVAY
FT                   WQLYGKEAAASAARIRQWGSDVGEQADSALTKFKGFSTNASASLTDFETASHTSTKSVA
FT                   KDFGDMYTEMEKDSKDTIQQMQKDMKGLPDSVQGDLKKDIADRKKHNTTVLADAKENYN
FT                   NAEAILKNHNGKMSGLSDTERTALLNSQRKMNSDEISLLKIGGSAKKNVLAALNGDIGN
FT                   MTRKQRDTTINQLTSSMQKENKLYNDQSQQIKSMYDKGEISASQYGKAMKDLQATHRST
FT                   TDNMAAAIYKLDKANGTSKAQITQDLLNVGYTYKQAAAIVKRQNDDMSKSTSLVVAETG
FT                   NMSKKSKAAADTWNSLVFDSKTGKVKTNAQAEVNKAAKSKDKWNQMKLLVKQGKMSSNA
FT                   AAMVGVAAVQTKRWDGLTLKEKQAMIKSKGGDDLAGLIEKGKQWGKFTPAEKKAIITSK
FT                   GGPELLGVMTKAQTWNKLTMAEKRAVLKDNASPAMKQASVSVKDWNNLTPQMKTVMAKA
FT                   KGAEDVAKGVKNLKDWNSLPEREKRLIANDKGATGIIKKVTGNYKAYQNLPKNATKNLF
FT                   AKDNASKNAGKAKISVDKYGRVKVTGKVLKATDRASGPAKNGKKGLDKFNSTKMQTKTA
FT                   KGKDSASGSMNGARKSAMKYNGVNMALKTARGHDAASSPINGAHRSLDRYNGVGMRGKT
FT                   ARGYDSASGAMDALKVR"
FT   gene            544082..544615
FT                   /locus_tag="JDM1_0512"
FT   CDS_pept        544082..544615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0512"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61401"
FT                   /protein_id="ACT61401.1"
FT                   /translation="MGNVTHFITTVFRKITRHATGTTGTDGNPIIVNDEESSVYREAVK
FT                   YPGRPAFIPHGRNVYLDAPKGTQVIPAGLTAKMFGVSQYAAGTIPANSSIIQASKAIND
FT                   SIGGDNTTINYNLGGSDSTQAIVAGLEAILNKLDDQQPTFEVHNDMIGEKLRTLIKQKD
FT                   SREHNLNRFFPQGG"
FT   gene            544619..545440
FT                   /locus_tag="JDM1_0513"
FT   CDS_pept        544619..545440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0513"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61402"
FT                   /protein_id="ACT61402.1"
FT                   /translation="MDALITNLNGTEHKLSDFGFQVLDFEESAPTITRTTKSFDGRAGS
FT                   LDYGGRHVVKKIIINGLYWVKSLEQADDVRDKVNAALSQAEPIYLTRIYGGRNLYDVRE
FT                   SGKDFVMPAQTVDKKRFKVYRTDTNLPSIIERTGKGVYYTWSLEFETVELPYGESKPRS
FT                   QTLVSGQSITYNGTVACSQLEQAFYFVVTAKVASASGFTLTVDGQSLIVTSPVVAGDVY
FT                   TLSGMNNTRGNQNINDKTNAGYFVLHPGAANKVVCSISADIQIKNLCDLCI"
FT   gene            545460..549428
FT                   /locus_tag="JDM1_0514"
FT   CDS_pept        545460..549428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0514"
FT                   /product="reticulocyte binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61403"
FT                   /protein_id="ACT61403.1"
FT                   /translation="MIKFHDPSGTPHFGQATITRTTSVNGGLSLTGEVFAGDDVLNGLD
FT                   YGWWLNFDNEKYVITYKKLSDDTNTVVFDAVQQFFWDFAKVALHAQYTGSHEYTFYLGQ
FT                   LFDKSGYTYKNDITVPAFEKENWGYKNKLDLFNDIIDQAGVEFEVHNETVHIAKQIGSD
FT                   LTSFARKGINLSDLTEEMKISDFATYAKGYGAFKDAEDQSKGRLEVEYRSELAKQFGDL
FT                   EMDPIVDERYTIADNLIAALKKQVDATYTVSMTMNIYDLENAGYPNYEAPKVGDWILAI
FT                   DEALNFKRKIRIIQLEEQFDVTGKRIGYTATCGDLSIVDQYTHLQSSLDSKVQRIQESV
FT                   DNALSSANGKSTNYYGAKEPVSANEGDLWFDQSDSDPDKWSIKQWVNGRWEQLTLNPGE
FT                   VDAKVDVAKKEAETAVENAKSASDKADQLAAKYDDTNALANQALDRAIDAQNSAVGLID
FT                   DVNKASQNADDAKSIANSVNSKYTTLTDGSTMTIAELENGLAAKLTKDDLSGYATETWT
FT                   QNQIKVTADGINSTLSSVKTTVDGQTTSLNDLKADSRGLKAQFVTVNDTLGKQTKDIGT
FT                   LQATNKSLTAGFDSLNADNTVNQHNISQLQLTATSLSNTIENVNQKVEDGLISTNIFRS
FT                   ANDFSRSYWTDTFGYPFTTIQTESRYHDSLIHYQGQGKTPAPYSTIAQQTITDDAMAAD
FT                   TWYTLSFYARGAGDNNTVGKFGVYFYGNGSDQSMSSSDGVEVLGTSDTHCIITLTPYFR
FT                   RYVITFHTPKDFSGGHSFWARNDLDLNDGSLYCDFWHPKLELGKVASDFSVNPADTATI
FT                   SALSSISQTVDAIQTTVRGKVDNDTYQSKMTQINNAIIAKVSKGDITNENILPYSGYWS
FT                   DTTGWNLFAWGASDKTLSLVHHDFYHNAADATLCIQTTQNATAPVGSSKFTLIPNTTYT
FT                   FSFWGFASSNVVGTNVYILGRSYTSTKDYDFVHAVFENLKMSPSGINKYTATFKTGPTE
FT                   TQAYIRLDNGGSNNGQSAGSYFAELKIERGDTATPYTRVSSGEIQVTSDNINLKVSKDG
FT                   VINAINISREGTLIYGNKLHITADTYIDNAVIKDAMIANLSANKLTAGSINAANINVYN
FT                   INGANIVSNSITADKIQAGSMLLAMNSTLQTLKIGTDGLYTTNTSGAFIGKIHANNLIE
FT                   HPNDWGLHFDLAAGAQYMAWGAQNSNDPNGGYVVKFGWTRNSSAGDFTLPWGGFWFNDN
FT                   VMLHKNLSFDGGGIDVKDAYQLMKFAWIEMNGTKYPFFGSSNLKAGWLFGSSETYLVRN
FT                   GGIINASKILGILNGQHYKFIKDLNSNGTVKGYVDVNF"
FT   gene            549455..549937
FT                   /locus_tag="JDM1_0515"
FT   CDS_pept        549455..549937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0515"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61404"
FT                   /protein_id="ACT61404.1"
FT                   /translation="MNTTISFKNRELAGIANTLGKFKLKGKASLGRSALIRKLASKQEE
FT                   YVSDRVLIQQKYFESDKDGNLKTQDDGSEKLIPKSELSDKKDPSKLAKDSESNLNSEMG
FT                   ELSDDFANIDFSEYSARFKALKLSLDDYPYELEKEDAIVYERVYDQLEQAFSKGEK"
FT   gene            549939..550373
FT                   /locus_tag="JDM1_0516"
FT   CDS_pept        549939..550373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0516"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61405"
FT                   /protein_id="ACT61405.1"
FT                   /translation="MNLINRSIQYALSAETGNTDSVVVGVYGKSDNLEINGTLTIVADD
FT                   LDEGTTFDDLSKKQLFALATKKLPTLLPTLAYTNYQFFVQNDTPVRLTAYSDLSNNGSY
FT                   ISLSSTLDQSDFTNKAIESVGYEDVKSAVKTILSQEFPTS"
FT   gene            550403..550780
FT                   /locus_tag="JDM1_0517"
FT   CDS_pept        550403..550780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0517"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61406"
FT                   /protein_id="ACT61406.1"
FT                   /translation="MGIRRNYSILMTGVEIIMIGAFFVANTFRFDRPDLLNNLASHIDD
FT                   PPFATINIIIGTVIVMVAIFDIRPLIKWCYAVAAFIWTIYGLAFMLQNIEVMGQPFGRL
FT                   DCWLMFAIAGRVILESWAGDD"
FT   gene            550780..551052
FT                   /locus_tag="JDM1_0518"
FT   CDS_pept        550780..551052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0518"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61407"
FT                   /protein_id="ACT61407.1"
FT                   /translation="MNWTVIIQSVLTFAGGFAAAYWSFKGSVKKASFSNEGIYADKTGD
FT                   LFERIDKLTNERDDLKEQVMKLQGEVKDLTKAVKEMKQEMKERDI"
FT   gene            551052..551336
FT                   /locus_tag="JDM1_0519"
FT   CDS_pept        551052..551336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0519"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61408"
FT                   /protein_id="ACT61408.1"
FT                   /translation="MMEFIQLLNGGTIAMIAIATFVIVWGVKQTPLKNVYLPMIALGIG
FT                   AVIGIAFGWLNGDIKPVVGLVDGLVAGAVSVGGNEVFKSITHALDGGTK"
FT   gene            551336..551722
FT                   /locus_tag="JDM1_0520"
FT   CDS_pept        551336..551722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0520"
FT                   /product="putative phage lysin"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61409"
FT                   /protein_id="ACT61409.1"
FT                   /translation="MSLNGFDVASYQAGMNVGEVAGDFVLVKATEGIDYTNPEFNGHAK
FT                   QTLSAGKKLGVYHFIRNDSDIKQQADYFLTVVKPYIGKAMLVLDFENTTGSTIQNQAGV
FT                   GLAKQWLDYVYQQTGVRSVLYTGD"
FT   gene            551805..552269
FT                   /locus_tag="JDM1_0521"
FT   CDS_pept        551805..552269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0521"
FT                   /product="putative phage lysin"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61410"
FT                   /protein_id="ACT61410.1"
FT                   /translation="MNGYQPRDLYGSLKHWKTAVMFQYTSTGRLPGWNGNLDFDVFYGD
FT                   EAAWDKYAKATKMVINKSIVQKTTTKDGVWTITNEVGTFRPNQKLGIFKYPGLELTGKY
FT                   YDKGESVKYFGYVSNPQAGYVYIAYRYNSKLIYYVACREIATGRALGTFE"
FT   gene            552695..553549
FT                   /locus_tag="JDM1_0522"
FT   CDS_pept        552695..553549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0522"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61411"
FT                   /protein_id="ACT61411.1"
FT                   /translation="MIRMSRWWWRILVGGVLVSGVVYPAQAAVTTYPITGIQVVQTRVY
FT                   QTNSQNGVGYHLTVVRHQRAQLRVNLHLKYHQHTQWTRTEQADIYRNGHYQRFYYVHNG
FT                   HQQSGWIAANQLKPASTASVQLRVPLIDQLPELPTGCEMTATTMMLQYAGVNINKEQFA
FT                   SHVPRSSTPNTGFVGDPASAYGIGLYIYPQGLLPTIRHYLPSAVDLSGVGLQRLKAQLT
FT                   KRHPVVAWVQGLDGFASHTVTLTGYTTATIRYNDPWRGQSGQMDNQAFETMWQLNGRRA
FT                   LSY"
FT   gene            553840..554814
FT                   /gene="pts9AB"
FT                   /locus_tag="JDM1_0523"
FT   CDS_pept        553840..554814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pts9AB"
FT                   /locus_tag="JDM1_0523"
FT                   /product="mannose PTS, EIIAB"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61412"
FT                   /protein_id="ACT61412.1"
FT                   /translation="MVSIIIASHGEFAKGIYQSGSMIFGEQENVQAVTLMPSEGPDDIK
FT                   AKLEKAIASFDDQEQVLFLVDLWGGTPFNQVNGLFEAHKDKWAIVAGLNLPMLIEAYAS
FT                   RLSMDSAHEIATHIIETAKDGVKVRPEALAPKEEKAAAAATTNNNAGRPGKLEYGLARI
FT                   DSRLLHGQVATAWSKTVNPTRIIVASDNVAKDELRTNMIKQAAPSGVKAHVIPIAQMIK
FT                   IAKDDKHFGGQKALVLFETPQDALRAIEGGVPIKTLNIGSMAHSAGKVQPNKVLAFDQD
FT                   DIDTYRKLEKDGIEFDVRKVPSDGKENMDNILNKAENMLKEQK"
FT   gene            554850..555656
FT                   /gene="pts9C"
FT                   /locus_tag="JDM1_0524"
FT   CDS_pept        554850..555656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pts9C"
FT                   /locus_tag="JDM1_0524"
FT                   /product="mannose PTS, EIIC"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61413"
FT                   /protein_id="ACT61413.1"
FT                   /translation="MNLNVIQVILVVLVSFLAGMEGILDEFHFHQPVVACTLIGLVTGQ
FT                   LVPCIILGGSLQMIALGWANIGAAVAPDAALASIASAIILVLGGQGRAGVTSAIAIAVP
FT                   LAVAGLLLTIIARTLATGIVHIMDRAAEEGSFSKIDFWQWVAICMQGLRIAIPAALILA
FT                   VGATPVKAMLNAMPSWLTDGLSIGGGMVVAVGYAMVINMMASREVWPFFALGFVLAAIS
FT                   EITLIGLGAIGISLALMYLALSKQGNSGNGGGSNTGDPVGDIIDKY"
FT   gene            555675..556607
FT                   /gene="pts9D"
FT                   /locus_tag="JDM1_0525"
FT   CDS_pept        555675..556607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pts9D"
FT                   /locus_tag="JDM1_0525"
FT                   /product="mannose PTS, EIID"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61414"
FT                   /protein_id="ACT61414.1"
FT                   /translation="MSETTNITKKVTLSKSDRLHVWWRSTFLQGSWNYERMQNGGWAYS
FT                   LIPAIKKLYTTKEDRAAALKRHLEFFNTHPYVASPVIGVTLALEEERANGAPIDDVTIQ
FT                   GVKVGMMGPLAGVGDPVFWYTVKPIVGALAASLAISGSIVGPILYFVVWNAIRMGFMWY
FT                   TQEFGYKAGSKITDDLSGGILQDITRGASMLGMFILAALIERWVKVDFSPVKVSTIKQQ
FT                   AGSYIDWDKLPKGASGVKEALTQQAAGRSLDKYKVTTLQDNLDQLIPGLMALLLTFLCM
FT                   WLLKKKVSPIIIILGLFVLGVLLHVIGWM"
FT   gene            556736..557122
FT                   /locus_tag="JDM1_0526"
FT   CDS_pept        556736..557122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0526"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61415"
FT                   /protein_id="ACT61415.1"
FT                   /translation="MVQSINTKVDLVTNGNSHMGLTDYGKIMVGDNGFEFYDDRNVRNF
FT                   IQIPWTEVKYVVVSVMFGGRWIPRFSFQTKRNGMITFSAKDPKKVLRAVRQYIEPDRIV
FT                   KSLTFFQVLGRIFKGKGKKDKYLK"
FT   gene            557427..560276
FT                   /locus_tag="JDM1_0527"
FT   CDS_pept        557427..560276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0527"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61416"
FT                   /protein_id="ACT61416.1"
FT                   /translation="MTRKSKICEYVRQHSDRHGLTTEMVATALMIARSNVSKELNALVR
FT                   EGQLHKLTGRPVHYVPVNATATTATTTSGVANGATTERIPTAPVATSVPKPVVNDIFAS
FT                   MIGSHESLANQVEQAKAAILYPPRGLNTLIIGPTGSGKTYFANAMYRFAETQQVLTNPQ
FT                   GLITFNCADYAHNPELLMSHLFGYVKGSFTGANEDKDGLIQEADGGMLFLDEVHRLPPE
FT                   GQEMIFYFMDHGTYSRLGETAKSHHANVRLVCATTEDPESTLLQTFVRRIPITIQLPAF
FT                   NHRSAKERLELLKALLSLEANRINKQIRLTEDVVQALLGSVTFGNVGQLKSNIQLVCAQ
FT                   GFVNSIENDSEITITMDDLPQNIRSGLMTVASNRHELGAISELLDPVLIVKPNDGPTPL
FT                   RNKNDNYELPYNLYEIIGDKAALLRREGLDKEHINRFITTDINVHLKSFYKQNQLEVSP
FT                   ENKLAEIVDQDVIDFTKTAQMTVQDMLGYNFKDNFIYAVSLHVSSFIKRIQAGKPMRQM
FT                   SSDMLAMVREYPAEIKAAEALKQGLEERYHLPIPKSEVYYLAILLISLKSMQLNGKVGV
FT                   LVAAHGMSTASSMAQVVGQLLDDYDVQAFDMPLDMDPSVAYDHVKRRVEKLDSGKGILL
FT                   LVDMGSLTTFGERIQQETGIATRTIDMVTTPVVLEAVRKASLVDSDLDSMYQELVGFKG
FT                   YSRISRNLPTDSQRATVKPALATDKTAQRAIIAICATGVGTAERIKSILDSLLAQNFIE
FT                   GITVFPISVVEMKTRIQQISQNYQIIAATGITKPELDVPFISLEELLQGGGEKFIDQLA
FT                   TGIDSPQTMAEESQQLTPELCERYLGDYFTFLNPKKLTGILWEYSEVIATHLDGVMTNA
FT                   FRIDLIMHLAGALERTAIKDEISAPTEEMPDIMASKWYPLVQQANQQLTDQLQLTFSDA
FT                   ENYYIVQLLETHQAKVAMS"
FT   gene            560347..560766
FT                   /gene="pts10A"
FT                   /locus_tag="JDM1_0528"
FT   CDS_pept        560347..560766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pts10A"
FT                   /locus_tag="JDM1_0528"
FT                   /product="mannose PTS, EIIA"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61417"
FT                   /protein_id="ACT61417.1"
FT                   /translation="MLAFVVVSHGSFAQGVVDSSYMIFGKQDKVQTVTFQLDEEPNELA
FT                   DKLAAAVARFDADDQVLFLVDLWGGSPFNAASRIVAEHTERMGLITGLNLPMLIEAYTV
FT                   RDKPIDEVIAHLEETGKIGIKHLKLLQDDGEDEPL"
FT   gene            560763..561281
FT                   /gene="pts10B"
FT                   /locus_tag="JDM1_0529"
FT   CDS_pept        560763..561281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pts10B"
FT                   /locus_tag="JDM1_0529"
FT                   /product="mannose PTS, EIIB"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61418"
FT                   /protein_id="ACT61418.1"
FT                   /translation="MTMDIRLARIDSRLLHGQVATVWTKTVSPNRILVVSDEVAQDALR
FT                   KILIVQAAPPGVKANVITVDKMIEIYQDSLFDEVKPLILTDTPQNMARLVAGGLDFSKT
FT                   GIDIGSLAFSAGMVMVTNAIAIGQAEARALYALQAAGLKVFAQKVPTDKRVDVMPLLAK
FT                   NGFMAPDKY"
FT   gene            561445..562416
FT                   /gene="fabH1"
FT                   /locus_tag="JDM1_0530"
FT   CDS_pept        561445..562416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabH1"
FT                   /locus_tag="JDM1_0530"
FT                   /product="3-oxoacyl-(acyl carrier protein) synthase III"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61419"
FT                   /protein_id="ACT61419.1"
FT                   /translation="MPTYTKLTAMGQYVPGRVVDNDELAAIMDTSDEWIQAHTGIETRH
FT                   YAMNDENTSDLATQVAQQLLQKSGLAASAIDLILVTTITPDALTPATACLVQANIGADN
FT                   AFAFDLSAACAGFTFGLATADKFIRSGQYQNVMVISAEVNSKMMDFQDRTAAVFFGDGA
FT                   GGALLQATDNPDENSLIAEKLESQGNATVIHSGRVRPITEVAATNYPQTDAFYQVGRDV
FT                   FQFATTVVPEQMRGLIASVQLTPSDLQYVICHQANLRIIEKIAANLALPMTKFPHNVDH
FT                   YGNTSSAGVAMALANVFDTLTGPVLLTAFGGGLAYGSVLIKK"
FT   gene            562427..562828
FT                   /gene="accB1"
FT                   /locus_tag="JDM1_0531"
FT   CDS_pept        562427..562828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accB1"
FT                   /locus_tag="JDM1_0531"
FT                   /product="acetyl-CoA carboxylase, biotin carboxyl carrier
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61420"
FT                   /protein_id="ACT61420.1"
FT                   /translation="MELKDLDRLVEKYARQGYQQIRVKAGDLEIEVTKPALASETVTPV
FT                   AATPASTVAETEDEVVTLPSPMVGVVHLAPDLKVGQSLTAGQELGQIESMKLFNPLVSP
FT                   TDGTLTAVLVADDATVEYEQPLFTMRKDR"
FT   gene            562831..564153
FT                   /gene="accC1"
FT                   /locus_tag="JDM1_0532"
FT   CDS_pept        562831..564153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accC1"
FT                   /locus_tag="JDM1_0532"
FT                   /product="acetyl-CoA carboxylase, biotin carboxylase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61421"
FT                   /protein_id="ACT61421.1"
FT                   /translation="MFRKLLIANRGEIAVRIIKACQQLNIQTVAVCSTADRHAGYTQLA
FT                   DEVVCIGPAAASGSYLNAEAILMAAINTHADAIHPGYGFLAENADFAAMCAECGIAWIG
FT                   PQTEQIKLMGDKARAKDFARQQAVPVLAGQSLQGLAWPDIKHAAAKIGFPLVLKASYGG
FT                   GGKGIRVLTDVHELHQQLRAARQEAAASFLNDAMYLEQFLTTARHIEVQVLGTGTKLFI
FT                   LGDRDCSLQLHKQKVLEESPASILTETQRRTLYDLSRQLLAGTHYQSLGTIEYLFADGQ
FT                   FYFMEMNTRLQVEHGVTELTTGIDIVAEQIKQAAGVTVDFPEHVGLQPKCTAIEARLTA
FT                   TLPVKQTRIETLSWPADVRVDTDYHQGDRLVTMYDGLIAKLMVTGANRQQAVRNLQRAL
FT                   AQVTLTGPTTNLTFLQQTVARPAYIHDQYTIHSLARWEASK"
FT   gene            564150..564953
FT                   /gene="accD1"
FT                   /locus_tag="JDM1_0533"
FT   CDS_pept        564150..564953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accD1"
FT                   /locus_tag="JDM1_0533"
FT                   /product="acetyl-CoA carboxylase, carboxyl transferase
FT                   subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61422"
FT                   /db_xref="GOA:C6VLJ0"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6VLJ0"
FT                   /protein_id="ACT61422.1"
FT                   /translation="MSHYPASGTWQACPKCGRHVHQRQWGTYQQCPYCHYWQRLTTAQR
FT                   LEQLVDEGSFQPLTMTERPVNQLGFPDYTNKLRRAQRQTGLNEAVVCGTALIEQQPCIL
FT                   AVMDSHFMMGTLNTAVTRRLLHASEQARAQRLPLIIVTASGGARMQEGVYALVGMNLIL
FT                   AELARLAATPLPLITVLTDPTMGGVSASFAFKGDLIIAEAGAKIGFAGARVIQQTLPVK
FT                   LPADFQTADQLFKNGMVDAVVERPQLRSTLGQALANYGIGRSAHG"
FT   gene            564946..565719
FT                   /gene="accA1"
FT                   /locus_tag="JDM1_0534"
FT   CDS_pept        564946..565719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accA1"
FT                   /locus_tag="JDM1_0534"
FT                   /product="acetyl-CoA carboxylase, carboxyl transferase
FT                   subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61423"
FT                   /protein_id="ACT61423.1"
FT                   /translation="MDKRLQRLRAADRISAPTIIQALLPTMTQQRGDRLLGQDAALTAG
FT                   FGRTATGRQLAVLGVDRGVDIASRRRKNGGALTVPGYRTALRVVTHAAKFGWPVVSLIN
FT                   MPGADASPRSERYGQSQAIADLIAATGQLTVPNVVVFLGEGHSGGALAFANANRIIMLD
FT                   DALFNVASPEAVTAILHGQQTSSDAIDLLPMTASALQSRGLVDLVIDHQDQTLVAAINQ
FT                   AIETQLAALEALPAPDLIEQREAKFQHFLQSWPVN"
FT   gene            complement(565786..566979)
FT                   /locus_tag="JDM1_0535"
FT   CDS_pept        complement(565786..566979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0535"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61424"
FT                   /protein_id="ACT61424.1"
FT                   /translation="MSENNNDNEMGPRQRRYREQQQRNPHLKPHKKRPWLITLLIVVVL
FT                   LIVTGGWWGYKTWNAAKDTMNTTYQSTGSTKLRNVDAVIKKGKPFSILLLGTDTGALGR
FT                   GKDFSARTDTMIVATINPKKESMTLTSIPRDTQVMIDGQSQKINAAYTIGGASGAVKSV
FT                   EKLLDVPIDFYVLLNMGGLKQIINAMGGVTVTPKLTFKYGNANVKKGVKIKLNGAAALD
FT                   YSRMRYDDPQGDYGRQKRQRQVIMAMVSQSNSLGSIANIEKITKKLAKNMRTDLTWNDM
FT                   VALDTKYKNASHHAKSYTVQGTDATIDGLSYQVASSSERYKNSKRIRKALGLSNSNLTE
FT                   SVFSETASITTGSSSSSSSSSSTTTSSDTTTYGTSTTQDTTTQDQTTTQDQTTTNQY"
FT   gene            567289..568251
FT                   /gene="mleP1"
FT                   /locus_tag="JDM1_0536"
FT   CDS_pept        567289..568251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mleP1"
FT                   /locus_tag="JDM1_0536"
FT                   /product="malate transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61425"
FT                   /protein_id="ACT61425.1"
FT                   /translation="MQILQTFVQSIQGVMTIIVMIAVGYLLARWGWFNESATKLIARLV
FT                   TQIALPAYMIATITKQFTAHKLLSTLPGLRFPVLNMAILFGISFGVMRALNIKKSHRGL
FT                   FASMFLNSNTVFIGLPVNQALFGNSALPYVLVYYMANTTIFWTLGVYLIQRDGTGTAKF
FT                   DLKQTLTKIFSPPLLGFMIGVLLVLGNIHVPKFLMDDFSYIGGLTIPLSMIFIGISMAN
FT                   AGLSSMRFDRDSLGILLGRFILAPVLMTLMLIPMSIPLEMKQVFILQSAMPVMTNAPVV
FT                   SKLYGADADYAAVMVTETTLLSLIVIPILMVIVQANFIR"
FT   gene            568684..569709
FT                   /locus_tag="JDM1_0537"
FT   CDS_pept        568684..569709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0537"
FT                   /product="transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61426"
FT                   /protein_id="ACT61426.1"
FT                   /translation="MKKAYLYIAISTLMFSSMEIALKMAGSAFNPIQLNLIRFFIGAIV
FT                   LLPFALRALKQTGRKLVSADWRLFALTGLVCVIVSMSLYQLAITVDQASTVAVLFSCNP
FT                   VFALLFSYLILRERLGRANLISVVISVIGLLIIVNPAHLTNGLGLLLAIGSAVTFGLYS
FT                   IISRYGSVKRGLNGLTMTCFTFFAGAFELLVLAWITKIPAVANGLTAIGLRQFAAIPVL
FT                   VNVNLNYFWLLFFIGVCVTGGGFAFYFLAMEQTDVSTASLVFFIKPGLAPILAALILHE
FT                   QILWTTVVGIVVILIGSVVTFVGNRFRERDTMGAIEQPTAAANDDEHVIKAAHAVSNQE
FT                   N"
FT   gene            569859..570536
FT                   /gene="pgm2"
FT                   /locus_tag="JDM1_0538"
FT   CDS_pept        569859..570536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgm2"
FT                   /locus_tag="JDM1_0538"
FT                   /product="phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61427"
FT                   /protein_id="ACT61427.1"
FT                   /translation="MTELVLVRHGESTANRDNTYTGWSDVPLTAVGIAQAHQAGKRLRA
FT                   TGLQFGAVHTSVLKRAIVTANIMLSEIDQLWLPEYKTWRLNERHYGALRGQNKDVTRQE
FT                   YGKAQVQQWRRSFYTVPPLLTPAELDHDRRYTKYGAAVEPRGESLKMAYDRIMPYWIDE
FT                   IAPRLLDGQNQLVVAHGSTLRAMIKYLEHISDTGIDGVEVANGVPICYHLDQQLHVIGK
FT                   EEY"
FT   gene            570956..571648
FT                   /gene="zmp2"
FT                   /locus_tag="JDM1_0539"
FT   CDS_pept        570956..571648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zmp2"
FT                   /locus_tag="JDM1_0539"
FT                   /product="extracellular zinc metalloproteinase (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61428"
FT                   /protein_id="ACT61428.1"
FT                   /translation="MMKHKNLLLLIIMSLGFCGMLLMFAPQISTLINPNASRVEADKAS
FT                   GHDTTHDQVYYNDQMDNYQYDYINNGTKVLNYKARFKSRVITYRITSDSKVYRAIWLRA
FT                   VERWNNTNTVRLVEAKDQAKAQITLGESEDETETTGSEIGRTWRTYYQSGSQGTTWMDS
FT                   AKCVIYTNRFPASNHSVEYKLSVATHELGHALGLEHENNKSAVMYYQSHRAAHITTREI
FT                   STLKQMYK"
FT   gene            complement(571838..573169)
FT                   /gene="pepC1"
FT                   /locus_tag="JDM1_0540"
FT   CDS_pept        complement(571838..573169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepC1"
FT                   /locus_tag="JDM1_0540"
FT                   /product="cysteine aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61429"
FT                   /protein_id="ACT61429.1"
FT                   /translation="MSKAISMNQIANFQADLDQRPEAKVIERSVTKNGILASSQDIQAM
FT                   SQTTPVFSIDLDTGDVANQKQSGRCWMFAALNTMRHSLAEKFNLKHFELSQNYTFFWDK
FT                   FEKANYFYENVLATADQPTSSRKVAWLMTTPQQDGGQWDMLVAIIQKYGIVPKSVMPET
FT                   YNSSKSAEINSTLNLKLRKDAVELRELVAAGTSDDAIQERKEKMLNEVYRMLAYAFGEP
FT                   VSHFDWEYRDDKKQYHIDQNLTPQSFFEKYVGWNLDDYVSIINAPTDDKPYNHTYTIEM
FT                   LGNVLGGREVKHLNVSMADFKQLAIKQLQAGQSVWFGCDVGQSSDRQKGVMATDVYSKD
FT                   ELFDVDLSMSKAERLDYGESLMTHAMVITGVDLVDGQPTKWKVENSWGDKVGTKGFFVM
FT                   SDAWMDEYCYQVVVNKEFLSDDLKAAQAEEPTVLAPWDPMGALA"
FT   gene            complement(573245..573928)
FT                   /gene="rpiA1"
FT                   /locus_tag="JDM1_0541"
FT   CDS_pept        complement(573245..573928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpiA1"
FT                   /locus_tag="JDM1_0541"
FT                   /product="ribose-5-phosphate isomerase A"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61430"
FT                   /protein_id="ACT61430.1"
FT                   /translation="MNQDQLKQLVGQKAVEYIQDGMQVGLGTGSTVKFMVDALGERVKN
FT                   EHLNIVGVSTSDRTAAQAKALGIPMKSVDEVDHLDLTIDGADEIADDFQGVKGGGAALL
FT                   FEKIVAINSDKVMWIVDESKMVHQLGAFGLPVEVIPYGSQHVFEKMAARGYNPVFRKVN
FT                   DELVRTDSNNIIIDLHIDPITDPHALAEDLIHMVGVVEHGLFLDMVNTVIVGHANGPEV
FT                   IEARP"
FT   gene            complement(573937..574233)
FT                   /locus_tag="JDM1_0542"
FT   CDS_pept        complement(573937..574233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0542"
FT                   /product="acetyltransferase (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61431"
FT                   /protein_id="ACT61431.1"
FT                   /translation="MEFTREAHRFYFNDDHGKLAGEITFPAINNDQTWVIEHTFVRDDF
FT                   GHQGIAGQLTKAVIDAARVEHKRIQPLCTYAKAYFDRHPEAADVLVTSSQSKE"
FT   gene            574372..574908
FT                   /gene="dut"
FT                   /locus_tag="JDM1_0543"
FT   CDS_pept        574372..574908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dut"
FT                   /locus_tag="JDM1_0543"
FT                   /product="trimetaphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61432"
FT                   /protein_id="ACT61432.1"
FT                   /translation="MARGFEIVSQYAQAGLHVPYRTTKQAAGYDFEAAEDFTLPSIWKM
FT                   NFIKVLWQIHHGETSSAVDLDAAAKVLKPWLVPTGIKAFMNDGEYLLLANRSSNPLKRN
FT                   LILPNGIGVIDADYYNNPKNEGAIFVQLINMGIRDVHIKKGERIAQGIFTPYLTVTDET
FT                   NVTTTRSGGFGSTNK"
FT   gene            576034..577413
FT                   /gene="radA"
FT                   /locus_tag="JDM1_0544"
FT   CDS_pept        576034..577413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="JDM1_0544"
FT                   /product="DNA repair protein RadA"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61433"
FT                   /protein_id="ACT61433.1"
FT                   /translation="MAKAKTQFVCSNCGYSTPRYLGRCPNCGEWNTLTEEHFDTKPDRK
FT                   SRVSFAGKSAKPQRLKEVSLTKTPRVKTKLKEFNRVLGGGVVPGSLVLIGGDPGIGKST
FT                   LLLQVSGQLAETGGSVLYVTGEESASQVKMRADRLAVSSEDFYLYPETDMSNIRSTIES
FT                   THPEFVVIDSVQTMQEPDMDSAIGSVSQIREITAELLQIAKTNGITIFIVGHVTKGGAI
FT                   AGPKILEHMVDTVLYFEGDLHHTYRILRAVKNRFGSTNELGIFEMRTGGLYEVANPSEI
FT                   FLEERLKDATGSAIVVSMEGTRPILVEVQALVTPTVFGNAKRTASGLDHNRVSLIMAVL
FT                   EKRASLMLQNQDAYLKAAGGVKLDEPAIDLAIAVSVASSYRDQQTRPSDCFVGEVGLTG
FT                   EIRRVNRIESRVGEAAKLGFKRIFIPKNNLQGWDIPTGIEVIGVATLKEALQLALQQPN
FT                   Y"
FT   gene            577593..578603
FT                   /locus_tag="JDM1_0545"
FT   CDS_pept        577593..578603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0545"
FT                   /product="PilT family ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61434"
FT                   /protein_id="ACT61434.1"
FT                   /translation="MFLANAAVRLVDRVEKNLSKQNPMTLLFGSIGFIIGLLIAVLISQ
FT                   LFNRSPLFLLNTVVPIILMLFFGYIGARVGTTRIDEWRKVFNFRRREKETSPEITDAQP
FT                   DQNYHHYKILDTNILIDGRIYDIVKTGFLEGTLLVPNFVLYELQYIADSADSIKRVRGR
FT                   RGLDILNKLQNENIIPVEMYEGDFEDIPEVDSKLIQLAKKVNGVIVTNDYNLNKVIEFQ
FT                   NVQVLNINQLAKSLKPRVIPGEEMNVMVVKNGSERQQGVGYLDDGTMVVVEDGKFYINE
FT                   KVDVVVTSALQTDAGRMIFARLAHANRGIPDHADGNNKHNNNHSNNRNNNRDNRH"
FT   gene            578927..580417
FT                   /gene="gltX"
FT                   /locus_tag="JDM1_0546"
FT   CDS_pept        578927..580417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="JDM1_0546"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61435"
FT                   /protein_id="ACT61435.1"
FT                   /translation="MAKSKIRVRYAPSPTGHLHIGNARTALFNYLFARHNKGKFILRIE
FT                   DTDLKRNVKDGEKSQMDNLTWLGIDWDEGPDKGGDFGPYRQSERKSIYDPLIQQLIDEG
FT                   KAYESYMTEDELSAQREAQKARKEMPHYVYEFAGMTEDEKQAKIAAAKAAGIQPVIRFH
FT                   VPENTTYAWDDMVKGKVSFESKTVGGDFVIKKRDGMPTYNFAVVVDDHMMEISHVFRGD
FT                   DHVANTPKQLMIYEAFGWQPPKFGHMSLIINTETGKKLSKRDETVLQFIEQYRELGYLP
FT                   EAMLNFIILLGWSPVGESELFSKREFIKMYDEKRLSKSPAAFDGKKLEWVNNQYIKKAD
FT                   ENEVFAMSIRQLIKAGRLPQRPDMSQIEWTRTLVSLFKNQMSYTGQIVDLADLFFNGPA
FT                   DINDEAKAELDNDTALPVLKEFRQRIEDIDVFEATAIQKTIKSIQKDTKIKGRALYMPI
FT                   RIAVSHEMHGPELPETIELLGRETTKKHLDAMIAELAK"
FT   gene            580695..582107
FT                   /gene="cysS"
FT                   /locus_tag="JDM1_0547"
FT   CDS_pept        580695..582107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="JDM1_0547"
FT                   /product="cysteine-tRNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61436"
FT                   /protein_id="ACT61436.1"
FT                   /translation="MLSVFNTLTRQKEPFKPITPGVVKMYVCGPTVYNYIHIGNARSAI
FT                   AFDTIRRYFEYCGYHVDYVSNFTDVDDKLIKRAAEDHTTVPAVADRFIKAFMEDTTAVN
FT                   IEPATVHPRASENIPEIIAFVQALIEKGYAYESAGDVYYRARKFKKYGQLSDQRIDDLE
FT                   VGASQHTADEETDRKEDPIDFALWKAAKPGEISWESPWGAGRPGWHIECSVMSTKYLGD
FT                   TFDIHGGGQDLEFPHHENEIAQSEAKTGKTFANYWLHNGFVTVGDDNEKMSKSLGNFVT
FT                   VHDIIKTVDPQVLRFFMATTQYRRPIQYTQANLDEAANNLDKLRNAYRNLTFRLQDATN
FT                   GTDTAVAEQLQTLITNFGTAMDDDFNVQNGVAAVYELAKLANVYAAKATVQKETLIALQ
FT                   KALVQLTGVFGVTFETANATLADDAIQALIDEREAARKAKDFAKADQIRDDLKAQGIIL
FT                   EDTPQGVRFRKE"
FT   gene            582109..582519
FT                   /locus_tag="JDM1_0548"
FT   CDS_pept        582109..582519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0548"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61437"
FT                   /protein_id="ACT61437.1"
FT                   /translation="MQVDYQQLNGIALAYLGDAVYEPFIRQHLIESGFTKATKLHHHAT
FT                   HYVSAKAQAALIERMQAEEVLTPTEVDVFKRGRNAKSHTSAKHTDVVTYRISTGFEAVF
FT                   GYLQLTQQADRIAELAQWCIKQVDEGRVSSVK"
FT   gene            582509..583276
FT                   /gene="trmH"
FT                   /locus_tag="JDM1_0549"
FT   CDS_pept        582509..583276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmH"
FT                   /locus_tag="JDM1_0549"
FT                   /product="tRNA/rRNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61438"
FT                   /protein_id="ACT61438.1"
FT                   /translation="MSNNEQDQTAADFVIGRHPAMAAIKSDQQINKVFIQSGLQADVLN
FT                   DIAKIAKKRNLIVQYVPKQKLDRLTDNANHQGVAVGVAAFEYATIDDLFAVAKAKNEAP
FT                   FFLILDNIEDPHNLGSIMRTADAAGAHGIIIPKRRAVGLTSTVAKTSTGAIEHVKVARV
FT                   TNLVQTVKQLQEAGLWIFGTDMNGTDYRQWDASGAVGLIIGNEGKGISPLLKKSVDEML
FT                   TIPMIGHVQSLNASVAASLLIYQGYTSRHPLGK"
FT   gene            583278..583823
FT                   /locus_tag="JDM1_0550"
FT   CDS_pept        583278..583823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0550"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61439"
FT                   /protein_id="ACT61439.1"
FT                   /translation="MKQQLLIVDAYNMIGNWPELNHLKQTDRLPQARDELISMLTEYKK
FT                   ITGLNISLVFDAMYVPGNSKSYRQADLEIIWTSKDQTADSYIEKYAGEKQSRVLQVTVA
FT                   TSDQAEQWVIFSEGALRVPALELRHRVKTALKDVRHTAVRTQDLGAVRKSPWNDDQLSA
FT                   LDQYRQQLERNHVKHHHK"
FT   gene            584330..584932
FT                   /gene="sigH"
FT                   /locus_tag="JDM1_0551"
FT   CDS_pept        584330..584932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sigH"
FT                   /locus_tag="JDM1_0551"
FT                   /product="DNA-directed RNA polymerase, sigma factor 30"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61440"
FT                   /protein_id="ACT61440.1"
FT                   /translation="MQFLKLVRSEECHVNEQQLIHLAADGDDASINALAQQYVPVVWRL
FT                   RRQYYVRNFDEDDWLQEGRIAVYRAAKKYQRLRQCSFGTYYRVLLSNQIIDHIRRTQAR
FT                   KRRPEGDILSLDVNDEDILCNIQTLRASTLDVVHVREQVRIFPAICSAFEGLVFMDLLA
FT                   GQSPERIALSRQVEVDQVVNATDRCRKKMRDFLQDAA"
FT   gene            584994..585143
FT                   /gene="rpmG"
FT                   /locus_tag="JDM1_0552"
FT   CDS_pept        584994..585143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /locus_tag="JDM1_0552"
FT                   /product="50S ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61441"
FT                   /protein_id="ACT61441.1"
FT                   /translation="MAQKKVALACTVCGSRNYTIDANPNRTDRLEVKKFCKYCGKHTLH
FT                   RETR"
FT   gene            585155..585340
FT                   /gene="secE"
FT                   /locus_tag="JDM1_0553"
FT   CDS_pept        585155..585340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="JDM1_0553"
FT                   /product="preprotein translocase subunit SecE"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61442"
FT                   /protein_id="ACT61442.1"
FT                   /translation="MRSFKFFGQVGHEMKKVTWPTWRENRRDSWTVVSTSLFFVAFFAL
FT                   FDWIIQLLLQMLTSWH"
FT   gene            585445..585993
FT                   /gene="nusG"
FT                   /locus_tag="JDM1_0554"
FT   CDS_pept        585445..585993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="JDM1_0554"
FT                   /product="transcription antitermination protein NusG"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61443"
FT                   /protein_id="ACT61443.1"
FT                   /translation="MVESVEKRWYVLHTYAGYENKVSSNLESRIQSMGMEDNIFRVVVP
FT                   EEEAHEVKNGKDKVEMKKIFPGYVLVEMVMTDQAWYIVRNTPGVTGFLGSHGQGSKPTP
FT                   LLPEEAEQILHQLGMSARHTELDVEVGEQVTIIDGAFSGLSGEITEIDNEKMKLKVNIN
FT                   MFGRETSTELDFDQVDQIR"
FT   gene            586021..586908
FT                   /locus_tag="JDM1_0555"
FT   CDS_pept        586021..586908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0555"
FT                   /product="cell surface hydrolase, membrane-bound
FT                   (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61444"
FT                   /protein_id="ACT61444.1"
FT                   /translation="MAEVILVIIGALVLGILGRITFKFWQYGRPQHLRQSVSANSADDS
FT                   AVTLFIPGYAGNRFSFGGMLQRFTAGGIANKSLVVMIDRHNHPHVTGELDAYRPMVQLI
FT                   FATPRVAVRQQAAGVLAVVQYLIAHEHVQTINLVAHSMGGVVLFQYLTTAAKLVNLPEV
FT                   RKVVTIGAPFNDSEVGQNTYPIENHPLTATGPTKTTPVYNYFLRTLQRLPNTISYLNIA
FT                   GNIGDAAQSDGAVALNSALSLRFLLRPTRDQYQEFVVHGKNARHSRLHENYEVDRQIVQ
FT                   FLYPEATKKVASEK"
FT   gene            587010..587435
FT                   /gene="rplK"
FT                   /locus_tag="JDM1_0556"
FT   CDS_pept        587010..587435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="JDM1_0556"
FT                   /product="50S ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61445"
FT                   /protein_id="ACT61445.1"
FT                   /translation="MAKKVANVVKLQIPAGKATPAPPVGPALGQAGINIMGFTKDFNAR
FT                   TADQAGMIIPVVITVYEDRSFDFITKTPPAAVLLKKAAGVESGSGEPNTKKVATVTKDQ
FT                   VKQIAETKMQDLNAADVEAAMRMIEGTARSMGFTVEG"
FT   gene            587536..588225
FT                   /gene="rplA"
FT                   /locus_tag="JDM1_0557"
FT   CDS_pept        587536..588225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="JDM1_0557"
FT                   /product="50S ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61446"
FT                   /protein_id="ACT61446.1"
FT                   /translation="MAKKSKQYQDAAKLVDRDKAYDVTEAVDLVKKMDFAKFDATVEVA
FT                   FKLNVDTKQADQQLRGAVVLPNGTGKDQTVIVFAKGDKAKEAEEAGADFVGETDLVQKI
FT                   QDGWLDFDVAIATPDMMAQVGRLGRVLGPKGLMPNPKTGTVTMDVAKAVNDSKAGKVTY
FT                   RTDRDGNVHVPVGKVSFDTDKLVGNFKTIEDTIVKARPASVRGTFIQNLVVTSTFTPAV
FT                   RVDLASF"
FT   gene            588424..588927
FT                   /gene="rplJ"
FT                   /locus_tag="JDM1_0558"
FT   CDS_pept        588424..588927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="JDM1_0558"
FT                   /product="ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61447"
FT                   /protein_id="ACT61447.1"
FT                   /translation="MSKETIAVKAQEVEEVAEQLKSSVSAIVVDYRGLTVEQVTDLRKQ
FT                   LREAGVKMRVIKNKIMVRAADKAGFEDLKPVFAGPTAVAFSEEDPVAPAKILANFAKTA
FT                   DALQLKGGVIEGKVADLETVQEYATMPSREELLATIANLLQAPVRNVAYAVKAVAEKGD
FT                   EDAA"
FT   gene            588989..589357
FT                   /gene="rplL"
FT                   /locus_tag="JDM1_0559"
FT   CDS_pept        588989..589357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="JDM1_0559"
FT                   /product="ribosomal protein L12/L7"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61448"
FT                   /protein_id="ACT61448.1"
FT                   /translation="MAFDKDAIIDSLKEASISDLNDLVKAIEEEFDVSASAPVAVAGAA
FT                   GGDAAAAKDSYDVELTESGDQKVKAIKAVRDITGLGLKDAKGLVDNVPSIIKEGVSEDE
FT                   ANDMKAKLEEVGGVVTLK"
FT   gene            complement(589721..590698)
FT                   /locus_tag="JDM1_0560"
FT   CDS_pept        complement(589721..590698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0560"
FT                   /product="prophage Lp1 protein 65"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61449"
FT                   /protein_id="ACT61449.1"
FT                   /translation="MALIGTILLFATLYWFWRLHRRYRGRQWWQHSWPAIIALLVSFSI
FT                   LGTSDESTQPTVKTKTVTRTHLVTANNDKQLTALQAANRASASSLKQAVKKLSSSQQHI
FT                   DKLKTKNKQAGATSTTAPTKVNSDHNPSNTTLASKTYNGQQTITINQNQPAFTAKELST
FT                   SQGAWQQYGNLDSLNRVTAANALLNQSLMPKAEREALNVRPTGWHNKRISSGWLYNRSH
FT                   LIGYQLTGQNNNIKNLMTGTRSLNDPEMTTYENQVAAYLKESPKNYVRYQVTPIFKGNE
FT                   LLARGVQMRGQSVGSNAVSFNVYIFNIQPGMTLNYTDGTSQVSH"
FT   gene            complement(590711..591379)
FT                   /locus_tag="JDM1_0561"
FT   CDS_pept        complement(590711..591379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0561"
FT                   /product="prophage Lp1 protein 66, lipoprotein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61450"
FT                   /protein_id="ACT61450.1"
FT                   /translation="MHHAKKLVVALTSLLILTGCTTGNQQAANHTSVKTKTVRVEKRTA
FT                   ANKAAWAKAKAASRANAASAKALSSNTTQLAIATSQAKRQSEQLKAKHDDAMASSKSAS
FT                   QAAAKSAASEAAAQSRSQSEAQSASAVAAVSQSKQAAKASSQAASQSQQTQTSTATTSR
FT                   QNNFSGDTDTAQTGRIVGNRNSKIYHVETGQNYRMAGKNAVYFSTEDAARAAGFRKSFR
FT                   "
FT   gene            591728..594286
FT                   /locus_tag="JDM1_0562"
FT   CDS_pept        591728..594286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0562"
FT                   /product="integral membrane protein (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61451"
FT                   /protein_id="ACT61451.1"
FT                   /translation="MGIIKALFVFSVLLFVITEVGKIAKEVSGAQLANALASQSWWHLL
FT                   SMVVIGIIAVTPMLTYDVMITKFLPNHYSLGYILKAGWITNTFTNIGGFGGVLGASLRA
FT                   NFYNREATKKQIVFAISKIALFLVSGLSLYCMISLVLVYGFGIGNMYGSYWIWLVGGAL
FT                   YFPAIFIFTRVNDSEFFDGLTLGNVVRLLSGSFGEWTGCVLFFLLIGNFMGLPIDFAAV
FT                   VPLFVIASVVGEVSMVPGGIGSFDVFMIFGLGAVGVSRPDAVAWLLFYRLFYYIIPFAI
FT                   GLVLFIHDTGHRLNVRLAGIPKQALQRVAQMVLTVFLYFSGFLMLLMSTVPNFAYNNKL
FT                   FLQFYPYTFFFINQASSIIMAFLLIGVALGTAGRVKKAFWPTVIVLLIAILNTIRWLVV
FT                   YDAISMKFVIFLIVILALVALSRHAYYRDRLAFSWGQTLWVSCVYVVTFILYTIVGVYN
FT                   APQIHHRHAVPEALFFPSQKLWLFGVIGLVLAAMILIIMYRYFASGYNARLRQKMDAAR
FT                   VKQVIETYGGNEISHLAYLNDKLAYYYQVDGVDQLIFLYQQKADKLIIMGEPFGNQAVL
FT                   QAALEQLLDDADSDGCSLVFYEISEMLTMRLHEMGFDFIKTGEEGHVKLADFSLAGKRL
FT                   RGERALMNKFTRDHYEFAILQPPFSADVMAELRAVSDSWLAGETEKGFSLGFFDEQYLN
FT                   QAPVAVVYDPDRRIVAFANIMPQGNHQTTSIDLMRSSKSAPSGIMDTVFVHLFEQARDD
FT                   GYAYFNMGMAPLSGVGVSRYSFIQEKIAHLIYEYGYQLYGFQGLRSYKEKYVTEWEPKY
FT                   IAYRKRNSLIFTILQLLQVVNTRVHKSERHRPVWLLKRLK"
FT   gene            594573..595238
FT                   /locus_tag="JDM1_0563"
FT   CDS_pept        594573..595238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0563"
FT                   /product="transcriptional regulator, xre family"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61452"
FT                   /protein_id="ACT61452.1"
FT                   /translation="MELGQALKLQREALGLTQQVLADQLHVTRQTVSRWENGSTYPNLD
FT                   TLVELSDRLQISLDKLLKSDEVPVAPVVHQISRDVQLKRRYLRGLIVTVSLIVLLGGLI
FT                   VLLSWGHRNQIAAIDRVNPFLTTKLGYGVLPTKVTGMTDTYVSDDPFGKGSWLKFYSGQ
FT                   PTKTARWVLVKHKGSYVSAVRIVRRDQIPLVMREQAGSTYFKYHKQTEGPRASWQFWD"
FT   gene            complement(595536..596111)
FT                   /locus_tag="JDM1_0564"
FT   CDS_pept        complement(595536..596111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0564"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61453"
FT                   /protein_id="ACT61453.1"
FT                   /translation="MAIHNICVFCGSNSGLDPAFSEKTVALGQYLAANDYQLVYGGGDH
FT                   GLMGKVAKATMDAGGRVIGIIPHFLVARELAFKDVTTFIETRTMTERKEKMLHLADAFI
FT                   VLPGGFGTFEEFLQMLSWSQMDIHQKPIALYNIDGFYDDLVAMLQKTADLGFAPEANLD
FT                   LFINGHDLDEIFAGFHDFKHVLPPKYTN"
FT   gene            complement(596193..597203)
FT                   /gene="nrdF"
FT                   /locus_tag="JDM1_0565"
FT   CDS_pept        complement(596193..597203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdF"
FT                   /locus_tag="JDM1_0565"
FT                   /product="ribonucleotide-diphosphate reductase subunit
FT                   beta"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61454"
FT                   /protein_id="ACT61454.1"
FT                   /translation="MATDLAYYQKLLSNGNYKAINWDRVSDAIDKSTWEKLTEQFWLDT
FT                   RIPVSNDMADWRELDDDHRWVVGHVFGGLTLLDTLQSQDGLQALRRNVLTSHETAVLNN
FT                   IQFMESVHAKSYSTIFETLNTPDEINEIFDWSDSEEFLQAKAQWIYKLYDNIDEDPLKQ
FT                   KVANVFLETFLFYSGFYTPLYYLGHNQLPNVAEIIKLILRDESVHGTYIGYKFQLGFKD
FT                   RSEKQQAEFKDWMFDFLYKLYENEENYIHLVYDQIGWSDEVLTFSRYNANKALMNLGQD
FT                   ALFPDTAEDVNPVVMNGISTGTSNHDFFSQVGNGYRLGQVEAMQDTDYDIGNPDD"
FT   gene            complement(597231..599396)
FT                   /gene="nrdE"
FT                   /locus_tag="JDM1_0566"
FT   CDS_pept        complement(597231..599396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdE"
FT                   /locus_tag="JDM1_0566"
FT                   /product="ribonucleotide-diphosphate reductase subunit
FT                   alpha"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61455"
FT                   /protein_id="ACT61455.1"
FT                   /translation="MTLKDLKDVTYYDLNNEINIPVNNQIPLNKDQEALAAFLEQNVEP
FT                   NTMKFDSLKARFDYLREHDYLETPAIDKYDFSFIEKLYDYLRSQDFHFKTFMAAYKFYA
FT                   QYALKTDDGDYYLENFIDRVAMNALYFADGNEDLAMDLADEIVHQRYQPATPSFLNAGR
FT                   ARRGELISCFLIQSTDDMNSIGRTINSALQLSRIGGGVGINLSNLRGAGDPIKHIDGAA
FT                   SGVVPVMKLLEDSFSYSNQLGQRQGAGVVYLSVFHPDIIAFLSAKKENADEKIRLKTLS
FT                   LGVTVPDKFYELIKADADMYLFSPYGVEREYGVPFSYVDITKEYDNMVKNPNIRKTKIK
FT                   ARDLENEISKLQQESGYPYVVNIDTANRENPIDGKIVMSNLCSEVMQVQTPSLIDDQQQ
FT                   YEKLGTDISCNLGSTNIVNLMTSPDFGHSVEAMVRALTFVTDHSNVDVVPSIQKGNRQA
FT                   HTIGLGAMGLHAFFAKNQMEYGSKEAVDFTNIYFLLLNYWTLKASNEIARERHETFVNF
FT                   EKSKYADGSYFDKYTTQDWQPKYDKTTALFDGIFIPTKADWEALKEAVMRDGLYHQNRM
FT                   AVAPNGSISYINDTTASLHPIINRVEERQEKKIGKIYYPAPYLSNDTINYYKSAYDTDM
FT                   RKVIDVYAAAQQHVDQGMSLTLFMRSTIPAGLYEWKDGRTDKMTTRDLNILRNYAYRKG
FT                   IKSIYYIRTFTDDDGEVGVNECESCVI"
FT   gene            complement(599535..599765)
FT                   /gene="nrdH"
FT                   /locus_tag="JDM1_0567"
FT   CDS_pept        complement(599535..599765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdH"
FT                   /locus_tag="JDM1_0567"
FT                   /product="glutaredoxin-like protein NrdH"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61456"
FT                   /protein_id="ACT61456.1"
FT                   /translation="MKKVTVFTKNNCMQCKMTKKFLTAHNIAFEEKNINTNPEYVDYLK
FT                   NQGFHAVPVVEINGEDSIAGFRPDALKQLAV"
FT   gene            599988..600596
FT                   /gene="rsmc"
FT                   /locus_tag="JDM1_0568"
FT   CDS_pept        599988..600596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsmc"
FT                   /locus_tag="JDM1_0568"
FT                   /product="16S RNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61457"
FT                   /protein_id="ACT61457.1"
FT                   /translation="MTNYYYTHNPDIVHDEKQWNFEIFNHSFKFTTDNGVFSKRTVDYG
FT                   SRTLLAAFDPTDLPAGPMLDLGTGYGPIGMALAYQSPERTVDMVDVNELALSLARKNVA
FT                   LNQITNTNIFTFDVYQQVTATNYAAIVTNPPVRAGKAVVDAMLTGAVSRLVVGGTLTVV
FT                   LQKKQGAPSAKKLMQTTFGNCQVIKKDKGYYILQSVKEG"
FT   gene            600599..601105
FT                   /locus_tag="JDM1_0569"
FT   CDS_pept        600599..601105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0569"
FT                   /product="cytosine/adenosine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61458"
FT                   /protein_id="ACT61458.1"
FT                   /translation="MTEPTAEDWMQEALHEARMAYLIGEVPIGAVIVHQGEIIGRGHNL
FT                   REHGQDATMHAEIIAIQEACEYLHSWRLADCQLYVTLEPCLMCSGAIINARLPELYFGA
FT                   RDPKAGAVRSLYQVMDDTRLNHQVTVHERILARPAGEMLENFFRGIRKRKKAAKKARRE
FT                   AAEKN"
FT   gene            601631..603328
FT                   /gene="dnaX"
FT                   /locus_tag="JDM1_0570"
FT   CDS_pept        601631..603328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="JDM1_0570"
FT                   /product="DNA-directed DNA polymerase III, gamma/tau
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61459"
FT                   /protein_id="ACT61459.1"
FT                   /translation="MYRALYRVWRPQRFDEIVGQQMITQTLKNAIMTHQTSHAYLFTGP
FT                   RGTGKTSAAKIFAKAINCHHLVDGEPCNECETCTAITKGQLNDVIEIDAASNNGVEEIR
FT                   DIRDKAKYAPTQADYKVYIIDEVHMLSTGAFNALLKTLEEPPANVIFILATTEPHKIPL
FT                   TIISRTQRFDFRRITAKDSYDRMVYILNEKDVTYDEKALRVIAAAAEGGMRDALSILDQ
FT                   VISFGDNTVTLDDALMVTGSVTKQLLANYVSEVTDHDTKPALETMRQILQEGKDANRFI
FT                   EDLISYTRDVLLYQQAPEMVDSVAMGEDDQQFEAFAKQIDAEVLYQMVKTLNDIQQQMR
FT                   FTTHPDVYLEVLTVKLAQLDGQAAVQPVAAATVNPEDPTVHKLAQQVEQLQSEVKTLRS
FT                   QGGSVTKPAPAKPRSSNGPVVKKVNVSQIYPILGAATKNDLIKVRDVWTDLMNILSVTQ
FT                   RALMHVAQPVAASSEGVVVAFDYAFVYQKAIDDQTLIDALGNGLDRLMGQAPKIVCVPK
FT                   EQWPQIRKDYLATHQPGGATSEQQAPAKEPVVEEAKNMFGDLVEVQPD"
FT   gene            603350..603658
FT                   /locus_tag="JDM1_0571"
FT   CDS_pept        603350..603658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0571"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61460"
FT                   /protein_id="ACT61460.1"
FT                   /translation="MMRGMGNMQSMMKQMKKMQAQMTAEQAALNEQTFTGAAPDDMVKV
FT                   TFTGDKKMKDITINPDAVDPDDVDMLQDLVVAAVNDALTKVDEQTQSTMGKYTKGLQ"
FT   gene            603674..604273
FT                   /gene="recR"
FT                   /locus_tag="JDM1_0572"
FT   CDS_pept        603674..604273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="JDM1_0572"
FT                   /product="recombination protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61461"
FT                   /protein_id="ACT61461.1"
FT                   /translation="MQYPEPIAKLIDSYMKLPGIGGKTATRLAFYTIDMNGDDVTEFAK
FT                   SLIAAKRDLHFCSICGNITEDDPCVICKDKSRDQSTVLVVEEAKDVMAMEKVKEYNGLY
FT                   HVLHGVLSPIDGKGPEDINIASLLKRLQQNEAIKEVIIATNATPEGEATAMYISRLVKP
FT                   AGIKVTRLAHGLSVGSDIQYADEMTLFKAVEGRQEM"
FT   gene            604288..604539
FT                   /locus_tag="JDM1_0573"
FT   CDS_pept        604288..604539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0573"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61462"
FT                   /protein_id="ACT61462.1"
FT                   /translation="MFKRKQKIKHPKEVFDEQLLSTLNAAKLDWDRAKQNQEAVYDNNT
FT                   SELVTQTALARAKYLYLYREARLRQVHGQTIQRSVIDK"
FT   gene            complement(604892..606940)
FT                   /locus_tag="JDM1_0574"
FT   CDS_pept        complement(604892..606940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0574"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61463"
FT                   /protein_id="ACT61463.1"
FT                   /translation="MEVNDIKHGEDILELLLQPSSYVDFNRIHEVLHISRRTFFYALKK
FT                   INHYLDDNDLDTIQNVKGVGYHLSDDTKHTLLKEFSDSKTISQVFSQRDRKLLTMLSLI
FT                   NHEYVSLENNQRRFHITHHTAVSDLKALKVTALNYGLTIISGTNGTSLTGTERNQRNWF
FT                   LTVLGENGPLINSALKIDPNTSLEITHFLRTLETDTGNYFSDDTLTILITFFSWYLNRL
FT                   LTNHSFELKQNDANMSEQVGIINNWAKAFLCHYQIYNVNEQLFITYLVKSGQFIHINPD
FT                   NKLAHKLAPIVRQIIRRFNDVSGSQISVESLEVPLLTHLLSTYYRVKYQITFKQPSLSI
FT                   IMKQYNELIFFTRLSLKPFEDLIDQRLSDEEVTLVAIYFGGILRKENKPDYAVDVVCSS
FT                   GIGTSKVLHEELCQRYPNVKFSEPMSVFKLKNSHSRNIKLIISTIKLTDSYPVPTIVVA
FT                   PIPTKIQWQQINQALISLKIIKRSSHNALTVTNLMDIIGDYARISNPVALESALSNLLA
FT                   KNQPTPETALTNSIGLQELLSLDNILISQRDDLSWKDAIINAFTPLFKKGYINRHYIDT
FT                   IIASTVEHGPYMVIGNGVMLAHARPADGVRKVGMSLLVLKKPIKIYDENTKHAKRINVI
FT                   IGLAPIDAAEHVLALSQLVKLLQQPHWLANIENATNAQMVYDSCFPN"
FT   gene            607072..607509
FT                   /locus_tag="JDM1_0575"
FT   CDS_pept        607072..607509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0575"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61464"
FT                   /protein_id="ACT61464.1"
FT                   /translation="MQLLDSSLVQLDVTVDSWQSAIRCAAEPLVKNKFVTKEYPERVIE
FT                   IAEKDGPYIVIAPHIALSHAAVSDGALKNGLGLTVLTEPVKFGNKVNDPVSLVFTLSSV
FT                   GDDIHLSQMAALVNVLQKTRVIEKVTRSNDVNEVIDLFNER"
FT   gene            607561..607791
FT                   /locus_tag="JDM1_0576"
FT   CDS_pept        607561..607791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0576"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61465"
FT                   /protein_id="ACT61465.1"
FT                   /translation="MLTVQVRNVASKNGWDVDCEHASLDAVGSFRGDLIISLSDVAKEL
FT                   EDEGVKTPIIGIDSLMDSNEIERKMTPYIGK"
FT   gene            607802..609064
FT                   /gene="ulaA"
FT                   /locus_tag="JDM1_0577"
FT   CDS_pept        607802..609064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ulaA"
FT                   /locus_tag="JDM1_0577"
FT                   /product="ascorbate-specific PTS system enzyme IIC"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61466"
FT                   /protein_id="ACT61466.1"
FT                   /translation="MLKFLISLFSSPAILLGAVAFIGLVSQKGKDATDVTKGTIKTIVG
FT                   FLIFQIGASTITTTLQSFNVLFKEGFHIHGVIAAPEAATAMAQGKYGFVVALTLILGFA
FT                   MNLVFARITPFKNIFFTGGHSLFFACVLALILKFEGLNDLWAIIFGGAILGFCSTALPA
FT                   LCQPFMRKITGGDAQAIGHFNMIGYATSGLVGTLFKKHADETTENIKFPKFLSLFKDFI
FT                   IGVAIVMLIMFYIATFAAGQVATAKISGGVHWLVFPLIQALTFTVAMSVLMYGVGMFLE
FT                   EITNAFVAISTKYIPGSRPALDVPTIFPYAPTAVLVGFIGSYAAGLLGIVIMTVFHFST
FT                   VIIPAAHICFFSGGAAGVFGNSTGGWRGALAGSFVMGLMLSFLPLLLLPVLQQMGIQGS
FT                   TFPNVDYNVIGILLKQVFSIF"
FT   gene            609079..609717
FT                   /locus_tag="JDM1_0578"
FT   CDS_pept        609079..609717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0578"
FT                   /product="2-keto-3-deoxy-6-phospho-gluconate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61467"
FT                   /protein_id="ACT61467.1"
FT                   /translation="MDMQKAEITKEIRDYGIMSVVRADVQTSLNIAEAGLKGGVKLIEL
FT                   SFTVPTAQESIKQVKKNFPEIIIGAGTVLDAVTARIAILSGTDFILSPEFDKDVALICN
FT                   RYQVPYLPGCNTVTEAVEAMTYGAAFIKVFPGSAIDGPKWINTVKTPIPNMPILASGGG
FT                   NFDNFNDFLDAGADCVAFGGLLANGSLQQIESNAHKLTEQLEAYRKNKA"
FT   gene            610221..610886
FT                   /gene="tmk"
FT                   /locus_tag="JDM1_0579"
FT   CDS_pept        610221..610886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tmk"
FT                   /locus_tag="JDM1_0579"
FT                   /product="thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61468"
FT                   /protein_id="ACT61468.1"
FT                   /translation="MLTGKLVTFEGPDGAGKTSALNAIVAKLQPQLGDRLVVTREPGGN
FT                   QISEAIRKIILDRHNTAMDDRTEALLYAAARRQHIVQTIQPALQNDQLVLCDRYIDSSV
FT                   AYQGAGRGIGEQAVYDMNQFATAGLTADLTLYFDVDAAVGLNRIQQHRQNEINRLDVEA
FT                   LSFHHRVQAAYLRLLADHPDRIKRVDASQPLDQVVTQALEIMASQLPTYVASKGGEDQ"
FT   gene            610883..611212
FT                   /locus_tag="JDM1_0580"
FT   CDS_pept        610883..611212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0580"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61469"
FT                   /protein_id="ACT61469.1"
FT                   /translation="MKLIIAIVQDKDSNRLSSQFIEANVRATKLSTTGGFLRSGNTTFM
FT                   IGIDDDRVDEVLAMIKETSHAREQFMTPPVNLDVTMDGAAAYPVEVQVGGATVFVLPIE
FT                   QFHQF"
FT   gene            611229..612248
FT                   /gene="holB"
FT                   /locus_tag="JDM1_0581"
FT   CDS_pept        611229..612248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holB"
FT                   /locus_tag="JDM1_0581"
FT                   /product="DNA polymerase III subunit delta'"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61470"
FT                   /protein_id="ACT61470.1"
FT                   /translation="MATTESFAQTLAAKQPRLLAAFKHIIAQNHLAHAYLFAGMEGAGQ
FT                   PELAHWIAQRLFCLHINDGEPDGTCEECVRIANGSHPDIVTVAPEGQRIHVDQVRYLKA
FT                   EFSKSAVEGNRKLFIINDAEKMTASAANSLLKFIEEPSGNVTALLLTTNKQLMLPTIIS
FT                   RTQVIEFPPLNAQALQQTFEQAGIAPNQAQMLRGLTNSVTQAQALLADDWLPQAAQALW
FT                   RWFDQAVKGDPRSFVAVQVNLVGLAKDADHQLVMLDLIAALFQDLLQLHFEVATTALTF
FT                   GQYQKELAGLTAEVSDEQLIAATELALTAKRQLASNISFQNVLEGLTLKLWPIFQTNA"
FT   gene            612273..612620
FT                   /locus_tag="JDM1_0582"
FT   CDS_pept        612273..612620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0582"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61471"
FT                   /protein_id="ACT61471.1"
FT                   /translation="MDKRDLYDSFGEMEQQMQQMLDKMAKLRADMTTVLEKNAELVIEN
FT                   EHLREHMVEIENELPKKAASTTTLSKSRQNLEKLYDEGFHVCNQFYGKRRDDDESCVFC
FT                   LEVIYGERERA"
FT   gene            612719..613615
FT                   /locus_tag="JDM1_0583"
FT   CDS_pept        612719..613615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0583"
FT                   /product="methyltransferase (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61472"
FT                   /protein_id="ACT61472.1"
FT                   /translation="METQQSFADHAGIGTLYLVPTPIGNLQDMTYRAVATLKTVDLIAA
FT                   EDTRNTQKLLNHFEITTKQISFHEHNTQERIPQLIEKLQTGVNLAQVSDAGMPSISDPG
FT                   KELVAACIAANIPVVPLPGANAGLTALIASGLVPQPFYFYGFLPRKKNEQKADLAKLAR
FT                   RHETVVLYESPFRVAKTLTLLATVCEGTRPIVACRELTKRYEEFARGTLAEMVTWAQDH
FT                   QLKGEFVLLIGGNPDKDEPETTDELAQLPVKAQVEALIAAGDKPNVAIKTIAKRRNIPR
FT                   QSVYNQFHELNTNDEES"
FT   gene            613619..614404
FT                   /gene="fat"
FT                   /locus_tag="JDM1_0584"
FT   CDS_pept        613619..614404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fat"
FT                   /locus_tag="JDM1_0584"
FT                   /product="oleoyl-(acyl-carrier protein) thioesterase
FT                   (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61473"
FT                   /protein_id="ACT61473.1"
FT                   /translation="MATLGANASLYSEQHRITYYECDRTGRATLTTLIDIAVLASEDQS
FT                   DALGLTTEMVQSHGVGWVVTQYAIDITRMPRQDEVVTVAVRGSAYNPYFAYREFWIRDA
FT                   DGQQLAYITSIWVMMSQTTRRIVKILPELVAPYQSEVVKRIPRLPRPISFEATDTTITK
FT                   PYHVRFFDIDPNRHVNNAHYFDWLVDTLPATFLLQHDLVHVDVRYENEVKYGQTVTAHA
FT                   NILPSEVADQVTTSHLIEVDDEKCCEVTIQWRTLPEPIQ"
FT   gene            614543..615538
FT                   /gene="galE1"
FT                   /locus_tag="JDM1_0585"
FT   CDS_pept        614543..615538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galE1"
FT                   /locus_tag="JDM1_0585"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61474"
FT                   /protein_id="ACT61474.1"
FT                   /translation="MSILVLGGAGYIGSHMVDRLVEHGTDVVVVDNLVTGHRAAVNSAA
FT                   KFYQGDLRDADFLNHVFDTEDIEAVVHFAAFSIVPESMSKPLKYFDNNTGGMITLLETM
FT                   QAHNVKQIVFSSTAATYGTPKQIPIKETDPQLPINPYGASKLMMEQIMHWADVAYGIKF
FT                   VALRYFNVAGAKPDGSIGEDHGPETHLVPIILQVAQGKRDELKIFGDDYNTPDGTNVRD
FT                   YVHVIDLADAHILALKYLAAGNDSNAFNLGSSTGFSNKQMLAAAREVTGQPIPAKLAPR
FT                   RPGDPDSLVAASDKARDVLGWQPNYDNVNDIIETAWAWTQKHPNGYDDRD"
FT   gene            complement(615672..616772)
FT                   /gene="phnW"
FT                   /locus_tag="JDM1_0586"
FT   CDS_pept        complement(615672..616772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnW"
FT                   /locus_tag="JDM1_0586"
FT                   /product="(2-aminoethyl)phosphonate--pyruvate
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61475"
FT                   /protein_id="ACT61475.1"
FT                   /translation="MKQPYLLLTPGPLSTTASVKDAMQIDYCTWDSDYRHVTETIRQQI
FT                   LAMAQANPENYTTVLLQGSGSFGVEATIGTAVPRTDAILMIAINGAYGHRISQIAEYYD
FT                   IPHIDVVFNEDEAVDPVRIEATLADHPEITHFATVHSETTTGILNPIEALMPIMHEHGI
FT                   VTIIDAMSSLGGVPISIDELDCDYLISSANKCVQGVPGFAFIIAKQATLAHTADNARSL
FT                   CLDLYDQWQAMTKQPGKWRFTSPTHVVHAFAQALIELQAEGGVTPRYQRYRASQQLLSD
FT                   GLQALGFELVIDPAIQGPIITSFKYPNVDFDFADFYQFIKQRGFVIYPGKVSNIPSFRI
FT                   GTIGDVDTTDIQRLLTIIGDYQQLHR"
FT   gene            complement(616794..617591)
FT                   /gene="phnX"
FT                   /locus_tag="JDM1_0587"
FT   CDS_pept        complement(616794..617591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnX"
FT                   /locus_tag="JDM1_0587"
FT                   /product="phosphonoacetaldehyde hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61476"
FT                   /protein_id="ACT61476.1"
FT                   /translation="MTIKAVIFDWAGTTIDYGSRAPIVAFQKAFANVGIQISEAEIRQD
FT                   MGLDKYTHIHKIMDLPAVQNDWQARFQVLPTEDDCNQIFSNFKAILLSSLTEFGQLKPG
FT                   MSAVIDYLTAHNISYGTTTGYDAEMLALVLPIAAKQGYRPAVNITSEQTGGVGRPAPAM
FT                   LALAAEQLTITDPTTVMKIGDSVNDILEGNNADAVSVGIIDGSNIMGLSELAFNALSPA
FT                   EQAERRAHVTAAYQRAGADYILQSMAELPALLDQINQPVATDH"
FT   gene            complement(617616..618470)
FT                   /gene="phnE1"
FT                   /locus_tag="JDM1_0588"
FT   CDS_pept        complement(617616..618470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnE1"
FT                   /locus_tag="JDM1_0588"
FT                   /product="phosphonates ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61477"
FT                   /protein_id="ACT61477.1"
FT                   /translation="MIENSQPKTQVLQPSAPPTRSISLVTRPRKILRAVMIGLTLISVY
FT                   SLVTLNNANLNIIDALHSLGLNLNAMFLHPSVGQDTLGQLLRALMTSVSLAMLTTLLGA
FT                   LIAFFIAVGAARNLAPSWLATSIKAVMAFIRAIPTILWVLIYSVVMGLGASAAVVGLTF
FT                   HSVAYLVKAYSESIEETSQDTIEALKASGVGFWPIVFQAILPSIIPALLSWTFIRFEIN
FT                   FANAVAVGAAAGADDIGYYLFMAGSFYFDFHEVGLIVYLLLGVAIVLELVSMRLRGHYL
FT                   KNN"
FT   gene            complement(618467..619255)
FT                   /gene="phnE2"
FT                   /locus_tag="JDM1_0589"
FT   CDS_pept        complement(618467..619255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnE2"
FT                   /locus_tag="JDM1_0589"
FT                   /product="phosphonates ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61478"
FT                   /protein_id="ACT61478.1"
FT                   /translation="MTPQRFFRQRRLRLSVVLLILIGIYVLSMALVNFQAWASISKIPA
FT                   GLMWLFTNFIPTSRSISYLGPILYQLWRTLLVAISSTMVASLFALIFAILGAKTTTPTP
FT                   VLRWIIRFGASLLRNIPVVAWAMILLFSFKQSDFTGFLALFFMTLGYLTRAFTETIEDL
FT                   DAEKLQALQAVGANYFQCVFCGVLPEAASTLTSWILYMIENNLRDATLVGLLTGTGVGF
FT                   LFDYYFKAFRYDAAGLIVLLIAILVIVLELTSNRIRRAIA"
FT   gene            complement(619260..620030)
FT                   /gene="phnC"
FT                   /locus_tag="JDM1_0590"
FT   CDS_pept        complement(619260..620030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnC"
FT                   /locus_tag="JDM1_0590"
FT                   /product="phosphonates ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61479"
FT                   /protein_id="ACT61479.1"
FT                   /translation="MLKVIQLDKTYGSNKHSLKAVNFTAKPGEVTAIIGPSGAGKTTIL
FT                   RSINQLIRDDGGQILLDDTDIRQANKAELRKVRHHIGMIFQNYNLISPLTVLENVLHGR
FT                   LGAKSTVAGMLGLYSSAEKQEALQLLDEVGLKEYAYQRCDQLSGGQQQRVGIARALMQH
FT                   PKMILCDEPIASLDPKSTTIVMDILRRLAKEKQLIILINLHQVDIAMAYTDHIVGINSG
FT                   AIVFEGATNEVDDAVLQHIYRQPDQSTAVAANEN"
FT   gene            complement(620068..621120)
FT                   /gene="phnD"
FT                   /locus_tag="JDM1_0591"
FT   CDS_pept        complement(620068..621120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnD"
FT                   /locus_tag="JDM1_0591"
FT                   /product="phosphonates ABC transporter, substrate binding
FT                   protein (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61480"
FT                   /protein_id="ACT61480.1"
FT                   /translation="MSKVSKSLLGLSFISVLGLGLAGCASGTSAKSGGSSTDSSKTITV
FT                   VFYPNESAKSFAGSRTAIKQAVEKATGKTVKLQTTTDYNVAIQAIASGKAQVAYMGANG
FT                   YIQAHHKSKDVVPFAAQSDAKGTLKDATYNSYLMVQQKDAKKYEENGKYSIKNVKGKKM
FT                   SYVSNSSTSGFLVPTAEISREFNIKTADQDKLTQSGSFFSKVLYGGSHQGSAVNLIKGD
FT                   ADVAAFDDADLMPYLNVTKGSWDKVGSTFTVKDNAEAPFTSLAGKSVVNIAMMPVQQGP
FT                   WVYNTKALSKDDQKKIATEFTSKSFAQNKKIFSEPNAKTPMMFPKKSEKSKLVNVTDKW
FT                   YAPTHKLVGY"
FT   gene            621400..622125
FT                   /gene="gpp"
FT                   /locus_tag="JDM1_0592"
FT   CDS_pept        621400..622125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpp"
FT                   /locus_tag="JDM1_0592"
FT                   /product="glycoprotein endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61481"
FT                   /protein_id="ACT61481.1"
FT                   /translation="MKLLAIDTSNRPLSVAVLEDTQILATTTTNVGRNHSSTLLPIIEQ
FT                   AMAQAKLAPADLDRIVVAAGPGSYTGLRIGVTTAKTLAFTLDKALVGVSSLAVLAGNIV
FT                   TEGQLVAPLFDARRDNIFAGLYRIKNQRPVAVIADQHISVTEWGQRLASYDEPITFVGA
FT                   DVDQYADALQQSLAKQFVRAAPQLDLPQAVVLGLMGRTLTPVSEIHNFVPNYLRLTQAE
FT                   RDWQAKHPEKEHAPYVEKI"
FT   gene            622205..622687
FT                   /gene="rimI1"
FT                   /locus_tag="JDM1_0593"
FT   CDS_pept        622205..622687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimI1"
FT                   /locus_tag="JDM1_0593"
FT                   /product="ribosomal-protein-alanine N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61482"
FT                   /protein_id="ACT61482.1"
FT                   /translation="MGEVNYYVSRALITDVPEMLAIERAVYAGQTPWDENAFKTELRRQ
FT                   SGRFYIVMRHEDRLVAFCGCVFDDRRQDAHITNIAVHPDVQGQGLGHFMMQVMMKRARK
FT                   LHYQTVTLEVRYSNTIAQQLYRDLGFEKTGIKKRYYFGDHEDAIDMTYRIPVATDD"
FT   gene            622680..623135
FT                   /gene="rimI2"
FT                   /locus_tag="JDM1_0594"
FT   CDS_pept        622680..623135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimI2"
FT                   /locus_tag="JDM1_0594"
FT                   /product="ribosomal-protein-alanine N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61483"
FT                   /protein_id="ACT61483.1"
FT                   /translation="MTERQLVASTQLDAGRAVQVCYQLATLAYPGGAPWRQATFAADMA
FT                   LPTVHYDLLRWQDELIGFVSRSTVLDETEITNIAIDPAYQRQGHARWLLTACLAQLSAG
FT                   SVFLEVRASNLAAQRLYQQCGFDQIATRKEYYHDPEEDAWIMRKMIN"
FT   gene            623140..624186
FT                   /gene="gcp"
FT                   /locus_tag="JDM1_0595"
FT   CDS_pept        623140..624186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcp"
FT                   /locus_tag="JDM1_0595"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61484"
FT                   /protein_id="ACT61484.1"
FT                   /translation="MGTVEKQNLILAFESSCDETSVAVIKDGHEILSNVIATQINSHKR
FT                   FGGVVPEVASRHHIEQITICIEAALQEAHVTYADLNAVAVTYGPGLVGALLVGVNAAKT
FT                   VAYAHQLPLIPVNHMAGHIYAARFVKPFEFPLMALLVSGGHTELVYMQADGQFEIIGET
FT                   RDDAAGEAYDKIGRVLGVPYPAGKVIDEMAHAGHDTFKFPRAMIDEDNYDFSFSGLKSA
FT                   FINTVHHADQIGATLDKNDLAASFQASVVDVLMSKTLRVLKQYPVKQLVLAGGVAANQG
FT                   LRERLQQDLPTAFPDTELILAPLKLCGDNGAMIGAAGYVQYQHHQFGDAALNADPSLEF
FT                   DWMPGMLK"
FT   gene            complement(625105..627087)
FT                   /locus_tag="JDM1_0596"
FT   CDS_pept        complement(625105..627087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0596"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61485"
FT                   /protein_id="ACT61485.1"
FT                   /translation="MILLQVQQVMRRFGADVLFDNVQMDIQEHARVALVGRNGAGKSTL
FT                   LKMIAGETVPDEGQISMRKGLTIGYLAQDQGLDSNNTIWEEMSSVFAELHAIEKRMHQL
FT                   ENQLSDPSIMNDEQAYQQTLKTYDQIQTEFQQKNGYGYQAEIRGVLHGFQFDAEVYDKS
FT                   VTALSGGQKTQLALAKLLLEKRDLLILDEPTNHLDVETLTWLESYLQSYSGALLIVSHD
FT                   RYFLDRVVNEVYDLSHHEMVHYTGNYDQFVQEKAARIQAQWKHYEKQQAEISKLEDFVN
FT                   RNIVRASTTKRAQARRKQLAKMDRLDRPDSDEKTAHFGFHAAKQSGNIVLTVKDAAVGY
FT                   DGQILSEPDNLNIKKHEAIAIVGPNGIGKSTFLKSILGQIPFIKGQAVFGTNVVTGYYD
FT                   QEQRNLNDKKTVLSELWDEHPTTPEKDIRTILGSFLFTGEDVDKPVHALSGGERARLLL
FT                   TKLAMQNDNFLILDEPTNHLDIDSREVLEVALNDFDGTLLFVSHDRYFINQVATSVVEV
FT                   SPEGTELFLGDYEYYIDKKQEQAEIAAAAASQAAEKAAEAGAADSTSATTAAPRSKGQQ
FT                   NYQASKQQQREKRKLERSVAALEEQMTALDEQATQIQTEMAQPEVSADVGKLQDLQKEL
FT                   EAINTQQEQVETEWTEQAEALEELS"
FT   gene            627256..627933
FT                   /locus_tag="JDM1_0597"
FT   CDS_pept        627256..627933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0597"
FT                   /product="redox-sensing transcriptional repressor Rex"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61486"
FT                   /protein_id="ACT61486.1"
FT                   /translation="MAETKIPRATAKRLPIYYRYLNILLDADKKRVSSTELSEAVKVDS
FT                   ATIRRDFSYFGALGKRGYGYDVETLLAFFKKILNQDTLTNVALIGVGNLGHALLNFNFH
FT                   KNSNVRISAAFDVNEAIANTVQSGVPVYPMTELKKQLIEQQIEIAILTVPTTVVQKITD
FT                   DLVDANVKGIMNFTPLRISVPETVRVQNVDLTNELQTLIYFIEHYGQQLGDNGNDDENE
FT                   TED"
FT   gene            628122..629774
FT                   /gene="isp2"
FT                   /locus_tag="JDM1_0598"
FT   CDS_pept        628122..629774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="isp2"
FT                   /locus_tag="JDM1_0598"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61487"
FT                   /protein_id="ACT61487.1"
FT                   /translation="MQDYYNMNQTTLSIALDYQPEEHHSARYINQLVESLKLKYDYQFG
FT                   RPREYNLGAMLKLVLLAYSYGIFSSRKIERFARENKPAGWLIADQIPSYRTICRFRISD
FT                   ELATLTTDSLSQLTQYLRQNGMIDDVSFIDGTKILADANKYSFVWKKNTIRFDKMNREK
FT                   LVDLLGELHEAKIVGEIPAGSELTPELLDIMISKVEDHLVVLNETVEATKQVSPNPAKQ
FT                   QRRTVKSQKRKLDKRRDKMREHQAQQAIYDQRNSYSKTDHDATFMRVKEDPMQNGQLKP
FT                   AYNVQIATSNQFITGYRLFQNPTDTRTLQPFIEHLKANNVLGHTIVADAGYGSESNYRY
FT                   LEDEFGQHTVLIPYGTMLKENSRKWQSDDRKVMNWDYHEKDDYFINPQNVRFNFNAYRQ
FT                   RTDKYGFTRDFKEYIAEKYDENHQLISAALTPKGYLKRISVNENWEYFKSKQRELLSAP
FT                   ETGQIYAQRKIDVEPVFGKMKASLHFNRFSVRGFDKVTKEAGIVILALNIMKLVTVGTN
FT                   FKNQRRKQMGRETKIRFLVPFAYTEASYVTASF"
FT   gene            complement(629867..630514)
FT                   /locus_tag="JDM1_0599"
FT   CDS_pept        complement(629867..630514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0599"
FT                   /product="CAAX family protease"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61488"
FT                   /protein_id="ACT61488.1"
FT                   /translation="MMVNRRQSIFILIIYFIIYALPSVLVTAFHQLGAQVFVIQTVDYL
FT                   VGAILLIWLASRMRTKNVVEKQPSNWFMTFIWGLIGLVLVIVGQVIILKMTALLGQSTA
FT                   STNTTTLLTVGQQYPAFFLAIIVGAPIMEEIVFRKVIFGNLSAVTGQIGAALISSVLFS
FT                   FAHADGHFILYAFIGLLFCWLYQHTGRIQTSMTAHILMNASVVLPTLLGLLH"
FT   gene            630704..630988
FT                   /gene="groES"
FT                   /locus_tag="JDM1_0600"
FT   CDS_pept        630704..630988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groES"
FT                   /locus_tag="JDM1_0600"
FT                   /product="co-chaperonin GroES"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61489"
FT                   /protein_id="ACT61489.1"
FT                   /translation="MLKPLGDRVILQQQEEEEQTIGGIVIANNAKEKPQSGKVVAVNDG
FT                   RVLDNGTKVDPSVKVGDQVLFDKYAGTEVKYQGAKYLVLHEKDIVAIED"
FT   gene            631044..632669
FT                   /gene="groEL"
FT                   /locus_tag="JDM1_0601"
FT   CDS_pept        631044..632669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groEL"
FT                   /locus_tag="JDM1_0601"
FT                   /product="chaperonin GroEL"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61490"
FT                   /protein_id="ACT61490.1"
FT                   /translation="MAKELKFSEDARSAMLKGVDQLADTVKSTLGPKGRNVVLEQSYGS
FT                   PTITNDGVTIAKAIELDDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQSIVNEGMK
FT                   NVTAGANPVGIRRGIEEATKTAVDSLHAMAHEVKTQEDIAQIASVSSASEETGKLIAEA
FT                   MEKVGHDGVITIEESRGVDTSLDVVEGMQFDRGYLSQYMVTDNDKMEADLDNPYILITD
FT                   KKISNIQDILPLLQSIVEQGKPLLIIADDISGEALPTLVLNKMRGTFNVVAVKAPGFGD
FT                   RRKEQLQDIAILTGGTVITDDLGLELKDTTIDQLGQANKVTVTKDNTTIVEGAGSKDAI
FT                   SERVEFIRNQIGETTSDFDKEKLQERLAKLAGGVAVVRVGAATETELKERKYRIEDALN
FT                   ATRAAVEEGFVAGGGTALINVIKDVAALKETGDVQTGINIVKRALEEPVRQIAENAGLE
FT                   GSVIVEKMKEQKPGVGFNAATDEWVDMIKAGIVDPTKVTRSALQNAASVSALLLTTEAV
FT                   VAEKPEENAPAAPAAPNPGMGGMM"
FT   gene            632919..634754
FT                   /locus_tag="JDM1_0602"
FT   CDS_pept        632919..634754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0602"
FT                   /product="transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61491"
FT                   /protein_id="ACT61491.1"
FT                   /translation="MWRYLKRLVIGKPLKTMDEGGQALTKFKALALLSSDALSSVAYGT
FT                   EQITTVLITLSAAALMYQLYVAALVLVLLFAITMSYRQIIRAYPSGGGAYVVASTNWGR
FT                   PAGLVAGGSLLVDYMLTVAVSVTSGTEAITSAIPALANYQVLIAVLIVIAIMALNLRGM
FT                   RESASFLTFPVYFFIIMIIGMILWGVMNIASGNLTYHASAAVGAPVQGMTLVLFLRAFS
FT                   SGSSSLTGVEAISNAVPNFKRPKRKNAANTLAIMSLVLAVFFGGITYLSYYLGVKPQVD
FT                   NTVLSQIATAVFGHGLFYYLLQLSTALILAVAANTGFSAFPILAYNLAKDKFLPHAYMD
FT                   RGDRLGYSNGIISLAVGAIALIFIFHGKTTLLIPLYAVGVFVPFTLSQSGMIIHWFRER
FT                   GQWWWMKAAVNLLGALISILLVIFLFLLHFGNVWPYLIVMPLLLYMFYRIHVHYNRVAA
FT                   QLRVVAKEKAAIHDYDGATVIVLVSNVTRVTAQAVNYARSIGDYVIAMHVSFDENPEKE
FT                   HKTAAEFKETFPDVRFVDIHSSYRSIATPTLRFCDVIAKRAAERNFSTTVLVPQFVPKK
FT                   PWQNILHNQTSLRLRAVLNSRENIIVSTYNYHLKE"
FT   gene            634970..636067
FT                   /gene="tagO"
FT                   /locus_tag="JDM1_0603"
FT   CDS_pept        634970..636067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tagO"
FT                   /locus_tag="JDM1_0603"
FT                   /product="undecaprenyl-phosphate N-acetyl-glucosaminyl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61492"
FT                   /protein_id="ACT61492.1"
FT                   /translation="MIRFEILVSLVATMILSAILTPFVRKLAFKIGAVDKPNVRRVNKI
FT                   PMPTMGGLAIFISYTVGTTVLYLMHQFPSRIFFALLGGELIIIATGVIDDIYELKPRQK
FT                   MLGITLAALEVYFIGGIRMTTFTFPLLGLIHFQWLSLPVTLLWILAITNAVNLIDGLDG
FT                   LATGVSIISLSTMGIIGLFFLNANMFVSLLIFTLVAAMIGFLPYNFFPARIYLGDTGSL
FT                   FIGFMTAVFSLFGLKNVTLISVGIPVMILGVPITDTVYAMIRRILNKKPISQADKHHLH
FT                   HRLMQLGLTHRQTVMVIYGIALIFSFISLLYPISSIWGSVLLTIGLLFGLELFVEAIGL
FT                   AGDNRQPLLDWIKRTVARLTSKSNH"
FT   gene            636392..637294
FT                   /gene="pstF"
FT                   /locus_tag="JDM1_0604"
FT   CDS_pept        636392..637294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstF"
FT                   /locus_tag="JDM1_0604"
FT                   /product="phosphate ABC transporter, substrate binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61493"
FT                   /protein_id="ACT61493.1"
FT                   /translation="MKKALTLGALAVTMTILLAGCGSSSATSTKSTSSSSGSSKTTKIV
FT                   ATGSTALQPLVEQAGQAYQNEHANVTINVQGGGSGAGLSQVAKGSVNIGNSDLFAQEQK
FT                   GLDAKGLVDHKVAVVGMAPVINKDAGVTNISKEQLIKIFQGKITNWKDVGGKDEKITVV
FT                   NRAQGSGTRATFEKWGLDNAKVATSQEQDSNGTVQKIVSTTPGAISYLAFSYVKSDVQA
FT                   LSIDNVKPTEANVATNKWKIWAYEHMYTKGQPTGELKNFLTYMTSKAVQGSLVEKLGYI
FT                   PLTSMKVDRGQSGAITNLK"
FT   gene            complement(637485..638132)
FT                   /locus_tag="JDM1_0605"
FT   CDS_pept        complement(637485..638132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0605"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61494"
FT                   /protein_id="ACT61494.1"
FT                   /translation="MTKPYYTITQDTVFEQTIKKSRFIAHLYRISDEVDAQAKIAAVRA
FT                   DNPKANHNCFAYMLGDDDHIQRMSDDGEPVGTAGSPILEVLKTNELHDVLAVVTRYFGG
FT                   IKLGAGGLIRAYNGTPAQAIEVSGKVQRILQTRIAITLDYRNVDALTYYLQQNKLTTLN
FT                   TDYGVQVTQIIAVTQSEIATIQQDITNLLSGQVTFSEQGEQFTEIPVTTPGN"
FT   gene            638199..639551
FT                   /gene="comFA"
FT                   /locus_tag="JDM1_0606"
FT   CDS_pept        638199..639551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comFA"
FT                   /locus_tag="JDM1_0606"
FT                   /product="ATP-dependent DNA helicase/translocase
FT                   (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61495"
FT                   /protein_id="ACT61495.1"
FT                   /translation="MEAQVLYGRQLALSANEAAAVPAGTQILPAMQVDEHQIICQRCGS
FT                   HLDRLRAQLPNQQYYCYQCLNLGRVSTLVKLYHMPEPNAFATVPVCTWQGTLTPQQADC
FT                   AQSIKANFMAHKRQLLWAVTGAGKTEMLFPGIAWALAHQWRVAIASPRVDVCLELAPRL
FT                   QAAFADVQIAVLHGRNPDPYQYTQLTICTTHQLLRFRQAFDVLIIDEVDAFPFAANPCL
FT                   EFAVNQAAKVEGAILYLTATPSQSLLSQVHRGELAISYLPLRFHQHLLPAIKVKLQPNW
FT                   ARLLQQGKLPRDLIRQLQQYQQQHQRFLLFVPRIQQLAPVFAVLQHYFPHMTGETVYSA
FT                   DPERLTKVQQMRNQQFQYLVTTTILERGVTFPGIDVIVLGADDEVFSTAALVQIAGRVG
FT                   RSSERPTGLVWFICHSHSRNIKRAQRQIRVINRKGRQLRASMPTVSQHYHD"
FT   gene            639511..640185
FT                   /locus_tag="JDM1_0607"
FT   CDS_pept        639511..640185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0607"
FT                   /product="late competence protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61496"
FT                   /protein_id="ACT61496.1"
FT                   /translation="MLACLLCHNIITTKFTLPWILSWQPVMRPVVCSVCWRQFVRIDRA
FT                   TACSKCGRAQKRPQPCTDCQRWPEIGPFHNEALFEYNDAMHDYFQRYKFQGDYQLRQVF
FT                   AKIMQQAVVQRCAEICLVVPVTPTTLQTRGFNQVAGWLAAPLAPGLMTQATAKSVPQSK
FT                   KDRQARLRTPQPFKMAPNTILAGRRVLLVDDIYTTGRTMRHAATLLLENGAKSVTGLTL
FT                   AR"
FT   gene            640319..640885
FT                   /locus_tag="JDM1_0608"
FT   CDS_pept        640319..640885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0608"
FT                   /product="ribosomal protein S30EA"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61497"
FT                   /protein_id="ACT61497.1"
FT                   /translation="MLNFNIRGENIEVTQAIRDYVQKRVGKLQKYFDNNVDSIAHVNLK
FT                   VHPDKTAKVEVTIPLPYLVLRAEETSPDMYASVDLVTDKLERQIRKYKTKVNRKSREKG
FT                   YKAIDFAATDETVAAADNDQDDKLDVVRTKRVALKPMDNEEAILQMDMLGHDFFIYEDA
FT                   ETDAINIVYRRNDGRYGLIETDDNH"
FT   gene            641272..643635
FT                   /gene="secA"
FT                   /locus_tag="JDM1_0609"
FT   CDS_pept        641272..643635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="JDM1_0609"
FT                   /product="preprotein translocase subunit SecA"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61498"
FT                   /protein_id="ACT61498.1"
FT                   /translation="MANILKRWVESDKRTIRRLDKIANKVEAYADEYGKLSDADLQAKT
FT                   PEFRERYKEGESLDDLLPEAFATAREGAKRVLGLYPFHVQILGGIVLHQGDIAEMKTGE
FT                   GKTLTATMPVYLNAISGKGVHVVTVNEYLSARDATEMGELYNWLGMSVGINGAEKSPEE
FT                   KRAAYNADITYSTNGEIGFDYLRDNMVVYREDMVQRPLNFAIIDEVDSILIDEARTPLI
FT                   ISGQSEGTTGMYKRADRFAKTLTKDEDYKVDLESKTVALLDEGIRKAEKYFGLENLYDT
FT                   DNTALNHYLDEALRANYIMLKDKDYVISDGQALIVDSFTGRIMDGRRFSDGLHQAIEAK
FT                   EHVEIQEETKTMANITYQNLFRMYKKLSGMTGTAKTEQEEFREIYNMEVITIPTNRPMI
FT                   RDDRSDLLYPTLQSKFNAVVKEIKQLHEKGQPMLIGTVAVETSEYLSHRLDEENIPHVV
FT                   LNAKNHAKEADIVANAGQRGAVTIATNMAGRGTDIKLGPGVKEVGGLAVIGTERHESRR
FT                   IDNQLRGRAGRQGDPGMSQFYLSLEDDLMLRFGSERIKNFLKRMNVEDDDAVIQSRMIT
FT                   RQVESAQKRVEGNNYDSRKNVLQYDDVMRAQREVIYGERQQVIMEEKSLKPVIMPMIKR
FT                   TVERTVQLHMQGDAKDWDLDAVVDFAQAAMVKEDSISVADLKGKSPAEVEAYLMDRVDK
FT                   IYADKAKQLYDAGQMLEFEKVVILRVVDSHWTDHIDAMDQLRQSIGLRGYGQLNPLVEY
FT                   QRDGYQMFEEMVADIDYDTTRLFMKSEIRQNIQR"
FT   gene            643741..643815
FT                   /pseudo
FT                   /gene="prfB-N"
FT                   /locus_tag="JDM1_0610"
FT                   /note="hypothetical protein"
FT   gene            643784..644857
FT                   /gene="prfB"
FT                   /locus_tag="JDM1_0611"
FT   CDS_pept        643784..644857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfB"
FT                   /locus_tag="JDM1_0611"
FT                   /product="peptide chain release factor 2"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61499"
FT                   /protein_id="ACT61499.1"
FT                   /translation="MLSTTLGGRFDLDALNESIQENEARMAEPGFWDDQAAAQKVIDEN
FT                   NVLKGKYDTFKQLADEVGDLAVAYELLSEEPDAEMQAEFETDFQHAEHDLQQYRLNLLL
FT                   DGPYDRNNAILEIHPGAGGTESQDWGAMLLRMYTRWAASHNFKVETVDYQAGDEAGIKS
FT                   VTLLISGHNAYGYLRSEKGVHRLVRISPFDAAGRRHTSFASVDVMPELDDTVDVDIRPE
FT                   DLKIDVYRASGAGGQHVNKTSSAVRITHVPTGIVVASQAQRSQLQNRQTALNMLRAKLY
FT                   EREEEKKAKERAAIQGEQMDIGWGSQIRSYVFHPYTMVKDHRTNYESHDGQAVMDGDLD
FT                   PFMDAYLQWKLAQRNPQ"
FT   gene            645041..646216
FT                   /locus_tag="JDM1_0612"
FT   CDS_pept        645041..646216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0612"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61500"
FT                   /protein_id="ACT61500.1"
FT                   /translation="MQVLKIFELFLLQPLVWLGLLRSYLTAKRRVKSERQHFQSAINPQ
FT                   LVEVHHFLVDGCLLGVLMTIISLALGLVVAPIWVVIYEVVAAISLIIIPGALVPVTAFG
FT                   LSWLVYWIMSPELTTVGGALQRHGVAMTSMSGNLVVNGLLLLAIVLAATAVLLRHYDYE
FT                   GRSPQLQPDQRGKRLVRYQWQQLLVLPVGVLVPGDWLHATISWWPVFMVGERSFSILLL
FT                   PLLVGTSVRVYKQLPQIAWRQLAARYGWVTLASVLVAIIARFAVLSPQWLLALMGLIVV
FT                   LTWGILAQHRYHDRHQQFRYSDTEQGVRVIGLRPHTPADKLNLDLGDIILECNRQPVNT
FT                   EAEFYAALLKSPTYVHLKVRNRQQELIITETAIYNGAPHELGIVLFTDQED"
FT   gene            646216..646944
FT                   /gene="rrp3"
FT                   /locus_tag="JDM1_0613"
FT   CDS_pept        646216..646944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rrp3"
FT                   /locus_tag="JDM1_0613"
FT                   /product="response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61501"
FT                   /protein_id="ACT61501.1"
FT                   /translation="MTMDKILVVDDEPAIVTLLSYNLKQAGYEVVTATDGADALSLGLA
FT                   QSFTCILLDLMLPKLDGMEVTKKLRQEKVQTPIIIVTAKNDEFDKVFGLELGADDYITK
FT                   PFSPREVLARIKAVIRRTTPDEPVTPPAPMPPANRAVMLVGDLQIDQNKYRVARNGKNI
FT                   SLTPKEFELLVYFVEREGRVLSRDAILNHVWGYDYASETRIVDIHISHLREKIEADPKQ
FT                   PRLIRTVRGFGYEFVGDGHA"
FT   gene            646937..648340
FT                   /gene="hpk3"
FT                   /locus_tag="JDM1_0614"
FT   CDS_pept        646937..648340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpk3"
FT                   /locus_tag="JDM1_0614"
FT                   /product="histidine protein kinase; sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61502"
FT                   /protein_id="ACT61502.1"
FT                   /translation="MHNRWQQTTRLLLMENVLLVLIVLVVLQHFSPIKWSWRLVGCLVG
FT                   AWLVLAVIEGLIAWRQQSERQRTIDRMEAKLRQMSSQQFPPHILLPQSDPLYSLAQAVN
FT                   QLESYQKSQTRRAELQEKELMMIMRYLPVGVMVIDHRRQVQLSNPAMSELLQVSVNTVA
FT                   HIYTKDIQLYALTKLIEDTITSGKNQRATITLTPAPNTQVVEASTVYIQGNRSQFQIVL
FT                   MLYDITEVYMIEQMQDDFVSNASHELKTPITAISGFTETLLSGAKDDPDTLDQFLHIIA
FT                   DESQRLIDLIQDVLSLSRIRAQNTTMLTLVPLAVRPLIEQELAVVQQAIERQHLTINNQ
FT                   VDADLMITSDSQKLSQIIKNLLTNAIKYNRPHGSVTIATMVSHQTWSLIVKDTGIGISA
FT                   DDQQRIFERFYRASPSRSQQLVSGTGLGLAIVQELVNAMHGTIDVVSQRGVGTTMTVTL
FT                   PLAASASEQ"
FT   gene            648685..649560
FT                   /gene="pstE"
FT                   /locus_tag="JDM1_0615"
FT   CDS_pept        648685..649560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstE"
FT                   /locus_tag="JDM1_0615"
FT                   /product="phosphate ABC transporter, substrate binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61503"
FT                   /protein_id="ACT61503.1"
FT                   /translation="MRKSRVIQLIVLIAIIGLVGLGYTHRDRTSASESITAVGSTALQP
FT                   LVEAAGEQYSSNHTGVFINVQGGGSGTGLSQIQAGAVAIGNSDIFAEEQSGITASKLID
FT                   HRVAVVGIAPIVNKKAGITNLTQQQLIQIFTGKVTNWREVGGRNLPITLINRAQGSGTR
FT                   KTFERYALKGNQSVDSQEQDSSGLARSIVASTPGAISYVAFSYLDKSVQTVNVDGIRPT
FT                   EKNVRNNRWYIWSYEHLYTGKHPNQLTKKFIDYILSTAVQQKLVKQLGYISVHDMQVQR
FT                   NAAGKVSVMK"
FT   gene            649571..650500
FT                   /gene="pstD"
FT                   /locus_tag="JDM1_0616"
FT   CDS_pept        649571..650500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstD"
FT                   /locus_tag="JDM1_0616"
FT                   /product="phosphate ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61504"
FT                   /protein_id="ACT61504.1"
FT                   /translation="MDKIRESLLKKSVASKIERRGKAISLVCLALIVGIVFLIFYFVAS
FT                   RGLATFFQNHINLWQFLSGTQWNPGTVGTNGQPAVGALPMIVGSFLITILSALIATPFA
FT                   IGTAVFMTEISPRRGAKILRPVTELLVGIPSVVYGFIGLQVVVPFVRNTFGGSGYGILS
FT                   GTFVLFVMILPTVTSMTADALNSVPRYYREASLALGATRWQTIYKVVLRAAIPGMLTAV
FT                   VFGMARAFGEALAVQMVIGNATLLPHNLVSPAATLTSILTMGIGNTVMGSLQNNALWSL
FT                   AMILLLMSLVFNLVIRYIGRKGKLNHER"
FT   gene            650490..651374
FT                   /gene="pstC"
FT                   /locus_tag="JDM1_0617"
FT   CDS_pept        650490..651374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstC"
FT                   /locus_tag="JDM1_0617"
FT                   /product="phosphate ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61505"
FT                   /protein_id="ACT61505.1"
FT                   /translation="MNAKRIDKIATGVLYGVAAFVVIILVALLGYILIQGVPKISWHFL
FT                   TSPALAFEAGGGIGIQLFNSFYLLFLALLISLPISLGAGIYLNEYAPQNTVTGLIRTTI
FT                   EILSSLPSVVVGLFGYLFFVVQFKLGFSILSGAFALTVFNLPILTRSIEEALANISDNQ
FT                   REAGYALGLSRWETVTKIVVPAALPSILTGVVLSAGRIFGEAAALIYTAGQSAPALDFG
FT                   NWNPFDISSPLSPLRPAETLAVHIWKINSEGIMPDAKAVSAGASAVLIIAVLLFNFLAR
FT                   WLGKRLYKHLTAE"
FT   gene            651389..652198
FT                   /gene="pstB"
FT                   /locus_tag="JDM1_0618"
FT   CDS_pept        651389..652198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstB"
FT                   /locus_tag="JDM1_0618"
FT                   /product="phosphate ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61506"
FT                   /protein_id="ACT61506.1"
FT                   /translation="MADNTMTTTQRNIMAFDPKDHEIALSTEDLHVFYGKSEAISEGDL
FT                   QFERYKISALIGPSGSGKSTYLRSLNRMNDRIATVKGKIMYRGLDINSNDIDVYEMRRH
FT                   IGMVFQRPNPFAKSIYENIAFALRQRGMNKKQDLDEIVERSLRQAAMWDQVKDDLNKSA
FT                   LALSGGQQQRLCIARAIAIKPDILLLDEPASALDPVSTSQIEDTLLELKQNYTIIIVTH
FT                   NMQQASRISDYTAFFNLGKVLEYSETGEIFTNPQVDLTNDYISGNFG"
FT   gene            652210..652965
FT                   /gene="pstA"
FT                   /locus_tag="JDM1_0619"
FT   CDS_pept        652210..652965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstA"
FT                   /locus_tag="JDM1_0619"
FT                   /product="phosphate ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61507"
FT                   /protein_id="ACT61507.1"
FT                   /translation="MSTILTTENLSLFYGKKEALKGINIDFDDKGITALIGPSGCGKST
FT                   FLRCLNRMNDLIPNVTITGEVNFNGHNIYAPTTDTVQLRKEIGMVFQQPNPFPFSIYEN
FT                   VIYGLRLAGVHDKERLDAAVEKSLKQAAIWDEVKDRLHANALSLSGGQQQRVCIARVLA
FT                   VEPDIILLDEATSALDPISSRMIEETLLNLRQDYTIITVTHNMQQASRISDRTAFFLNG
FT                   ELIEVNDTKQIFMNPVKQETNDYISGRFG"
FT   gene            652978..653652
FT                   /gene="phoU"
FT                   /locus_tag="JDM1_0620"
FT   CDS_pept        652978..653652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoU"
FT                   /locus_tag="JDM1_0620"
FT                   /product="phosphate transport system protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61508"
FT                   /protein_id="ACT61508.1"
FT                   /translation="MRRLFDDELNDIDANFTEMGMMVSETIEKAVKAFIDHDRDLAQEI
FT                   IDNDAKINQREVELEQKSFEMIALYQPVTSDLREIVTILKAVSELERMADYARNIAHAT
FT                   IRVKGNVRVPEIEAALSEMGNRVRKMVEEMLAAYVKSDDQEARRVAAKDAKVGEMYDRI
FT                   NEKGISKMERHPETVIGSTDYLNVATYLMRIGALVTNIGEWIVYLNTGEIIELNPESSN
FT                   LV"
FT   gene            653752..654063
FT                   /locus_tag="JDM1_0621"
FT   CDS_pept        653752..654063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0621"
FT                   /product="stress-responsive transcription regulator
FT                   (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61509"
FT                   /protein_id="ACT61509.1"
FT                   /translation="MKSNTKQKLTKSNNRVFAGVLGGIAEYLNWNATILRVLYVILTLV
FT                   THGFGVLVYLVLMTIIPSKPDNTGFFEQMRQSTGTQAKPQAHGRKEIHNVHEEDDPRH"
FT   gene            654085..654450
FT                   /locus_tag="JDM1_0622"
FT   CDS_pept        654085..654450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0622"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61510"
FT                   /protein_id="ACT61510.1"
FT                   /translation="MGFWKRILINTILFIAIAGFFQSSFHVASVWMALIASFVLAILNA
FT                   AIKPFLLLLSLPITLLTLGLFSIVINGFMLQMTSYVVGKANFGFSSFGMAMVVSILMSI
FT                   ANVIVSNFFAKDGVDGE"
FT   gene            654596..655543
FT                   /gene="hprK"
FT                   /locus_tag="JDM1_0623"
FT   CDS_pept        654596..655543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hprK"
FT                   /locus_tag="JDM1_0623"
FT                   /product="HPr kinase/phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61511"
FT                   /protein_id="ACT61511.1"
FT                   /translation="MAGSVTVADLVKNTRLDVYHGADLLEKKDITTSDISRPGLALTGY
FT                   FNYYPRERVQLLGKTETAYSKNMSHDERLMIFRKMCQLTTPAFVISTGLPVPEELVQAG
FT                   EENGVPILGTKMTSSRILSNMTNYLEGKLAERQSVHGVLVDIYGLGVLITGDSGVGKSE
FT                   TALELVKRGHRLIADDRVDVYQQDEQTLVGEAPAILNHLLEIRGIGIIDVMNLFGAGAV
FT                   RQDTDIDLIVHLENWTPDKQFDRLGNGEQNRKFFDVEVPEISIPVKTGRNLAIIIEAAA
FT                   MNFRAESMGYDATKVFDDNLNKLIKTNSVHDSHK"
FT   gene            655562..656410
FT                   /gene="lgt"
FT                   /locus_tag="JDM1_0624"
FT   CDS_pept        655562..656410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lgt"
FT                   /locus_tag="JDM1_0624"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61512"
FT                   /protein_id="ACT61512.1"
FT                   /translation="MNTVLGALNPIALRLGPIQVHWYGVIIASAVVIAVALAVREGQRR
FT                   GVRPDDIYDMILWALPFTLIAARTYYVIFQWSYYRQNPGEIIRIWDGGIAIYGGLIGAG
FT                   IVVILFCRSRFIPTWLMLDIAAPTVIMGQGIGRWGNFMNQEAFGRVTSLSFLQGLHLPD
FT                   WLINQMYIRGAYRQPTFLYESVWDLLGFALLMLTRHRTHWYKQGDVFLTYVAWYAFGRF
FT                   FTEGMRTDSLMLFNVIRVSQALSVVLFFGSIGLMIWRRRHNPNNRWYLAGSGQKVVAEN
FT                   K"
FT   gene            656428..657444
FT                   /gene="gpsA"
FT                   /locus_tag="JDM1_0625"
FT   CDS_pept        656428..657444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpsA"
FT                   /locus_tag="JDM1_0625"
FT                   /product="NAD(P)H-dependent glycerol-3-phosphate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61513"
FT                   /protein_id="ACT61513.1"
FT                   /translation="MMKKIAVLGAGSWGSILANLLDENGHSVRLWSYSPAQVTELNEQH
FT                   TNERYVPDFKYSETLTAYSNLTQAIDGADVILFVVPTKAIREVAQQVTAVLAKTHQRPI
FT                   IVHASKGLEQETHKRLSQVLAEEIPAELRQAIVVLSGPSHAEEVARHDITLITAASADE
FT                   SAAELVQQLFMNDYFRIYTNTDVVGVELGAALKNIIALGAGALHGLGYGDDAKAALMTR
FT                   GLAEISRLGVALGAEPLTFIGLSGVGDLIVTATSVHSRNWRAGNELGAGQDLKTVIDTM
FT                   GMVIEGIPSTKAAYELAQQQNIEMPITEAIYDVLYKSADIKEVIPQLMRREGKPEIQ"
FT   gene            657488..658408
FT                   /gene="galU"
FT                   /locus_tag="JDM1_0626"
FT   CDS_pept        657488..658408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galU"
FT                   /locus_tag="JDM1_0626"
FT                   /product="UTP-glucose-1-phosphate uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61514"
FT                   /protein_id="ACT61514.1"
FT                   /translation="MSKVRKAVIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQFIVDEA
FT                   RKSGIEDIVIVTGKSKRSIEDYYDSNPELEDNLRAKHKEEMLKLVQETTDINLYFIRQS
FT                   HPRGLGDAVLTAKAFVGDEPFVVMLGDDLMEDKVPLTKQLMNSYDKTHASTLAVMKVPH
FT                   EEVSKYGVINPESEKEPGLYNVNNFVEKPSPEDAPSDLAIIGRYLLTPEIFDVLENQKP
FT                   GKGDEIQLTDAIDTLNKTQRVFAHEFKGTRHDVGYKFGYLKTTIEYGLTHPDVKADLRT
FT                   YIKDLGAKLSKEDSAAPKTTKKPTK"
FT   gene            complement(658506..659186)
FT                   /locus_tag="JDM1_0627"
FT   CDS_pept        complement(658506..659186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0627"
FT                   /product="diguanylate cyclase/phosphodiesterase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61515"
FT                   /protein_id="ACT61515.1"
FT                   /translation="MYRYFIQPQLDKFNNSLIGYEMLIRYRETDQDRWTLPESFDNIPI
FT                   DVQVSLLKATASELALKIGSVSINFNRKQFLNDDIAAAVIDAQKKLFPVHVIVEVTEEP
FT                   GEDTFTLAAMQQQIDKYKANGLQFSIDDVGTGINVYDHIKPLLESAEEIKFAMQNFRAE
FT                   DRENEIPIQLKFWRDIAVQHDIRLILEGVENDAEDQMANDLNISLRQGYYYGKPHLFKL
FT                   KADH"
FT   gene            659578..660342
FT                   /locus_tag="JDM1_0628"
FT   CDS_pept        659578..660342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0628"
FT                   /product="NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61516"
FT                   /protein_id="ACT61516.1"
FT                   /translation="MKIVIVGCTHAGTAAAAQILKDHPEATVTIYERDDNISFLSCGIY
FT                   LYLGGKVNHLEDMFYSSPETLAKLGAMVRTKHNVLKIDAQSKTLQVVDMTTGKVFGDTY
FT                   DKLIMTTGSNVAVPPIFGIDESKVLLCKTYSQAQEIYQTAQDNQRIAIIGAGYIGTELS
FT                   ESYANTHHEVTLFQSHDQILNNYISKEISDQAVQLLKDHGVNVLLNHQVTAFTGNDDGE
FT                   LVIETNQGDFNADLAIVGTGFVPKYGTVTRSS"
FT   gene            660344..660991
FT                   /locus_tag="JDM1_0629"
FT   CDS_pept        660344..660991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0629"
FT                   /product="NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61517"
FT                   /protein_id="ACT61517.1"
FT                   /translation="MDKHGAIIINDYVQTSDPDIYAAGDSCVVNFNPTGRSAYTPLATN
FT                   AVRQGALAGANVFGNQQRYMGTQATSAMQLFDHTLATTGLTLAMAKLNHIPAERVTYEG
FT                   NWRPAYMPSTAKLMIELIYNPENRKILGAQFLSAHEVAQSANALSIAIQNGNTIDDLAF
FT                   VDMLFSPNFDEPFNYLNLVAQQAIEQERQAGRNHPRITAYGDWAKQNDKDLQ"
FT   gene            661184..662122
FT                   /gene="trxB1"
FT                   /locus_tag="JDM1_0630"
FT   CDS_pept        661184..662122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxB1"
FT                   /locus_tag="JDM1_0630"
FT                   /product="thioredoxin reductase (NADPH)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61518"
FT                   /protein_id="ACT61518.1"
FT                   /translation="MAKSYDVIIIGAGPAGMTAALYASRANLSVLLLDRGIYGGQMNNT
FT                   AAIENYPGFKSVLGPDLAKDMYESATQFGAEYAYGSVESVEDRGDVKIVTTDSDTFETK
FT                   ALVIGTGSEYRKLGVTGEDTYGGRGVSYCAVCDGAFFRNKHVVVVGGGDSAIEEGTYLT
FT                   QLADKVTVIHRRDQLRAQQILQDRAFANPKMEFVWNSNVTEIIGDDKKVTGVKVNNNKT
FT                   GEDSEIAVDGVFIYVGINPITKPFSNLGITDENGWIETNDHMETKVPGIFAVGDVRKKD
FT                   LRQVATAVGEGGTAGQGVYTYITALGDKVNN"
FT   gene            complement(662228..662860)
FT                   /locus_tag="JDM1_0631"
FT   CDS_pept        complement(662228..662860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0631"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61519"
FT                   /protein_id="ACT61519.1"
FT                   /translation="MFSYWDVTIKLALGLLTIILQINLSGKSNLAPISALDQVQNYVLG
FT                   AIVGGMIYSTSVTVLQYILVLLIWTLLVLVLRFLTHHNRYVKRLIDGQPQLLIKNGQLL
FT                   VSTALKNGMSANDLMFRLRTEGITDIRYVKRAVLEQNGQLTITQVGDDAVKYPIIVDGQ
FT                   VNLDALETSNHDEAWLLTQLQAQHYTVSDIYLATYTNKQLLLFPYQH"
FT   gene            complement(662861..663418)
FT                   /locus_tag="JDM1_0632"
FT   CDS_pept        complement(662861..663418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0632"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61520"
FT                   /protein_id="ACT61520.1"
FT                   /translation="MRSGPASVRIPINSEVLVSSVTIKTCYNKSYKEAIMTFYSYNYLV
FT                   HQNNNHTLVQLAAIGIIILIIAILSWLWYRHKTDLKYRDLFIIMVLLLLLLVGIQFNEW
FT                   QTIKNSFNQKSQVTQIMQRVAKEKGVRKTAVWSNTSSVSSGMLIKVHDHIYNVTINTDG
FT                   NSYTLTKATPIQSTINYVKEGQ"
FT   gene            663532..665259
FT                   /gene="pgm"
FT                   /locus_tag="JDM1_0633"
FT   CDS_pept        663532..665259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgm"
FT                   /locus_tag="JDM1_0633"
FT                   /product="phosphoglucomutase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61521"
FT                   /protein_id="ACT61521.1"
FT                   /translation="MSWQDTYNTWKNQATLETSLKQELTGMAGDDAALEDAFYEPMEFG
FT                   TAGMRGVLGPGINRMNIYTVRQATEGLARFMDTLPAEVKERGVAISFDSRHHSEDFAHE
FT                   SARVLGQHGIKSYVFESLRPTPELSFTVRHLHTYAGIMITASHNPKQYNGYKIYGEDGG
FT                   QMPPKESDLITSYIRKVDDVFAIAVADEQQLLADKTETIIGDDVDQDYLAKVKEVTINQ
FT                   KLVDEVGKDMKLVFTPLHGTGRMLGEKALKNAGFKNFSVVKEQAVADPEFSTVKFPNPE
FT                   FPEAFKMAIDLGKKEGADVLIAVDPDADRLGTAVRQPNGEYVLLTGNQIAAVLLHYILQ
FT                   ANKDAGTLPTNAAAVKSIVSSEFATKVAASYGVTMINVLTGFKYIAEQIEHFEATGEHT
FT                   YMFGFEESYGYLIKPFVHDKDAIQTTVLLAEVAAYYKQQGKNLYDGLQDLFKEYGYFRE
FT                   QTTSEEFDGVGGSDKIAALMTKFRSEAPTAFAGYDVTGTEDFQSQTESFADGHTAPIAL
FT                   PKANVLKYHLNDGTWIAIRPSGTEPKIKFYIGTLGSTLEEANDKLAKFEDAIQAFIKE"
FT   gene            complement(665383..666093)
FT                   /locus_tag="JDM1_0634"
FT   CDS_pept        complement(665383..666093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0634"
FT                   /product="diguanylate cyclase/phosphodiesterase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61522"
FT                   /protein_id="ACT61522.1"
FT                   /translation="MEPIYRYFVQPQLNLLNNTVYGYELLIKQLTPDGWRLPESFAAIS
FT                   SQVTSDLLIATTKILGLKVRYCAVNISREQLMDTTVAKAIIQSQVQLYPAKLVVELTEE
FT                   RSPKDYPDTMLIPHLRGFIEHGMQISLDDVGTGINDFKSIQEILPLASELKFALQNFRS
FT                   DIKDPKIQQKLHFWRAISSEYGLRLILEGIEDAEDDRLSSHFDINLRQGYYYGKPQLLR
FT                   LPGDPVNFEYPTMN"
FT   gene            666247..667605
FT                   /gene="nox2"
FT                   /locus_tag="JDM1_0635"
FT   CDS_pept        666247..667605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nox2"
FT                   /locus_tag="JDM1_0635"
FT                   /product="NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61523"
FT                   /protein_id="ACT61523.1"
FT                   /translation="MKVAIIGCTHAGIAAMKQILKYYPGTEITVYERHADISYMSCGTY
FT                   LHLGGTIHNLDQALYANPSEFSEQGVQMRMQYDVINVNADKHTILAQNLQTKELQTDHY
FT                   DKLVMATGSITAIPAIPGVENPKVMLCKTCEQAQQLYEAAKHAHHIAIVGGGYSGVELA
FT                   EGYVKSGHTVTLFQRGPHLINEYLDPQISEKIEDLLTTKGIQVRTNAQVTAFSDTADNR
FT                   LRVATADSEEIFDMAVICPGVIPQSELLAGQVNRTKQGAIVTDRYMGTSNPDIFAAGDV
FT                   TEVNFNPTKEHAYMPLVSHAIRQGALAGINIFDKRLGAIGTQATTGMLIFDQTVACAGL
FT                   TLTAAKAANFDAQAAFYEGNYRPDFMPTTAKVMIELVYDQQTRKVLGGQLMSAHEVSQS
FT                   ANTLSVVIHNGNTIDELAFMDMLFSPNFDEPFNYLNLVAQAAVDQEHGYRRNN"
FT   gene            complement(668051..668608)
FT                   /gene="aad"
FT                   /locus_tag="JDM1_0636"
FT   CDS_pept        complement(668051..668608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aad"
FT                   /locus_tag="JDM1_0636"
FT                   /product="D-alanyl-D-alanine dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61524"
FT                   /protein_id="ACT61524.1"
FT                   /translation="MDQALTGFTNIQHLDSEIIVDLRYATTNNFTHQVIYDFTTAIVRT
FT                   GTAHKLAKASALVKQQGYRLKVWDAYRPVSAQRRLFEVYPDPEFVAQPNPNFSHQKGVT
FT                   LDLTLAHPDGGELTMPTAFDDFTAAAHRDAPRTALQEKNYQLLDTAMTAAGFVGYVNEW
FT                   WDYRDTEMDAYQPLAADPNDYA"
FT   gene            668778..669974
FT                   /locus_tag="JDM1_0637"
FT   CDS_pept        668778..669974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0637"
FT                   /product="multidrug transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61525"
FT                   /protein_id="ACT61525.1"
FT                   /translation="MDRQTRRAILILVFSEFLVCLGISLVIPVMPFIKNELHLTATDMG
FT                   IMNALFALAQFVASPIIGRVSDKVGRKPVLTVGLVLYMVSEVLFALTNQLWVFNISRIV
FT                   GGLSAAMVVPTAMALASDITTKRQRAKVIGWLSAAFSGGLILGPGIGGVLAGISYKTPF
FT                   WVAGALGLLSAIVLVILLPADRQIDPDREAITATTTTTNHPMTRAFWTVPIIILFTMIL
FT                   VSSFGLQGFESIYSIYVNEVFHFSLRNIALVLTLNGLISLFLQVALFDTFVQRWGERRV
FT                   IRVCFAAAALCTIWITQAHSKVAVMVATLVIFSAFDLLRPAITTLLTKASEANQGLING
FT                   LNMSLTSVGNIVGPIMSGMLLDMNYHYPYLVVAGFLIVSYLMAFMLRLPNQVHSHQQV"
FT   gene            670080..670727
FT                   /locus_tag="JDM1_0638"
FT   CDS_pept        670080..670727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0638"
FT                   /product="HD superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61526"
FT                   /protein_id="ACT61526.1"
FT                   /translation="MGMHQYFQSLSNLETIQRAPGFFKYQNHSVAAHSFKVAEVAQFLG
FT                   DVEENAGQIVDWRALYEKALNHDYNERFIGDIKTPVKYATPTLRTMLADVEHKLSQNFV
FT                   QNEIPAEFQAAYSRRLSEGKDETLEGQILSVADKIDLLYESFGEIQKGNPEPVFRDIYQ
FT                   ESLKTIVAFKKMTSVQYFLKAVLPEMLAEPFTHQDQLQALTTQILTAGPQSD"
FT   gene            670876..672879
FT                   /gene="uvrB"
FT                   /locus_tag="JDM1_0639"
FT   CDS_pept        670876..672879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrB"
FT                   /locus_tag="JDM1_0639"
FT                   /product="excinuclease ABC subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61527"
FT                   /protein_id="ACT61527.1"
FT                   /translation="MIDRVDNNHFDLVSDYQPTGDQPQAIQQLTAGIESGEKEQILLGA
FT                   TGTGKTFTISNVIAKVNKPTLILSHNKTLAGQLYGEFKKFFPNNAVEYFVSYYDYYQPE
FT                   AYVPSSDTYIEKDSAINDEIDKLRHSATSSLLERNDVIVVASVSSIFGLGDPHEYQDHV
FT                   VSLRVGMEIDRNDLLRKLVDIQFDRNDIDFQRGRFRVHGDVVEIFPASRDDHALRVEFF
FT                   GDEIDRIREIDALTGEIVADREHVAIFPATHFMTNDAIMEHAIKGIEDELDGRLKELTA
FT                   DGKLLEAQRLKQRTTYDVEMLKEMGYTSGIENYSRFMDGRKPGEPPYTLLDFFPKDFLL
FT                   VVDESHVTMPQVRGMYNGDRARKQMLVDYGFRLPSALDNRPLKLEEVEQHINQVVYMSA
FT                   TPGPYEMDRTKHVVQQIIRPTGLLDPTIEVRPIMGQIDDLVGEINKRIEVNERVFITTL
FT                   TKKMAEDLTDYFKDLGIKVRYLHSDIKTLERTQIIRDLRLGKFDVLVGINLLREGIDVP
FT                   EVSLVAILDADKEGFLRNERSLIQTIGRAARNEHGSVIMYADTTTDSMQAAMDETARRR
FT                   AVQMKYNEDHHITPHTIKKAIPELIASTKTTEDAGKKDDFLETDFDDMTREQQLDMISK
FT                   LEEQMKTAAKKLDFEQAATLRDTVMELKAQIS"
FT   gene            672914..675769
FT                   /gene="uvrA1"
FT                   /locus_tag="JDM1_0640"
FT   CDS_pept        672914..675769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrA1"
FT                   /locus_tag="JDM1_0640"
FT                   /product="excinuclease ABC, subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61528"
FT                   /protein_id="ACT61528.1"
FT                   /translation="MANDKIVIHGARAHNLKDIDVTIPRDKLVVITGLSGSGKSSLAFD
FT                   TLYAEGQRRYVESLSAYARQFLGQMQKPDVDSIDGLSPAISIDQKTTSKNPRSTVGTVT
FT                   EINDYLRLLWARVGEPICPNDGTPIASQTVEQMVDRIQKLPERTKLQILSPIVRQKKGE
FT                   HKKIFEKIKREGFVRVRVDGDIHDISETFELNKNQQHTIEIVIDRIVVKSGDRSRLFDS
FT                   FEAALRLSGGYAIADVIGGEPIMFSEHYACPICGFTVGELEPRLFSFNAPQGACPDCEG
FT                   LGIKLEVDEDLVVPDKSLTLAEGALAPWNPISSQYYPEMLKQACEQLEIPMDVPYEDLS
FT                   KADQQTVLYGSNGKTFHFHYQNDFGGVRDVDAVFEGVINNVDRRYHETNSDFTRDVMRK
FT                   YMTELTCQTCHGFRLNRKALSVKVGGEHIGMVSDLAIGKELDFFNELSLSEQSLVIAKP
FT                   ILKEIRDRLSFLQNVGLAYLTLSRSARTLSGGEAQRIRLATQIGSNLSGVLYILDEPSI
FT                   GLHQRDNDRLIGSLKKMRDLGNTLIVVEHDEDTMRAADYIVDIGPGAGENGGEVMAAGT
FT                   PKQVARSRKSLTGQYLSGKRFIPLPETRRPGNGKKIRITGAAENNLKQIDVDFPLGEFV
FT                   VVTGVSGSGKSTLVNDVLKRVLAQKLNRNYEKPGKYKSVSGIKNIERLVNIDQSPIGRT
FT                   PRSNPATYTGVFDNIRDLFAQTNEAKLRGYKKGRFSFNTKGGRCEACHGDGILKIEMNF
FT                   LPDVFVPCEVCHGKQYNSETLEVEYKGKNIADVLQMTASEAVKFFEPIPKIRRKLQTLV
FT                   DVGLGYVKLGQPATTLSGGEAQRMKLASELHKQQSGKNFYILDEPTTGLHSEDIRRLIG
FT                   VLDRLVDAGNTVLIIEHNLDVVKSADYLIDLGPEGGDGGGTIVATGTPEQVAEVAESYT
FT                   GQYLKPVLERDRAREATAPAK"
FT   gene            675830..676306
FT                   /gene="luxS"
FT                   /locus_tag="JDM1_0641"
FT   CDS_pept        675830..676306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="luxS"
FT                   /locus_tag="JDM1_0641"
FT                   /product="S-ribosylhomocysteinase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61529"
FT                   /protein_id="ACT61529.1"
FT                   /translation="MAKVESFTLDHTKVLAPYVRKITVENGPKGDAITNFDLRLVQPNK
FT                   TAIDTAGLHTIEHMLAGLLRDRMDGVIDCSPFGCRTGFHLITWGEHDTVEVAKALKSSL
FT                   EFIAGPAKWEDVQGTTIDSCGNYKDHSLFSAKEWAKLILSQGISSDPFVRKVVE"
FT   gene            676643..677878
FT                   /gene="argG"
FT                   /locus_tag="JDM1_0642"
FT   CDS_pept        676643..677878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argG"
FT                   /locus_tag="JDM1_0642"
FT                   /product="argininosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61530"
FT                   /protein_id="ACT61530.1"
FT                   /translation="MVKQNDKIILAYSGGLDTSVAISWLKDKGYDVVACGIDVGEGKDM
FT                   DAIKEKALKLGAVSSYMIDAKQEFAEEYALIALQGHTLYEGEYPLVSALSRPLIAKKLV
FT                   TLAKQEHAVAIAHGCTGKGNDQVRFEVAIHALAPDIKIEAPVRDWHWSREEEIDYAKEH
FT                   NIPVPINLDSPYSIDENLWGRANECGILEDPWQGAPADAFDRTKALADTPDTPTTLEIT
FT                   FEAGVPVALDGESLNLADLIIKLDQIAGEHGIGRIDHIENRLVGIKSREVYEAPAATVL
FT                   LKAHKDLEDLTFERELAHFKPIIEQKLADTIYNGLWFSPLMEAMVAFLKQTQQVVNGVV
FT                   RVQLFKGNVITEGRKSPNSLYDTNLATYTSADSFDQQAAVGFIKLWGLPTQVNAQVQAK
FT                   AQAEAKTDKAHA"
FT   gene            677878..679281
FT                   /gene="argH"
FT                   /locus_tag="JDM1_0643"
FT   CDS_pept        677878..679281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argH"
FT                   /locus_tag="JDM1_0643"
FT                   /product="argininosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61531"
FT                   /protein_id="ACT61531.1"
FT                   /translation="MSTKKLWGGRFTETGAKYVDDFGASISFDQLLAAEDIAGSLAHVK
FT                   MLKKTGILPAADVDQIVAGLETLAERQKQGKLEFSTVNEDIHMNIESLLTEEIGPVAGK
FT                   LHTARSRNDQVATDFHLYLKHQLPLILDRLHELETVLVDKASENVETVMPGYTHLQHAQ
FT                   PISYAHYLLAYYQMFKRDMERFEFNLKHTDISPLGAAALAGTTFPIDREYSAKLLGFSE
FT                   VYHNSLDAVSDRDFVLEFLSNASILMMHLSRFCEEIVSWSSYEFKYISLSDQFSTGSSI
FT                   MPQKKNPDMAELIRGKSGRVYGNLMGLLTVMKGIPLAYNKDLQEDKEGAFDTVTTVLTS
FT                   LHVFTGMLATLTVNEDRMADATTNDFSNATELADYLANKGIPFREAHAIVGKLVLDGLK
FT                   KQRPLQDIPLKEYQSISPLIQEDVYHDLNAKVAVERRHSLGGTGFDQIRQELQRAQTQL
FT                   SAYQSETTD"
FT   gene            679483..680019
FT                   /locus_tag="JDM1_0644"
FT   CDS_pept        679483..680019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0644"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61532"
FT                   /protein_id="ACT61532.1"
FT                   /translation="MFNDHRWGFDWTEFMTGIVFLIAAYFVIKQPQAALLSLVFLFAIA
FT                   AIISGVTTIGGYTKLRRETGLRANFALVFAIIDILVGLLFLFHAPTGVLVLGYVFAFWF
FT                   LIDSIERLTVVSHLRVFGTGYFVLSLILDIISLALGILLVINPMVAVISFNVLVSFYFA
FT                   VFGINAILIAFARRN"
FT   gene            680216..681100
FT                   /locus_tag="JDM1_0645"
FT   CDS_pept        680216..681100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0645"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61533"
FT                   /protein_id="ACT61533.1"
FT                   /translation="MAESLQLVIISGMSGAGKTVAVQSFEDLGYFCIDNMPPALLPKFS
FT                   ELVEESGKIKKVALVIDLRSRAFYDEIMDMLANLDNTDFVSTRILFLDASNEELVSRYK
FT                   ETRRSHPLAMEGRVMDGVRKERELLAPLKDRASYVIDTSTLTPRELRESIFDKFETDQD
FT                   ETFHIEMLSFGFKYGLPIDADIVMDVRFLPNPYYIPELKKLTGLDKPVADYVMQQPATE
FT                   AFYQQFLSMLESIMTGYEAEGKSSLTIAIGCTGGQHRSVALTQRIGEALAKHYKVHISH
FT                   RDIEKRKETVNRS"
FT   gene            681097..682098
FT                   /locus_tag="JDM1_0646"
FT   CDS_pept        681097..682098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0646"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61534"
FT                   /protein_id="ACT61534.1"
FT                   /translation="MRKYTFKTQRPKIVVIGGGTGLPVVLNGLRKQAVDITAVVTVADD
FT                   GGSSGIIRNYVNVVPPGDIRNVMVALSSWPDLYKDIFQYRFQGDDQFFAGHAIGNLIIA
FT                   ALTEMKSGVFDAVQELSNMMQVDGHVYPAANEALTLHGKFSDGTELVGEAEITAAHKSL
FT                   ERVWVTDKNGKEPQAVQPVIDAIMAADQIVLGPGSLFTSILPNLTIGNIGRAVCESDAE
FT                   VVYICNIMTQKGETDNFSDADHVRVLNRHLGQNFINTVLVNTEKVPEDYMDFHKFNEVS
FT                   KQVSHDFRGLREQNCRVISSNFLKLRDNGAFHDGDQVVAELMNLVGHSDVFR"
FT   gene            682111..683043
FT                   /locus_tag="JDM1_0647"
FT   CDS_pept        682111..683043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0647"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61535"
FT                   /protein_id="ACT61535.1"
FT                   /translation="MSYASDVKKELTNLAVHRENAKAELMALIRMNGAISIANHHFILN
FT                   IQTENPAIARRIYRLLKQFYDVDSELIVRRKMKLNKNNLYIVRLKTGTDMVLADLGILK
FT                   DYQIVEVAPTEVLTDDAAVRSYLRGAFLAGGSVNNPETSRYHLEIYSLYEEHNHMISEM
FT                   MNQYGLNSRTTDRRGGFITYIKEAEKIADFLSLVGATNAMLKFEDIRIMRDMRNSVNRL
FT                   VNCENANMDKVANASSKQIENILLIDATVGLQQLPPKLQEVAVARLEHREVSLKELGTL
FT                   VPGGPISKSGINHRLRKINQFAEQLQKDA"
FT   gene            683468..685120
FT                   /locus_tag="JDM1_0648"
FT   CDS_pept        683468..685120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0648"
FT                   /product="lipoprotein precursor, peptide binding protein
FT                   OppA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61536"
FT                   /protein_id="ACT61536.1"
FT                   /translation="MKKRSVLAVVMSLVLVTVLAACGKHNSQSSGNGKYASSQVLNLSY
FT                   PSSLDSIDISNMSGYGSTGNIFESLYRLGKNGSITPGLAKSTKVSKDGKTYTFTIRNAK
FT                   WSDGSKITAQDFVYSWKRTVTPATKSQYAYLFSGVKNADEIVAGKKSPSTLGVKAQGEH
FT                   TFIVTLDKPITYFKKLMTYPLFGPISEKAVKKWGNKYATKAQYMLYSGPFKLTGWTGTN
FT                   NSWQFVKNNQYWDKKAVHLQKINYTVNESTTTTLNLFQEKKLDLTQLASEQVKNMKSSS
FT                   DYTTYPYSITAFLVYNFQDSNATIKKALNNAKIRQAISLSINRKTLVKNVIGDASTVSK
FT                   TFVPQDLVKDAKTGKDFADESTVKNSTSYNKALAQKLWKQGLKETGIKKLSIQLLASND
FT                   EPNKPISQYLKSALEKNLDGLTVNLSNIPSKVASSRAQSGDFDLYLSGWGADFNDPISH
FT                   LQIMTNNSGYNYGKYNSSTYNALVNKAQNQDANDTSARWQDMINAEKTIMKDQGITPLY
FT                   QTVYSYLQNPKVKGIIHNTAGTQWNYKYAYIAK"
FT   gene            complement(685332..686306)
FT                   /gene="serA2"
FT                   /locus_tag="JDM1_0649"
FT   CDS_pept        complement(685332..686306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serA2"
FT                   /locus_tag="JDM1_0649"
FT                   /product="phosphoglycerate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61537"
FT                   /protein_id="ACT61537.1"
FT                   /translation="MTKVFIAGQLPAQANTLLLQSQLVIDTYTGDNLISHAELIRRVAD
FT                   ADFLITPLSTQVDQDVLDHAPHLKLIANFGAGTNNIDIAAAAKRQIPVTNTPNVSAVAT
FT                   AESTVGLIISLAHRIVEGDHLMRTSGFNGWAPLFFLGHNLQGKTLGILGLGQIGQAVAK
FT                   RLHAFDMPILYSQHHRLPISRETQLGATFVSQDELLQRADIVTLHLPLTTQTTHLIDNA
FT                   AFSKMKSTALLINAARGPIVDEQALVTALQQHQIAGAALDVYEHEPQVTPGLATMNNVI
FT                   LTPHLGNATVEARDGMATIVAENVIAMAQHQPIKYVVNDVTPA"
FT   gene            complement(686465..687055)
FT                   /gene="clpP"
FT                   /locus_tag="JDM1_0650"
FT   CDS_pept        complement(686465..687055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /locus_tag="JDM1_0650"
FT                   /product="ATP-dependent Clp protease proteolytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61538"
FT                   /protein_id="ACT61538.1"
FT                   /translation="MYPVPTVIEQSSRGERAYDIYSRLLKDRIIMLSGPIEDNMANAII
FT                   AQLLFLDAQDSGKDIYLYINSPGGVVTAGLAIYDTMNFIKSDVQTIVMGMAASMASVLA
FT                   SSGTKGKRFALPNSEILIHQPSGGAQGQQTEIEIVAEEILKTRKKINQILADNSGQSVE
FT                   KLNHDTERDNYLSAQEAKDYGLIDDIMENNKLK"
FT   gene            complement(687872..687946)
FT                   /locus_tag="JDM1_tRNA08"
FT   tRNA            complement(687872..687946)
FT                   /locus_tag="JDM1_tRNA08"
FT                   /product="tRNA-Arg"
FT   gene            688029..689366
FT                   /gene="rpoN"
FT                   /locus_tag="JDM1_0651"
FT   CDS_pept        688029..689366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoN"
FT                   /locus_tag="JDM1_0651"
FT                   /product="RNA polymerase factor sigma-54"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61539"
FT                   /protein_id="ACT61539.1"
FT                   /translation="MALGPGFRQQQRQSQKLAMTQRLQQSIQMLQFNVEELRDFLTQKA
FT                   LENPLIDVDTNWNNNHASLNAAKNVTTKADFIERVSTSNQHSLFEYLLDQIHLTMRDTH
FT                   LRQIVLYLIEYVDVNGYLRIDERQVRQETKATPIELLDAITLLQQLDPPGVGARSLQEA
FT                   LMLQTENDDHAPNLAYIVLEESFDELVNRQWDLLAKKYQVTLADISSIYDYVRTLTPVP
FT                   GAAIGQETTGYIFPDLVVTNQGGQLALRTASMAQPVVKFRSRYYQQMGQHDDQEVTEYL
FT                   KEKKSEYDWIANSLQQREATIFRVGTAIIERQADFFLEKTTDLRPLLLRDVAQQLKVHE
FT                   STISRSINGKYIQTDFGMFELKRFFTKAVSKRPTGGKIVSADSVQHRIVTLIEQENKEK
FT                   PLSDQKIVQILNAENVELSRRTVAKYRENLNIPSSSRRKQYLRTER"
FT   gene            689583..690614
FT                   /gene="cggR"
FT                   /locus_tag="JDM1_0652"
FT   CDS_pept        689583..690614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cggR"
FT                   /locus_tag="JDM1_0652"
FT                   /product="central glycolytic genes regulator"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61540"
FT                   /protein_id="ACT61540.1"
FT                   /translation="MHSDIQWIEAIAPDMVDMLSRRYLVLRTINWMAPVGRRLLAQTLG
FT                   VSERTLRTETDTLRKLDLIMTNKSGMQVTQQGQDVLVGLSHFMDELMGIRQKERQLAQY
FT                   FNIKRCIIVSGDSDRQLKVIGTMGEEVNQLLQQLLPEGRNIIAVMGGHTMEHVASHLTN
FT                   KLGDKRDLLFVPARGGVGESVAIQANTIASQMAQHTGGKFRSLFVPEQVSERTYEPLLK
FT                   EPSIQEVLAIIGQANVVVHSIGEAISMAHRRNMSEDQIKVLRSREAIGEAFGYFFDKKG
FT                   NVVYRIPRIGLQIGELAHREIILAIAGGASKATAIAAYMKNIAPKQTCLITDEGAANLI
FT                   LKK"
FT   gene            690681..691703
FT                   /gene="gapB"
FT                   /locus_tag="JDM1_0653"
FT   CDS_pept        690681..691703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gapB"
FT                   /locus_tag="JDM1_0653"
FT                   /product="glyceraldehyde 3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61541"
FT                   /protein_id="ACT61541.1"
FT                   /translation="MSVKIGINGFGRIGRLAFRRILELGEKSSDIEVVAINDLTSPALL
FT                   AHLLKYDSTHGTLNADVSATDDSIVVNGKNYRVYAEPQAQNIPWVKNDGVDFVLECTGF
FT                   YTSKAKSQAHLDAGAKRVLISAPAGSDLKTIVYNVNDDILTADDRIVSAGSCTTNCLAP
FT                   LAFFENKEFGIKVGTMTTIHAYTSTQMLLDGPVRGGNFRAARAAGVNTIPHSTGAAKAL
FT                   GLVIPELNGKLQGHAQRVGVVDGSLTELVAILDKKVTADEVNAAIKKHTEGNESFGYND
FT                   DEIVSSDVIGTTFGSIFDPTQTEVTSDGDNQLVKTVAWYDNEYGFTCQMVRTLLKFATL
FT                   "
FT   gene            691824..693026
FT                   /gene="pgk"
FT                   /locus_tag="JDM1_0654"
FT   CDS_pept        691824..693026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgk"
FT                   /locus_tag="JDM1_0654"
FT                   /product="phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61542"
FT                   /protein_id="ACT61542.1"
FT                   /translation="MAKLIVSDLDVKDKKVLIRVDFNVPIKDGKIGDDNRIVAALPTIK
FT                   YVIEHDGKAILFSHLGRIKSEDDKKGLSLRPVAERLSNLLNKPVTFVPVTEGEQLETAI
FT                   NNMNDGDVLVVENTRFEDVVNGEQVKRESGNDPELGKYWASLGDVYVNDAFGTAHRSHA
FT                   SNVGIASNMDQVAAGFLMEKEIKFLGDAVDNPKHPFVAILGGAKVSDKIGVIDHLISKA
FT                   DKIIIGGGMTYTFYAAKGMGIGNSLVEKDKIELAKSIIEKAGDKLVLPSDSIVAEKFDN
FT                   DVPSKVVEGSIPDGYMALDIGPKSIEEFEDVLRDAKTVVWNGPMGVFEMSNYAKGTLEI
FT                   GKFLGTLSDATTIVGGGDSTAAVKQLGVGDKLTHISTGGGASLEYLEGKELPGIAAISE
FT                   K"
FT   gene            693053..693811
FT                   /gene="tpiA"
FT                   /locus_tag="JDM1_0655"
FT   CDS_pept        693053..693811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tpiA"
FT                   /locus_tag="JDM1_0655"
FT                   /product="triosephosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61543"
FT                   /protein_id="ACT61543.1"
FT                   /translation="MRTPIIAGNWKMNKTASEALAFVNAVKDQLPDPSKVESVVAAPAL
FT                   FLQEMVEAAKGSDLKIAAENAYFEDAGAFTGEISPAALADLGVDYVVIGHSERRGYFHE
FT                   TDEDINKKAHAIFKNGMKPIICCGESLEQREAGEAESWVSGQIKAALKDLSADQVSSLV
FT                   IAYEPIWAIGTGKTATSDQAEEICAVVRKTVADLYSQEVADKVRIQYGGSVKPANVNEL
FT                   MGKDDIDGGLVGGASLQPDSFLELVNYQNN"
FT   gene            693893..695221
FT                   /gene="enoA1"
FT                   /locus_tag="JDM1_0656"
FT   CDS_pept        693893..695221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="enoA1"
FT                   /locus_tag="JDM1_0656"
FT                   /product="phosphopyruvate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61544"
FT                   /protein_id="ACT61544.1"
FT                   /translation="MSIITDIYAREVLDSRGNPTVEVELYTESGAFGRGIVPSGASTGE
FT                   HEAVELRDGDKSRFMGKGVTKAVDNVNKLIAKEIVGYDVTDQRAIDQAMIKLDGTPNKA
FT                   KLGANAILGVSIAAARAAADELEMPLYNYLGGFNAHVLPTPMMNVINGGAHANNDVDFQ
FT                   EFMIMPVGASSVKEAIRMGSETFHNLKAILNERGYSTAVGDEGGFAPDLKNNEEPFEIL
FT                   VEAIERAGYKPGKDIAIAFDCAASEFYNEETGKYDLKGEGENGQSFTAEEFVDLLDSIV
FT                   DKYPIVSIEDPLDENNWEDWQMATAKLGKKVQIVGDDLFVTNTDYLAKGIKMGVANSIL
FT                   IKVNQIGTLTETVEAIEMAKEAGYTAIVSHRSGETEDTTIADLVVAMNAGQIKTGSMSR
FT                   TERIAKYNQLMRIEDQLESTSEYKGIHGFYNLDEAARNTITSK"
FT   gene            695513..696244
FT                   /locus_tag="JDM1_0657"
FT   CDS_pept        695513..696244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0657"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61545"
FT                   /protein_id="ACT61545.1"
FT                   /translation="MAARFTVGPTQIAIFPPSEVIPQTRAYYQAERFGLTRMARLSLGA
FT                   PRLLHAGFIFDKYQFYYVIYQPLQGLTLTEFCATAKPLAKSTLGRQIGTMLTRLNTEVP
FT                   AFGPTAAQSTEWDTLGPDFVAERAAWLQVHTVTPNQFVHGNLVGGNLIVTSGELGLQRF
FT                   SAAHQAAKQTELVPLILQAFNDDTDLLAGFKETYQTDDLEKDLLLGLLLRVDGPQQIQA
FT                   LHPGAPVTLAAVQQVIAQRLS"
FT   gene            696261..697814
FT                   /gene="eriC"
FT                   /locus_tag="JDM1_0658"
FT   CDS_pept        696261..697814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eriC"
FT                   /locus_tag="JDM1_0658"
FT                   /product="chloride channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61546"
FT                   /protein_id="ACT61546.1"
FT                   /translation="MVAQRPHIAKQHFDFTRFSSIGRALIVGVIAGIVVSIFRFSIEQG
FT                   LRFVQWVYAQIHTNWLLLFPWIGLSVAVAFFVGWLVKNEPNIKGSGIPQVEGQLAGELD
FT                   YSWWSVLWRKFVGGILGIGSGLFLGREGPSIQLGATIGQGVASKLKQTGSDRRSLIAGG
FT                   AAAGLSAAFNAPIASTLFVLEEVYHNFSPIIWTTALVSAMASNFISLNFFGLVPVLHIP
FT                   YGHNLPLSQYGNLIGLGIFLGIFGYLYQNVTLTMPNWYAKLRLPSWLDGLVPFLLVIPI
FT                   GLIWPQLLGGGNAVILNLAAVTPALLALLGIFVLRFTFSTISYGSGLPGGIFLPILSLG
FT                   AILGAIYAQFMVAVGWMPTNLIPNFIIFAMAGYFAGIGKAPFTAILLITEMVGTLHHLM
FT                   PLAVVSMTAYLVVDLLGGAPIYEALLEKLIQPRLPEHSGIQDRLELPIFEGSKLEGHQV
FT                   RDFKWPAESLLIAIRRGERQVIPHGDTLMRAGDTLIILTDRDNRAWVRHQIAHLTVATP
FT                   "
FT   gene            697914..698150
FT                   /gene="secG"
FT                   /locus_tag="JDM1_0659"
FT   CDS_pept        697914..698150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secG"
FT                   /locus_tag="JDM1_0659"
FT                   /product="preprotein translocase subunit SecG"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61547"
FT                   /protein_id="ACT61547.1"
FT                   /translation="MYNLLLTLILVVSVLIIIAVMMQPSKTNDAMSSLTGGADDLFAKQ
FT                   KPRGFEAFMQKVTVVLGIAFFILALALAWYSSK"
FT   gene            698199..698948
FT                   /locus_tag="JDM1_0660"
FT   CDS_pept        698199..698948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0660"
FT                   /product="carboxylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61548"
FT                   /protein_id="ACT61548.1"
FT                   /translation="MMLKQPEPFFFEHGQHAVILLHAYAGSANDVRMLARALEREDYTV
FT                   YGPQFSGHATDDPRDILAQTPAQWWQDTQQAISFMRQKGYTKISIFGLSLGGIFATAAL
FT                   ERDPQLLGGGTFSSPLFAGNRSDVAEMFITLSHHQLAHSQFSITEREQILMTLPELVQR
FT                   QLQAVNTFTTTEVTSHLSAVTQPFFIGQGGQDELIDATVARRLRDQLPQVPVDFHWYAD
FT                   AGHVITVNSAHHQLEQDVLTYLKTIYK"
FT   gene            698957..701371
FT                   /locus_tag="JDM1_0661"
FT   CDS_pept        698957..701371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0661"
FT                   /product="ribonuclease R"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61549"
FT                   /protein_id="ACT61549.1"
FT                   /translation="MSEANLQEQILTFLQAHPDRTYSVEQLTDELHFTGATAFTFLVKE
FT                   LANMERKKLVSTDDHDHFKLVQETKTVEGSFHGNDKGFGFVRYDPDLPDIYINPDNTQF
FT                   AITGDDVAVEIIRPARPGSDRGPEGKIVSIVKRNYTQIVGAYTPSTDEDGIIGSVEIKD
FT                   KKLSKYQLLITDQGLHPTEGEVIIAEVAAYPDAQHPTRMIGIAKQVIGSVDDPGMDVLQ
FT                   VVYQHDVPSVFPEEVTDEANRIPDYVTDEEKVGRVDITDQPLVTIDGAESKDLDDAVVA
FT                   WRLPNGNFHLGVHIADVSHYVTENSELDREAFKRGTSVYLTDRVIPMLPRRLSNGICSL
FT                   NPDVERLAMSCEMEIDQTGEIVNHKIFQSVIRSHARMTYDAVNQILEAHDPKTREKYAD
FT                   LVDMFDTMGDLHRILYKHRRHRGAIDFDDNEAKIIVDEAGHPIDIQLRVRGLAERMIES
FT                   FMLAANETVAKNYSQLKVPFIYRVHETPDSDRMLSFFEFVTNFGVSVKGSSKDVKPKML
FT                   QDVLKKVAGKPEEAMVSVMMLRSMKQARYADQSLGHFGLAAPYYTHFTSPIRRYPDMMV
FT                   HRLIRHYAENGTGEEARARYRDNLPNIAETTSDHERRGIDTERDVDSMKKAEYMADHVG
FT                   ETFEAVVDSVMKFGLFVELENTVEGLVHISTMDDDYYEYVEKQLALVGRKTKRTFRIGQ
FT                   PVKVQLMRVDKDQREVDFKLLNPEEAPKTDLLPKREHHDNYRGNNRRGGNNGNYRRNGN
FT                   NNNRNNDHRGGNNNNHRNGNSNGRRNNNNHNSNNNNHSTNNNRRSSTDRRR"
FT   gene            701397..701867
FT                   /gene="smpB"
FT                   /locus_tag="JDM1_0662"
FT   CDS_pept        701397..701867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smpB"
FT                   /locus_tag="JDM1_0662"
FT                   /product="SsrA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61550"
FT                   /protein_id="ACT61550.1"
FT                   /translation="MAKQHGKHPDTALAQNRKARHDYAVEETYEAGIALTGTEIKSVRD
FT                   RRVNLKDGFVQVRNGEAWMQNVHISPFKEGNRYNVDPLRSRKLLLHKKEISKLGAATMT
FT                   KGVTIIPLKMYLKHGFAKVLIGVAHGKREYDKRQDIKKREQQRQIDRVMKHY"
FT   gene            702327..703952
FT                   /locus_tag="JDM1_0663"
FT   CDS_pept        702327..703952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0663"
FT                   /product="cell surface protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61551"
FT                   /protein_id="ACT61551.1"
FT                   /translation="MNRFITSKQHYKMYKKGRFWVFAGITVATFTLNPLISRADTETTT
FT                   AATAATTTAGASSSSNSQVLRTTTTSTTGATTQSSATAINAATTNTSAQKKQAVSGTTT
FT                   DSKAEQPVTAVGKNENATSNLSTSDSASASSQAKTGSGDSLDQTSNSSVSVASSSQKVT
FT                   TQNSDYQNDQGTGSESGIQSNVTDTVVADESLQTNRSSVASPSTSTMASIGDSDSKDSN
FT                   ETEKVVDSETSPIVVTATTNTITTTNDKVQLNRALLARAAIPAIVQSGTLGTSQWTMNS
FT                   DGVVTIGAGDWSNVDDVSALFYTLGSTVTGVVIDGKVNAGEDLSYLFFKSPNLATITGF
FT                   QNIDTSKVTDFSYMFCGTSVADFSSISHWDVSDSENFDSMFASNSKVQSIDLSHWELSQ
FT                   TQSIKMRRMFAADTALISMYLSAWNMSMVTNINGMFAGNDLNTMALKSVDLHGWNLKNV
FT                   TDMGTMFNFDNSLTSVNMSGWQTSSNLSSVDSMFRGTSSLASLDLSSIDLQGVTRKYML
FT                   LSQNKLYDPIPSSLSTLTLGTIQS"
FT   gene            703949..710200
FT                   /locus_tag="JDM1_0664"
FT   CDS_pept        703949..710200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0664"
FT                   /product="cell surface protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61552"
FT                   /protein_id="ACT61552.1"
FT                   /translation="MTDTGLPDIPTGTGYTGKWVNQADATQTYTSSELMALYNGVDSPA
FT                   DTITWVWETSPSYADFTSKNVTGLIAGPKTTWRVADSVATLKDVNGTDIYATADTVVKV
FT                   ISVNGDTAVTTVDTQTAGTYQVDLQYTDAYGKVWQQTSTVAVAVNQGKLVGKPLTIKMG
FT                   AKPTYTINDLIDTDNSRNAAGDKLSADELATATVTGLDTSKAGAQTVTLAYTDDATGMV
FT                   HTTTTTVTMVATKADLTMRNSTIIKGPENSSWDYRQYVTSVTDFDGNPVSLDGLNIVVD
FT                   QQPDLTQIGSQTVTLTYTDALGNVISVPTQVTVVASQAQVTTKAPLTIWPSEVAQLKVA
FT                   DLVTITAANGNPVDTSTDLTDVTMSSIDTSKGGAQTVTITYTDEAGNLVTAYAKVTVDQ
FT                   SDLKTKLTNPIAGPKAKWDYLAGLEWVKDANGKLLDNLATADIKVVTEPDLSVAMVGHD
FT                   QTVTLSYTDELGKEHLVTAVVNTVASKAKITAVSDQIIIPDEAKKLTATDLVSELIDAA
FT                   GNKATNFDDVTMSGFDAKAIGPQTVTLTYSDAYGNQTTDSTTVTVDFATITGQATHPIA
FT                   GPTATWDYRDSVTQVIDANGKIIDVGDADITATTPDLTPAKVGKPQTVTLTYTDSLGKV
FT                   HTTDVIVTTTLSKAKITAVADQIIIPDEAKKLTATDLVSELIDAAGNKITNFDGVTMSG
FT                   FDAKAIGPQTVTLTYSDAYGNQTTDSTTVTVDSATLTLQNHTQVAGPKATWNYADNIKA
FT                   ITDSKGQSLTLSDAKITVVQRPDLSVAGTYKIVLEYTDDLGQAHTETANVEVTASKAAI
FT                   TAVSKQVILAEKATMVTASSLVSTLYDADGVQIYNSDDVTMSGFNAKAIGPQTVTLAYT
FT                   DAYGNQTTVSTTVTVDFATLTLQNHTQVAGPKATWNYADNIKAVTDSKGQSLTLSNAKI
FT                   TVVQRPDLSVAGTSPIVIEYTDDLGQVHTETANVEATASTLAITAVSKQVILAENANMV
FT                   TAPSLVATLYDADGFQIHNFDDVMMSSFDAQAIGPQTVTLTYTDAYGNQMTDSTTVIVD
FT                   LATITGQATHPIAGPAATWDYRDSVTQVIDANGKTIDVDTADITATTPNLTLAKAGKPQ
FT                   TVMLTYTDSLGKVHTTDVIVTTTLSKAKITAVADQIIWPDQAKQLTATDLVDRLYDAEG
FT                   HLITNYDNVEMSALDSKLAGQQRLTLTYTDVAGNQSVAYANVTVDQAKLVTKPSTVIAG
FT                   PTATWSYEAGISQLTNAAGQLITVQPGTIKVLNRPDLNVDSVGQQQLITLIYTDELGKS
FT                   QSVTAMVTAEASQATLTAKKAVILQPDAAAKLTANDLVTSLTDASGQAVTDYQIVQMSK
FT                   LDATRPGVQPVSLTYTDAAGNEVSTVVKVTVDQAKMESQNRTQIWGPSMTWDYRQQLAT
FT                   VTDSQGHQLNPDQAKITVITGPQLTAKMIDKPQTVTLMYTDDLQQTHTVSATLTLTASQ
FT                   AALVPRPAQIVWAKDAGQLTPANFLQTITGADGTQVSSLTNVKMSAVDASQPGAQTVIL
FT                   TYTDDYGNEVTTTAQVTVDQAALTTQTARPIAGPTAHWDYQTNFKTVTNAAGEVINVGD
FT                   ANIKVLTGPDLSTGMVGQPQVVTFSYTDELGLTQTATAKVTTVASRAHMTTSADQVTWP
FT                   ATVGKLTVADLVTGLTDAWGQTSQNYQNVTMTTINAQQAGKQQVTLTYTDEVGNVKTAT
FT                   TTVTVDQAALTTQPQTVIAGPTAKWDYHQGIGTITDGMGQPIAVNNAAITVVAMPDLTV
FT                   AHIGQPQTVQLVYTDSLGQQQTALVQVTTVATQAKISTRPVTVIAGPKTTWSLNDSVDW
FT                   STSLAADGTLLTAAQRQRVTVDGTLNLRRAGNYPLTLSYMDRAGNLITVTTSIDVLASQ
FT                   AQLQVRDSQLTVGNTWAAQDNFERATDAQGQALTLADIAVDGTVNTQRAGQYTLTYRYT
FT                   DVAGNQLTKTAVVTVALPEDDHINTTDPDNNDHAGITNPSETPKPSEQPNDSDGHTVDW
FT                   GVDDRITTKQQPAAATRAQTKVKMTAEPALPANNERTSAAKAVTRVTDTTADTLPQTGE
FT                   RDRSAQQGAVVLGLTGLLGLMGLGRRRHTHED"
FT   gene            710411..712066
FT                   /gene="isp2"
FT                   /locus_tag="JDM1_0665"
FT   CDS_pept        710411..712066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="isp2"
FT                   /locus_tag="JDM1_0665"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61553"
FT                   /protein_id="ACT61553.1"
FT                   /translation="MQDYYNMNQTTLSIALDYQPEEHHSARYINQLVESLKLKYDYQFG
FT                   RPREYNLGAMLKLVLLAYSYGIFSSRKIERFARENKPAGWLIADQIPSYRTICRFRISD
FT                   ELATLTTDSLSQLTQYLRQNGMIDDVSFIDGTKILADANKYSFVWKKNTIRFDKMNREK
FT                   LVDLLGELHEAKIVGEIPAGSELTPELLDIMISKVEDHLVVLNETVEATKQVSPNPAKQ
FT                   QRRTVKSQKRKLDKRRDKMREHQAQQAIYDQRNSYSKTDHDATFMRVKEDPMQNGQLKP
FT                   AYNVQIATSNQFITGYRLFQNPTDTRTLQPFIEHLKANNVLGHTIVADAGYGSESNYRY
FT                   LEDEFGQHTVLIPYGTMLKENSRKWQSDDRKVMNWDYHEKDDYFINPQNVRFNFNAYRQ
FT                   RTDKYGFTRDFKEYIAEKYDENHQLISAALTPKGYLKRISVNENWEYFKSKQRELLSAP
FT                   ETGQIYAQRKIDVEPVFGKMKASLHFNRFSVRGFDKVTKEAGIVILALNIMKLVTVGTN
FT                   FKNQRRKQMGRETKIRFLVPFAYTEASYVTASFC"
FT   gene            712364..713800
FT                   /gene="glnPH1"
FT                   /locus_tag="JDM1_0666"
FT   CDS_pept        712364..713800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnPH1"
FT                   /locus_tag="JDM1_0666"
FT                   /product="glutamine ABC transporter, substrate binding and
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61554"
FT                   /protein_id="ACT61554.1"
FT                   /translation="MRKWQVAVVMLLAALGSWFAIGTQAQAKTYTIATDTTFAPFEFQV
FT                   KGGKYKGIDIDILKAIAKKENFNYKLKALSFGAAVQQLSANQVDGVIAGMNITAERKQT
FT                   FDFSDAYYTSGVVMAVAKDSKVKTFKDLKGKTVALKTGTAGATYAKSIQSKYGFKIKYF
FT                   NDSNNMYNDVKVGNSAACFEDYPVMSYGIKNGIALKIVSKQHEAGDYGFAVKKGKNAEL
FT                   LKKFNAGLKAIKADGTYKKIINKYLKSSEASLTGEDASSRTFIGLFTQNLDTIGSGLWM
FT                   TLELTVISIILATILGLILGVLGVMPGKLGPAISSTIIYIFRGMPLMVLAFFIYIGFPD
FT                   LIGHGFKIPAFVAGMITLMLNEGAYTGAFVKGGFAAVDDGQMEAARSLGLPYWTAMRKV
FT                   IMPQGIRIMIPSFINQFIITLKDTSILSVIGIVELTQTGTLIIARNFEGFKIWLMIAII
FT                   YLIIITLLTWLSNWVQRRIN"
FT   gene            713803..714537
FT                   /gene="glnQ1"
FT                   /locus_tag="JDM1_0667"
FT   CDS_pept        713803..714537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnQ1"
FT                   /locus_tag="JDM1_0667"
FT                   /product="glutamine ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61555"
FT                   /protein_id="ACT61555.1"
FT                   /translation="MAKVIVKDLHKSYGDNEVLKGLNLEVQDNEVVCMIGPSGSGKSTF
FT                   LRCLNDLEVPTQGQVVISGYDLSDKGTNINLVRENIGMVFQHFNLFPHLSVLQNITLAP
FT                   TQLKKESQQEAEKTARDLLATVGLSDKADAMPKSLSGGQKQRVAIARALAMHPKIMLFD
FT                   EPTSALDPEMVGDVLDVMKKLAADGMTMIVVTHEMGFAKEVADRVVFMADGLIQETGKP
FT                   EDVFEHPQSPRLQDFLQKVINV"
FT   gene            complement(714811..715374)
FT                   /locus_tag="JDM1_0668"
FT   CDS_pept        complement(714811..715374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0668"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61556"
FT                   /protein_id="ACT61556.1"
FT                   /translation="MRKLYFSRNSFAQGARIVRDAHNQSHYLLVGRWGRRQDALSLYAI
FT                   QGELLAEIRQTTLGLLPKFDLYYNRQNVGSISKTLGFWHEMLYVRKLRWIIMGSLSAEN
FT                   YRVYHGTELIMTMRPVVTTNGEAFELAITDQSTEPLCICIAAILDHWQKPTNRARTPVA
FT                   KKGLNVSFGESNYTLTPRNKVPQH"
FT   gene            complement(715398..716267)
FT                   /locus_tag="JDM1_0669"
FT   CDS_pept        complement(715398..716267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0669"
FT                   /product="HAD superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61557"
FT                   /protein_id="ACT61557.1"
FT                   /translation="MISIIASDMDGTLLNNEMVVSDFNANAIRQAQQQGVHFIVSTGRR
FT                   FSEAQPLLAAQGITAPLITLNGAEVYDASGKMLDMVPITNSVARTVFHTLTSQGYYFEV
FT                   VGNDGIYSNSKAKRIEQIAHLLTNLNPDTTFKIAVSLASARLELMDINYVDNYNELLDD
FT                   PTKHVMKIIAFSEEGPAKLKPLSDEILAKHSSLKITSSSASNIEINNINAQKGIAVERY
FT                   ANMLNTPMSDVMAIGDNNNDVSMLELAGVSYAMGNASPEVKQLARYITDTNVNDGVGKA
FT                   ILEVLAKQ"
FT   gene            716383..717075
FT                   /gene="ung"
FT                   /locus_tag="JDM1_0670"
FT   CDS_pept        716383..717075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ung"
FT                   /locus_tag="JDM1_0670"
FT                   /product="uracil-DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61558"
FT                   /protein_id="ACT61558.1"
FT                   /translation="MKAFIHTDWWDVLKPEFEKPYYHQLHEFLKNEYRTKNIHPDMYNI
FT                   FQAFEWTPFADTKVVILGQDPYHGPGQAHGLSFSVLPGVAVPPSLVNIYKELQNDVGCT
FT                   PVNHGYLESWAKQGVLLLNSVLTVQNGVAFSHAGKGWERLTDVAIQRLSERSTPVVFIL
FT                   WGKAARSKIKLIDTQTNVVLQAPHPSPLSAYRGFFGSKPFSKTNIALTSFGEQPINWQL
FT                   PEHVNLEH"
FT   gene            717099..718076
FT                   /gene="eutD"
FT                   /locus_tag="JDM1_0671"
FT   CDS_pept        717099..718076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eutD"
FT                   /locus_tag="JDM1_0671"
FT                   /product="phosphotransacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61559"
FT                   /protein_id="ACT61559.1"
FT                   /translation="MDLFESLAQKITGKDQTIVFPEGTEPRIVGAVARLAADGLVKPIV
FT                   LGATDKVQAVANDLNADLTGVQVLDPATYPAEDKQAMLDALVERRKGKNTPEQAAKMLE
FT                   DENYFGTMLVYMGKADGMVSGAIHPTGDTVRPALQIIKTKPGSHRISGAFIMQKGEERY
FT                   VFADCAINIDPDADTLAEIATQSAATAKVFDIDPKVAMLSFSTKGSAKGEMVTKVQEAT
FT                   AKAQAAEPELAIDGELQFDAAFVEKVGLQKAPGSKVAGHANVFVFPELQSGNIGYKIAQ
FT                   RFGHFEAVGPVLQGLNKPVSDLSRGCSEEDVYKVAIITAAQGLA"
FT   gene            718186..718647
FT                   /locus_tag="JDM1_0672"
FT   CDS_pept        718186..718647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0672"
FT                   /product="ATPase or kinase (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61560"
FT                   /protein_id="ACT61560.1"
FT                   /translation="MESITVTSPEATMAIGAKLGQLVQPGDLILLDGDLGAGKTTFTKG
FT                   LAKSLGIPNNVKSPTFTLIREYRQGRLPLYHMDVYRLEDGGAEDLGLDEYFDGDGVSVV
FT                   EWSQFIADLLPPTYLRIAISRDTDADDQRVITFKPIGEHYQRLVDQLKE"
FT   gene            718653..719168
FT                   /locus_tag="JDM1_0673"
FT   CDS_pept        718653..719168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0673"
FT                   /product="acetyltransferase (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61561"
FT                   /protein_id="ACT61561.1"
FT                   /translation="MAEEVVDVRPAEVADAAQLLALLAQLGRESNTFTVDEGIEDLSET
FT                   DEQAQIERINGTTTNIIFVATLDSRLIGVSTVQASTDFSAAQGEVGVAVLKEFWGMGLG
FT                   TALIEEVLDWARNYSSLERLVLTVQLRNVRAVKLYQHLGFENCTATSYDVVDPTGKRVP
FT                   AIDMGIWV"
FT   gene            complement(719392..719913)
FT                   /locus_tag="JDM1_0674"
FT   CDS_pept        complement(719392..719913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0674"
FT                   /product="DNA-directed DNA polymerase III, epsilon chain
FT                   (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61562"
FT                   /protein_id="ACT61562.1"
FT                   /translation="MDFETANAKRDSACSLALTVVRNNQISDEFYTLIKPESDFFWRNV
FT                   QIHGIHEADVADAPKFPDVWQHIEPFFQRDRLVIAHNAPFDIGVLRNTLAHYGISAPEY
FT                   LSMDTVKTSQRFYPELPNHKLDTVCQALDIDLQHHHNALDDSLACANILLTEAQAFGTE
FT                   QLKPFVRVQG"
FT   gene            complement(719991..720755)
FT                   /gene="exoA"
FT                   /locus_tag="JDM1_0675"
FT   CDS_pept        complement(719991..720755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exoA"
FT                   /locus_tag="JDM1_0675"
FT                   /product="exodeoxyribonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61563"
FT                   /protein_id="ACT61563.1"
FT                   /translation="MKLISWNVNGLRAAVKHGFVTTFNELDADFFCVQETKLQAGQIEL
FT                   DFPGYYQYWNYAERKGYSGTAIFTKHEPLNVTYGIGVPEFDDEGRVITLEYADYYVLTC
FT                   YTPNSGGELKRLDYRQQWEDAFLTYINSLSANKPLIFCGDLNVAHENIDLKNWRSNHHS
FT                   AGFTDEERTKFDRLLAAGYTDTFRHFYPDQTDIYSWWSYRGHARDNNSGWRIDYFITSQ
FT                   QLDSQLLNARIHNEIFGSDHCPVELDIILPNH"
FT   gene            721077..721979
FT                   /locus_tag="JDM1_0676"
FT   CDS_pept        721077..721979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0676"
FT                   /product="oxidoreductase (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61564"
FT                   /protein_id="ACT61564.1"
FT                   /translation="MLKIGVIGLGNIAQKAYLPVMAAMQDQYEFHLTTRNPEKRAQLAT
FT                   MYGFQHTHATLEELMAVKPAAVFVHTPTDTHAAIIKQLLLAGIHVYVDKPVATDLQVVQ
FT                   SLYDLAAARHLLLTCGFNRRFAPFNQQLKALPDKRMLVAEKVREVGSQDPETAVFDQMI
FT                   HMVDTGLFLLDEPLEHTSGRLTTTATGALAQGYLTVQTAHEQLEVITNMYGGVNLEQVT
FT                   VQTTGQRASVTDLSTKTVMTTATTTTTAFPDWTPTLEKRGFAPLIRAFLTAVTTHGPNP
FT                   VDPTGAITSHAVCRHLLSD"
FT   gene            722151..723059
FT                   /gene="murB"
FT                   /locus_tag="JDM1_0677"
FT   CDS_pept        722151..723059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murB"
FT                   /locus_tag="JDM1_0677"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61565"
FT                   /protein_id="ACT61565.1"
FT                   /translation="MTKDVLATFPAIEIKKNESLSHYTNTKTGGPADYVAFPKSISETK
FT                   ALITFANEQNLPLTVIGNASNLIVKDGGIRGLTIILTRMKQIHASGTKVVAEAGAAIIA
FT                   TTKVACGASLTGLEFAAGIPGSVGGAIFMNAGAYGGEMSEVVETVTVLTPAGQLKTLDH
FT                   DELDFGYRHSTIQDYDDIVVSVTFGLKPGNQTKIQARMDELNTLRAAKQPLEWPSCGSV
FT                   FKRPTGYFTGKLIHDAGLQGHRIGGAEVSKKHAGFIINVDHATATDYMDMIHYVQKVVF
FT                   ERFGVHLQTEVRIIGEDVVQG"
FT   gene            723093..725222
FT                   /locus_tag="JDM1_0678"
FT   CDS_pept        723093..725222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0678"
FT                   /product="Na(+)/H(+) antiporter (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0678"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61566"
FT                   /protein_id="ACT61566.1"
FT                   /translation="MPIIELVILLACLVLLSNVLSHYLVAIPVSLIQVGLGLGVALLLN
FT                   VQVKLQTDWFMLVFIAPMLYNDGREFPKQELWELRGAIFANAIVLVFITTILGGFLIHV
FT                   LIPTIPLAVGIALAAILSPTDPIAVQSISEGVKLPKEILHLVSGESLINDASGLIGFKY
FT                   ALAAAVTGTFVLGEAVGDFFYISLVGLAVGLALITIIQLIRDVLRREGINDIVFNVVLQ
FT                   ILTPFAIYFIAEEWFHASGVVAVVAAGVLSHLQNSHESEDAPELRLVTERVWNVVVYLL
FT                   NGIVFLILGIELPAATQATIKGAHTNTFHAVFDVLIVWGILLLIRVAWTYAYMLFNWLR
FT                   HHKKAKPSLRIAALSGLSGVRGAITMAGVFTIPTVVASGKAFPERALVLFIAAGVIIVS
FT                   LVAAAAILPLMAAKSLPFVTRGSSPDEDDAVLADGTDDGDDSSGQLPQLTYKQARIYIL
FT                   QLAIQNIEEHRRPANQRAAYDLILDQQFQIRRLEVASQTADELAPMLTDELELRLVALN
FT                   GERAAVREMIANKQTSKLAGQVYLRRVDRREQRFLQATHRQGLPTLRSLRLLLTRAMQG
FT                   IRLWLAPGDSEELRVALLDIQREASKAAIKALSQYLKQANVDEQQFDRQALYHLIVHYR
FT                   NRIENAKNDHTLSRDDYEQQLHGLRIKSLGAERAGVQHLLESGQISLRTAAKLRQFINY
FT                   SENLLMLNDIEADED"
FT   gene            725361..725873
FT                   /locus_tag="JDM1_0679"
FT   CDS_pept        725361..725873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0679"
FT                   /product="transcription regulator (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0679"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61567"
FT                   /protein_id="ACT61567.1"
FT                   /translation="MTESEIHERFVDTYMHILKYVGDFVSVPTRPYKITFEAYTVMRMI
FT                   ATSEEPLTLVKIAKEQRVSRSAIARQINVLLDLKYIEQTTNTHDRRIKYLSLTPAGHKV
FT                   EQEITTASEERFHQWVQVYGEKRASDTLRYINDAEQKATELGFSGFSGLHDKRGRHTEY
FT                   SDPKTKN"
FT   gene            complement(725949..726614)
FT                   /locus_tag="JDM1_0680"
FT   CDS_pept        complement(725949..726614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0680"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61568"
FT                   /protein_id="ACT61568.1"
FT                   /translation="MTKLQRWFVRLAFWGFFIFAAVDLHGAFHFLLLNSILAYVPIELS
FT                   FWLTPRRSPLLFWLIAVIWLLFYPNAPYLMTDLFHLSLLKPYGINGLLRFDLPMWRDFA
FT                   YLVGPMMVSTIIGTWGVDRIAQQLTQRLHFQRLPASRGIICAALFLFASVGVYVGRFLR
FT                   LHSIYLLITPQYIVKQLVEMWSLKMLAFVLMMWLLQLLIYAAWRFTMPTVPHQTPDKS"
FT   gene            726799..727641
FT                   /locus_tag="JDM1_0681"
FT   CDS_pept        726799..727641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0681"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0681"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61569"
FT                   /protein_id="ACT61569.1"
FT                   /translation="MTFNWSGLLTLQNFVRLLDILAVWFVIYELIVLLRGTKAVQLFRG
FT                   IVVIAIIKAVSVLIGLDTVSWIMDQIINWAVIAMVIIFQPEIRRGLEHLGRGSMFARGK
FT                   RQNEDEERMIAELDKAIQYMAKRRIGALMSIKMDTGLEDYIETGIALDADITGELLINI
FT                   FIPNTPLHDGAVIIQDNQIKVAAAYLPLSESNLIPKELGTRHRAAVGISEVTDALTIVI
FT                   SEETGEVSITKDNELMRGMTRENYLRYFRQVLLTPEDSTKQNALQNWFGRVFGGGPRK"
FT   gene            727638..728615
FT                   /locus_tag="JDM1_0682"
FT   CDS_pept        727638..728615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0682"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61570"
FT                   /protein_id="ACT61570.1"
FT                   /translation="MKKFMNSNWSMRLLALLCALVLFAYVNSLKTTHNASILTNSSSKT
FT                   TLTSNRKVTISAPLELNVNSTKYFVTGYPENIKVTIEGPSALVTTTANTQNFKVYANLS
FT                   KLAVGRHSVKVEVDGLNKELSYGLSQKYIHVNIQPRRTATYKVSADFNKANVADGYEVG
FT                   SARLGTSSVKVTGAVSEVSKVAKVVAVVNTNKNLEKSVNQQAIIEALDANGQNLNVVLT
FT                   PSTTSVYIPITQATTTKDVPIDLKASGKTAADTSYSFSSDTKSVTVTGTKAALAKLKSL
FT                   PVNVDVTNVDSTTTKTVDVSTSDEDGISSVSPTSVKVKITVKND"
FT   gene            728647..730002
FT                   /gene="glmM"
FT                   /locus_tag="JDM1_0683"
FT   CDS_pept        728647..730002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmM"
FT                   /locus_tag="JDM1_0683"
FT                   /product="phosphoglucosamine mutase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0683"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61571"
FT                   /protein_id="ACT61571.1"
FT                   /translation="MKYFGTDGVRGIANSGLTPEMAFRLGRAGGYVLTEHAENKSTQPR
FT                   VLVARDTRISGQMLEEALIAGLLSAGIEVLRLGVITTPGVAYLVRIQDADAGVMISASH
FT                   NPVEDNGIKFFGGDGFKLSDAKEEEIEELLDQPKDTLPRPAAEGLGTVADFPEGNLKYS
FT                   QFLEQTIPDDLSGIHLAVDGANGSTSNLVSRIFADLNVEFDTMATAPDGLNINKGVGST
FT                   HPEALSKFVVEKGAQVGLAFDGDGDRCIAVDELGNIIDGDKIMYICGKFLSERGKLKQD
FT                   TVVTTVMSNLGLYKALEAAGLHSKQTQVGDRYVVEEMLKDGYNLGGEQSGHVVFLDFNT
FT                   TGDGMLTGIQLLHVMKETGKKLSELAAEVTTYPQKLVNVKVQDKKAALNNDKIKAVIKD
FT                   VEDEMAGDGRVLVRPSGTQDLLRVMAEAKTDELVSAYVDRIVDVVKAEVGVE"
FT   gene            730521..732338
FT                   /gene="glmS1"
FT                   /locus_tag="JDM1_0684"
FT   CDS_pept        730521..732338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmS1"
FT                   /locus_tag="JDM1_0684"
FT                   /product="D-fructose-6-phosphate amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0684"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61572"
FT                   /protein_id="ACT61572.1"
FT                   /translation="MCGIVGVTGKDSAVSILLNGLEKLEYRGYDSAGIYVNDQDGHDYL
FT                   VKEKGRIDDLRKEVGEAVHGSTGIGHTRWATHGEPSVANAHPQVSADGRFYLVHNGVIE
FT                   NFEDLKQTYLSDVTFKSQTDTEVIVQLVDRFVTKEGLSTLAAFRKTLGLLGHSSYGFLL
FT                   MDKEDPDTLYVAKNKSPLLIGVGEGFNVVCSDSLAMLDQTKDFLELHDGEIVVVKPDEI
FT                   KITNQAGEPVERKPFHVDIDAAQADKGTYPFYMLKEIDEQPNVMRKLSQVYLNDAGDPI
FT                   INDDLLTALKAADRLYIVAAGTSYHAGLVGAKLFESLANVPTEVHVSSEFAYNQPLLSA
FT                   HPFFIFLTQSGETADSREVLLNVNDQHFPSLTITNVPNSTLSREATYTLLLHAGPEIAV
FT                   ASTKAYTAQIALQAILAKALGVAVDQPAATAFDVKQQLALVANGMQSLVDEKATFEKIA
FT                   KSALLNTPNAFYIGRGLDYAVSLETALKLKEISYVQAEGFASGELKHGTIALIEKDTPV
FT                   IGIITQKNTAGLTRSNLQEVAARGAKTVTIVTDSLAKDGDTVILPTVDERLTALLSVVP
FT                   GQLLAYYTSLNKGLDVDKPRNLAKSVTVE"
FT   gene            732532..733203
FT                   /locus_tag="JDM1_0685"
FT   CDS_pept        732532..733203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0685"
FT                   /product="diguanylate cyclase/phosphodiesterase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0685"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61573"
FT                   /protein_id="ACT61573.1"
FT                   /translation="MVMLKYKYFAQPINNLGTNRTILYELLLRQWDERQQTWRIPATFE
FT                   IAPTELIQLLDCAIQELNNHHVSINLTARQFANPDFQAAISHYVQTHLLPRELTVELVA
FT                   TPELSELQQLSVGYRAAGILLAFDDVGSDNLFQQIKMMLPYVNTVKFALQNMRPLGTPT
FT                   TDAIVSTLKFWFDKAEEQQMLFTFEGIESAADVQLANHLGITRGQGYYFAKPQLPATFM
FT                   A"
FT   gene            733334..734149
FT                   /locus_tag="JDM1_0686"
FT   CDS_pept        733334..734149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0686"
FT                   /product="HAD superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0686"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61574"
FT                   /protein_id="ACT61574.1"
FT                   /translation="MAINLIATDLNGTLLHQDQRFDKERFKRVLAQLRAINVSLVLSSG
FT                   NQYAHLRQLFKDVMADNLIIVAENGASIYAQDRLIFDGSLSADQQRKFVTVDRYQPLFK
FT                   DAYVILVGSHGSYTELGAPDKLVAMARQFYDHLHLVADLDTVDDTVKKISISTSPDQAA
FT                   ALVARANDYFDGQLRAHDSGYGVVDLVDQRVGKLPAIQFLATKLGLTAANVMAFGDGAN
FT                   DVPLLRYAAHSYAMCNAPADIQAAAKHVTALDNEHDGVLATIEQELLNN"
FT   gene            734324..735991
FT                   /gene="isp2"
FT                   /locus_tag="JDM1_0688"
FT   CDS_pept        734324..735991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="isp2"
FT                   /locus_tag="JDM1_0688"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0688"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61576"
FT                   /protein_id="ACT61576.1"
FT                   /translation="MQDYYNMNQTTLSIALDYQPEEHHSARYINQLVESLKLKYDYQFG
FT                   RPREYNLGAMLKLVLLAYSYGIFSSRKIERFARENKPAGWLIADQIPSYRTICRFRISD
FT                   ELATLTTDSLSQLTQYLRQNGMIDDVSFIDGTKILADANKYSFVWKKNTIRFDKMNREK
FT                   LVDLLGELHEAKIVGEIPAGSELTPELLDIMISKVEDHLVVLNETVEATKQVSPNPAKQ
FT                   QRRTVKSQKRKLDKRRDKMREHQAQQAIYDQRNSYSKTDHDATFMRVKEDPMQNGQLKP
FT                   AYNVQIATSNQFITGYRLFQNPTDTRTLQPFIEHLKANNVLGHTIVADAGYGSESNYRY
FT                   LEDEFGQHTVLIPYGTMLKENSRKWQSDDRKVMNWDYHEKDDYFINPQNVRFNFNAYRQ
FT                   RTDKYGFTRDFKEYIAEKYDENHQLISAALTPKGYLKRISVNENWEYFKSKQRELLSAP
FT                   ETGQIYAQRKIDVEPVFGKMKASLHFNRFSVRGFDKVTKEAGIVILALNIMKLVTVGTN
FT                   FKNQRRKQMGRETKIRFLVPFAYTEASYVTASFWVLLK"
FT   gene            complement(735983..736570)
FT                   /locus_tag="JDM1_0687"
FT   CDS_pept        complement(735983..736570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0687"
FT                   /product="transcription regulator (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0687"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61575"
FT                   /protein_id="ACT61575.1"
FT                   /translation="MPATDLRVQRTQTALKEAFRTLALKYPRYRDITVKELTSVANINR
FT                   KTFYLHFDSIDDLAETFVQEGADKILALIDPQDFKKNISQPGLIFDRLVTYFRQSEAFH
FT                   RVILLNDDYSFLSRKIHAAVVAGLTTTIQTNYHLSAIDAKVCSSFLIHNNLTFFRLYFN
FT                   GDLGLSLAELKQRLVSLNTYGIHQFFYPNQSL"
FT   gene            complement(736905..737954)
FT                   /gene="galM1"
FT                   /locus_tag="JDM1_0689"
FT   CDS_pept        complement(736905..737954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galM1"
FT                   /locus_tag="JDM1_0689"
FT                   /product="aldose 1-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0689"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61577"
FT                   /protein_id="ACT61577.1"
FT                   /translation="MSGSYGSEGIMKIIEHQGNGINYYTLVNNHHMSVTIMDWGATVTA
FT                   IKTHDKDGNFANIVLGFDDGADYITYQSFFGATIARVAGIIKNARWRQYDLTQNAGENH
FT                   LNGGNMPQISFEPWFLERKLHTSDQVGLVMQYITLDGENGYPGTMTITANFVLDNDGKF
FT                   TISYTGKSDKTTLFNPSNHTYFNLSGDAERLIDHHVLKINADEYAALNKHGIPTGKLPW
FT                   VTDTPFDFRDPVEVGPQVANIKGGLHHGFVLNDTPYPQVELLDRISGRKVTMRTNAPAV
FT                   VVSSATNYRDDRYRLNGGKPMRSQLGLSLQAQKLPDAIHHKEFGSIIIEPNIPVTYQTA
FT                   YRFSNIYDV"
FT   gene            738624..738938
FT                   /locus_tag="JDM1_0690"
FT   CDS_pept        738624..738938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0690"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0690"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61578"
FT                   /protein_id="ACT61578.1"
FT                   /translation="MQLKNHEVLDLIQEITRNDGTSYMEIGNMLMNGRAELAAERGFIK
FT                   QVRILQLNIPHSTHVAKYEQYINETFTIPDETMDHWEEWTKTPDIQAEVDLILKENHIG
FT                   "
FT   gene            739184..739609
FT                   /locus_tag="JDM1_0691"
FT   CDS_pept        739184..739609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0691"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0691"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61579"
FT                   /protein_id="ACT61579.1"
FT                   /translation="MKNGALLQFIQSHFQTRFRFRNAFETQLTVQILSRLIGEHPESLL
FT                   LTRRDVEALAGCSLDAPALQREYFPQRAMTLLETALDELVTLSVIIHQDQGRTRYPLFR
FT                   SVQLDQVCQRIVFNLNLDVLPQLTDWSRELQQEQERF"
FT   gene            739610..740362
FT                   /locus_tag="JDM1_0692"
FT   CDS_pept        739610..740362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0692"
FT                   /product="nitro/flavin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0692"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61580"
FT                   /protein_id="ACT61580.1"
FT                   /translation="MTKSVIETLQDHRTRRQFTTEPISDAQFAQIITTAQQMPTSQYLQ
FT                   AYSLIEITQPALRQQLATITTMPTVGENGRLLVVVVDQHRNVKLAPGATTRRALSEFDR
FT                   FAGSIEDATLITAAMVMVAESMGLGSVVLGSINNDTQAVIDALHLPDLTLPVFGLQLGH
FT                   PADVPEEKPRLGLPAVLFQDTYAEPASYQAELDRFDGVLNQYYQHRSSHARTEHLAHMT
FT                   QEATHSAAKRREFLTIARQQGFLPELDQ"
FT   gene            740656..741855
FT                   /locus_tag="JDM1_0693"
FT   CDS_pept        740656..741855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0693"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0693"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61581"
FT                   /protein_id="ACT61581.1"
FT                   /translation="MINANFRKLVLGRAVGNAGDSIYMIAMNWFILQLTNSALWIGIMN
FT                   VAIVLPGVLLFLFGDSIDRHSKRRLLVAVEFSQLVIVVMLIGLVALHIKLPGIYVGLVF
FT                   VAALFGSLAYPIQDTLVPLLVEPDQLVQAQADMSIAYKGTDYVFNALSGFLISLCSVLG
FT                   VLIMDAATFVVTVATFRRIKLAEPRQQHTREKSLYLNQILVGFKIISTDPLLRLLTFAS
FT                   VVMNFFFGGLNTYVVLFGRHFGGSIYYGILESMSAVGILLGMTVVYRQLKKLTVRQSYL
FT                   IGNFGRALFMILTVVSYNQFWLFAIIYLLSFVFQGLTQVFETPMIQATVGSDQLGKVMT
FT                   CFYTLVSVTLPLGSLAFSFLADRFDLRLFLLLFALFYAGIFLLFLASHAFKKVDELQLS
FT                   "
FT   gene            complement(742893..744419)
FT                   /gene="glpK"
FT                   /locus_tag="JDM1_0694"
FT   CDS_pept        complement(742893..744419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpK"
FT                   /locus_tag="JDM1_0694"
FT                   /product="glycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0694"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61582"
FT                   /protein_id="ACT61582.1"
FT                   /translation="MSAKYIMAIDEGTTSTRTIIFNHAGQKVADAQKEFPQYFPQPGWV
FT                   EHDATEIWNAVSSTIANVLIDANIKPNQIEAIGITNQRETTVVWDKQTGLPIYNAIVWQ
FT                   SRQTAPLAEQLIADGMGDLIHRHTGLVTDAYFSATKIRWILDHVDGAQKRAERGELLFG
FT                   TIDTWLVWKLTGGETHVTDYTNASRTMLFNIHDLQWDQTILNLLNIPAAMLPEVRSNSE
FT                   IYGTTRDYLLYGSQIPISGMAGDQQAALFGQMAFEPGMVKNTYGTGAFTVMNLGEQPQL
FT                   SDHNLLTTIAYGLDGNINYALEGSIFVAGSALQWLRDGMQLIESAPESESLAQQSHNHN
FT                   EVYVVPAFTGLGAPYWDSETRGAVFGLTRGTTRADFVKATLQSLAYQSRDVIDTMKNDA
FT                   NITMPTLMVDGGAARNNWLMQFQADISNVKIIRAADLETTALGAAFLAGLAVGYWQDLD
FT                   ELKSIHQTGNVFQPRMAAPQRANLYQGWQAAVKAAQLFKHTPIDAQSSTN"
FT   gene            744724..745506
FT                   /locus_tag="JDM1_0695"
FT   CDS_pept        744724..745506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0695"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61583"
FT                   /protein_id="ACT61583.1"
FT                   /translation="MQKRRFFLKGSAAEVAWLNRQAAWGYQLTAIHGLSYQFKEVPQAR
FT                   QLIAEYMPQTTLQAMTTVFQPLTSYTFHDDMAVVYSTVAPKQRVVNNDQQYRLAVYRHA
FT                   RDVALNWLNGWVLVVWLMMSATIVISSQLQATPLLTRLLLLGLALGAGVMVAGIIVGVR
FT                   TAIRCHREVCRLIRITGDDHETWKPTFHVLFKHQHAAPDTTCWDDLGSWQLALHNQRGD
FT                   YYFELKTTLSELEITNTLAQRFSKQDFSVVSWLGLYVV"
FT   gene            745604..745675
FT                   /locus_tag="JDM1_tRNA09"
FT   tRNA            745604..745675
FT                   /locus_tag="JDM1_tRNA09"
FT                   /product="tRNA-Asn"
FT   gene            745900..746322
FT                   /gene="nrpR1"
FT                   /locus_tag="JDM1_0696"
FT   CDS_pept        745900..746322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrpR1"
FT                   /locus_tag="JDM1_0696"
FT                   /product="negative regulator of proteolysis"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0696"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61584"
FT                   /protein_id="ACT61584.1"
FT                   /translation="MTVNLYYSTSSKSSRSARAWLVENNIPFNERDIIANPLDRDELKQ
FT                   ILRLTENGFEDIVSTRSKAFKALHIDLSDLGFNQLLDLLVEKPQLLKRPIIYDGRRLQI
FT                   GYNEEDIRAFLPRSVRKSELREIQQKLYDDDQQAVG"
FT   gene            746590..746820
FT                   /locus_tag="JDM1_0697"
FT   CDS_pept        746590..746820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0697"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0697"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61585"
FT                   /protein_id="ACT61585.1"
FT                   /translation="MSEQDQAAWAIQALAALKTADNQVVVESIIKVIDDQQAEIESLRG
FT                   SMEGQLWSPTSWHQDQQAQRAAHEDKSTTNH"
FT   gene            complement(746988..747500)
FT                   /locus_tag="JDM1_0698"
FT   CDS_pept        complement(746988..747500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0698"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0698"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61586"
FT                   /protein_id="ACT61586.1"
FT                   /translation="MRWEPFRIILIVATLSCLVILVHVRQPQARTRQLLGLGYLFGLSV
FT                   ILFTPLSFDGTAIYVMPAGVGQVNLSRLYLHGLGFIENIILTIPLGWGIKRHFHHYPLL
FT                   GLGLTGLLVGASIESLQYFMSQHWLINRSSDINDVIANATGILIGGLVAATFKFVAQHR
FT                   KTSVTDY"
FT   gene            complement(747616..749070)
FT                   /locus_tag="JDM1_0699"
FT   CDS_pept        complement(747616..749070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0699"
FT                   /product="transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0699"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61587"
FT                   /protein_id="ACT61587.1"
FT                   /translation="MINGGFILSTTTPVIPTQTKVAIFGTASLAFCGILVETSMNVTFP
FT                   TLMHQFHTTLATVQWVTTAYLLAVAATMVITAFIQQRFRWRTIINVGGAGFVLGGLLCT
FT                   VAPQLWLLLFGRIIQAIGTGLALPLVFAQIMTQVPFTAQGRFTGTAGMLIALAPSLGPT
FT                   YGGLVTQLLSWRLIFGITLPFGLIAWLITAKTIRQTQAPRSRPFPLCQFGLVVAALILL
FT                   IFSVNNLSTHGLSLVFVWLPLLLAVLAVLTFTRSATRTTHPLINLAVFQQGNFTRALLI
FT                   YFFIQFIQIGLTFLLPNFAQLALGKNALVSGLMLLAGSLCSAILSPLAGKLMDRRGIRR
FT                   PFQIGSGFLLLATLSLAGLAQHLSVGLIIGLFVGFQIGFSCLFNNALTYGLQQLPPQLM
FT                   GDGNALFNTLQQYSGSLGTAIMAVLITLGTRMAPSASSTMQTTLGTQIALWFSLIIIMI
FT                   VAALALTTKPIANMADDQHQSRSSNH"
FT   gene            complement(749219..750172)
FT                   /gene="ppx2"
FT                   /locus_tag="JDM1_0700"
FT   CDS_pept        complement(749219..750172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppx2"
FT                   /locus_tag="JDM1_0700"
FT                   /product="exopolyphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0700"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61588"
FT                   /protein_id="ACT61588.1"
FT                   /translation="MENFAVIDLGSNSCRMTITQIQEDGSYAVTHRLKEMVRLSENENA
FT                   TDTPTLQAEAIDRTIAALKSFAAVYKDLPNLTIKAVATAATRKASNQKKFLKRVKNDVG
FT                   LDIEVIPGTTEAYYDYLGVVNTLPTTNCVMVDTGGGSCELVLIVNGQAKDLISLPIGAV
FT                   SLSEKFGLNDQVTASQLFKTMTFVDKIFNSVWWLRNGLNLPLVCLGGSNRTLAKINRRK
FT                   CNILNFEDIHGYRLRDNAIYDTFNTVISQDAAGRAAIPGLAKDRADIIVGGMIPAISLM
FT                   RFLDSDRMIFSQNGLREGILFEHLTALAEQSAKVSE"
FT   gene            complement(750175..752331)
FT                   /gene="ppk"
FT                   /locus_tag="JDM1_0701"
FT   CDS_pept        complement(750175..752331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppk"
FT                   /locus_tag="JDM1_0701"
FT                   /product="polyphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0701"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61589"
FT                   /protein_id="ACT61589.1"
FT                   /translation="MNYYKESYYTNRELSWLDFNYRVLDEARDKDNPLLERVRFLGITQ
FT                   SNLDEFFTVRVASLRKLMSVNYTKPDPAGLTAADQVSAISDKAHEMVKRQYNTLNRSLL
FT                   PLLEQHAIHLLSMADLNEEQHAFVKNYFDDELYPALTPMADDSSRPFPFIGNNTLNIAL
FT                   RIYKNGDKKDRKFATVQVPDVFPRVVVLPGAPNQFILIEEIIKAFVGSLFINYTVKETS
FT                   CYRVMRDLDLDVAEEDTSDLLKEVQKQLKMRERGKVMRLEVEKSMSKHQRTRLAKALGI
FT                   NESALYVINGPLNLTFLSKLVKAVQGHEDLNYPKYHAYYPAKYRERSIFDLIKDHDILM
FT                   QYPYDDFKPVVDFIHEAAEDEDVLAIKMTLYRVSADSPIIKYLGQAAQNGKQVTVLVEV
FT                   KARFDEENNVHWAKKLEEMGCHVIYGLIGLKTHCKLALVVRRENEGIKRYMHMGTGNYN
FT                   DVTAHFYTDMGLFTADTDMGIDASNIFNMLSGYSEPPYFHKLHISPDGIRDFINEKLDD
FT                   EIAIAKAGQPAVVKMKMNSLSDPQIISKLYEASHAGVKIQLIIRGICCLRTGIKGISDN
FT                   IEVHSIIGRLLEHSRIYYFSNDGEPQIYLSSADMMTRNLNRRVELLFPLLQPEISHRAM
FT                   TIFETMWADTVKTRILQPDNTYARVDGRGLEVLDSQAEFIREAEQAVKADHGDTTPTSN
FT                   AHQFIPMMSPKNEPDASDLDREDD"
FT   gene            complement(752332..753861)
FT                   /gene="ppx3"
FT                   /locus_tag="JDM1_0702"
FT   CDS_pept        complement(752332..753861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppx3"
FT                   /locus_tag="JDM1_0702"
FT                   /product="exopolyphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0702"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61590"
FT                   /protein_id="ACT61590.1"
FT                   /translation="MAAKLFGIMMINVQSIELSIVNLRTLRQVERVRSDVSLGEDIYDQ
FT                   HTIDYDSVEQAAQALSGFVQIMNDYGVKDYHLWGSWSLSSANNADYIQDQLLVRTGLKI
FT                   DWLSSSQETYLRSVAVAVHFPRFKQMITKPTYLLGINSGSVGISHYDQSNFVFSRSLRL
FT                   GPVRIAEVLEDLQSSVPNYVEVLDDYISSQIVDFGRFLPGRRDQPSNVVMLGVAPFATL
FT                   FRQQQSKAGVEELSKADFQALYEDVLNASDQYLMDKYEVDEEDVRLIVPELLLINELLQ
FT                   LTNAEKIWLGNVTVLDGLIIQEAIKLGYKKYNFNDQIVTAAKNIADRYNVEPKHRDLVT
FT                   KFSLHLFDQLKPLHHLGKRERLLLQVAAIVHDVGSYIDPHQHYLHSDYILQATELMGLT
FT                   DTEKRMVALISRYHSAQTPSKDIRHFGHLQVEQRLLVSKLSAILRIADALDDGRKQKID
FT                   KISVSIRNPRVIITCFAHDDLFLENWVFAQKAEFFKEVFGLTPVIKLRGVR"
FT   gene            complement(754182..754991)
FT                   /gene="licD"
FT                   /locus_tag="JDM1_0703"
FT   CDS_pept        complement(754182..754991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="licD"
FT                   /locus_tag="JDM1_0703"
FT                   /product="lipopolysaccharide biosynthesis protein LicD"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0703"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61591"
FT                   /protein_id="ACT61591.1"
FT                   /translation="MPLTPLHQVELRLMRTVIAICEAENIDYFLIGGSLLGAIRHHGFI
FT                   PWDDDIDIGMRRHDYQRFIAVANHHLDPNKFFLQTGASDPDYALSYMKLLDVNTYIEER
FT                   NNVNNAFKGVFVDIFPFDKIPDDEALRRSQMLHYKLADAAILLKLNYRFVKTPLRNLIT
FT                   KHTPQQLAEVNRYKLEREEYMRLYEQSDSRTYKNLASQYDYEKEIMTYQELTELTTVPF
FT                   EDIQVKIPSAYDTILTRMYGDYMQLPPSDKRVEKHLNKLIIDNHEIL"
FT   gene            755160..755633
FT                   /locus_tag="JDM1_0704"
FT   CDS_pept        755160..755633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0704"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0704"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61592"
FT                   /protein_id="ACT61592.1"
FT                   /translation="MNSDELSKLLNDYFEAYQNTTKIMMDLVAWPLSQNKLSFEQFLIL
FT                   RRIATTDEVTLNDIAIQRQVTRSAISRQVKSLLMQHYVFQVPDPRDRRRLYLHLTERGQ
FT                   QVERIVDQAITQHFDHWVNQLGAPQIDQVLKMMGTFSQQVTDLGEPQSHPVLH"
FT   gene            complement(755848..756009)
FT                   /locus_tag="JDM1_0705"
FT   CDS_pept        complement(755848..756009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0705"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0705"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61593"
FT                   /protein_id="ACT61593.1"
FT                   /translation="MAGSKITAIFFLILYAVLLYLVFTMQNMLAMYLMAIGMFLEACEG
FT                   VYHNFFKH"
FT   gene            756289..757596
FT                   /locus_tag="JDM1_0706"
FT   CDS_pept        756289..757596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0706"
FT                   /product="transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0706"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61594"
FT                   /protein_id="ACT61594.1"
FT                   /translation="MNKIAAYFNFSELKTSMRTEVLAGLTTFVSMAYILFVNPSVLGAS
FT                   GMDKGAVFTATALASALGCLLMGLVAKYPIAIAPGLGVNAFFTYSVVIGMGIKWQTALA
FT                   GVFVAAVIFILITIFKLREMIIDAIPRDMKLAISAGIGFFIAFIGLHGGGLIVANKSTV
FT                   VGLGSLTVGTTWLTIFGLIVTLILMSRKVPGGIFIGMVLTSILGLATGLIKMPSTIVSA
FT                   APSLKPTFGVALGHIGDINSLQLIIVVLTFLLVTFFDTAGTLVGLAEQAGFMKNNKMPR
FT                   VGKALMADSTSMLVGSVLGTSPTSAYVESSAGIAVGGRSGMSAVVTGALFILGLFFSPL
FT                   LNVVTDQVTAPALIIVGVLMAESLKQISWERFEIAVPAFLTVIGMPLTYSISDGIALGF
FT                   IAYVITMVATKHAKEVHPLMYVLFFIFIIFLWILNV"
FT   gene            758213..759952
FT                   /gene="pox1"
FT                   /locus_tag="JDM1_0707"
FT   CDS_pept        758213..759952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pox1"
FT                   /locus_tag="JDM1_0707"
FT                   /product="pyruvate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0707"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61595"
FT                   /protein_id="ACT61595.1"
FT                   /translation="MAKISGSDAVLKVIQKWGVKHIYGLPGGSFDSTMNAIYNQRETLK
FT                   YIQVRHEEAGAIAASADYKLTGKIGVCFGSAGPGAVHLLNGLYDAKEDGIPMLAIVAQV
FT                   PTKRMNMDFFQAMNEEPIFDDVTVWNRTAMTAESLPMMTDEAIRQAYAHNGVAVLTIPK
FT                   DFGWAEIEDNFETNASVHTVNYPAPTAESVADAVKLIKAAKSPMIYFGVGAKDAAEELK
FT                   AASEKFKMPLVSSVLAKGIIEDDYPAYLGSTGRVAPKPGAEIGFSTDLILWVGNNVPFS
FT                   IFLFNKKAKVIQIDIDSGKFGKRHHTNVAIQADAKKALAAINAAGEARDDSAFYDAAVA
FT                   DKKNWDKWQASFNDSTESPVRPEPIFDVLNQEASDKAVWAIDVGNVNINFERLIRMHDD
FT                   QKWATSGIYATMGFGVPAALAAKVNYPDRDVYSLSGDGAFAMLSEEILAQVKYNLHIIN
FT                   IVFSNETLGFIEAEQTDDSHQPLSGVDLPDTDWAKVGEGYGAVGYTVRTKAEFKQALED
FT                   AKKTDKPVVIDVKLTHAMPFTTEHMYLDDAWQDKDKIAEFVKKYDAQALKPFSYFLKQA
FT                   QTN"
FT   gene            760093..760941
FT                   /gene="ribC1"
FT                   /locus_tag="JDM1_0708"
FT   CDS_pept        760093..760941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribC1"
FT                   /locus_tag="JDM1_0708"
FT                   /product="bifunctional protein: riboflavin kinase; FMN
FT                   adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0708"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61596"
FT                   /protein_id="ACT61596.1"
FT                   /translation="MQVINLDAHRLKMLASQPPLVLALGFFDGVHQGHQRVIQTAKRIA
FT                   KQRDLPLAVMTFNRHASQLFKSQTTFRYLNTVAQKSQHMAALQVDRLYITDFNHQFAGL
FT                   TPTAFIKDYLVGLNAQVVVAGFDYTFGQGGANGMRELAELGAPYFETVTVDRLANQQLK
FT                   VSSTRIRGLIARGQIEQANDLLGYTYATQATFDPLTRTIQLANRQQQLPAAGDYRCWLV
FT                   SANYRQAVILRVTTTLKIISPYQLPPETSVLDVDVQWQQRALQVVSSVSAQHQQSQYSK
FT                   A"
FT   gene            761273..761854
FT                   /locus_tag="JDM1_0709"
FT   CDS_pept        761273..761854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0709"
FT                   /product="putative pyruvate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0709"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61597"
FT                   /protein_id="ACT61597.1"
FT                   /translation="MTKMIAGQALVKVLEAWGVDHIYGIPGGSINHTVEGLYLEKADID
FT                   YIQVRHEEVGALAASADAKFTGKIGVSFGSAGPGATHLFNGLYDAKMDHVPVLALVGQV
FT                   PQATMNTNYFQEMDETPMFSDVAVYNRTVTTAGQLPYVINQAIREAYRQKGPAVVIIPE
FT                   NLSAEEIDYQPVSTPNTVSDTFEHRPLRQR"
FT   gene            761857..763020
FT                   /locus_tag="JDM1_0710"
FT   CDS_pept        761857..763020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0710"
FT                   /product="putative pyruvate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0710"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61598"
FT                   /protein_id="ACT61598.1"
FT                   /translation="MLKAAKHPLVYAGRGLLGAKADLVKFSEQFNIPVMNTVPATGVIP
FT                   TNHPNAIGTFGRLGSKSGFEALQHADLILFLGSEFPFASFWPKGIKIIQVNNNSFDIGK
FT                   MVPIDYAVISDAQAYLQAMIATGETLPETAWLTTNRQNKRNWDKWLQQLAADDHDGLAP
FT                   EAVMHKVASMVGPRDTYGVDTGNVSEWAVRGLPMDQEQRFALSGLFATMGFGLPAGMAG
FT                   ALSVPDSQAWSFSGDGGFAMVAPDIITEARYGLPVINVIFSNQRFGFIYREQVDTKQHL
FT                   YGVDLTDADWAKVADGLGGIGFTVQNNQEVETVFDQIKALQAKGNKRPIVVNAVIKNDD
FT                   PIGTAYMPLDPELYGQAEVDAYAKANHIDIKEQPSLGALLRAQGDQL"
FT   gene            complement(763142..764050)
FT                   /gene="pepR1"
FT                   /locus_tag="JDM1_0711"
FT   CDS_pept        complement(763142..764050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepR1"
FT                   /locus_tag="JDM1_0711"
FT                   /product="prolyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0711"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61599"
FT                   /protein_id="ACT61599.1"
FT                   /translation="MKQGTTIITLDNGYHLWTNTQGKGDIQLLCLHGGPGGNHEYWENF
FT                   GEELADLGVQVSMYDQLGSWYSDQPDYSDPEIAKKYLTYDYFLDEVEEVRQKLGLDNFY
FT                   LIGQSWGGALTMMYALKYGQHLKGAIISSMVDNIEEYVVNVNKCREEALPADAVAYMKQ
FT                   KEAEGNWNDPQYQKYVDVLNAGYVDRKQPTSIRHLINTTATPVYNAFQGDNEFVITGKL
FT                   KEWDIRDQIHNIKVPTLLTFGEHETMPLASARRMARDIPNSRLVTTPNGGHHHMIDNAP
FT                   VYFDHLKQFIRDVEDGSFNQK"
FT   gene            764505..765494
FT                   /gene="birA2"
FT                   /locus_tag="JDM1_0712"
FT   CDS_pept        764505..765494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="birA2"
FT                   /locus_tag="JDM1_0712"
FT                   /product="biotin-(acetyl-CoA-carboxylase)ligase and biotin
FT                   operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0712"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61600"
FT                   /protein_id="ACT61600.1"
FT                   /translation="MANQVAVLRLLIQAAPAYCSGDWLAQRLAISRTAIWKLVQGLQAA
FT                   GHTIESRHGRGYRYVANNQLSAPVIEYALTALPPFDLTVLPTVDSTNAYLRRLVTQTPL
FT                   ALPKIVVADTQTAGYGRSGRAFYSPAQTGIYMSIGLPLSDQKALDAGLLTTSTAVVVAQ
FT                   TLQQLFAVDVSLKWVNDVLVNHHKVVGILSEGITSLETGQISAVVIGIGINLTTTAFPA
FT                   LLAHKAGAVVANPNGVTRNQVICELLRRFFNSYGTYRSGTFMDAYRKLSMVIDQQVELK
FT                   SGTQKYRGVVTDIDAHGALVVKLETGQSRHFSSGEITKVNLLSGGYHG"
FT   gene            765916..767898
FT                   /locus_tag="JDM1_0713"
FT   CDS_pept        765916..767898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0713"
FT                   /product="acyltransferase (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0713"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61601"
FT                   /protein_id="ACT61601.1"
FT                   /translation="MNENLRSVNMSRTMSRMNRHRMNPRRYITGFDGIRTLAVLGVIIY
FT                   HLMPASLQGGYLGVPIFFVVSGYLITDILLQDILSRGHVRIWRFLGHRMRRLYPAFVTM
FT                   LLGTTAYITLFQRSLLTNIRATVLTNLVYVYNWFEINHGQSYFDRFNGESPFTHLWSLS
FT                   IEGQYYLFWPLVIGILMVIFKKRSRVFWFMMIAAGISAITMAMLYDPANTNRVYYGTDT
FT                   RMFAILLGSGLAFIWPSRELSADIANVNRVTLDILGGASLIAIIWMFFQMSGQSDFTYR
FT                   GGMLLFTVLSTVLVATVAHPASHLNRVLTNPLFKYVGQRSYGIYLYQFPVMIFYETKVK
FT                   NIGDHLLLNSLIEVALILIVTELSYRFIENPMRHYDYSRLLVDFKDFLRKPKFNRVTTA
FT                   IVALTTVLFVITAVGFVQQPSKAEANKKTELQKTIAANSKAADKKNAAALKRQKAAQAA
FT                   AASSKKVATEKMQTKQAEAKLNSKQKQVEKEYDLKPQVVLAMANTDLTAIGDSVLLDVS
FT                   SDLQDVIPGTVVQGRVGRQVTEVPGIINSLKSQGQLAHNVLLNIGTNGTITDDQAEQVV
FT                   KLIGKDRQIFWVTAHVPTQSWQNQVNAQIAKTAKKHANVHVIDWHGRAQNQSGWFADDN
FT                   VHPNTTGNRQLTNLIANRIAEVNNN"
FT   gene            complement(768063..770504)
FT                   /gene="pepX"
FT                   /locus_tag="JDM1_0714"
FT   CDS_pept        complement(768063..770504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepX"
FT                   /locus_tag="JDM1_0714"
FT                   /product="x-prolyl-dipeptidyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0714"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61602"
FT                   /protein_id="ACT61602.1"
FT                   /translation="MKNNQFAIVPTDSETAIAELTKIHFITPDMDALTTVPAVYQALLA
FT                   KSLPEVHTASGLTHKFNNIMATSQHTLSEWLANATIVNNQVFYNVGLQLLGFLPGQDFE
FT                   LADPLLAMRDIHLPMVGDSAFDREALYYAWYLLLNTRGNNGQTLIESLTTRGYFVPFYQ
FT                   LPNDQKPLFFNGKAQAVFDTNALIRDVVYVEAPLDTDHDGQRDLLKVEILRPTETETGL
FT                   KVPVLYTASPYNQGINDQAGDAQMHNVDVPLTAKEPDENTYADVEFQPTTAQLPAARTA
FT                   TTTTDTAEETFSREKSYTLNDYFLARGFAVVYAAGIGSIDSDGLAPTGDVDETTSTVAI
FT                   IEWLTGKRQAFTNRDGNIAIKAWWCNGAVAMTGRSYLGTLATAAATTGVAGLKTIISEA
FT                   AISSWYDYYRDNGLVVAPDTFQGEDTDVLAAEVFSRSLKAGDAHQIQPAFDQKLAELTA
FT                   DQDRASGNYNRFWDERNYLKNVDKIKADIIMVHGLNDWNVKPRNVANLWDKLQAVPVTK
FT                   KLILHQGQHIYINNLQSLDFTDMMNLWLSHKLYGLDNHAETLLPNVLVQDNTQAQTWHG
FT                   YDNWWQDTTDALDFKVQYKELVPADHTVDQRAAHFTDKLPDKLFDHYKHHLDSWQRDLL
FT                   QEDKLNPLYDHRLLFKSWQAPEDQLLVGIPHVAGSVAVNKNFGMLSFMLIDFGAARRLT
FT                   VSPQMLAAKALDLGYHWRENDLKDFKLAGETPFKMITKGHLNLQNRHHPWHAEAIQPNV
FT                   FYDFSVDLQPLFHHLLKGHQLGLVIYATDMKMTIRGNQDLQYSLNLNDIRLHVPMKKIT
FT                   D"
FT   gene            770639..771043
FT                   /locus_tag="JDM1_0715"
FT   CDS_pept        770639..771043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0715"
FT                   /product="redox protein, regulator of disulfide bond
FT                   formation (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0715"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61603"
FT                   /protein_id="ACT61603.1"
FT                   /translation="MSDFPILYTTQAVNEDGIEGHAYIPNGLEVAVSSPLKAVPGSNPE
FT                   QLIGLALSTCLNATLEAIEKEHGQTHQSKVVTTVKMSRDRFRYQFFLDARVTIPEVDAE
FT                   TAARWLAIAETRCPVAKLVGPSANVTIQLA"
FT   gene            complement(771161..771463)
FT                   /pseudo
FT                   /locus_tag="JDM1_0716"
FT                   /note="hypothetical protein"
FT   gene            complement(771614..773011)
FT                   /locus_tag="JDM1_0717"
FT   CDS_pept        complement(771614..773011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0717"
FT                   /product="amino acid transport protein (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0717"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61604"
FT                   /protein_id="ACT61604.1"
FT                   /translation="MGIFQRIFQKEDLERYLQKDSHFERTLSAVDLIALGIGAVIGTGI
FT                   FILPGTVAATKAGPGIILSFVLAAIVCAVAAMCYAEFASVLPIAGSAYSYGNIVYGEMI
FT                   GWIIGWALVLEYVLAVATVAVGWAAYFNSFIAGFGLKLPKAITGSFDPAHGTYINVVAI
FT                   LIVCLIAWIIDTGLKTSIRLNNIIVVVKLAIIVLFLLVGSFYVKPSNWTPFAPFGGTGI
FT                   LKGAAVVFFAYLGFDAVSSSAAEVKNAKRNMPIGIIGTLVICTIFYILVSGVLTGMVSY
FT                   KQLNVDDAVAFALQLVHQNFVAGIISIGALAGMFTMMVTMIYSSSRLLYSIGRDGLLPR
FT                   FLGKIDKHHAPKNAMLTVTIVISILAGLIPLDQLANLVNIGTLIAFAFVSFGILLLRRN
FT                   PKLNAIKGFRVPLYPVLPIISGLLCLFMMTQLSMETWLASLVWFLLGLIIYFGYGIRHS
FT                   RMNKADE"
FT   gene            773517..773990
FT                   /locus_tag="JDM1_0718"
FT   CDS_pept        773517..773990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0718"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0718"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61605"
FT                   /protein_id="ACT61605.1"
FT                   /translation="MGAAIDITGQHFGRLIAVHRAGRAKNGNALWFCQCQCGRTCVVDS
FT                   YVLRHGKTRSCGCLAVEQSRQNIFNNPQAVSHMGDPRNLKIRDHHTDVSSIKKSKRNTS
FT                   GVVGVSYDKQSGSWVAHFYYKGTYILNKHFAHFEDAVRARHAMEQQYLTSSDN"
FT   gene            774354..775172
FT                   /gene="pdx"
FT                   /locus_tag="JDM1_0719"
FT   CDS_pept        774354..775172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdx"
FT                   /locus_tag="JDM1_0719"
FT                   /product="pyridoxal kinase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0719"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61606"
FT                   /protein_id="ACT61606.1"
FT                   /translation="MSTMLVAEDLSAVGGISLSSALPVLTAMQYDVAALPTSLLSTHTS
FT                   GYGTPAVVDLSTWLPQVFAHWTRAQLHFDQALIGYVGSVALCQQITTYLEQQTLSLLVV
FT                   DPVLGDLGQLYQGFDQDYVAAMRQLIQQADVILPNTTEAALLTGAPYQVTPDLEVILPA
FT                   LQAQLKTGAHAVITDVQRADQIGCAWLDEAGHVQYCGARRLPGHYNGTGDTLAAVIAGL
FT                   LGRGYALAPTLARANQWLNMAVAETIAQNRTDDRQGVALGDLLQAILALN"
FT   gene            775226..775645
FT                   /locus_tag="JDM1_0720"
FT   CDS_pept        775226..775645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0720"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0720"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61607"
FT                   /protein_id="ACT61607.1"
FT                   /translation="MSTEVASGAVVYQQKDGHPAYLLLQSATSDFWGFPKGHVEGNETL
FT                   AEAARREIREETQIEATLDTNFKAYTEYDLPNGNLKQVTLFVSEVPSGVVVTRQQAEIS
FT                   AIGWFDYAAARERLTYDNLKQMLDQANTYIEQHLQ"
FT   gene            complement(775722..775925)
FT                   /locus_tag="JDM1_0721"
FT   CDS_pept        complement(775722..775925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0721"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0721"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61608"
FT                   /protein_id="ACT61608.1"
FT                   /translation="MIHASRSKPTIFRREFCHMQFQKTNSWFSIVLDTQRQMFVATDKL
FT                   HPELFAEGVTIEDAVANLQTQA"
FT   gene            776022..776603
FT                   /gene="gmk2"
FT                   /locus_tag="JDM1_0722"
FT   CDS_pept        776022..776603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmk2"
FT                   /locus_tag="JDM1_0722"
FT                   /product="guanylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0722"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61609"
FT                   /protein_id="ACT61609.1"
FT                   /translation="MTTKRIFVITGPTGSGKTTVSHYLRSQYQIPQVITHTTRAPREGE
FT                   VSGRDYYFETPASFVTKHYLEHVTYSGNQYGSSREGLAAAWERSPLISIVLDTAGAITY
FT                   ARELGEQAVVIYLEVADQEALIQRLTKRGDLPSRIKKRVASDEYLRDQALPVGLVGHAH
FT                   VIVNDDWQATRRQLDELVTEYCQHDVVTKD"
FT   gene            776714..777157
FT                   /locus_tag="JDM1_0723"
FT   CDS_pept        776714..777157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0723"
FT                   /product="metal uptake regulator"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0723"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61610"
FT                   /protein_id="ACT61610.1"
FT                   /translation="METPIEQAVAILRRNQFKITKQRQALLDYLVTYQDHYVAISAVDE
FT                   HMRTLFAGMSHNTIYRNIKEFETLGLLELKAQANQTLVKYQCDFKHQHHHHFVCSNCGK
FT                   VTELQACPLDEYEAQLPGCTITGHRIEIYGLCANCTKKQAINS"
FT   gene            777290..777808
FT                   /locus_tag="JDM1_0724"
FT   CDS_pept        777290..777808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0724"
FT                   /product="extracellular protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0724"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61611"
FT                   /protein_id="ACT61611.1"
FT                   /translation="MTSMAYRTPPFISPFAIVSIVLALGATNVVVNKTTHTVNGAKATS
FT                   SVVKSSSASSASLKKKAADDSSDENKSKDKSSSDTSNDEQNSSSSSSTDENDTDSSSAN
FT                   KTSSSSSSADDTSSSATNSSTTDNNSSTTDTSDDDESSAAESSSTTASSSTTTTSQSTT
FT                   DTTTSDGGE"
FT   gene            777812..778630
FT                   /locus_tag="JDM1_0725"
FT   CDS_pept        777812..778630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0725"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0725"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61612"
FT                   /protein_id="ACT61612.1"
FT                   /translation="MFSILDMINHALGYVNVNVKIKNQIYIGIGIAGNLYLGYVAIRLM
FT                   QNGAWLRGILYMLVFLALIYFITLNVIYYFTNKTAKYDLSPRIEKLLGGKPKEALAAEK
FT                   QAQQSQQQPYIPANGIFDGQELLPATVKTSRAEQENVHQIVDQLQAANIVRLDYGGLTD
FT                   DAIIQQAQATGEPVYAIGQGIQIPFSQLKLENHRLVIYAGINQMDQSPVGHITKVGLTD
FT                   VHDAHEDYKLYLASTVIKGGMSKIAGRTSAIEQPGDYQVTAQVAYEGRED"
FT   gene            complement(778927..779553)
FT                   /gene="gph1"
FT                   /locus_tag="JDM1_0726"
FT   CDS_pept        complement(778927..779553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gph1"
FT                   /locus_tag="JDM1_0726"
FT                   /product="phosphoglycolate phosphatase (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0726"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61613"
FT                   /protein_id="ACT61613.1"
FT                   /translation="MTYQALMFDIDGTLTNSQPAYTTVMREVLATYGKPFSPAQAQKTF
FT                   PMAAEQAMTELGIAASEFDHFQAQYEDVMASHYDQIELYPGITSLFEQLPSELRLGIVT
FT                   SQRRNELESGMRSYPFMMRMAVTISADDTPKRKPDPLPLLTALEKVNVAPQNALFIGDS
FT                   VSDEQTAQAANVDFGLAVWGMDPNADHQKVAHRFQKPLDILALFK"
FT   gene            779875..781149
FT                   /locus_tag="JDM1_0727"
FT   CDS_pept        779875..781149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0727"
FT                   /product="bifunctional protein: amino acid
FT                   aminotransferase; 2-hydroxyacid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0727"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61614"
FT                   /protein_id="ACT61614.1"
FT                   /translation="MEFQGVRFFDPSPVRFHQQDQPNLGGIFMSINSETLVNHMNHEIA
FT                   AIQPSDILAFNAEIANIPGIVRLTLGEPDFNTPEHVKQAAIESIEADESHYAPSNGTLA
FT                   LRTAAAEFLAAKYDVHYDPASEVIITAGATGGIYTALTSILNPGDEVLIPTPIFPLYIA
FT                   IVKLSGATPVFMDTSDNGFVLSPDQLQTTLAAHPKTKAVVLNFPSNPTGVTYRHDDLKA
FT                   LAAVLADQPIFVLSDEIYSELTYGEPHESIANYLPTQTILLNGVSKSHAMTGWRIGIMC
FT                   APKAITAQLGKIHQFTVTSTTTNAQAAATEALKNGLDDAQAMKREYQERRDYLYDALND
FT                   LGFQSAKPEGAFYLFSKIPAGLPQNSMAFCRELAHEARVALIPGSSFGPGGEGYVRISY
FT                   AASMADLKTAVTRLRTYVASKKQGA"
FT   gene            781152..782144
FT                   /locus_tag="JDM1_0728"
FT   CDS_pept        781152..782144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0728"
FT                   /product="bifunctional protein: amino acid
FT                   aminotransferase; 2-hydroxyacid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0728"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61615"
FT                   /protein_id="ACT61615.1"
FT                   /translation="MKILMYSVRDDEQDAIQAWAAAHQIQVDTNDLEFHPETADLVKGY
FT                   DGLVIQQRSPIGGDASLYQSLAAAGLKQLTSRTAGVDTIDIPAAKAAGLVVTNVPAYSP
FT                   NSVAEMSVAQTMRLIRNLEMFDQRISQQNFQWAGLQAREIRSLTVGIIGAGRIGGTAAR
FT                   LFHGLGAKVIAYDVVRHPELEDVLTYVDTKEDLLRQADVVDLHVDLNETSAGLIDAAAL
FT                   KLMKTDAYLINASRGPVIVTDDLVAALKAGEIAGCALDTVEGENALFNQNHQGEVLQDT
FT                   NVAQLMQMPNVIITPHVGFYTNLAVKNMVDISLDDVLAILNGETTAHAF"
FT   gene            complement(782378..782629)
FT                   /locus_tag="JDM1_0729"
FT   CDS_pept        complement(782378..782629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0729"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0729"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61616"
FT                   /protein_id="ACT61616.1"
FT                   /translation="MLLDQAANMTNIIAAQIIKVFYPFVIAKTETGAYLKLNLSTNEQR
FT                   DPLFWDELRSILQAKLWVPIGKHYHQLLDNGWLAESTS"
FT   gene            782849..783028
FT                   /locus_tag="JDM1_0730"
FT   CDS_pept        782849..783028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0730"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61617"
FT                   /protein_id="ACT61617.1"
FT                   /translation="MKSLSKNYSAVAVPKRKANYYWLFTNNVQYWSCYSAILTENSVAV
FT                   SHYFMDIEQYLATF"
FT   gene            783168..783902
FT                   /gene="glnQ2"
FT                   /locus_tag="JDM1_0731"
FT   CDS_pept        783168..783902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnQ2"
FT                   /locus_tag="JDM1_0731"
FT                   /product="glutamine ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0731"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61618"
FT                   /protein_id="ACT61618.1"
FT                   /translation="MIEFHDVEKYYGDFHALKNINLTINEGEKVVLIGPSGSGKSTLIR
FT                   TVNGLERVQSGQLLVNGFDLADRKTDMNKIRKNVGMVFQHFNLYANKTVLENIMIAPRL
FT                   VLKRPEDENKKLAMDLLDSVGLADKANSLPSQLSGGQSQRIAIARSLAMKPKCLLFDEP
FT                   TSALDPEMIDDVLNVMKSVAEDSSMTMLVVTHEMGFAREVADRVIFMADGEILEDDAKE
FT                   KFFDGQPSNERARQFLSKIITH"
FT   gene            783923..784759
FT                   /gene="glnH1"
FT                   /locus_tag="JDM1_0732"
FT   CDS_pept        783923..784759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnH1"
FT                   /locus_tag="JDM1_0732"
FT                   /product="glutamine ABC transporter, substrate binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0732"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61619"
FT                   /protein_id="ACT61619.1"
FT                   /translation="MKKLKRLIGALGMLAMLVVVLTACGSRQSLAKQDVLTNDKASKTI
FT                   TWGVKADTKLFGLMDVKDNQIKGFDADIATALTKRVLGKNATAKFVQVTSQTRIPLLKN
FT                   GNIDAIIATMTITPEREKQVDFTNSYFDAGQSLLVKKGSAIKSVKDLNKSGTKVLGVTG
FT                   ANSVENIKKAAPKAKVLELSDYAQAMTALKSGQGVALTTDNGILYGMASQNPGYEVVGG
FT                   TFTKEPYGIAVNKGQEPLKKALNKALKEIEADGTYNRILKKWFGNVAGFDYKEASR"
FT   gene            784759..785400
FT                   /gene="glnM"
FT                   /locus_tag="JDM1_0733"
FT   CDS_pept        784759..785400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnM"
FT                   /locus_tag="JDM1_0733"
FT                   /product="glutamine ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0733"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61620"
FT                   /protein_id="ACT61620.1"
FT                   /translation="MGYILTHYWSELIQGLGYTLLSSVIALVFSTIIGTMFAIFEVLPS
FT                   RTMRIIGRVYIEIFRNIPLLVIAMFFYVIIPMYVTKIDGFTAGTIGLTIYTSSFIAETV
FT                   RAGIQSVDPGQMEGARANGMTYWQAMSKIVLPQAFKIIIPPLGNQFINLVKNSSVLAFV
FT                   AGFDLMYQANSIASLSLDTINSYVVVGVFYLIITLPLSYYMRHLEKKLAN"
FT   gene            785417..786070
FT                   /gene="glnP"
FT                   /locus_tag="JDM1_0734"
FT   CDS_pept        785417..786070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnP"
FT                   /locus_tag="JDM1_0734"
FT                   /product="glutamine ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0734"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61621"
FT                   /protein_id="ACT61621.1"
FT                   /translation="MQNFIQAYSWINIRFLLEGLWVTVEVSVVSIIASFIIGSVLGVLR
FT                   YVKIKYLSAVVGFVVDIIRNLPLILIIFFTYFGLPHLGFKPGIIFAAILAMTIFESAML
FT                   AEIIRSGILAVDYGQMEGARANGMSYVQALWHIVFPQAIKKTIPTIVSQFISLIKDTSL
FT                   ATIIVLPELLNHAQIIYGQNSAYILPMFLMIAVMYFIICYALSILSRVLDKKLA"
FT   gene            786332..786826
FT                   /gene="pts11A"
FT                   /locus_tag="JDM1_0735"
FT   CDS_pept        786332..786826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pts11A"
FT                   /locus_tag="JDM1_0735"
FT                   /product="PTS, EIIA (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0735"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61622"
FT                   /protein_id="ACT61622.1"
FT                   /translation="MMFGIKRKKVDAFEVVTPIEGICIPITAVMDEVFAKKMMGDGFAI
FT                   RPSEDTNQVVAPISGKIVALPESKHAIGIMDETRGVSVLVHIGLDTVGLNGRGFTAHVK
FT                   LNQEVKAGTLLVTLDRQTMATAGLDMTTIVVFTEGYTGEVPLGSKLHQQLAAGTPVLKQ
FT                   A"
FT   gene            786852..787694
FT                   /gene="bglG1"
FT                   /locus_tag="JDM1_0736"
FT   CDS_pept        786852..787694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bglG1"
FT                   /locus_tag="JDM1_0736"
FT                   /product="transcription antiterminator"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0736"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61623"
FT                   /protein_id="ACT61623.1"
FT                   /translation="MRVVKKINNNVVVCLDQHGEELVAFGKGLGFQKVPYELTDMTKVT
FT                   MTFYKLNYQYYQLLKEIPTEIFDLSAAIVERAQALIPRILNPNMIFSLADHINFAITRL
FT                   THYKSAQLPFSYDVEQLYPQETDVGYYAVRLINRRLNIQLPVSEVTAIAMHFVNSQTND
FT                   LATNSSVNSDDEMIKIITKIIEQEYELRINQTEFTYNRFVMHLRYYIKRMKKHEQISEN
FT                   DNSKLFNTMRHDEPEIYLVAKRIADYVDSQLDTNSNDDELFYLMIYVKRIVNKINTQA"
FT   gene            787722..789173
FT                   /gene="pts11BC"
FT                   /locus_tag="JDM1_0737"
FT   CDS_pept        787722..789173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pts11BC"
FT                   /locus_tag="JDM1_0737"
FT                   /product="beta-glucosides PTS, EIIBC"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0737"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61624"
FT                   /protein_id="ACT61624.1"
FT                   /translation="MKNKDKQYEKVANGVLEAVGGSANISSVTHCMTRLRFNLKDESIP
FT                   NDGEVQNIPGVIGVNRAGGQYQIIIGQAVSKVYDALLTVGNLTRNAPINEDLDNRPKEK
FT                   LTFKSAGNMILNKLAGCLTPLIPMLIAASMFKMFAAILGPSMFNVLGTKTSLYQLFTLV
FT                   GDAGFYFFPIILGYTAAKQFNTSRIISMFLGAILIDPNLIKIVTAGKAFNIFGIAMPLV
FT                   NYSSTVIPIILSVWVMSYIERFFKRYVPESISTIVIPTLTIAIMLPISLCILGPAGNFI
FT                   GNYICTGILAFGKLGGLPTIIAVGVVGALWEILVMTGMHLLMLTTMMMIFAQSGHENFV
FT                   TLGAVAASMSVAGMCLGAALRIKDQDQKTLAWGYLIASIIGGVTEPGLYGLAIRYKRPF
FT                   IGMMIGGFCGGLYAGLTTVTAYVMVPVANFLSLTAYVGGQTSNVINGVVSGVIAFVAAA
FT                   IATYAIGVEANTNKQGTKEFKLVEA"
FT   gene            789180..789938
FT                   /locus_tag="JDM1_0738"
FT   CDS_pept        789180..789938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0738"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0738"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61625"
FT                   /protein_id="ACT61625.1"
FT                   /translation="MERKVIVRADDLGYSDAVNVGIARTVHNGLINNVGVMVNMPTTMS
FT                   GLAMIKDAGVCLGLHTVISAGRPLTNPKLIPSITNPDGTFRHSSDYRAAVHDFVDLNEV
FT                   VLEIEAQYQKFVALVGRQPDYFEGHAVVSDNFVKGLEIVGERHHLNLLRFAAGPDSPSV
FT                   LFKGKVLHVFMESMGKNYNPYETLKRAALAQYNDGYAMMVCHPGYLDDYLLQHSSLTVP
FT                   RTQEVAMLTDPQMQEWLERQQIKLIKYSEV"
FT   gene            complement(790073..791404)
FT                   /locus_tag="JDM1_0739"
FT   CDS_pept        complement(790073..791404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0739"
FT                   /product="amino acid transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0739"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61626"
FT                   /protein_id="ACT61626.1"
FT                   /translation="MQETKQATTLNRSLGFWSALSLVVGTVIGSGIFFKQSSVLDSAGS
FT                   PSAALLAWLLGGLITLTAGLTIAEVGAQMPHTGGLYVYMEQIYGKLWGFLSGWMQIAVY
FT                   GPAIIASISAYLGILLVGFFNLQAGWQAPLSIGVIVLIGILNMFENRWGAAFQIATTLG
FT                   KLLPIAAIIIFGLFYGNQNALGQSLHTITQSTGSFGVAVLATLFAYDGWILVANLGGEI
FT                   KNPQKLLPQAIILGISMVLIAYTLVSYGILHFVPAATIHKLGQQTTLYFAQAAFGTIGG
FT                   RLLNIGIIISMVGCLNGKIMTFPRIVYAMAAQNQLPFAKQLSYLHKKSHEPIAATIAIL
FT                   VYASIMILFFNPDRLSDLCIFTVYCFYVATFVGVFILRKRRPASERPFSTPGFPITPLI
FT                   AILGALFVIISEIGSDLSGVLISLVIVAVGFPIYYWKQQQNQNA"
FT   gene            complement(791675..792115)
FT                   /locus_tag="JDM1_0740"
FT   CDS_pept        complement(791675..792115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0740"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0740"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61627"
FT                   /protein_id="ACT61627.1"
FT                   /translation="MKTTTIRPLEDHVCFSTYTTVHAIQRLYQPTLTAHRLTYPQYLVL
FT                   VALYATPPHAVTVKTLSTQLNLSTGTLTPVLQRMTQAGLITRHRNPQDERSILLTLTPQ
FT                   GTATRLALNDLPDLLTAKGGLNQSEWAQLTQLMTKLMTNLTR"
FT   gene            792386..793267
FT                   /locus_tag="JDM1_0741"
FT   CDS_pept        792386..793267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0741"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0741"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61628"
FT                   /protein_id="ACT61628.1"
FT                   /translation="MMVIAIVVLLMLLSIGLFGLLLAGARRQAAPFFDHSFGFGMVIGA
FT                   VTDFLDTLGIGSFVVSTAIFQASHYLKDERKLPGTLNTMHAIPTAFEAFFFVTAVAVEP
FT                   VTLISLVLAATLGALLGSEVMTKLNQRWIQLIMAGALVITALLMAAKLLGWISLLGVAN
FT                   QATGLSGWKLLVGIGGNFILGLLMSAGVGLYAPCMVMVYFLGLTPIAAFPIMMLSCALL
FT                   MPISAVNFIRHDRVDYRGLFGIILGGIIGVVVAATLVKSLSLTALSWLIVLVSCWTAFS
FT                   LWRAAQRRKNVL"
FT   gene            793404..793844
FT                   /locus_tag="JDM1_0742"
FT   CDS_pept        793404..793844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0742"
FT                   /product="transcription regulator (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0742"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61629"
FT                   /protein_id="ACT61629.1"
FT                   /translation="MIKMNHDEMVARQVLILARQIKRRRNQHLRTVGLTTEQADALTFF
FT                   TDQPGRTVTAFKTYQEITHQTARMIVQRLQTRGYVQLVVSTTDARAKQVVVTPSGRAKR
FT                   EQLRQHGWQTSAQMFAHLDAEQQQVFLDLLRQVNQNLESDEN"
FT   gene            793841..794998
FT                   /locus_tag="JDM1_0743"
FT   CDS_pept        793841..794998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0743"
FT                   /product="multidrug transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0743"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61630"
FT                   /protein_id="ACT61630.1"
FT                   /translation="MMKTRLYTPDVKLVLMASFFFLMSPMLINPVIAGFAHGIGASSVL
FT                   AGTIAGLTNLTSLVLRPLAGNLTDRVSKYRLTFVGGCLLLLASLGYSLTTNVTLIMLLR
FT                   ILNGLGYTLCSVCMATWMASLLPPDRIGSGMGIYGLANALGMACGPAISVFLYQHYSYQ
FT                   SVFWLAAGCSLLLVIMIQFVGDHGEPIVTPQTATTKHHIRIVQPRVIPVALILLLFSLP
FT                   YFATQTYIVSYVAARHFHVAAGVFFPVYAGILLVLRIILRDWFDRVPFKRFIWLCLIFN
FT                   LLGLIGLTDMNNWAMLLLGAAGLAAGYGLMFSICQAKALMLVPKADHGLANSTFYIGVD
FT                   LGMSLGPIIGGLISSQLPMAWFYPVMMVTLPLIIVVYLVSRRQLA"
FT   gene            complement(795118..795879)
FT                   /locus_tag="JDM1_0744"
FT   CDS_pept        complement(795118..795879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0744"
FT                   /product="transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0744"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61631"
FT                   /protein_id="ACT61631.1"
FT                   /translation="MIQFKGEFTTFVFLSGLLIGIFVSLIGGGGAALYLGVLTSQVGLA
FT                   TAVAVPTSLIVALPALFFGFLTQLKIKNVNFKIGNQMIIAAVPGIIVGTFSAQFIPQQL
FT                   YNWIVGTIFLIMGAMVLIKYVHHSKQTTAGHQPWQAAFFGLLSGLMVGIGGLSGGATTA
FT                   AGLAILGLTAVEAAGTATYVLTVMSTISLIGHLFTSTFAWQSGLVLMIGAIIGAIITPL
FT                   VIRHLNLDKVNRVLTPFLGLIIIYFGIKMFI"
FT   gene            795964..796524
FT                   /locus_tag="JDM1_0745"
FT   CDS_pept        795964..796524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0745"
FT                   /product="transcription regulator (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0745"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61632"
FT                   /protein_id="ACT61632.1"
FT                   /translation="MRKDAQINQQKILTAARQLFAARAIETVSMKDIAAAAGIGPGTLY
FT                   RHYAHKSTLCLALVTDRVATFIKTNQVYLTTTSVGAAARFDHVIGEYLAIREHNMALLM
FT                   NVEAGEPGRRQFYQSELYQQLCGLLTQLVHDLKPTLSKPACEFQADMLIAMLKGTSYAF
FT                   QRQWRGRSQSELLAQLHALMVTE"
FT   gene            complement(796637..797932)
FT                   /locus_tag="JDM1_0746"
FT   CDS_pept        complement(796637..797932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0746"
FT                   /product="GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0746"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61633"
FT                   /protein_id="ACT61633.1"
FT                   /translation="MSETNAQKVQEVIIAGMSKTVANYDYAMSELEALVAANNMHAALR
FT                   IDQGLEKPNPATFFGKGKVVEIKEVAAANDLHIMVINADLTPSQVRNLEEQTDIQIIDR
FT                   TGLILEIFGNRARSKEAKLQVKIAQLQYQLPRLRTSISNRLDQQAGAAAGGGGGFTNRG
FT                   AGETQLELNRRTIQDRISHAKHELKELNKDEVVRRSQRDKAGLPNVALVGYTNAGKSTT
FT                   MNGLVKLFGKGEDKQVFEKDMLFATLDTSIRQLTFPDNKQLLLSDTVGFVSDLPHNLIN
FT                   AFRSTLAEAANADLLIQVIDYADPHYKEMMATTEKTLKEIGVHDVPMIYAFNKADLTEA
FT                   DYPNQQDDQLIYTARDEASLQALTSMIKAKVFKNYVTTTLLIPFNDGDVVAYLNDHANI
FT                   LKTDYLADGTQLTVELNTVDAQRYEKYVVTPA"
FT   gene            798021..798458
FT                   /locus_tag="JDM1_0747"
FT   CDS_pept        798021..798458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0747"
FT                   /product="NTP pyrophosphohydrolase (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0747"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61634"
FT                   /protein_id="ACT61634.1"
FT                   /translation="MGYVLDLRRRVGHQPLVVAGAALMAQNSIGKIVLIYRTDNHCWGL
FT                   PAGSTEPGETVQQTARRELKEETGLTVGELTLIDVYSGPKMHYQYPNGDIIDSVTTLYR
FT                   ANTTGGELIQATDETSTAAFFALDALPTPLTPLTKWMLCGE"
FT   gene            798600..798914
FT                   /gene="sugE"
FT                   /locus_tag="JDM1_0748"
FT   CDS_pept        798600..798914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sugE"
FT                   /locus_tag="JDM1_0748"
FT                   /product="GroEL supressor protein SugE"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0748"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61635"
FT                   /protein_id="ACT61635.1"
FT                   /translation="MTWIYLIIAGLFEVVWATMMKLSNGFSHFGYAAATVVGMVLSFGF
FT                   LALATKHLPLSIAYPIWTGIGAVGAIIVGLVFFKDTIAPITWIFIAMLVIGIIGIKVTS
FT                   "
FT   gene            799220..799420
FT                   /locus_tag="JDM1_0749"
FT   CDS_pept        799220..799420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0749"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0749"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61636"
FT                   /protein_id="ACT61636.1"
FT                   /translation="MMMYPYLNLGPRDGVLIIAAAIMLALTVVFNWSVWELLFAVVAVV
FT                   IAFLAGSMKPSKKNVLAFLKK"
FT   gene            complement(799737..800414)
FT                   /gene="pgm3"
FT                   /locus_tag="JDM1_0750"
FT   CDS_pept        complement(799737..800414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgm3"
FT                   /locus_tag="JDM1_0750"
FT                   /product="phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0750"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61637"
FT                   /protein_id="ACT61637.1"
FT                   /translation="MAQFSIYFVRHGQTFFNLYNRMQGWSDSPLTEYGQATATKVGQAL
FT                   ANTAFDYYYSSDSKRAIDTAQLIRQAAGATAQPFKTLMNFREVFYGYFEGDDSSRTWSL
FT                   VGRQYGVTSMHELLEHVPIDQTRDLMREIDPWHEAEDNSMYWERINQGFDYLKAHHDHH
FT                   QKVLVVTHGTTIRSMVAHFAPEIDITNGPKNGSVTRIDINGDQIRVVDYAQDLADVKVN
FT                   QHL"
FT   gene            complement(800429..801085)
FT                   /gene="pgm4"
FT                   /locus_tag="JDM1_0751"
FT   CDS_pept        complement(800429..801085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgm4"
FT                   /locus_tag="JDM1_0751"
FT                   /product="phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0751"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61638"
FT                   /protein_id="ACT61638.1"
FT                   /translation="MATFSVYMIRHGQTYFNKYRRMQGWCDSPLTAVGEQDARNAGKML
FT                   NGIDFDAVYASDMTRAMRTAELILPASGNTDLTVQPMAAFREAFYGYFEGDDTSQTWFM
FT                   VGAPHQAPSLSAIIEQYGIEKAKDFCKEADPFHRAENNAEFWQRVNGGLDTLRAHHLDG
FT                   DKVLVVSHGNTIYSIAARFAALTSPARPQNGSVTKFTISDNDVTLDYFGRKDHLD"
FT   gene            complement(801156..803012)
FT                   /gene="napA2"
FT                   /locus_tag="JDM1_0752"
FT   CDS_pept        complement(801156..803012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="napA2"
FT                   /locus_tag="JDM1_0752"
FT                   /product="Na(+)/H(+) antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0752"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61639"
FT                   /protein_id="ACT61639.1"
FT                   /translation="MDQVSLVIILLAALLIPLIMAKFKINSLPTAVMEIIVGIVIGPSV
FT                   FNFVNTSDLISQLSTIGVIVLLFLSGLEIDFSLFKKRRTALTPLEQKNAVNTPKYSPVR
FT                   LSVYAYSTIIVLSLLLAAAFKVSGLFSDFWLAAILFGTISLGIVIAALKEQELLSKAFG
FT                   QTILLISVFGELVPMMGLTLYASVYGSNSQSLWLLLLILAVAALLLLRFKPFFRFYQNI
FT                   NKSTTQLDIRLAFFLIVTMVTVAESVGAENILGAFVAGIVLKLLNPSETTRERLDAIGY
FT                   GFFIPIFFITTGVDLNLRTLLTSGKTLLLIPLFFLAYMVAKIGGYWVLKLRFKQANALA
FT                   GTALTATTMTMVLAVLRVAKSMKTITSDQSGAFLLAALLTCVISPLIFNKFYSAEKEDL
FT                   VKTAVHFIGANLSTVPVAQQLRKGWYDVSMYTNHPENYQTYHAQVPVTLMENFTAQDLQ
FT                   DHGVFDTDILVLGHIDAERNYELAKAAKAYGVRRIIVRFEDRNVLNEHEDELRELGVEV
FT                   YNTPEANITLLRALIESPSTLLLLNDTENSIYEVRVLNHLYTDVQIKNLQFAQDITISQ
FT                   VIRNRKLIAPNGNTTIMYGDRLIFTGNKQTAAQIRQALATAN"
FT   gene            complement(803034..804107)
FT                   /locus_tag="JDM1_0753"
FT   CDS_pept        complement(803034..804107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0753"
FT                   /product="7,8-dihydro-8-oxoguanine-triphosphatase
FT                   (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0753"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61640"
FT                   /protein_id="ACT61640.1"
FT                   /translation="MSTAVQLKYYRSNFLKGTSFLFKTTQKVYPFNDLFEWRDSMQPIQ
FT                   LTAYQSDWQKQAIEYQTLLRQQLQANLLKSSHVGSTAMPQLLARPTIDLALLVKDQAAA
FT                   VATLHARPVAGTTHTYATQLAANDIHVIITTDEQHYQQLLTFRDYLNAHRTDGRKYTAI
FT                   REKGARNGQADLAAYLQTKAAFMASINDKAQDWLATKDQHEHHDRTVRAELVNMCLITN
FT                   PATGDVLVENKIDAQWSGLTFPGGHVDRGESQVTAMKREVLEETGLHVDQLKLVGTVTW
FT                   VENADGDVSLGTLYTTSHYHGDLLAGSYEGAISWQPLSQLTPDKLAPGVDQILKVFTDA
FT                   HASEAFWGFDDDQLRVY"
FT   gene            804261..805103
FT                   /gene="bglG2"
FT                   /locus_tag="JDM1_0754"
FT   CDS_pept        804261..805103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bglG2"
FT                   /locus_tag="JDM1_0754"
FT                   /product="transcription antiterminator"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0754"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61641"
FT                   /protein_id="ACT61641.1"
FT                   /translation="MRIKKVLNNNAFITHNDDHQEMIVIGKAIAYGKHFNDTVDESKVY
FT                   KMFTPISRGDRKLILDMVNEIPIQYFQIAKQIVDKAESDENIELTDSVYIALTDHISSS
FT                   VDRIKSGLMLTNQFLWEIRSYYPKEYQIGQWAIQLINGTCDVTLPDDEAGFIAIHIISG
FT                   ELGEQLDEFHEIINFIKKITSIVTYQLSVEIDRDSLDYNRFVTHLKFFWQYMMENDKKH
FT                   TIGDLSDEMLAIIKGKKVAAYECALKVKNFVQKTYHYTLNNEDLLYMTIHIARIADAN"
FT   gene            805115..806977
FT                   /gene="pts12BCA"
FT                   /locus_tag="JDM1_0755"
FT   CDS_pept        805115..806977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pts12BCA"
FT                   /locus_tag="JDM1_0755"
FT                   /product="beta-glucosides PTS, EIIBCA"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0755"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61642"
FT                   /protein_id="ACT61642.1"
FT                   /translation="MTYKEMNDQIINGVGGKSNIESVVHCATRLRFVLKDEAKADDDLV
FT                   RSIPGILQVVKKAGQYQLVIGNNVEDVYNELSDMLQLDENVDHNQSKDKRSIFDKIIST
FT                   ITGSIAPAIPLLAGAGMGKVLLLILTLSGLLTEKSQTYQMLNLIFDTGYFFMPAFIGFS
FT                   AAKIFKTNQFLGAFMGLVTVNPNWVAMVAAGKPVSFIGVPIQLVSYSSTLITAILSVWL
FT                   MSYIEKFVKKITPGMIKVFAEPMLIMLITAPLTFIVLGPIANLISMGIASISMFLYDNA
FT                   GFIAIPLLAAAYPWLVSIGIHKALSPISIQLVATQGFDPIIRVVALCSNMSQAAASLAV
FT                   GLKTKNKQLRALALSSTVTAYLGGITEPAMFGVNLKLKKPMYGAMIGGAVAGLFAGFMK
FT                   MKAFIYVTPGLLSLPMWVSKTENYVVLAVATIVIASVATFIATWLIGFEDPVSEEVMKQ
FT                   KQAQANKVVTTKHSINSPVVGEARMLNEVNDETFASGVMGKGIAVIPTEGVVIAPTDGV
FT                   ASAVFDTSHAIGLHLDNDADLLIHVGIDTVELKGQYFETLVKKGERFHAGQELLRFDLD
FT                   KIKQAGYDPTVMIIVLNTKDFLEVLPVPESNESVTADNNLLMLA"
FT   gene            806992..808494
FT                   /gene="pbg2"
FT                   /locus_tag="JDM1_0756"
FT   CDS_pept        806992..808494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbg2"
FT                   /locus_tag="JDM1_0756"
FT                   /product="6-phospho-beta-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0756"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61643"
FT                   /protein_id="ACT61643.1"
FT                   /translation="MDVYKTSPNFMWGVATAANQVEGAWNEDGKGMSIADCLRYRPQID
FT                   SSDYQAVNQMDSAEIENALNDESTKGWAKRHGVDFYHHYREDIKQLAETGINTYRFSIS
FT                   WARIFPNGDDKCPNQAGLDFYLSLVKELAKYQITPVVTLSHYEMPLNLVLNYDAWYDRR
FT                   VADFFGRYARTVIDYLHDYVKYWIPINEIDSIIRHPFSSAGLVADRFASHDFKTVIYQA
FT                   MHHQFVAAAQVVKYCHRHYPQMQVGSMITRTMVYPYNSDPNNVLAATQTMREVYAFSDI
FT                   QVRGEYPEFLLTKLKKAHITIEFQEGDQEVLRENTADFVAFSYYSSICTASNVEGLRVT
FT                   KANRTVGVYNRYLPESEWGWQIDPVGLRLSLIDLFDRYQKPLFIVENGLGAVDELSSDL
FT                   RVHDIYRISYLRQHIRQMLIAIANDGVDLMGYCMWGTTDMISASSNQMSKRYGLIYVDL
FT                   DDNGDGSYNRYLKDSYFWYQELLSYKNQIPAIFLDENSIVVQ"
FT   gene            complement(808545..809216)
FT                   /locus_tag="JDM1_0757"
FT   CDS_pept        complement(808545..809216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0757"
FT                   /product="DedA protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0757"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61644"
FT                   /protein_id="ACT61644.1"
FT                   /translation="MQLKLEVAPLVNLITILTHLEQNIVPLLTTLGSWSYILLFAVIFL
FT                   ETGMVVFPFLPGESLIFLASTMAATHSDALSIQILVPVFFVAAVIGDTVNFEIGRHLIR
FT                   LPWLQRHLPQSKQQRAQQFFAKYGAKAVMFGRFVPLVRTFVPLSAGAAKMPQPTFAIWN
FT                   LVGVGIWVSVGCSLGYFFGSISFVQNHLSLCFLGIMAAALIPATVVALIKTWRQQRISY
FT                   K"
FT   gene            809421..811727
FT                   /locus_tag="JDM1_0758"
FT   CDS_pept        809421..811727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0758"
FT                   /product="DNA helicase (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0758"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61645"
FT                   /protein_id="ACT61645.1"
FT                   /translation="MAKSIKAAEQEHLDHVVAKIKVAEEQQSQTITRSEKDQADIKRDL
FT                   LNNINIKTDSYEGMMETGLSVRQQQQMMDERQNSWKHATKQLSTLKKLEKNAYFARIDF
FT                   HETGEPKPETIYIGLSSFSDTPDHFLIYDWRAPISSIYYDGGLGHVTYQTPDGEQTVNV
FT                   KLKRQLMVENGQIVTVYDTDEAVGDSMLLEVLDEKSDVKMKSIVTTIQKEQNTIIRDTS
FT                   SDLLFVQGAAGSGKTSSVLQRVAYLLYRYRGNLTAGQVILFSPNQLFNDYINQVLPELG
FT                   EQNMVQMTYFQYASYRLPHMQVETLQQRFETENTPQMAKVTKLEGSLAFFNAVTTYGRH
FT                   LEQADMRFRNITLNDEVIISREKIKSIYYSFNENYHLANRLSATKEELIKILNRKVESE
FT                   MRSKWVEEAVQDLSREEINQLYGNQPREFKNGDKEFKFLARKIVMQRLGKARTQIVRNR
FT                   FLSINMQYAHFLREVPKIIKLADHGISAADWDATVERKLAEIKERHISLTTVSAYMYLH
FT                   DLMTGKHGQRDIRFVFLDEIQDYNAFQLAFLKFSFPQARFTMLGDLNQAIFTKENSHSL
FT                   INELATLFDPEKTRVVQLTKSYRSTQQITDFTKEILVNGEAVTAFDRQGDLPNVVVTPN
FT                   FEAGVDQVVDQLAMNDSERDTTAIIGKSLAECEALTKALKARGEQVTLIQTENQRLAPG
FT                   VIVVPSFLAKGLEFDAVIVWNANQENYQREDERQLLYTICSRAMHELTLVAVGSLSPLL
FT                   ARVNHALYTLNEAKV"
FT   gene            812022..812951
FT                   /locus_tag="JDM1_0759"
FT   CDS_pept        812022..812951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0759"
FT                   /product="2-nitropropane dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0759"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61646"
FT                   /protein_id="ACT61646.1"
FT                   /translation="MSITEMLGIQYPIFSGAMMRIATHELVGAVSEAGGLGVLGSAGLS
FT                   AEQLRAEIQATRKLTDKPFGVNLMLQMKNCPELAQVIIDEGVKVVTTGAGNPTSYIPPL
FT                   HAAGIKVIPVIASVHHAHKMVAAGADAVVAEGQESGGHIGQTSTMALLPQVVDAVDIPV
FT                   IGAGGVGDGRSIAAMFALGAQGVQCGTIFLTAEECPVPASYKQRVLAASDTDTIVTGRS
FT                   QRDPVRALVNPMLAQYLRLEQTNAPVAELHALADGSFAKAVEDGDMEHGTPMAGEVAGM
FT                   MTTIRPVKEIITTLFGQAREVAAQLKIE"
FT   gene            813120..814049
FT                   /gene="coaA"
FT                   /locus_tag="JDM1_0760"
FT   CDS_pept        813120..814049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaA"
FT                   /locus_tag="JDM1_0760"
FT                   /product="pantothenate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0760"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61647"
FT                   /protein_id="ACT61647.1"
FT                   /translation="MEDQMNYYRFSREQWKQFYRNNQHQVPLTAANLHEIEAFNDRISL
FT                   DDVRDIYMPFAHLLQAKYEHYLSWRETESVFLHRQNRQSPFIIGVSGSVAVGKTTTARL
FT                   LEILFKYLYPDRRTQLITTDGFLYPNAELKKMQLMERKGFPESYDMTRLIQFLNDVKSG
FT                   KPLAKAPVYSHQTYDIVPNRFDVITHPDILIIEGINVLQLPSNQAIYISDFTDFSVYVD
FT                   ADADLIEDWYLERFKALMKTAFQDPTNYFYPWAIGDPKDAMAMAERVWEEVNLKNLNDY
FT                   ILPTRNRADLILHKVAHHVIDAVYFRKY"
FT   gene            814143..815699
FT                   /gene="guaA"
FT                   /locus_tag="JDM1_0761"
FT   CDS_pept        814143..815699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaA"
FT                   /locus_tag="JDM1_0761"
FT                   /product="bifunctional GMP synthase/glutamine
FT                   amidotransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0761"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61648"
FT                   /protein_id="ACT61648.1"
FT                   /translation="MAKTDTASFDSILVLDFGSQYNQLITRRIRDFGVYSELLPNTITA
FT                   EEIKARHPKGIIFSGGPNSVYDDGAFRVDPEIFKLGLPILGICYGMQLMTYTLAGGKVE
FT                   SADNREYGKANIDVTSDSATLFKDTPAEQSVWMSHGDLVTQAPDGFDVVATSKNCPIAA
FT                   IQDVDRKLYGIQFHAEVRNTDYGNDILRHFAFDVCQAEANWSMDDFIDMQIEKIRAEVG
FT                   DKKVLLGLSGGVDSSVVGVLLHKAIGTQLTSIFVDHGLLRKGEADQVMASLEGKFGLNI
FT                   IKVDAKDRFLSKLAGVSDPERKRKIIGNEFIQVFDEEATKLNGMEFLAQGTLYTDVIES
FT                   GTSTAQTIKSHHNVGGLPEDMQFKLIEPLRTLFKDEARELGEKLGMPSDLVWRQPFPGP
FT                   GLGIRVIGEITEDKLEIVRDSDFILRDEIKKAGLDREIWQYFTVLPGIKSVGVMGDGRT
FT                   YDYTVGIRAVTSIDGMTADFARIPWDVLQKISVRIVNEVDHVNRIVYDVTSKPPSTIEW
FT                   E"
FT   gene            complement(816025..816393)
FT                   /locus_tag="JDM1_0762"
FT   CDS_pept        complement(816025..816393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0762"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0762"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61649"
FT                   /protein_id="ACT61649.1"
FT                   /translation="MKSKNLALTNGIVGLVGGIILLFGGWFIAGGIVSDAATGSVSNTS
FT                   GAAAFLNILKIAILALGIIALIYYKGDKRVGTASGVLLIVGGAIALIPFLGWIGGILAI
FT                   IGGSLYLASLKHFSQPQA"
FT   gene            complement(816627..816995)
FT                   /locus_tag="JDM1_0763"
FT   CDS_pept        complement(816627..816995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0763"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0763"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61650"
FT                   /protein_id="ACT61650.1"
FT                   /translation="MPAKTQNNFIRRLINLRDSRNWSKTEVARKLGLSSMQRYANYEYG
FT                   TNEPDLNMLKQIADLYDVTTDYLLGEDSASKWIVRKDTTDLKDFLTAHVDSMTYGGEAL
FT                   TEEERQQVRVAMAVIFWE"
FT   gene            817532..820495
FT                   /locus_tag="JDM1_0764"
FT   CDS_pept        817532..820495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0764"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0764"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61651"
FT                   /protein_id="ACT61651.1"
FT                   /translation="MKNKQANQILRAWDLAEKISGGELDKKAKWFSGDIRKTAYQKRES
FT                   GTINEKISQNNQSSDQHVTISLLYLGAYKKQDLRDSIQNIRFRDTEMVQNRDPAKGYSV
FT                   ALIVNSDWSFQKIEVPYAAYFYLKLRQENIEEAMHGQQYDDFKSQLSQQLEEVIDRKRA
FT                   DLAECLALANQIVLKTFKLAGTRNVGQLRGLFQIQDEPPMLNSFYTEDIERVLQASADD
FT                   SLLLKYLGLNPDVATKQEVDQNRDFISKLLDVENLPDGRWPGPEKYFQSLMQQVAVNVI
FT                   RDKGPIKTDLKTVNGPPGTGKTTLLQDVFADTIVQQAKVMAQLEKPMDGFRRIKPIELF
FT                   SNCKYNAYELIPALQGYGIVVTSNNNSAVANISKEFPSRNKIRQYPNENREKQDEYRTQ
FT                   LEEIDYFSDLANRILETADSWGMFAVPMGSKANQRKVFKHINHGVLKKQLSVYSDSWAD
FT                   ARQNFNTALEAVHQEKARLHRMISIVERANPSVVDQAYLELKVVDEGIEVLNQEIANLT
FT                   QKIENTRHRLVTLPKKRFLIFWQHETPTHDSLRFHISNLNKKIEGLNERVADRRKERRH
FT                   VVHLIAQQEKIIREVEPIQKQLKKEGIVVFNDDFWRQTNEKRQQALPNNSRVLQNKRAR
FT                   LFIAAMRLRKVFICEARVPISNAWEFFAHQDKLVFAEDTLVLTAGFQIMQLLIPVMSTT
FT                   LASVGRMFANFGENTIDNVYIDESGQATPASAVGIAWRAKHLVAIGDPAQIEPVVTTNE
FT                   ATLRTIARDFKVSEQYLLPTTSVQQLADQGSIYGMHRSNHTWVGIPLWVHRRCDSPMFE
FT                   IANEISYENKMVQGKPTKLSQVERSRWINSKGKATNQQFVPENVTALARIMKKRRDEGK
FT                   SLDQMFVISPFRAVVNGITNKLPKEFNDGAISKKWLQEHVGTVHRFQGKEADVVFLIIG
FT                   TDQDTDGGADWAFSKPNLLNVAVTRARHDFYLIGDYHRLKSKPYAEVAARELPLLDN"
FT   gene            820797..821489
FT                   /locus_tag="JDM1_0765"
FT   CDS_pept        820797..821489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0765"
FT                   /product="CAAX family protease"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0765"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61652"
FT                   /protein_id="ACT61652.1"
FT                   /translation="MSKSHSTNRTVTWLLNIVKLIGLFALYQLAMIPTMMPAIRHGFSA
FT                   TATLIAGVASLVLLGSLIWWLVTIYRRQAPIVTSLSRPTRPVLTIVGLFILVELGNVLA
FT                   GLIVKQTPENQVILDKVFTTSPVINVVMMAVLAPIVEELIFRGLMYRWLFPRVTNWVSF
FT                   TVALVFASLVFALAHTLSFSPALLAYLPIAVVLTFTYVWFNDIRYSIALHIINNSLAMV
FT                   GMLTLLSR"
FT   gene            821709..822053
FT                   /locus_tag="JDM1_0766"
FT   CDS_pept        821709..822053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0766"
FT                   /product="transcription regulator (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0766"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61653"
FT                   /protein_id="ACT61653.1"
FT                   /translation="MRTITPIENSRRHEEFCPLDTTLSILSGKWKSIIICRLMGSSQRF
FT                   SSLLKGMPGCTSRMLAMQLKELVADQIVSQQTVANHSVYELTNIGVSLVPIVEAMDRWG
FT                   KAYLETLQLA"
FT   gene            complement(822185..823483)
FT                   /locus_tag="JDM1_0767"
FT   CDS_pept        complement(822185..823483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0767"
FT                   /product="transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0767"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61654"
FT                   /protein_id="ACT61654.1"
FT                   /translation="MVYFYPINDSRWYTFIHLFLYCKALKLLVVPNSKGVSPIFNQITI
FT                   HNQHTENWLIIGLFCGAFVTGADAFIISALLPAIATSLHVPTNTAAYGVTVYALCYAIG
FT                   APLFGPLGDRFNKRFLLINGCGIFLLGTLLCGLANSLLTFYLYRAIAGIGAALFVPNIW
FT                   AFIGTYFNGQRLNQVMGIVMSALSLSIATGVPLGALLAQLSSWHMAFWGSAMLTLIALS
FT                   ILTIAIPSLPSQNAQPDGYFTSFKTLVHTPHAIAALLITLTWMTGFYGVYTFLGVFATA
FT                   TFHFNTMQTGLIFITYGSANFVASFFAGKLISLLGKKQSVTINGLVSATLVLSLGIWGQ
FT                   HLAVLLIILVVLALSQGWGVTALTATIVNIVPSNRSTIMSFNSAFLYYGLTLGSAAGGL
FT                   LLTKIGFYAVTIAAATALLVAVLIANALSHYSD"
FT   gene            823757..826261
FT                   /locus_tag="JDM1_0768"
FT   CDS_pept        823757..826261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0768"
FT                   /product="cell surface protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0768"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61655"
FT                   /protein_id="ACT61655.1"
FT                   /translation="MNKKLLYTSITTAALFVGTQLGVNNAQADTATDNSDTTNQTSATQ
FT                   GSAQTATNEKLATVKPTSQQQYQANVQTAKGNVVTAQNQVNTTQAKVATAQGQVTNQSQ
FT                   LVAIGQSQYDAGKARVDRAQQTLDANNQVLAEAENKVDAAKSQTAAAETQIPADQQQIA
FT                   ANKVAIANQPATEKKAQTAKDAADTALTQAKTEQATAQSDADAASAVTAAKQATVDQAS
FT                   AAQQKAATQANQAKVAVASAQDAVNKNTQAINSAKTAIQNTTSQINANNQAVSTAQAKV
FT                   TAAQAALAAAERPTTTTESQNKYDAAEFPQSQLTGAETVSVAYPSNGKYVPNADKINQY
FT                   MFEYINQLRALNGQPALKQMSTLQNNAIARAAAQVDGGLDHTGSSYAENLTQVYPQWFM
FT                   SDQETAYNAVMGWYDESNNVESGSFGHRVNLIYSTGDAGVAINLAKHVAAFEVDNAGMT
FT                   EAQQDKYVDLFDNAHTNAATGTKALPAVTFNYVQTTPADPKKIAAANATLIAATASLNG
FT                   LQNTGKTLATTLANQNASLQALQNQTSGLQATVTTKQAQVQVAATSLKAANVALTQAQG
FT                   QLAMAQQQQLSPVRNLKTAIAKTAAAQVTATQAAKNLASAKTLVADLTAENARLAAEIA
FT                   ALPARIASMKAQIATAEQQIAVAKAMLAQGQAQVDTANEQLAAGKAQLDRKKTDLAQLK
FT                   QVLGAARVDFAVAQGDLTATKAFLARVEANKFTTTTAAAADGIVETTSVAQSAGVTAPH
FT                   ATATETVANSKDTANATSTSADVSDGNATTKLVAGAKQQPAAAKATALPQTDEKQSASL
FT                   TVVGLLAAGFSLLGLTKLRKRA"
FT   gene            826746..827129
FT                   /locus_tag="JDM1_0769"
FT   CDS_pept        826746..827129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0769"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0769"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61656"
FT                   /protein_id="ACT61656.1"
FT                   /translation="MGKISSRMVFEIITIIGIVTFAVISLTPSTVKQQSVQLDHGRMSY
FT                   SGAVLKHKFDGQGTLQVNKQGRYVGNFTNGRFEGPGEFIAPNGWRLQGNFSKGALNGVV
FT                   KLRVGNKTYAKKITGDGKLENAD"
FT   gene            827119..828966
FT                   /locus_tag="JDM1_0770"
FT   CDS_pept        827119..828966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0770"
FT                   /product="acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0770"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61657"
FT                   /protein_id="ACT61657.1"
FT                   /translation="MRIKWFSLVRITGLVLVLTYHFFQTQFTGGFIGVDIFFTFSGFLI
FT                   TSLMVDEFARSDNFKLMAFYGRRFYRIVPPLFIAVLLVLPLTYLIDHDFVTDIGKQVAA
FT                   ALGFTTNYFEIATGGSYENKFIPHLFVHTWSLAVEMHFYILWGLIAWLVAKISRRLASG
FT                   RRALTRFRWGLGLLTTAFAIESFVMMYFGAVGLKDFSPVYFSSLTHCFPFFVGGLIGVL
FT                   SGIKAQGPIYRWTTAHCNPIIAGAVMLISFILLVALGDRMKFDALQTYQGGLLLATVLA
FT                   GIMIYGARLLHDHTPNLKEPRWMTFLADVSYSVYLYHWPLYVIFSHMMVNWLAALLTTV
FT                   LSIILSALSYYVLEPVIAGKRAHVFGHTVTWRQLQLPVITAGVLLAVNTGVVVKNAPQL
FT                   STLEQNLWVSGIYQDIDKIGTTHEAVLAAVTPKKKQATPKGDQEKAPGVSIIGDSVTLG
FT                   TRSYLGDHVANSNIDAEGDRTMNLAYKVMMNQQRSHTLRQYVVICIGTNALDDYEEQTM
FT                   KIIHDLEPGHKLILMTPYNARADADWNSSKLAVLERRLPAKYKFITVADWGKIAAQHPE
FT                   VFKGTDGVHFGGIRAGDILYAKVINQALTAAKQTPAKPA"
FT   gene            829207..829461
FT                   /locus_tag="JDM1_0771"
FT   CDS_pept        829207..829461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0771"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0771"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61658"
FT                   /protein_id="ACT61658.1"
FT                   /translation="MLGWLWSLIVGGVIGALAGAITSRDVPMGIIGNIIAGLVGAWIGQ
FT                   ALLGTWGPSLAGMALVPSILGAIILVLIVSAIFGMRKKR"
FT   gene            829473..830018
FT                   /locus_tag="JDM1_0772"
FT   CDS_pept        829473..830018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0772"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0772"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61659"
FT                   /protein_id="ACT61659.1"
FT                   /translation="MSRLAKFTVTLVGIVLVLLAVFELGQLYPIPWLTSWLADLTINYP
FT                   MVWSILLMVFAIIAGIVGILLVIVGLFRPVKVSTLTYDGKVGQLTIPQRALERDLQYRL
FT                   VNQLNLIDPEVHLKLRRRRRVRVKIDAMVNTDASLETTAQQAATLAQDYLKNQLGLTVE
FT                   QPVVQVKPANHQRKLTVV"
FT   gene            830031..830213
FT                   /locus_tag="JDM1_0773"
FT   CDS_pept        830031..830213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0773"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0773"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61660"
FT                   /protein_id="ACT61660.1"
FT                   /translation="MSNAQYGFLIGLLLGIVWVLTSFSAVLLVAVLGLIGWAIGRFVHV
FT                   DLAAVSQKLSEYLSK"
FT   gene            830228..830650
FT                   /gene="asp1"
FT                   /locus_tag="JDM1_0774"
FT   CDS_pept        830228..830650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asp1"
FT                   /locus_tag="JDM1_0774"
FT                   /product="alkaline shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0774"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61661"
FT                   /protein_id="ACT61661.1"
FT                   /translation="MAQPEQQLQTQLTFDDGVIEKIAGLASRNVDGVLSLEGGMLSNLT
FT                   NRFRDEADPTQGVDAQVGKKQVALDMTMIVEYGKDMRQIFNQICQRVQQDVERYTGLKV
FT                   IEIKVHVSDVMSKRDWQDQATGKPNTDQSTDKRQVE"
FT   gene            830672..831151
FT                   /gene="asp2"
FT                   /locus_tag="JDM1_0775"
FT   CDS_pept        830672..831151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asp2"
FT                   /locus_tag="JDM1_0775"
FT                   /product="alkaline shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0775"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61662"
FT                   /protein_id="ACT61662.1"
FT                   /translation="MVRRFLTKQGGILMEATATSLKPEVVFDDTVLAKIASNTAQEVEG
FT                   VLSLQGNLIDDISNRFTDKDRPQTGVSVDTDDDDQTVGIELTAILAYGKNGQEILARVA
FT                   DKVAKAVKSMTGYQVTKLKLVVKDMLTTEEWRQQNDKQEKAPEKKHPEPKDDGPH"
FT   gene            831325..832155
FT                   /gene="hpaG"
FT                   /locus_tag="JDM1_0776"
FT   CDS_pept        831325..832155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpaG"
FT                   /locus_tag="JDM1_0776"
FT                   /product="2-hydroxyhepta-2,4-diene-1,7-dioateisomerase /
FT                   5-carboxymethyl-2-oxo-hex-3-ene-1,7-dioatedecarboxylase
FT                   (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0776"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61663"
FT                   /protein_id="ACT61663.1"
FT                   /translation="MYNNINEVINMKIGMRANRPFIITDEQHGQTVLNAKTVLEALHMP
FT                   AVDRQLGSLETFAPQELAAPITAPRQIFAVGMNYRDHSAEIHITLPKVPSIFTKFSSSL
FT                   APANVTVATHGPETDWETELVVMIGKGGRDIATADAMAHVAGVMVGEDLSDRAVQFEND
FT                   NPQFSMGKSFENYAPVGPWLTTVDELANLDDEVITTTVNGQTMQQAPLSQLIFKVPDLV
FT                   HYLSTVCELQPGDLIFTGTLSGTGVGRNPQVFLQAGDQLCGQITHLGTLNITIK"
FT   gene            832286..833296
FT                   /locus_tag="JDM1_0777"
FT   CDS_pept        832286..833296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0777"
FT                   /product="lipoprotein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0777"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61664"
FT                   /protein_id="ACT61664.1"
FT                   /translation="MKKVWVGLLLGSLLLAGCATSPKSSASKTSQKATSTKVAAKQAAS
FT                   QKNTASSDSSSPAEATLWNTGKQAALSTFMAAWQREMGQTYVGTYDDKVPDHLGFRFPN
FT                   ALLNGSLAGRIKWGSQSVDLKWSKDGEDRSEFQVVAVATGGKAEAQYPNTYFFCLHHRR
FT                   PVVFVTQTTNGDELIIHDTQNSALQAGFAKIITGSRPTTLTDSALNVNMSRDAKANQWP
FT                   QSYQGTWYYYNKYDHKINSITQNDTDGLKLSYAAAEGQKWIHIMGAEQTAGAGNFEYVR
FT                   YHYFDGRQIPVLMNASGAGAWFDNNAYPSAAAANQMRDWQYGDESKTSPAADSLD"
FT   gene            833613..833945
FT                   /locus_tag="JDM1_0778"
FT   CDS_pept        833613..833945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0778"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0778"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61665"
FT                   /protein_id="ACT61665.1"
FT                   /translation="MQKNMEHTLNLTMTMILKIGSARSMIAAALAEIAAYRYEAAREKL
FT                   RQAETELLTAQRLQVRRLIENAKAQRFVHSTLFMNAQSALVNVMGELQMTENLIGAFER
FT                   WEPEAA"
FT   gene            834051..834623
FT                   /locus_tag="JDM1_0779"
FT   CDS_pept        834051..834623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0779"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0779"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61666"
FT                   /protein_id="ACT61666.1"
FT                   /translation="MTVTFSNEDDHKFHELTDQCFTANPKLLTKANVSVPLTTRTIQPR
FT                   RYLVVTKINQATLATATWQPVTGAIALHKHERLIYDLGALYVGHFQVAIDVAGSPMDAP
FT                   LLMRTRFAEQLQELSVDASRVTSWLPTAWIQDDTRHVELLPTTVQFERRYSCRYIMLEP
FT                   VGQSLKWQPVLADAEFEEIIDDFRQAA"
FT   gene            834805..837339
FT                   /gene="pepN"
FT                   /locus_tag="JDM1_0780"
FT   CDS_pept        834805..837339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepN"
FT                   /locus_tag="JDM1_0780"
FT                   /product="membrane alanine aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0780"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61667"
FT                   /protein_id="ACT61667.1"
FT                   /translation="MATTTHFYETFQPEHYDLYININRADNLISGKSTITGDAKAQEVL
FT                   IHQNGLTIAGVQADGADVPFTVDNAIQGIRIELAKAGQTTLTITYSAKLTDTMMGIYPS
FT                   YYEVNGVKKELIGTQFETTAARQAFPCVDEPEAKATFDLAIKYDEHDGETILSNMPEDH
FT                   EADGVHYFETTVRMSTYLIAFAFGELQGKQTKTKSGVTIGVFGTKAHKANELDFALDIA
FT                   KRSIEFYEDFYQTPYPLPHSWQLALPDFSAGAMENWGLVTYREAYLLLDPDNTALETKQ
FT                   RVATVIAHELAHQWFGDLVTMKWWDDLWLNESFANMMEYVATDALEPDWHIWETFQTSE
FT                   ASMALQRDATDGVQSVHVQVEDPAEIDSIFDGAIVYAKGARMLVMARALVGDDALRAGL
FT                   KQYFINHKYGNAKGDDLWNALADASGMQVGDIMHSWLEQPGYPVVTATVVDGQLTLSQQ
FT                   QFFIGEGEEVGRQWQIPLNSNYEAAPAIMKDQAVTVGDYAKLRDASGQPFRLNVGNNSH
FT                   FIVKYDQTLLDDILAHVDDLTAIDQLQLLQDLRLLAEGRQISYAAVVPLLSRFAASHST
FT                   VVNAALYQVAGNLRKFVTPDSDEEKHLQTLFDQLSAAQVKRLGWLPQAGESNDDQLTRP
FT                   YVLSAALYAKNSAAVLAAHELFEGNRDKLATLPADVRVFILRNEVKNFGSKDLFDSLLT
FT                   ASRQTADASYKADICDALTATTDPELIKQLVVKFEDADTIKPQDLRAWFRGVLANPAGE
FT                   QAAWDWIRDEWSWLEATVGGDMEFTTYITVISRVFHTVERLAEFKAFFEPKINTPGLTR
FT                   EIKMDTKVIASRVALVEDERDAVNAAVAEVVK"
FT   gene            837481..839271
FT                   /locus_tag="JDM1_0781"
FT   CDS_pept        837481..839271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0781"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0781"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61668"
FT                   /protein_id="ACT61668.1"
FT                   /translation="MRYNKIEENIGNIEPVVEIVPYNTGYNVSLHRDMQNRELIFEYPT
FT                   VYLIYDKLGSGRSSNDPKFKVYVGETNDISRRTRQHLKDTGKSRMDWKALNESHNSQMI
FT                   VIGDYYFNKSLTLDIENKLMMYLLSAESVTQLNNRRSNPQRKYFMSDQFENVFEGVWQT
FT                   LRKKRPEIFPEKSEIENSAVFKASPFHSLNAEQHESKNEIFGKIESALKESSTERGKTI
FT                   FIAGQAGTGKTVLLSNLFYDLTNSSLVRKDSVYLLVNHDQQKTVYKTIAHKLGLDHEHK
FT                   DIVSKPTHFIQKHTGAAKVDVVLVDEAHLLLTQGKMAYRGHNQLEDLLKLAKVVVIVFD
FT                   KYQILTTEGYLDDMAVRKLEDDAEREGNRIELTHQERMIAEQRTIDWLRNFAIDGRINA
FT                   IPDDAQYQLKIATSPEKLHAKIKALDRLKNSNGASLARMLATFDWPYVEKRKPKDGDCW
FT                   RVKIGTWSLPWNLQIPISRQEKRRNKGLAWAEQFQTINEVGSTFTIQGFDLNYAGVIIG
FT                   PSVKYRDGKLIFDKQASKNKKATNQRTWKHQKIDVSEELLRNELNVLLTRGVHGLYIFA
FT                   VDEELQQALLRAAGNQHILR"
FT   gene            839277..839594
FT                   /locus_tag="JDM1_0782"
FT   CDS_pept        839277..839594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0782"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0782"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61669"
FT                   /protein_id="ACT61669.1"
FT                   /translation="MNYSEIEQALIEFRNKKGWQKYHNLKDLAISLNIESSEVLEIFQW
FT                   HNANQKLDNRENQHLQEELADTLIYIFYMCEKLQVDPFEIVAQKMKINQSRHWDTERKT
FT                   Q"
FT   gene            complement(839958..840488)
FT                   /locus_tag="JDM1_0783"
FT   CDS_pept        complement(839958..840488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0783"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0783"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61670"
FT                   /protein_id="ACT61670.1"
FT                   /translation="MKVYLIRHSEPTYQQVTTAGLTGFGRELGGLTDRGIMLAQQCAQQ
FT                   PLFAQVQLILSSPYTRALQTALEIVRFNDIPLKVELGLHEWLPDNTGIRTDTDEQAATA
FT                   YKLYRQHAGKRTIASPLPYETAAEMKTRVLATLNKYATSYDCIACVTHGEVMRQFGDEK
FT                   DVDYCGVRVIAVN"
FT   gene            complement(840603..844376)
FT                   /locus_tag="JDM1_0784"
FT   CDS_pept        complement(840603..844376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0784"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0784"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61671"
FT                   /protein_id="ACT61671.1"
FT                   /translation="MKPNNVNNQNKRHQSRWVITSATAMILTTLTIASQAAAADDTVTT
FT                   TTNEPTNSQLNTNTQVNATQVNLKADTSTSVSTIKSGQSAVAATSPTTSTGSPSEHSSS
FT                   VNTNPQQQSANPASQSQATTTSESTPTTDIKHPTQTAPAQTTSASTTEPTTESNTESAT
FT                   DSQAKATTTDNQASKQPSQQAVPASSNSTTTEVNTQSATSSASTDDKIVTNVNQEKLVL
FT                   KTNQPVVRAISRTASENINDWMPNTLLQQEVLSQLRKQNPDRTWNSAADITKADMLLLT
FT                   TYYGKDTYIDGKTSYSLEGLQYATNLTTVWLNNNLNAPSGSYYSDVTDISPLANLQKLQ
FT                   VVNIQQNRITDISPLANLKNLTEVDAAYNHISDFSPLKGFKNLKGTFSNQFITLPPAYI
FT                   SADNNIATLAIDCYLPDGSKVQLKPNNGVGETVFYKNGQLYVRWYFNGAGGGNYDSNGH
FT                   IYYTNMKPQQPGLTGPTFNGTTVIPMDDYYFMTAASDSNNFVVVRPYVLAATSAPITVK
FT                   YVDALTGESLVTADLTLNGIVGQPYTTQRIDDELPNYDFTNIVGNASGVFTADAQTVTY
FT                   YYTRKDAGDITIHMVDTNGNLVYEPQILPGKHNLGNAYNLDAPTFDHFKLQQTIGNAAG
FT                   IFTTDPQSITFVYVRLDAGNITVKYQDKQGHQLKPDKTISGSQSLGQAYTTEPLDIENY
FT                   TLMTTPANATGTFTDQEQTVIYVYVRRDAGQIVVKYQDSAGNPLAPDKLLDGKEQLGAA
FT                   YQTAAISIPNFYLVVTPANATGTFSTDAQTVIYQYARSNAGHITVKYQDANGTTLAPDD
FT                   ILTGNGQLGRPYQTNAKTIENYRLIQTPANATGQFSDQAQTVIYVYTREDAGDITVQYL
FT                   AENGQQLAADNVLSGQGQLGQPYETSPLNINGYTVKSTQGNTTGTYTLQPQRVVYIYER
FT                   TAGQPVTAKYQDQDGKSIHPDVVHSGYLGDNYSTEQLVIDGYTFKAVQGDVSGTFGTSA
FT                   KTVTYVYERTAGLPVTAKYLDEHGKSIHPDVVHSGYLGDSYSTEQLVIDGYTFKAVQGD
FT                   VSGTFGTTAKTVTYVYTVNTPTIPDTQGTVTVHYMTKDGIKLNEPTVLSGKTGTTYQTV
FT                   PLTFTDHELVGQPENAMGLFTADNVDVTYVYQATDTTGTDDIIDPEQPEQPTKPVEPTT
FT                   PETPNEPGTTVTQPDRIKPTQPAVAVKPAATVKPTLKPVAAQASLVKTTSPVTEHSAQL
FT                   PQTDEQTGKLAVILGLLLSVVTFGFYGKHRQS"
FT   gene            844582..844704
FT                   /locus_tag="JDM1_0785"
FT   CDS_pept        844582..844704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0785"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0785"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61672"
FT                   /protein_id="ACT61672.1"
FT                   /translation="MMEKQDLASARRRLRGTNLKSRKRALKILHDARRNASKAK"
FT   gene            844793..845287
FT                   /locus_tag="JDM1_0786"
FT   CDS_pept        844793..845287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0786"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0786"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61673"
FT                   /protein_id="ACT61673.1"
FT                   /translation="METTLVIIRGNSGSGKTTLAQALQRRVGHHTLLVSQDVVRRDMLM
FT                   SHDYPGNISIGLIEQIACYGLGRVPVVIVEGILARDRYGKMLARLSQSFPRVLTYYFEV
FT                   SFATTLARHQKRHRDFGVEDMRRWWLPHDTLGVANEVLIGEQQDLTTEVQQIMTTIHDC
FT                   D"
FT   gene            845356..846108
FT                   /locus_tag="JDM1_0787"
FT   CDS_pept        845356..846108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0787"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0787"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61674"
FT                   /protein_id="ACT61674.1"
FT                   /translation="MLLAALLKTRRCQYGLTQAQLASKLFVTTQAVSKWERGKAIPSID
FT                   NLLALSDLYNLSLDELVRGSAFFPKPYIVGRRLSFGRLLGLGLFWLFVCLLFTGFGYQP
FT                   WWLFLSLYIVGLIVVVPVGINSYWVIQPATIELHTYAASTLTKFRQIVFNCPRCQLIHY
FT                   TDLQRVTISYRCRKRFSPFDFNPDYFQLILKTNAQTYQLECALKASDYLPQFVSYLQRQ
FT                   GVTVDDPQQVVELLVSGKSLYQHFHTET"
FT   gene            846208..846759
FT                   /locus_tag="JDM1_0788"
FT   CDS_pept        846208..846759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0788"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0788"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61675"
FT                   /protein_id="ACT61675.1"
FT                   /translation="MKIVIGSKIKEQRQQHEWSQQTVAERLHVSRQTISKWELGKSYPD
FT                   LELLVALSKLFAVSTDELLGLSRRPVQRPWWQLLLRKRSRTDMTVKWYSGGQDRARVAV
FT                   GIISDLVANLNTTNEQPLRQLLATYYQELLEQRTGSVLGVFDRMNLDISKCLRQQQIKL
FT                   SPENEQLMQQLVGLNMIYYR"
FT   gene            complement(846830..847756)
FT                   /locus_tag="JDM1_0789"
FT   CDS_pept        complement(846830..847756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0789"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0789"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61676"
FT                   /protein_id="ACT61676.1"
FT                   /translation="MENKLLVFLEAIQQHNSMTKAAQSLFISQPYISRTIKSAETHFGT
FT                   PLIDRGHHPLELTYAGERLLTYLQSDARLHQRMNTELKEISQNKYQSMTIGITPPMANA
FT                   WFSQTLPAFYQRFPNIRTKILEITTSKAETLLASHQLDFFIGKTIHQTNVKTIPLQTIS
FT                   LSLVIPKTAGIYQSNQFWRPFTPTILTGMTGEPVIRAVGEARFQELVDHYFADKGIQTI
FT                   PLIEVDNSRFALSLTLQGLGSIVLATAMLAKLATQPAKYPINAFKLPTSELSLDFSIAY
FT                   LPSHVLAKPIAYLVEQACQTFNPAIDF"
FT   gene            847943..849832
FT                   /locus_tag="JDM1_0790"
FT   CDS_pept        847943..849832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0790"
FT                   /product="fumarate reductase, flavoprotein subunit
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0790"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61677"
FT                   /protein_id="ACT61677.1"
FT                   /translation="MDFERVVSMLQKMNQVKWDYQYDTVVIGFGGAGATAARFAADAHA
FT                   KVLLTDAAPNGHEGGNTRYSAQLLGTVDSFDEGKKYYQNLTAPMQLDDSMVDTFVAGMA
FT                   NMRDYVQKYLNVEPVSVKNDFTAADSPISLDSAVHEFPEFDGVQSYDFTTVHHGIFDAA
FT                   LWKILRQKVLDRHQQIDVWLSAPAQHLIQDPTTNTIIGVQIERQHRLVNVRATNGVVLA
FT                   CGGFENNQQAIQDYLGAEHLAPLGTLFNKGAGIKMAQEVGADFWHMQNYESLGFLHGLS
FT                   IAVPQGERGRLILGWPEVNHGSVITVADDGSRYFDESEANRHGHIYDHGMWRVPRTNVH
FT                   PYLVFDETQYQQMLASQYTPINNLTDLVVKATTLNDLARVMEVDGTVLTKTVHDFNYFV
FT                   ESGTDYAFNRQVDTMRAFDGGPYYALKLTNNVLNTQGGPRRNDRAEILDANQQPIPHLY
FT                   GAGELGGICANQYQGGGNLAECLIFGKIAGENAAKPKEETTQLVDEKAVAKPDANTSAS
FT                   VHQTGANDLLAEASPDITVGEHQYLGRSDDGIGGQVVVRITYVDQQLTHVEVVEQHETG
FT                   EVGGQAVAELPAKMVAANTYDVDAVSGASVSSRAIKAAVKDALSQAKQTVSND"
FT   gene            complement(850108..850581)
FT                   /locus_tag="JDM1_0791"
FT   CDS_pept        complement(850108..850581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0791"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0791"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61678"
FT                   /protein_id="ACT61678.1"
FT                   /translation="MSISTEQTILTQLKTIRTKRASTTGEQKWLQQHITEANLRRLLPD
FT                   ISIVGLHLLSELEAGPQTGIDLATNLGVTRGGVTRAAKRLVTQGLIGSFQQPDDHKKIF
FT                   YRLTPSGRKLARYHDKMHATRNHQAITLLHEHYSPAELAVIQRFLADLTDYEA"
FT   gene            complement(850690..851319)
FT                   /locus_tag="JDM1_0792"
FT   CDS_pept        complement(850690..851319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0792"
FT                   /product="acyl carrier protein phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0792"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61679"
FT                   /protein_id="ACT61679.1"
FT                   /translation="MTKLLMINAHPHTTVPSASLTVAASFKTAYQQTHPNDEITTRDLY
FT                   QDGVPALNDTTFEAWRKQKYGEELTSVEAELLSRHAAWLAEFLAADKIVFVNPMYNHFL
FT                   PAELKQYLDLTAVARKTFKYTVNGPVGLLPDKHVLHIQAAGGYYHQPDQHNQVEAGDPY
FT                   LRGMMQLYGIQDYRTIFIEGLDQFPEQREQAITAAQVAAEKLAGEF"
FT   gene            complement(851489..852784)
FT                   /gene="asnC"
FT                   /locus_tag="JDM1_0793"
FT   CDS_pept        complement(851489..852784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnC"
FT                   /locus_tag="JDM1_0793"
FT                   /product="asparaginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0793"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61680"
FT                   /protein_id="ACT61680.1"
FT                   /translation="METISIINAADHVNEQVKIGVWISNKRSSGKIAFLQLRDGTATFQ
FT                   GVALKNELGETAFAQLTDLAQETSLWVTGTIHADTRSPFGYELAISQFEVVGTSHDYPI
FT                   TPKDHGIDFLLDHRHLWLRSSRPNAIMRIRNEVIRAVYEFFNDRGFIKIDAPILTGSAP
FT                   EGTTELFKTDYFGQDAYLSQSGQLYGEAGAMAFGKIFTFGPTFRAEKSKTRRHLTEFWQ
FT                   LEPEMAWIHQDESLEVQEQLVAYLVQAVIDHCPHELAVLDRDVATLQKYTKLPFPRVSY
FT                   DDAITLLQANGFDVDWGVDFGSPEETFLAEHFDQPVFVLNYPKAIKAFYMQAHPTRDDV
FT                   VIAADLLAPEGYGEIIGGSERSTDYDYLKERLLASGQDLQDYEWYLDLRKYGSVPHSGF
FT                   GMGLERFLAWITLQDHVRETIPFPRMLHRIYP"
FT   gene            complement(852823..853830)
FT                   /gene="asnA"
FT                   /locus_tag="JDM1_0794"
FT   CDS_pept        complement(852823..853830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnA"
FT                   /locus_tag="JDM1_0794"
FT                   /product="asparagine synthetase AsnA"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0794"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61681"
FT                   /protein_id="ACT61681.1"
FT                   /translation="MHLIIPKDYDPKLSVKETQQAIRYIRETFQDEFGKQLNLSRLSAP
FT                   MFVEKKTGLNDNLNGVEKPVSFTMQDMGDEQIEIVHSLAKWKRVALKRYGFDMHEGLYT
FT                   NMNAIRKDEDLDNYHSAYVDQWDWEKVISKEERTVETLKATVRQIFKVIKHMEHEVWYK
FT                   FPQAVHHLPDEIHFLTTQELEDMYPDMTPRERENAICKKLGCVFLMQIGWKLDSGERHD
FT                   GRAPDYDDWKLNGDILFWYEPLDQAIEISSMGIRVDAESMKKQLKDVDAEDRLSLPYHQ
FT                   MILNADVPYTIGGGIGQSRLCMLLLGKAHVGEVQAALWPQAMINQCAEHNIHLL"
FT   gene            complement(854283..855689)
FT                   /gene="pepD3"
FT                   /locus_tag="JDM1_0795"
FT   CDS_pept        complement(854283..855689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepD3"
FT                   /locus_tag="JDM1_0795"
FT                   /product="dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0795"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61682"
FT                   /protein_id="ACT61682.1"
FT                   /translation="MEKRIKGSCTTILVGKKASIDGSTIISRNDDGHEALDPERLVVVN
FT                   PADQPRHYQSVISKVEVDLPDNPLRYTSIPNSILTNGTWPAAGINSENIAMSATETITT
FT                   NSRILGIDPFVAGGIGEEDLCTLVLPYIHSAKEGVTRLGALLEQYGTYEPNGIAFSDQD
FT                   EIWWLETIGGHHWAAKRIPDDAYVVAPNRMNIDDFDFNADDTLASADLEQLIEDYHLNP
FT                   DFDRVNLRHIFGSASIKDTVYNNPRAWFGQKYFTPDVVQDPMEQDLPFICHANRKISIE
FT                   DVKFVLSSHFENTKYDVYGSGSEADKTLFRPIGINRNHDVHILQIRNNVPAAVAGIHWL
FT                   AFGANTFNTVVPFYANVNDTPASYKDADGTFNLNHMYWLSCTTALLGDTDYDFYVDMRN
FT                   SYELEAMSAYRKIENDTDADLANHQDVTAYLETANQQLADTAMKLQTKLLGDMVIAGSE
FT                   KMKLRYNLND"
FT   gene            complement(855725..856963)
FT                   /locus_tag="JDM1_0796"
FT   CDS_pept        complement(855725..856963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0796"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0796"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61683"
FT                   /protein_id="ACT61683.1"
FT                   /translation="MSMMPTNLTLLERKISNNLNCLYFVNHPIYRIQKDHQLALASEYS
FT                   LAGNVTEIICDEQQRYHILFVARKEIVLTEKKVAKVTNNQLGQDTVQFLATLGYQFPPA
FT                   QPAGELSQPTILPSPTELSECPTAYVIIDCEFGTRFRRNGSAKAVSWHVIESPELRASI
FT                   FQLSAIGFSHHTQTAPFFNRYFDDPNFLPDKKLAGLSATGLTTVAYEAQGDPLTILKAF
FT                   IQQVIQPQLPLVFWDQTQDMKHIRLLLTQYYQQLTPTEQQLVSRPVTIFDAQAYTNTLI
FT                   NRGNHKVGSHDLPLNGLAALFNISNPHQHNAIWDVQTTELVMVKLAELTHQTPVITTPP
FT                   APIALPATVPAVVPSIQTPSPTPQHASHAQVHQLRARGKTYREIAAVTGFSISGINYIL
FT                   KKARSIPTRSESV"
FT   gene            857476..857691
FT                   /locus_tag="JDM1_0797"
FT   CDS_pept        857476..857691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0797"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0797"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61684"
FT                   /protein_id="ACT61684.1"
FT                   /translation="MRGGRVMDRGRRATLEERIAIVKYTLDHCNDYREAAKHFNVSYPQ
FT                   VYTWVRKYRQHGMEGLVDHRGRPKQG"
FT   gene            857949..859757
FT                   /gene="recQ1"
FT                   /locus_tag="JDM1_0798"
FT   CDS_pept        857949..859757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recQ1"
FT                   /locus_tag="JDM1_0798"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0798"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61685"
FT                   /protein_id="ACT61685.1"
FT                   /translation="MIDLAAAQQVLKTTFGYDEFRPGQKAVIEQVLAGENTLAIMPTGG
FT                   GKSLCYQIPALLFQGLTVVVSPLISLMKDQVDALNDNGIAATFINSSLDFQEINERLQE
FT                   LRAGDYTLLYVAPERLDSDYFIQALGRLPIQLLAIDEAHCISQWGHDFRPSYLALSTAI
FT                   EQLPTHPQVLALTATATEQVAADICGRLAIDPQHEVNTGFARDNLDLTVVKDQDTDRYI
FT                   LDYLKVNHGEAGIIYASTRKEVMRLTSLLQKHDIKATPYHAGLDDAVRRQNQEDFLYDR
FT                   VDVMVATNAFGMGIDKSNVRFVIHAQVPGTLEAYYQEAGRAGRDGLPSEAILIFRPVDI
FT                   QLQHFFIDESEMDTEHRHLAYQKLQVMTRYANTQGCLQQFILKYFGEKSAPCGRCSNCT
FT                   DQRESQDITTAAQQVLSCVVRLHSRFGKGVVAQVLTGANNQRVRESNLNTLSTYGLMSG
FT                   QRQKSVVELIDFLTASGYLQSVGGQYPTLTVSASGVAVLKGTTTVHRKTAQKVQQTVPE
FT                   NSALFEQLRTLRRQLAEEQGVPPFVIFSDRTLHSMCDLMPEDDAAFLTVKGVGTSKLEK
FT                   YGETFMATIRAAAHAESATSTDEETD"
FT   gene            859800..860681
FT                   /gene="rluE"
FT                   /locus_tag="JDM1_0799"
FT   CDS_pept        859800..860681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rluE"
FT                   /locus_tag="JDM1_0799"
FT                   /product="pseudouridylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0799"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61686"
FT                   /protein_id="ACT61686.1"
FT                   /translation="MEFTWQHQGQPMAMKRFLTTHAISMRTIKAIKHGTGAFLVNNQVQ
FT                   TGVITIHDGDIAGIQLPDEAPDTAVVVSEQPIQIEYEDANWLVLNKPAGLTSVPGPSNR
FT                   TDTLVNRIKGYLIASHASNQRPHLITRLDRDTSGLVLVAKHRVAQGMLTEPRIAAQLVK
FT                   TYQAWIEGTITPASGTIDRPIGRVADSPRRVVTTAGQRAITTYQVEADQLQHNVSRLRL
FT                   ELVTGRTHQIRVHLTALGHPLLGDTLYGGNLAWIQRQALHAASLQFFDPFSEQTLHFEA
FT                   ALPADLQALNHD"
FT   gene            complement(860873..861199)
FT                   /locus_tag="JDM1_0800"
FT   CDS_pept        complement(860873..861199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0800"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0800"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61687"
FT                   /protein_id="ACT61687.1"
FT                   /translation="MANFQQSETALIESATLINIFAEKIRRQIIIALGNSDNGLNVTDI
FT                   TALVNISRPAVSHHLRLMREAGVIDMRSNGVEHIYFLTLTAPLQQLQATFATLTADNAP
FT                   LSQS"
FT   gene            861534..862316
FT                   /locus_tag="JDM1_0801"
FT   CDS_pept        861534..862316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0801"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0801"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61688"
FT                   /protein_id="ACT61688.1"
FT                   /translation="MMGVENVKVLGILGAHRADGVTAQLLQAVLKGAAASADTELVNLN
FT                   DYELRPDHDSQPNADLDALEAKLMAADVWVLAAPTYLGSLSGVMKNFCDCFRGRIARFN
FT                   SVGEAVPDRFKNKHYVTITDCYAGGIENYLTGVTDATFKTLDKFLTMGGLIKLREIVVT
FT                   KTWGMQTITAAKQAECERVGARAAHKKERDDSTVKRYIQLFFMIAVMALLTMGIEAGIQ
FT                   QLIPLNNFWAYYGVFVVVFYVLLAMILHFFTVVKHRRR"
FT   gene            862736..863737
FT                   /locus_tag="JDM1_0802"
FT   CDS_pept        862736..863737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0802"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0802"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61689"
FT                   /protein_id="ACT61689.1"
FT                   /translation="MQVFGQFIATVGWLGLALVASELGATLIHWLGQWVGFRLIGARIV
FT                   RITGFRLQLSRVRGHWKLERPLTRHPHIVAAPSADAKRFNHAIYCFGGGLFNLLTVMLS
FT                   LITLNQFKFSFDLWLFAFIIWIWVNTLKAAQLLPMNLHGYPTAGQEFRQARESTAAMTA
FT                   AYVTACAAAAKVQTGSVRDLDASMIVMPRDGGNRNYLVVRQAWLILEWGLQHGLDTPEL
FT                   LAGLSRLEPSFNTLPPADLAKYLDATLYWNLVTNHRYPQIIAWYQDDGVQQLLRRYQPL
FT                   AHYKLTAVYEWRVHQQPEQALALIEKGLKIAQRLHDEEEIAWLKALRVQVTA"
FT   gene            863701..864951
FT                   /locus_tag="JDM1_0803"
FT   CDS_pept        863701..864951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0803"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0803"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61690"
FT                   /protein_id="ACT61690.1"
FT                   /translation="MAESFTRSSNGLDYRRNLDSVKDCQNRSLYWKMGGKLVTIEVKKG
FT                   ENVKQRIKQRWGLWLTLLVIILGLIGVGLTRVNAGLYQQTVAQVTHVQTKSRSTTTDEF
FT                   ENKDATVTQLVTVRVLNKAHRGRTYQIKNTYTRSGAMDQPYHVRNQVFLRIPSDHSSAV
FT                   TIQGLKRDTALAFVAWLALALLLLIMRFSGLMAFLSVALNAVLFYAAIQIDLATNGGHI
FT                   YLLFGVLAVIFAVLTLLLVLGFSRQMLVTLGATVVGTGLAVIISLIVFAVTHERGVTYE
FT                   SMQYVTQVPRPLFLVETVLGSLGAVMDESTDIVASLFQLKTERPDIAPRQVFKSGIQIG
FT                   RSIMGPLINVLFLIFMADTFAMTLLYFRNGNSWGYTFTMNMSLGMVQSLISGIGIVLAI
FT                   PVASWLASRLMPKAVMA"
FT   gene            864948..865712
FT                   /locus_tag="JDM1_0804"
FT   CDS_pept        864948..865712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0804"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0804"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61691"
FT                   /protein_id="ACT61691.1"
FT                   /translation="MNTITVLGLILLGLMTLIGGKTGATAFLSLLFNFGLLFLAVVLIS
FT                   WGFPAMGVSLVIGTIILAFTIFFGEDNEVAAKPAYIAALIVMVMLVLIIFPVENWIMAQ
FT                   GFSLEDSEDLEGMSLAIGVSFIGVAVTEAILSTLGAIAEAAIAIAAGLSEILAQHPQLP
FT                   TKRLYIDGISIGKQIIGTTFNTLFFGFFGGFLALFIWFAGLHYSFGSVINNKIFVAEVL
FT                   MVLFSLIGVILVVPVTTWVMTIQHRQQIKHND"
FT   gene            865709..866332
FT                   /locus_tag="JDM1_0805"
FT   CDS_pept        865709..866332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0805"
FT                   /product="acetyltransferase (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0805"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61692"
FT                   /protein_id="ACT61692.1"
FT                   /translation="MTMTAGFATVEKTVGSVVMMEIRTAQPQDSAQIAPLISMIYRDME
FT                   MPVLKNVSEADLLAMLTELYQRPANLDGLAQTFVAVMDHKIVGVAFGHLAKNEVAVNDL
FT                   LRTTSGHHAGFEAPLELGGETRPNEWYLSMLAVDPQAQGHGVGSALLEALPGLVGQLGA
FT                   TKLSLNVDDGNPRAAKLYHRHGFVPDGQLMIGTHPYQHLVKPLS"
FT   gene            866464..867132
FT                   /locus_tag="JDM1_0806"
FT   CDS_pept        866464..867132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0806"
FT                   /product="alpha-ribazole-5'-phosphate phosphatase
FT                   (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0806"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61693"
FT                   /protein_id="ACT61693.1"
FT                   /translation="MQIYFIRHGRTQYNLEHRFQGGRADSPLVASGIDGAKAAGDYLST
FT                   TQFSAVYSSPQQRALDTAKYIVAANQWQPPIQIDDGLREFDFGDWDGKQEAEVQPQSYA
FT                   QVIFTKPAEYRPELAGGGESYADFVTRTTSTLHRLIDQVGVASTQPLLIVSHGLVTTMT
FT                   VKALMGVPIAELRAPFVVDGQVMKTVGHGIVDNDSLTVLSTTDNQHFELTTWNETGYLK
FT                   "
FT   gene            complement(867341..867670)
FT                   /locus_tag="JDM1_0807"
FT   CDS_pept        complement(867341..867670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0807"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0807"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61694"
FT                   /protein_id="ACT61694.1"
FT                   /translation="MLYSWHGGINVNKNDKAKRLMQQIDVAYNDPEVKQDAQVRADLLR
FT                   YAMELDKNGNYLLIATKVNGMAMRVMRDHMHQPLQAINTLYTQTARTSEYYWGVAAASI
FT                   FSGLW"
FT   gene            complement(867814..868827)
FT                   /locus_tag="JDM1_0808"
FT   CDS_pept        complement(867814..868827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0808"
FT                   /product="lipase/esterase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0808"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61695"
FT                   /protein_id="ACT61695.1"
FT                   /translation="MPTINSIQTTVNGVVKIVKPFNNDIAGEQFDPHVLQTLTAFKQPA
FT                   ILENDLAALRSGSLTPAIADPVGDAVTVQSRNITALNRTVSVEWLTPQNVINHTVLVYF
FT                   HGGAFYGGVPGNNTVLLKLVAAKSHCEILNVDYSLAPEAPAPAGILDGLAIFQYLEQRD
FT                   AETMITVAGDSAGANVIMAATNLNQQLGSNRINQQLLLYPVTAPNADHAGPLWDLAAFP
FT                   IIDSQRAILTNYHDLFRQLDSIMTDYYVPENFDSHSPLISPLHQENFTMTPPTTIMVGE
FT                   FDPFRPQAWAYAQRLAAADTATTFIQYQGLNHAFAPLVDQYWQSQDVAQVMAAALI"
FT   gene            complement(868814..869455)
FT                   /locus_tag="JDM1_0809"
FT   CDS_pept        complement(868814..869455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0809"
FT                   /product="sugar transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0809"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61696"
FT                   /protein_id="ACT61696.1"
FT                   /translation="MLRGNSAIFFIKYVYGRPELAPIFLGIGFVSVIGNLSVPFLSQRF
FT                   KNRNVLQFSLVLGVIGQLLLPIAEKMRSVSLLIAGSVIFLIAMGITFTIVFAMLSDTVD
FT                   YSTKVLGLNETGFLSAVPMIGAKLGMGIGGFLAGQFLAWGQFNAKAAVQSGRTITFINL
FT                   AFIWMPIILLAAMIFMMQFYRLDEKELQANKAEAAAKVEPKEDVEYDANN"
FT   gene            complement(869483..870214)
FT                   /locus_tag="JDM1_0810"
FT   CDS_pept        complement(869483..870214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0810"
FT                   /product="sugar transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0810"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61697"
FT                   /protein_id="ACT61697.1"
FT                   /translation="MSIFQTWKRRIAYGSTDMAGNIIWQMVSTYLLFYYTTVAGISAAF
FT                   AGMLFFVVRFIDAFDALIYGYLIDHTHTKYGQSRPYFVWFGIPLGLLAMSLFMIPSFGG
FT                   NTTMRLVYISITYTFFSLIYSGANTPITSILPSLTDDSVERTKLASARMVMTTIGTSAV
FT                   AAITLPMVKLLGKGNQSKGFTLWAIILGLVIMGLFIFAFLNLKETNGAQNPDGTTESAE
FT                   SLSIWQSLKGAASNKPWLLLA"
FT   gene            complement(870552..872033)
FT                   /gene="murE1"
FT                   /locus_tag="JDM1_0811"
FT   CDS_pept        complement(870552..872033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murE1"
FT                   /locus_tag="JDM1_0811"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamate--2,
FT                   6-diami nopimelate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0811"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61698"
FT                   /protein_id="ACT61698.1"
FT                   /translation="MQASQLINSLKFKQVQPALTTDFDVTMLTQDTREVQPGAMFIAVV
FT                   GYHVDGHDLVDQAIGKGAKIIVASKPLDVNVPVIYVENTERAMAILADVFYGAPSQKMR
FT                   MIGVTGTNGKTTVTHLIEQIYRDQQQATGLIGTMYRKIKDEKLPTANTTPDAITTQRTL
FT                   AAMRDAGVETVAMEVSSIALVLGRVWGIDYDIAVFTNLTQDHLDFHKTMAKYTEAKAML
FT                   FAQLGNKYSADGTNKVAVLNTDDPVGREFEQYTAAHVLTFGLKPDAMINAQNVEIKSHG
FT                   TEFDLSVFGHVTHVTMQLIGQFNVYNMLAAFAAAYASGIPEDQIIKSLEKVTGVKGRFQ
FT                   SVPSHTGVSVIVDYSHTPDGLLNALETIQDFATKDIYCVVGCGGDRDKTKRPKMAKIAV
FT                   EHSTKPIFTSDNPRTEDPTMILNDMVAGVPNADVPVYEDRHVAIAKAIEAAQPGDVVLI
FT                   AGKGHEDYQIIGRTKHHFDDSEEAAKALALKPTID"
FT   gene            complement(872228..873430)
FT                   /gene="thrA1"
FT                   /locus_tag="JDM1_0812"
FT   CDS_pept        complement(872228..873430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrA1"
FT                   /locus_tag="JDM1_0812"
FT                   /product="aspartate kinase I"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0812"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61699"
FT                   /protein_id="ACT61699.1"
FT                   /translation="MEIIVQKFGGTSVKDEAARIQALKHVQYAVDQGDKVIVVVSAIGR
FT                   KGAPYATDSLLGLVGAEHSRLTNRELDMLVSVGETISTAVFTELARKQGLNVTAMTGHD
FT                   AGIVTNDDFQNAKILRVDPKPITDAFIDADVVVVTGFQGATESGHITTIGRGGSDTSAA
FT                   ILGAALKAKRVDIFTDVNGMMTADPRLVTHARFIKAISYEELANMAHEGAKVIHPRAVE
FT                   IAEQAHVPMRIRSTYQEPDELGTLVTDRTTTQIEHYRTVTGIAHQTDLTQFTVPTDTLS
FT                   SSAIFQLMAQHGLSVDFINITPHQVVFNLVDGDADVAKQLLTDAHVHCQSIANCAKVSV
FT                   VGAGITGTPGVTARIVSALAAQHIDILQSTDSYTTIWVLVKEADLKAAMNALHDEFLGI
FT                   E"
FT   gene            complement(873435..875336)
FT                   /gene="asnB1"
FT                   /locus_tag="JDM1_0813"
FT   CDS_pept        complement(873435..875336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnB1"
FT                   /locus_tag="JDM1_0813"
FT                   /product="asparagine synthase (glutamine-hydrolysing)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0813"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61700"
FT                   /protein_id="ACT61700.1"
FT                   /translation="MCGFAGCLTDRTKADNAAYDQTIHEMTKMIVHRGPDDDGYFADDN
FT                   ITMGFRRLSIIDLAGGHQPLSYDNERYWMTFNGEIYNYVELREQLKQEGYEFKTSSDSE
FT                   VILAMYAKYHADATKYLRGMFAFVIWDKQEKTLFAARDQFGIKPFYYAISGDDFYYASE
FT                   SKAIYKILKDKTFDKNALQDYMTFQFVPEPETLTKEIKMLAPGCSLTKKLGSAPRIDRY
FT                   YHREFHPVQRSEDEYAQKIKDALIDSVKIHMRSDVPVGSFLSGGIDSSIIVAIAKNFNP
FT                   NLETISVGFEREGYSELDVAQETAEKLGVKNYSMTITPEAFMKAFPHFVWSMDDPLADP
FT                   AAVPQYFLAKEAVKHVKVCLTGEGADELFGGYTIYHEPESLKPFRYTKPINGALKRIAL
FT                   MMPEGMRGRSFLLRGTTPLENRYVGNAFIFGEQEKQAFFKNYNQNHPFQSITQPLYDES
FT                   VDYDPISRMQFIDMHTWLNGDLLHNADRTTMAHSLELRTPFVDREVYNLAAEIPADLRI
FT                   SHGTTKYILRKAVEDIVPAHVLHRKKLGFPVPIRFWLKDEMYDWAKQIINDSQTDQYFN
FT                   KDYFLKLLDDHKAGVRDNSRKLWTVLTFMMWHRLYVESDHLMDSPEANAVAEKVEEF"
FT   gene            complement(875807..876133)
FT                   /locus_tag="JDM1_0814"
FT   CDS_pept        complement(875807..876133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0814"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0814"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61701"
FT                   /protein_id="ACT61701.1"
FT                   /translation="MSTYIFVTILLCGLVTWLSRIVPFAIIKNLSVPQWLISFLSFVPI
FT                   AIMTAIFVESLLTYHAGHWPEFNLPNIYASIPAILAGVLTKSLLAVVITGIVAMAVLRL
FT                   VGWA"
FT   gene            complement(876130..876831)
FT                   /locus_tag="JDM1_0815"
FT   CDS_pept        complement(876130..876831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0815"
FT                   /product="amino acid transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0815"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61702"
FT                   /protein_id="ACT61702.1"
FT                   /translation="MDSSLTFRAGIKDVIPTVFGYIGVGLAMGIVANTSHLSVWAVLLM
FT                   SLIVYAGSAQFIIVSMLLAGSPISAIVLSTFLINSRMILMSMSVAQYFKKESLLQNIGL
FT                   GSLLTDETFALSMNKLNQTNQQLKTSWLHAANIVAYLVWAAATVVGCLLGNLITDPNQF
FT                   GLDFAVVGMFIGLLYLQIITDRSKSLPTQLWVVLFVALAMYFLMRWVPGNLALIFATLL
FT                   GCGFGMVVDHK"
FT   gene            877162..877380
FT                   /locus_tag="JDM1_0816"
FT   CDS_pept        877162..877380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0816"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0816"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61703"
FT                   /protein_id="ACT61703.1"
FT                   /translation="MTLEQLAAHSGVAADKIVAYTNAGLLPCKDVNAHFSADDEYWLDM
FT                   VNCFLENGSSVEDLKDLMPLCEQCAAQ"
FT   gene            878364..879107
FT                   /locus_tag="JDM1_0817"
FT   CDS_pept        878364..879107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0817"
FT                   /product="lipoprotein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0817"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61704"
FT                   /protein_id="ACT61704.1"
FT                   /translation="MKSGKHRVSLLILLCLMVVGLAGCHNKAYSQSIEKGLNAVAENKY
FT                   QKALTYFDNALAQKPKDEKAQAYRDQTQAYLTTISELKAGKVKTALTTVDKGVKITNGA
FT                   TSLTNKLKQLKVTVTSDYQEYQQLSDDVKAQLKVKNGNYSADVLKRCAAINWDKKPYLK
FT                   PLKAKVKQLLTAAKKAKTNMKVSAAEAKRAAALRRKIAAAKNKWNMAALDDVPDWFILA
FT                   LFADDSDVDDAAEELDDEYARSGRR"
FT   gene            879085..879507
FT                   /locus_tag="JDM1_0818"
FT   CDS_pept        879085..879507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0818"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0818"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61705"
FT                   /protein_id="ACT61705.1"
FT                   /translation="MPDQADDNDDYSDRDEQTTDSNDDTNDTDADSADDDWSDQDTDSN
FT                   DDTDDDSDTNSDADSDSDYSEDDDDEDSNRDDADDSETQSDDDYDDDTDSESDADDYDT
FT                   DDQYDDDDDYDDAESLLNPAPVQPSVADRLFASASC"
FT   gene            complement(879690..879947)
FT                   /locus_tag="JDM1_0819"
FT   CDS_pept        complement(879690..879947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0819"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0819"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61706"
FT                   /protein_id="ACT61706.1"
FT                   /translation="MYYHSTSGLFWIIIALLLYMLSKTGPKNFIIKQIRRFGWLINLAI
FT                   LTYIIVRQIQQPTGVLQIMVLIVIGFSTMSSIYARFKHQP"
FT   gene            complement(880277..880999)
FT                   /locus_tag="JDM1_0820"
FT   CDS_pept        complement(880277..880999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0820"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0820"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61707"
FT                   /protein_id="ACT61707.1"
FT                   /translation="MILVLLVVSAIALFLSFIYVHQNTLRISLSVIFAALLVTSIVFVS
FT                   KNDGQHYGMVKTTTTTTQSLKSAGSSKQLDLLLYQSVGTADKHRVYIYKKTTNQKKVSH
FT                   TTASVKTANQVKTTTATPKLVTKTTRWTYKSNAMKFWFGLANNDKQLIKRTNYFYINKN
FT                   WVVLSTTQAKQFSKLMKQQQATLKARAKVYVTNQVKAAMVKNPTMSKAQLAKVQKAAAA
FT                   QYQANAIQSMLKTVKASK"
FT   gene            complement(880999..882477)
FT                   /locus_tag="JDM1_0821"
FT   CDS_pept        complement(880999..882477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0821"
FT                   /product="multidrug transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0821"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61708"
FT                   /protein_id="ACT61708.1"
FT                   /translation="MSTPVDTHGKPYNRGLLIAVLLVGTFCTVLNQTILTTAFPTLMKD
FT                   FDITTSTVQWLTTGFMLVNGIMIPVSAWLSSRISTKWLYLSAMAIFEVGTIICWTAPNF
FT                   GFLLAGRLIQAVGVGVTMPLLQTIMLSIFPADKRGAAMGTAGIVIGLAPAIGPTLSGWV
FT                   IDNLSWRDLFGLIVPIVAIVLIAGFFFMANVLETSKQKLDFASLVLSTIGFGSLLYGFS
FT                   SVGDNGWTSTVVLSTLIIGVIFIIGFIWRQLTMENPFLQLRVFKHAEFTIAAILSSVAN
FT                   MAMVGAEMVIPLYLQIIHGFSAFESGLSLLAGALMMGVMSPITGRAFDRFGAKRLAILG
FT                   MFLLTIGTIPFAFITRNTATVYIVVLYAVRMFGIAMVMMPATTAGMNALPVELMGHGTA
FT                   VNNTTRQIASSIGTAILTSVLSNVTDATKPAHSLIKSNPLGYQNSYFNATLNGYHAAFW
FT                   VAVGFSVVGLVVAFFMKGKQHSVKPVMNTKEVND"
FT   gene            882607..883071
FT                   /locus_tag="JDM1_0822"
FT   CDS_pept        882607..883071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0822"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0822"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61709"
FT                   /protein_id="ACT61709.1"
FT                   /translation="MDKQEDGVFFKKFKEQLGKHQFTIGISDLAKMTGVSQTQLRYWEQ
FT                   KNYIHSLKVSEKNTTHRYSYGMLMRVHFIKMMLDEGFTLAAAVERADGYNNQMEMMRIF
FT                   MMTAFQGIEERDGHHMVKLGYFDEAKTQQLYCYIQDETPHYRLYPVKSER"
FT   gene            complement(883317..883460)
FT                   /locus_tag="JDM1_0823"
FT   CDS_pept        complement(883317..883460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0823"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0823"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61710"
FT                   /protein_id="ACT61710.1"
FT                   /translation="MILGLFFVDNHTDRLRFNVRKYKKAPSFPAALGTSGKYHHRAIED
FT                   YY"
FT   gene            complement(883575..883919)
FT                   /locus_tag="JDM1_0824"
FT   CDS_pept        complement(883575..883919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0824"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0824"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61711"
FT                   /protein_id="ACT61711.1"
FT                   /translation="MNDDAQLSITQLDSSLQHKAVEDFAAFYLPLFDANNLEMMSNYDV
FT                   ASYMTDINEHLTYGRYMTKAQRLSDTVNFSFTAYVNLIDRLDQQYFTSGNPALPWNEWL
FT                   AAKFAQTATS"
FT   gene            884131..884778
FT                   /locus_tag="JDM1_0825"
FT   CDS_pept        884131..884778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0825"
FT                   /product="metal-dependent regulator"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0825"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61712"
FT                   /protein_id="ACT61712.1"
FT                   /translation="MTPMKEDYLKIIFELGGTKKKVSNKQIALSLDIAAGSVTEMVGKL
FT                   VQEGLAKHTPYAGISLTKKGIRYAETLVRKHRIWEDFLVDKLDYDLPDVHTEAEVLEHV
FT                   TSERLVDSLEAFLGNPTHCPHGGAIPDKDGHYQEDSHVSLADTQDGTTVTIERFIDNHD
FT                   LLVYLHDTPLKIGQQVTVLKHDPFEGPVTVSIQKTGEEIPVSYKAAHNVFVK"
FT   gene            885030..885230
FT                   /gene="cspC"
FT                   /locus_tag="JDM1_0826"
FT   CDS_pept        885030..885230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspC"
FT                   /locus_tag="JDM1_0826"
FT                   /product="cold shock protein CspC"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0826"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61713"
FT                   /protein_id="ACT61713.1"
FT                   /translation="MEHGTVKWFNADKGFGFITRENGSDVFVHFSAIQEDGFKSLDEGQ
FT                   AVNFDVEESDRGPQAVNVTKA"
FT   gene            885399..886148
FT                   /locus_tag="JDM1_0827"
FT   CDS_pept        885399..886148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0827"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0827"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61714"
FT                   /protein_id="ACT61714.1"
FT                   /translation="MTVTTDEMIIATCLKAGKIMVENGSEISRVDDTMMRIAQNAGVVA
FT                   ANTYVTITGVMMSIQGRNATQIAAVNQRTIDLEKVAQVNQLSREFAATTIDLPTLYQRL
FT                   NQLDAASRSFPLWLQLVGAALVSGPLMIMFRQEIVNTWPTVIIGTLGYLVFYLLNRYLK
FT                   IKFLSELTAALLIGFGAEWVCQIGWGTNVNDIIIGSLMPLVPGVPLTNAVRDTLAGNFV
FT                   SGPARGVEAMLSAAALGFGIAVVITLF"
FT   gene            886182..886643
FT                   /locus_tag="JDM1_0828"
FT   CDS_pept        886182..886643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0828"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0828"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61715"
FT                   /protein_id="ACT61715.1"
FT                   /translation="MMGTIGQLVLAYIAVLGFGLIINIPHQALNVAGWIGTLTWGGYLI
FT                   VQAFDGGVVLGSLIGSVGIGVLSSLAARYKKMPAIIFNIPSLVSFVPGSQAYQMVRNFA
FT                   LGNYREAVSFTLQVIMITGAIALGFLLAELLNRLIAFCIRQWRLHRLES"
FT   gene            complement(886929..887966)
FT                   /locus_tag="JDM1_0829"
FT   CDS_pept        complement(886929..887966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0829"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0829"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61716"
FT                   /protein_id="ACT61716.1"
FT                   /translation="MEDMPSRSEMHREKSQGNNSQGNGNGPKKKHPVRNTVLIIIAVLL
FT                   VGTGAFAARTYFNAKNAADTVFKSSGIKKSRNTSAVLNGKKPVSILLLGTDTGALGRNY
FT                   KGRTDTIILATINPKTKTTTLMSLPRDSEVAVSGFEQDFPTKLNAAYAYGSAGTTIKTV
FT                   QKWLNVPIDYYALINMGGMKKVVDEIGGVDITPIRTFTYEGYTFTKGQKEHMNGAKALA
FT                   YSRMRYDDPLGDYGRQQRQRQLITAIIGESASASNLLKQDFLNSLAKQTRTDLTFGNLT
FT                   SIVTNYRSATKNIVSDHAQGTGKMIDGQSFEVVSQSEKQRVTNVLRKSLNLKAATTGEK
FT                   FANQN"
FT   gene            888227..888889
FT                   /locus_tag="JDM1_0830"
FT   CDS_pept        888227..888889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0830"
FT                   /product="phosphatase (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0830"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61717"
FT                   /protein_id="ACT61717.1"
FT                   /translation="MIDKSRSRPIKFVIGVILFAYLSYFISDGAVGIDLIDVALTSLVQ
FT                   ISNSGIWTVFYKVIAWLASPGMDILWIVILAFLMYGFKYKIQAFWTLAYMVGAMALGFI
FT                   VKHIIGRARPIGHLAQDTGYSYPSGHVLGTFVLVSVIIMLIVPELPSYRMAMIVKWVSV
FT                   VWLVLVIFSRIYLNAHYPTDTIGAVLLAWSWSQIMQWFYVFWAPGLLKWPLFYRSYL"
FT   gene            complement(889074..889868)
FT                   /locus_tag="JDM1_0831"
FT   CDS_pept        complement(889074..889868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0831"
FT                   /product="lipase/esterase (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0831"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61718"
FT                   /protein_id="ACT61718.1"
FT                   /translation="MQVIKQKLTATCAQLTGYLHQPDTNAHQTNLPAIIIVPGGSYTHI
FT                   PVAQAESLAMAFAGHGYQAFYLEYTLLTDQQPLGLAPVLDLGRAVNLLRQHAAEWHIDP
FT                   QQITPAGFSVGGHIVALYNDYWATRVATELNVTPAMLKPNNVVLGYPVISPLLGFPKDD
FT                   ATLATWTPTPNELAADQHVNSDNQPTFIWTTADDPIVPATNTLAYATALATAKIPYELH
FT                   VFKHGPHGLALANAQTAWKPDANQPHVAHWLTLALEWLADNR"
FT   gene            889931..890476
FT                   /locus_tag="JDM1_0832"
FT   CDS_pept        889931..890476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0832"
FT                   /product="acetyltransferase (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0832"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61719"
FT                   /protein_id="ACT61719.1"
FT                   /translation="MGMVTVTTRNEQLELRPFTLADTEDYYDLVRDPSIAASAGFTPAH
FT                   SLVEAEFLLKQQAKLPQIFAIELTAIHRVIGSVGLYERMTNTGEPATLEMDLGYMLNAR
FT                   YWGRGIMTAAVARILRYGFETLHLRRITASCLANNPASKRILEHANFRQYDAVRHPDYA
FT                   PFGAGQTELFFDCVELNL"
FT   gene            890488..891012
FT                   /locus_tag="JDM1_0833"
FT   CDS_pept        890488..891012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0833"
FT                   /product="transcription regulator (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0833"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61720"
FT                   /protein_id="ACT61720.1"
FT                   /translation="MQLAKSFEQAACVLVLLATQQPEIPLTADVLHERIGGSASYIRKI
FT                   IRKLVVAGLVTSTSGNNGGVHLARSPEDISITDVVAAIEGTLQTFPNYGYFDRVFKDVE
FT                   PVAHEGTKVVNGIFSRADQLWLDFLDQQKLATLIKELLVVTQIPVLDWTNYSDDKMAQL
FT                   NALLSRMRAHK"
FT   gene            891198..892880
FT                   /gene="als"
FT                   /locus_tag="JDM1_0834"
FT   CDS_pept        891198..892880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="als"
FT                   /locus_tag="JDM1_0834"
FT                   /product="acetolactate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0834"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61721"
FT                   /protein_id="ACT61721.1"
FT                   /translation="MPDKKYYGADAIVDSLVNHDVKYVFGIPGAKIDRVFERLEHPVNP
FT                   KSPRLIVTRHEQNAAFIAAGIGRITGKPGVVMTTSGPGASNLATGLVTATAEGDPVLAI
FT                   SGQVQRADLLRLTHQSMNNAALFKPITKYSAEVQEPENISEVLANAYQEATAAKQGASF
FT                   VSVPQDVTDSIVRTPVITPIQAPKLGPASPVEATLLAQKIKAAKLPVLLVGMRASSPEV
FT                   TKAIRNLVAAANLPVVETFQAAGVISRDLEANHFFGRVGLFRNQPGDMLLKKSDLVIAV
FT                   GYDPIEYEPRNWNAEGKSRIVVIDAMRAEIDHNFQPETELIGDIAQTLDFLLPYMKGYD
FT                   ISDSARAYLGELQERLQTRDFVPNIDKQSKLNHPLSVIAALQQRVSDDMTVTVDVGSHY
FT                   IWMARHFRSYEPRHLLFSNGMQTLGVALPWAIAAALVRPDTQIVSVSGDGGFLFSAQEL
FT                   ETAVRLKQNIVHLIWNDGTYDMVKFQEEMKYGEDAAVHFGPVDFVKYAESFGATGLRVN
FT                   QPADLEKVLDQAFATDGPVVVDIPIDYSDNKALGKTMLPDQFY"
FT   gene            893264..894715
FT                   /gene="lysP"
FT                   /locus_tag="JDM1_0835"
FT   CDS_pept        893264..894715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysP"
FT                   /locus_tag="JDM1_0835"
FT                   /product="lysine transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0835"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61722"
FT                   /protein_id="ACT61722.1"
FT                   /translation="MAEKQHQEVHRSLQTRHLSMIALGGSIGTGLFVASGSAISTAGPG
FT                   GALLAYVGIGVMVYFLMTSLGEMATYLPVSGSFSTYATKFVDPALGFAMGWNYWFNWAI
FT                   TLAVDISTAAIVMQFWLPSVPGWVFSLIALVLIFTINALSVRSFGETEYWLSLIKVVTV
FT                   LVFLVIGVLTIVGIMGGHATGLSNFTYKKAPFVGGIPTILSVFVVAGFSFQGTELIGIT
FT                   AGESATPEKSIPAAIKQVFWRILLFYILAIFVIAAIIPYTSKDLLGSSASDIAISPFTL
FT                   VFKRAGLAAAASVMNAVILTSVLSAANSGMYASTRMLYSLSLQGYAPKTFGRVNRRGIP
FT                   IMALLGTTVIGLLTFLSSLFGERIYIFLVSASGLTGFIAWLGIAISHLRFRRAFVKQGH
FT                   QLSELRYHAKWFPFGPWFAFILCVVVIIGQDLHSFATLDWQAIGVTYMSIPLFIILYVY
FT                   YKIRYHTKMIPLDKVDLTRKRHHQD"
FT   gene            895062..895835
FT                   /gene="dacB"
FT                   /locus_tag="JDM1_0836"
FT   CDS_pept        895062..895835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dacB"
FT                   /locus_tag="JDM1_0836"
FT                   /product="serine-type D-Ala-D-Ala carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0836"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61723"
FT                   /protein_id="ACT61723.1"
FT                   /translation="MLKRNLLRGLALVSLAGVLAGCGASQLTSKATSSSTSAKSTKTQT
FT                   KRQRLISALPKGVKSTDSDLVVVNKWHKRAEMTFNKSSVDGIEVRSSIVKPLEAFLAGA
FT                   KKAGYPATIVSGYRSVAYQKEVWDQSIQTYENQGKSAKEALKLTKEYVAVPSGSEHETG
FT                   LAADIMNTHWYSTHGNQLLSSSDKNKGQQWLINHAADYGFVLRFTKDGKQSTGIDYESW
FT                   HFRYVGKASAEFMTKHNLTLEQYVSLLQAREKAAK"
FT   gene            896218..896853
FT                   /gene="dgk1"
FT                   /locus_tag="JDM1_0837"
FT   CDS_pept        896218..896853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dgk1"
FT                   /locus_tag="JDM1_0837"
FT                   /product="deoxyguanosine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0837"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61724"
FT                   /protein_id="ACT61724.1"
FT                   /translation="MLVMSGTIGAGKTSLTQLVANHFGSKAFYESVDDNPILPLFYKDP
FT                   KKYAFLLQIYFLNKRLDSIKSAFANDLDVLDRSIFEDSLLFHLNGDLGRATNTEVDIYD
FT                   SLLDNMMQELPEASHQKSPDLLIHINISFDTMLKRIQKRGRSYEQIDQDPDLYKYYQTL
FT                   NERYDDWYANYDHSPKMQIDGDQLDFVADADARKEVIRLIDEKVASLG"
FT   gene            897136..898413
FT                   /gene="serS2"
FT                   /locus_tag="JDM1_0838"
FT   CDS_pept        897136..898413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS2"
FT                   /locus_tag="JDM1_0838"
FT                   /product="seryl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0838"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61725"
FT                   /protein_id="ACT61725.1"
FT                   /translation="MLDVKMIRQNPDFVKEQLGHRGVAASDIDGLLAADEKRRELIAKS
FT                   EQLKSTRNQVSGEISQKKRNKEDASAEIAEMQKVSADVKTLDEERRTVDAQVQDMAAHL
FT                   PNMPHPDVPVSLKEEDAVELRRIGTPRHFDFTPKAHWDIGEDLGILDFERGAKVSGSRF
FT                   LYYVGDGAKLERAVYNFFLDQHEAEGYTEVLPPYMVTDESMYGTGQFPKFKEDAFRITT
FT                   QDLTLIPTAEVPLVNYYRDEVIPAEKLPVYFTALSPAFREEAGSAGRDTKGLIRLHQFN
FT                   KVEMVKFTKPEDSWDELEKLTNNAESLLKKLGLPYHVITLTTGDMSFTAAMTHDLEVWF
FT                   PEQDKYREISSCSNCTDFQARRAHIQYRDDDGKLQFVHTLNGSGLAVGRTVAAILENYQ
FT                   NEDGTVTIPDVLVPYMHGKTKIEKQG"
FT   gene            898831..898912
FT                   /locus_tag="JDM1_tRNA10"
FT   tRNA            898831..898912
FT                   /locus_tag="JDM1_tRNA10"
FT                   /product="tRNA-Leu"
FT   gene            898916..898988
FT                   /locus_tag="JDM1_tRNA11"
FT   tRNA            898916..898988
FT                   /locus_tag="JDM1_tRNA11"
FT                   /product="tRNA-Thr"
FT   gene            899013..899084
FT                   /locus_tag="JDM1_tRNA12"
FT   tRNA            899013..899084
FT                   /locus_tag="JDM1_tRNA12"
FT                   /product="tRNA-Gly"
FT   gene            899093..899178
FT                   /locus_tag="JDM1_tRNA13"
FT   tRNA            899093..899178
FT                   /locus_tag="JDM1_tRNA13"
FT                   /product="tRNA-Leu"
FT   gene            899189..899262
FT                   /locus_tag="JDM1_tRNA14"
FT   tRNA            899189..899262
FT                   /locus_tag="JDM1_tRNA14"
FT                   /product="tRNA-Arg"
FT   gene            899270..899343
FT                   /locus_tag="JDM1_tRNA15"
FT   tRNA            899270..899343
FT                   /locus_tag="JDM1_tRNA15"
FT                   /product="tRNA-Pro"
FT   gene            899394..899467
FT                   /locus_tag="JDM1_tRNA16"
FT   tRNA            899394..899467
FT                   /locus_tag="JDM1_tRNA16"
FT                   /product="tRNA-Pro"
FT   gene            899958..900425
FT                   /gene="ctsR"
FT                   /locus_tag="JDM1_0839"
FT   CDS_pept        899958..900425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctsR"
FT                   /locus_tag="JDM1_0839"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0839"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61726"
FT                   /protein_id="ACT61726.1"
FT                   /translation="MQSQNISDIIEKYLKSILADSEHVEIRRSEIADLFNVVPSQINYV
FT                   IKTRFTIQNGYLVESKRGGGGYIRIEKVNLVDDADVLDALIQVIGDSITQRDAYAVVQS
FT                   LYEDDVLNRREAQLILVAIDHETLGLTDRDLENSLRARIIIGILNHLRYES"
FT   gene            900444..902948
FT                   /gene="clpC"
FT                   /locus_tag="JDM1_0840"
FT   CDS_pept        900444..902948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpC"
FT                   /locus_tag="JDM1_0840"
FT                   /product="ATP-dependent Clp protease, ATP-binding subunit
FT                   ClpC"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0840"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61727"
FT                   /protein_id="ACT61727.1"
FT                   /translation="MDNLFTPSAKSVLVLAQEQAKYFKHQAVGTEHLLLALAIEKNGIA
FT                   NKVLQKYAVSEDDIREEIERFTGYGTLSNVGKDTYLPYSPKAKEILSVAGDEAKRLGAN
FT                   KIGTEHLLLAMLSDESILSSRILMNLNLDLGQTRKVVLRKLGVSDAMSKRKGNAANRGG
FT                   KKTEGTPTLDSLARDLTQLASEQEMDPVVGRSKEVKRVIQILSRRTKNNPVLIGEPGVG
FT                   KTAIAEGLAQKIVAGDVPTDMADKRLMMLDMGSLVAGTKYRGEFEDRLKKVIDEIYNDG
FT                   HVILFIDELHTLIGAGGAEGAIDASNILKPALARGELQTIGATTLNEYQKYIESDAALE
FT                   RRFATVMVNEPTEDEAVEILDGLRPRYEEHHRVTITDEAVDQAVKLSSRYISDRFLPDK
FT                   AIDLMDEAAAKVRIDQMDQPTKLSKNQDKLAQLREDKETAIEAQDFEQAADIRKQEMQL
FT                   KQRLDRIEADQDAEVTEGATPHYDLQVTGEDIAQVVAEWTGVPLTQLQKSESERLVNLE
FT                   KILHERVVGQPEAVSAVARAIRRARSGLKDPSRPIGSFMFLGPTGVGKTELAKALAAAM
FT                   FGSEDNMIRIDMSEYMERYSTSRLIGSAPGYVGYDEGGQLTEKVRQKPYSVVLFDEVEK
FT                   AHPDVFNILLQILDDGYLTDSKGRKVDFRNTILIMTSNLGATTLRDEKSVGFGATDKAN
FT                   DYNAVAATIRATLKQTFRPEFLNRIDETIVFHSLNKEELHEIVKLMSQEIVDRVAQQGI
FT                   KIKITPAAIDVVAKAGFDPEYGARPIRRALQTEIEDRLSEELLTGAIKVDDQVTIGASK
FT                   GTITINIKNQPKADGRSTVSSK"
FT   gene            903127..903729
FT                   /locus_tag="JDM1_0841"
FT   CDS_pept        903127..903729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0841"
FT                   /product="transcription regulator (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0841"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61728"
FT                   /protein_id="ACT61728.1"
FT                   /translation="MATRAEQMAKTHQAILDTARELFLRNGYDATSTRDIANAIGITQP
FT                   ALYHHFKDKEVIFLAVITTVGAEIKAGIEAIQVRADWSPLDQLTEVSLLLTHKHPADVF
FT                   TLIHSSFKALTHEHIRELGGIFVTDYVKPIQTVFEQPDMQLHVGVTPQMATNFYITSLS
FT                   PLFNSFHQIGDLHADERTRVQTLLKMILYGVASEPEN"
FT   gene            903976..907590
FT                   /gene="rpoB"
FT                   /locus_tag="JDM1_0842"
FT   CDS_pept        903976..907590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="JDM1_0842"
FT                   /product="DNA-directed RNA polymerase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0842"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61729"
FT                   /protein_id="ACT61729.1"
FT                   /translation="MNNLAGHLVKYGKHRTRRSYARIKEVLDLPNLIEIQTDSYQWFLD
FT                   EGLREMFEDIMPIDDFAGKLSLEFVDYQLLEPKYTVEEAREHDANYSAPLHVTLRLTNH
FT                   ETGEIKSQDVFFGDFPLMTEQGTFIINGAERVIVSQLVRSPGVYFNEELDKNGRPSYGT
FT                   TVIPNRGAWLELETDAKNVSYVRIDRTRKIPLTELVRALGYGSDDDVIDMLGETDSLML
FT                   TLEKDVHKNTDDSRVEESLKDIYERLRPGEPKTADSSRSLLTARFFDPKRYDFAPVGRY
FT                   KVNKKLSMKTRLMDQTLAETLADPDTGEVIAQKDTVIDKNVMAKLSPYLERDDFKTVTY
FT                   TPSDEAVVTNPMVLQVVKVYSQNDPEKVVNVIGNGNIDLKFKHIVPADIIASINYFFNL
FT                   QEGLGSTDDIDHLGNRRIRSVGELLQNQFRIGLSRMERVVRERMSIQDAATVTPQQLIN
FT                   IRPVVASIKEFFGSSQLSQFMDQTNPLGELTHKRRLSALGPGGLTRDRAGYEVRDVHYT
FT                   HYGRMCPIETPEGPNIGLINSLSSYAKVNRYGFIETPYRRVDWTTHKVTDKIDYLAADE
FT                   EDQFVIAQANSPLNDDGSFVEDTVLARNKEENLETPIENVDYMDVSPKQVVAVATACIP
FT                   FLENDDSNRALMGANMQRQAVPLLDPHAPLIGTGIEYKAAHDSGIALICRHEGTVEYVD
FT                   AREVRVRRDDGSLDTYKLMKFRRSNGGKNYNQRPIVKVGDHVDNDEVLADGPAMEGGEL
FT                   ALGQNPLVAFMTWNGYNFEDAIIINERLVREDVYTSIHIEEYESEARDTKLGPEEMTRE
FT                   IPNVGEDALKNLDEDGIIRIGAEVKDGDILVGKVTPKGVTELSAEERLLHAIFGEKARE
FT                   VRDTSLRVPHGGGGIIQDVKIFTRENGDELSPGVNMMVRVYIAQKRKIQVGDKMAGRHG
FT                   NKGTVSIVVPEEDMPYMPDGTPIDIMLSPMGVPSRMNIGQVLELHLGMAARKLGIHMAT
FT                   PVFDGAQDTDIWEAIREAGVDSDAKSIVYDGRTGEPFDKRVAVGVMHYMKLSHMVDDKI
FT                   HARSIGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTYKSDDVVGRV
FT                   KTYEAIVKGEPIPKPGVPESFRVLVKELQALGLDMKVLDSEDKEIELRDMDDDDDEVVN
FT                   VDALSKFKQQQDEKAADKAAKADAAKPSETTNAQQDNQ"
FT   gene            907608..911249
FT                   /gene="rpoC"
FT                   /locus_tag="JDM1_0843"
FT   CDS_pept        907608..911249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="JDM1_0843"
FT                   /product="DNA-directed RNA polymerase subunit beta'"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0843"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61730"
FT                   /protein_id="ACT61730.1"
FT                   /translation="MIDVNKFESMQIGLASPDKIRSWSYGEVKKPETINYRTLKPEKDG
FT                   LFDERIFGPTKDWECACGKYKRIRYKGIVCDRCGVEVTRSKVRRERMGHIELAAPVTHI
FT                   WYFKGIPSRMGLVLDMSPRALEEIIYFASYVVIESGNTPLEKKQLLSEREYREKKAQYG
FT                   NEFEAAMGAEAIKRLLNNVDLEKEARDLKETLKDASGQKRTRAVRRLDIIEAFVTSGNE
FT                   PAWMVMDAIPVIPPDLRPMVQLEGGRFATSDLNDLYRRVINRNNRLKRLLDLNAPGIIV
FT                   QNEKRMLQEAVDALIDNGRRGRPVAGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSG
FT                   RSVIDVGPFLKMNQMGLPRQMALELFKPFIMKELVKRELASNIKNAKRKIEHADDDVWG
FT                   VLEDVIKEHPVLLNRAPTLHRLGIQAFEPVLVSGKAMRLHPLACEAYNADFDGDQMAIH
FT                   VPLSDEAQAEARLLMLAAHHILAPKDGKPVVTPSQDMVIGNYYLTTEEIGREGEGMIFK
FT                   DLNEAQKAYQSGYVHLHSRVGIQVSSMPDKPFTDDQKQAVLVTTVGKAIFNNILPGKFP
FT                   YLNEPTNDNLIAGTPDKYFLKPGEDIHQFLDAQEIIPPFKKGFLADIIAEVYKQYHVTA
FT                   TSLLLDRMKDLGYNISTKSGLTVGVADITGLKEKPAIIAEAHKQVNTISKQFRRGLITD
FT                   DERYERVIGVWNDAKDQIQQKLIESFNADNPIFMMSDSGARGNISNFTQLAGMRGLMAA
FT                   PNGKIMELPILSNFREGLSVLEMFISTHGARKGMTDTALKTANSGYLTRRLVDVAQDVI
FT                   VREKDCGTDRGLRIHAIMEGNEVIEPLYDRILGRYTMKTVFDPETHDEIVGNNVLIDED
FT                   LAHKIVDAGVTEVTIRSAFTCNTKHGVCEHCYGRNMATGDEVEVGEAVGTVAAQSIGEP
FT                   GTQLTMRNFHTGGVAGDDITQGLPRVQEIVESRNPKGRAEISEVTGTVELIEENPAERT
FT                   KEVTVKGETDTRTYTLPLTARMAVSEGDFIHRGAALNIGSIDPKQLIQVRDVLSTENYL
FT                   LREVQKVYRMQGVEIGDKHVEIMIRQMLRKVRVMDPGDTDVLPGTLMDIADFKDENYKT
FT                   LIAGGIPATSRPVILGITKAALETNSFLSAASFQETTRVLTDAAIRGKNDPLIGLKENV
FT                   IIGKIIPAGTGMPVYRHIKPKEVGNVADGVYSISDLEKQMQEQDASK"
FT   gene            complement(911903..912583)
FT                   /locus_tag="JDM1_0844"
FT   CDS_pept        complement(911903..912583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0844"
FT                   /product="type 4 prepilin-like proteins leader peptide
FT                   processing enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0844"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61731"
FT                   /protein_id="ACT61731.1"
FT                   /translation="MLTSSLFIIGLCLGSFVTCMAERISNGHILISTQRSRCPHCRHQL
FT                   RFWQLIPLLGILLQRGQCYDCRTPISLRSSLIELLCGGLLVSSSASLSLTLPLLISYLV
FT                   LIFNSLTDYLTFEVYPLTLLLPAGLGLWQQRPPLTISLYLVLALLVGLYLLARLTATFG
FT                   LGDVDVLLMLVFIIPADTLLTCLAIAAVAALVGFIISAPRHRLPFVPFISWSFIMVTQL
FT                   TGLA"
FT   gene            912846..913259
FT                   /gene="rpsL"
FT                   /locus_tag="JDM1_0845"
FT   CDS_pept        912846..913259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="JDM1_0845"
FT                   /product="30S ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0845"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61732"
FT                   /protein_id="ACT61732.1"
FT                   /translation="MPTINQLIRKGRKSKVSKSNAPALNFGYNSYKKVATNNPAPQKRG
FT                   VATRVGTMTPKKPNSALRKYARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLP
FT                   GVRYHVIRGALDTAGVEDRRQSRSKYGTKKPKK"
FT   gene            913276..913746
FT                   /gene="rpsG"
FT                   /locus_tag="JDM1_0846"
FT   CDS_pept        913276..913746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="JDM1_0846"
FT                   /product="30S ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0846"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61733"
FT                   /protein_id="ACT61733.1"
FT                   /translation="MPRKGAPAKREVLADPMYNSKLVTRLINHLMLDGKRGTASTILYD
FT                   AFDQIKEQTGNDPLEVFEEAMKNVMPVLEVKARRVGGSNYQVPIEVRPDRKTTLGLRWI
FT                   VQYARSRGEHTMSDRLAREIMDAANNTGASVKKREDTHRMAEANRAFAHYRW"
FT   gene            913888..915984
FT                   /gene="fusA2"
FT                   /locus_tag="JDM1_0847"
FT   CDS_pept        913888..915984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA2"
FT                   /locus_tag="JDM1_0847"
FT                   /product="elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0847"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61734"
FT                   /protein_id="ACT61734.1"
FT                   /translation="MANTREFSLDKTRNIGIMAHIDAGKTTTTERILYYTGKIHKIGET
FT                   HDGASQMDWMAQEQERGITITSAATTAQWKNHRINIIDTPGHVDFTVEVERSLRVLDGA
FT                   IAVLDAQSGVEPQTETVWRQASTYNVPRIVFVNKMDKIGADFKYSVSTIHDRLQANAHA
FT                   IQLPIGAEDNFEGVIDLIEMKADLYDEDQLGTEWDTVDVPDEYKEEAQAARDDLIEALA
FT                   DIDDGIMEKYLGGEEISKEEIKAAIRKGTLALEFFPVLAGSAFKNKGVQMLMDAVVDYL
FT                   PSPLDVKPYKATDPETEEEVDLIAGDDKPFAALAFKVATDPFVGRLTFIRVYQGTLESG
FT                   SYVLNATKDKRERVGRLLQMHSNQRKEIPEVFSGDIAAAIGLKNTTTGDSLTSIDHPYH
FT                   LESMEFPDPVIQVAVEPKTKADQDKMNVALQKLSEEDPTFKAETNPETGETLIAGMGEL
FT                   HLDIIVDRMRREFNVEATVGAPQVSYRETFTKSTQVQGKFVHQSGGKGQYGDVWVEFTP
FT                   NEEGKGFEFEDAIVGGVVPREYIPSVEQGLKEAMANGVLAGYPLVDVKAKLYDGSYHDV
FT                   DSSEAAFKIAASLALRNAVKTAGPVILEPIMKVDIVAPEDYLGDVMGHVTARRGNIEGM
FT                   EERGNAQEVHAYVPLAEMFGYATTLRSATQGRGTFTMTFDHYEKVPKSVQEDIIKKNGG
FT                   TPAK"
FT   gene            complement(916797..916892)
FT                   /locus_tag="JDM1_0848"
FT   CDS_pept        complement(916797..916892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JDM1_0848"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0848"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61735"
FT                   /protein_id="ACT61735.1"
FT                   /translation="MKITATSHDNVAGRVATFHIKANYDYLMMGI"
FT   gene            916936..917244
FT                   /gene="rpsJ"
FT                   /locus_tag="JDM1_0849"
FT   CDS_pept        916936..917244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="JDM1_0849"
FT                   /product="30S ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0849"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61736"
FT                   /protein_id="ACT61736.1"
FT                   /translation="MAKQKIRIRLKAYEHRILDQSADKIVETAKRTGATISGPIPLPTE
FT                   RTIYTVLRSPHKFKDSREQFEMRTHKRLIDIVNPTPKTVDSLMKLDLPSGVDIEIKL"
FT   gene            917282..917911
FT                   /gene="rplC"
FT                   /locus_tag="JDM1_0850"
FT   CDS_pept        917282..917911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="JDM1_0850"
FT                   /product="50S ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0850"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61737"
FT                   /protein_id="ACT61737.1"
FT                   /translation="MTTKGILGQKVGMTQVFTESGELVPVTVVEVQPNVVLQVKTVEND
FT                   GYEAIQLGVDDKREVLTNKPAQGHAAKAKTTPKRFIREIRNVELGDYTVGDEVKADIFA
FT                   AGDAVDVTGITKGHGYQGNIHKDGQSRGPMAHGSRYHRRPGSMGAIINRVFKGKKLPGR
FT                   MGNHQRTMQNLQIVRADVENNVLLIKGNVPGANKSFVTVKTSVKSK"
FT   gene            917930..918553
FT                   /gene="rplD"
FT                   /locus_tag="JDM1_0851"
FT   CDS_pept        917930..918553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="JDM1_0851"
FT                   /product="50S ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0851"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61738"
FT                   /protein_id="ACT61738.1"
FT                   /translation="MTSVALFKQDGTQNGDVTLNDAVFGVEPNENVVFDAILMQRASMR
FT                   QGTHAVKNRSARRGGGRKPWRQKGTGRARQGSIRSPQWRKGGIVFGPTPRSYSYKLPKK
FT                   VMRLALKSVLSQKVLDNSLVAVDSLAFDAPKTKDFVNVLNNLNVDTKTLVLVEEDNEKA
FT                   ALAGRNLPNVKILKAKGVNVLDVANSDKLVVTQKALDQLEEALA"
FT   gene            918553..918846
FT                   /gene="rplW"
FT                   /locus_tag="JDM1_0852"
FT   CDS_pept        918553..918846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="JDM1_0852"
FT                   /product="50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0852"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61739"
FT                   /protein_id="ACT61739.1"
FT                   /translation="MEARDVILRPVVTESSMADLDDKRYTFDVNVQATKTQVKKAIEEI
FT                   FDVKVVKVNVMNVKGKLKRQGRYAGYTKKRRKAIVTLSSDSNEIKLFNDDQQ"
FT   gene            918870..919709
FT                   /gene="rplB"
FT                   /locus_tag="JDM1_0853"
FT   CDS_pept        918870..919709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="JDM1_0853"
FT                   /product="50S ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0853"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61740"
FT                   /protein_id="ACT61740.1"
FT                   /translation="MGIKKYKPTTNGRRNMTASDFSEITKTKPEKSLLDSQSHTAGRNS
FT                   YGHITVRHRGGGHKQQYRLVDFKRIKDEVPATVKAIEYDPNRTANIALLVYADGVKSYI
FT                   LAPKGLEVGMQVQSGAEADIKVGNALPLTNIPVGTVIHNIELKPGKGGQLARSAGTSAQ
FT                   LLGKEGKYAIVRLSSGEVRLVLLTSRATIGTVGNEQHELINSGKAGRTRWQGKRPTVRG
FT                   SVMNPNDHPHGGGEGKAPIGHPSPMSPWGKKTLGKKTRNKKARSNKLIVRGRRPGKH"
FT   gene            919752..920027
FT                   /gene="rpsS"
FT                   /locus_tag="JDM1_0854"
FT   CDS_pept        919752..920027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="JDM1_0854"
FT                   /product="30S ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0854"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61741"
FT                   /protein_id="ACT61741.1"
FT                   /translation="MGRSLKKGPFADAHLLKKIDAQSDSDKKSVIKTWSRRSTIFPSFI
FT                   GYTIAVYDGRKHVPVYIQDDMVGHKLGEFVPTRTFHGHGTDDKKTK"
FT   gene            920048..920395
FT                   /gene="rplV"
FT                   /locus_tag="JDM1_0855"
FT   CDS_pept        920048..920395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="JDM1_0855"
FT                   /product="50S ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0855"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61742"
FT                   /protein_id="ACT61742.1"
FT                   /translation="MAEQVTSARATAKTVRIAARKVRLVVDLIRGKSVAEALAILKFTP
FT                   RGASPVVEKVLLSAVANAENNFDLDREDLVVSEAFVNEGPTLKRFRPRAKGSASPINKR
FT                   TSHITITVTEK"
FT   gene            920408..921061
FT                   /gene="rpsC"
FT                   /locus_tag="JDM1_0856"
FT   CDS_pept        920408..921061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="JDM1_0856"
FT                   /product="30S ribosomal protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0856"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61743"
FT                   /protein_id="ACT61743.1"
FT                   /translation="MGQKVNPTGLRVGIIRDWEAKWYAEKDFAAYLNEDLRIRKYIEQR
FT                   LADASVSTVEIERAANRVNISIHTAKPGMVIGKGGSEVEALRKELNNLTSKRVHINIIE
FT                   IKKPDLDAKLVGESIARQLEGRVAFRRAMRGAMQRTMRSGAKGIKTQVAGRLNGADMSR
FT                   VEAYSDGTVPLHTLRADIDYSWVEARTTYGKLGVKTWIYRGEILPEKKSAKGGN"
FT   gene            921064..921498
FT                   /gene="rplP"
FT                   /locus_tag="JDM1_0857"
FT   CDS_pept        921064..921498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="JDM1_0857"
FT                   /product="50S ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0857"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61744"
FT                   /protein_id="ACT61744.1"
FT                   /translation="MLVPKRVKYRRVHRGKMRGEAKGGKTVAFGDYGLQTLESHWISNR
FT                   QIEAARVAMNRYMKRGGKVWIKIFPHKSYTEKGVGVRMGNGKGTPAGWVAPVKRNKIMF
FT                   EVAGVPEEVAREALRLAGTKLPVKTKIVKREEVGGESDEG"
FT   gene            921488..921682
FT                   /gene="rpmC"
FT                   /locus_tag="JDM1_0858"
FT   CDS_pept        921488..921682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="JDM1_0858"
FT                   /product="50S ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0858"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61745"
FT                   /protein_id="ACT61745.1"
FT                   /translation="MKAKEIKALSTTEMLEKEKSYKDELFNLRFQLATGQLENTARLKQ
FT                   VRKNIARIKTALREQELNK"
FT   gene            921705..921974
FT                   /gene="rpsQ"
FT                   /locus_tag="JDM1_0859"
FT   CDS_pept        921705..921974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="JDM1_0859"
FT                   /product="30S ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0859"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61746"
FT                   /protein_id="ACT61746.1"
FT                   /translation="MSEDTRNSRKVIQGRVVSDKMDKTIVVIVETYKNHPVYGKRVRYS
FT                   KKFKAHDEKNEAKTGDIVKIMETRPLSATKRFRLIEVVQKAVII"
FT   gene            922017..922385
FT                   /gene="rplN"
FT                   /locus_tag="JDM1_0860"
FT   CDS_pept        922017..922385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="JDM1_0860"
FT                   /product="ribosomal protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0860"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61747"
FT                   /protein_id="ACT61747.1"
FT                   /translation="MIQQESRLKVADNSGAREILTIKVLGGSGRKTANIGDVIVATVKQ
FT                   ATPGGVVKAHDVVKAVIVRTKSGVHRADGSYIKFDENAAVIIRDDKTPQGTRIFGPVAR
FT                   ELRDKDFMRIVSLAPEVL"
FT   gene            922419..922730
FT                   /gene="rplX"
FT                   /locus_tag="JDM1_0861"
FT   CDS_pept        922419..922730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="JDM1_0861"
FT                   /product="ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0861"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61748"
FT                   /protein_id="ACT61748.1"
FT                   /translation="MLIKTGDKVRVISGKDRGQEGTVKKVISAKNRIVVEGVNKIKKHQ
FT                   KPTNVNPQGGIVDIEAPIDASNVMYLDPSTNEPTRLGVRREDGKRVRYAKKSGKDLEN"
FT   gene            922759..923301
FT                   /gene="rplE"
FT                   /locus_tag="JDM1_0862"
FT   CDS_pept        922759..923301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="JDM1_0862"
FT                   /product="50S ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:JDM1_0862"
FT                   /db_xref="EnsemblGenomes-Tr:ACT61749"
FT                   /protein_id="ACT61749.1"
FT                   /translation="MENRLKAQYEKEIVPALVDKFNYTSVMQVPKLAKIVLNMGVGDAV
FT                   TNAKNLDEAVEELTLISGQKPLVTRAKKSIAGFRLREGMAIGAKVDLRGERMYDFLDKL
FT                   INVSLPRVRDFHGVSTRSFDGRGNYTLGVREQLIFPEINYDNVNRVRGLDIVIVTTADS
FT                   DEESRELLTQFGMPFAK"
FT   gene            923322..923507
FT                   /gene="rpsN"
FT                   /locus_tag="JDM1_0863"
FT   CDS_