(data stored in ACNUC1104 zone)

EMBL: CP001618

ID   CP001618; SV 1; circular; genomic DNA; STD; PRO; 4669183 BP.
XX
AC   CP001618; ABTE01000000-ABTE01000035;
XX
PR   Project:PRJNA20827;
XX
DT   03-JUN-2009 (Rel. 101, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Beutenbergia cavernae DSM 12333, complete genome.
XX
KW   .
XX
OS   Beutenbergia cavernae DSM 12333
OC   Bacteria; Actinobacteria; Micrococcales; Beutenbergiaceae; Beutenbergia.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-4669183
RX   PUBMED; 21304633.
RA   Land M., Pukall R., Abt B., Goker M., Rohde M., Glavina Del Rio T.,
RA   Tice H., Copeland A., Cheng J.F., Lucas S., Chen F., Nolan M., Bruce D.,
RA   Goodwin L., Pitluck S., Ivanova N., Mavromatis K., Ovchinnikova G.,
RA   Pati A., Chen A., Palaniappan K., Hauser L., Chang Y.J., Jefferies C.C.,
RA   Saunders E., Brettin T., Detter J.C., Han C., Chain P., Bristow J.,
RA   Eisen J.A., Markowitz V., Hugenholtz P., Kyrpides N.C., Klenk H.P.,
RA   Lapidus A.;
RT   "Complete genome sequence of Beutenbergia cavernae type strain (HKI 0122)";
RL   Stand Genomic Sci 1(1):21-28(2009).
XX
RN   [2]
RP   1-4669183
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K.,
RA   Ovchinnikova G., Saunders E., Brettin T., Detter J.C., Han C., Larimer F.,
RA   Land M., Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T.,
RA   Wu D., Pukall R., Klenk H.-P., Eisen J.A.;
RT   "The draft genome of Beutenbergia cavernae DSM 12333";
RL   Unpublished.
XX
RN   [3]
RP   1-4669183
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K.,
RA   Ovchinnikova G., Saunders E., Brettin T., Detter J.C., Han C., Larimer F.,
RA   Land M., Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T.,
RA   Wu D., Pukall R., Klenk H.-P., Eisen J.A.;
RT   ;
RL   Submitted (04-MAY-2009) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 71930ce18d8316fa8d395a6279bd3848.
DR   BioSample; SAMN02598436.
DR   CABRI; DSM 12333.
DR   EnsemblGenomes-Gn; Bcav_R0001.
DR   EnsemblGenomes-Gn; Bcav_R0002.
DR   EnsemblGenomes-Gn; Bcav_R0003.
DR   EnsemblGenomes-Gn; Bcav_R0004.
DR   EnsemblGenomes-Gn; Bcav_R0005.
DR   EnsemblGenomes-Gn; Bcav_R0006.
DR   EnsemblGenomes-Gn; Bcav_R0007.
DR   EnsemblGenomes-Gn; Bcav_R0008.
DR   EnsemblGenomes-Gn; Bcav_R0010.
DR   EnsemblGenomes-Gn; Bcav_R0011.
DR   EnsemblGenomes-Gn; Bcav_R0012.
DR   EnsemblGenomes-Gn; Bcav_R0013.
DR   EnsemblGenomes-Gn; Bcav_R0014.
DR   EnsemblGenomes-Gn; Bcav_R0015.
DR   EnsemblGenomes-Gn; Bcav_R0016.
DR   EnsemblGenomes-Gn; Bcav_R0017.
DR   EnsemblGenomes-Gn; Bcav_R0018.
DR   EnsemblGenomes-Gn; Bcav_R0019.
DR   EnsemblGenomes-Gn; Bcav_R0020.
DR   EnsemblGenomes-Gn; Bcav_R0021.
DR   EnsemblGenomes-Gn; Bcav_R0022.
DR   EnsemblGenomes-Gn; Bcav_R0023.
DR   EnsemblGenomes-Gn; Bcav_R0024.
DR   EnsemblGenomes-Gn; Bcav_R0025.
DR   EnsemblGenomes-Gn; Bcav_R0026.
DR   EnsemblGenomes-Gn; Bcav_R0027.
DR   EnsemblGenomes-Gn; Bcav_R0029.
DR   EnsemblGenomes-Gn; Bcav_R0030.
DR   EnsemblGenomes-Gn; Bcav_R0031.
DR   EnsemblGenomes-Gn; Bcav_R0032.
DR   EnsemblGenomes-Gn; Bcav_R0033.
DR   EnsemblGenomes-Gn; Bcav_R0034.
DR   EnsemblGenomes-Gn; Bcav_R0035.
DR   EnsemblGenomes-Gn; Bcav_R0036.
DR   EnsemblGenomes-Gn; Bcav_R0037.
DR   EnsemblGenomes-Gn; Bcav_R0038.
DR   EnsemblGenomes-Gn; Bcav_R0039.
DR   EnsemblGenomes-Gn; Bcav_R0040.
DR   EnsemblGenomes-Gn; Bcav_R0041.
DR   EnsemblGenomes-Gn; Bcav_R0042.
DR   EnsemblGenomes-Gn; Bcav_R0043.
DR   EnsemblGenomes-Gn; Bcav_R0044.
DR   EnsemblGenomes-Gn; Bcav_R0045.
DR   EnsemblGenomes-Gn; Bcav_R0047.
DR   EnsemblGenomes-Gn; Bcav_R0048.
DR   EnsemblGenomes-Gn; Bcav_R0049.
DR   EnsemblGenomes-Gn; Bcav_R0050.
DR   EnsemblGenomes-Gn; Bcav_R0051.
DR   EnsemblGenomes-Gn; Bcav_R0052.
DR   EnsemblGenomes-Gn; Bcav_R0053.
DR   EnsemblGenomes-Gn; Bcav_R0054.
DR   EnsemblGenomes-Gn; Bcav_R0055.
DR   EnsemblGenomes-Gn; Bcav_R0056.
DR   EnsemblGenomes-Gn; EBG00001231862.
DR   EnsemblGenomes-Gn; EBG00001231863.
DR   EnsemblGenomes-Gn; EBG00001231864.
DR   EnsemblGenomes-Gn; EBG00001231865.
DR   EnsemblGenomes-Gn; EBG00001231866.
DR   EnsemblGenomes-Gn; EBG00001231867.
DR   EnsemblGenomes-Gn; EBG00001231868.
DR   EnsemblGenomes-Gn; EBG00001231869.
DR   EnsemblGenomes-Gn; EBG00001231870.
DR   EnsemblGenomes-Gn; EBG00001231871.
DR   EnsemblGenomes-Gn; EBG00001231872.
DR   EnsemblGenomes-Gn; EBG00001231873.
DR   EnsemblGenomes-Gn; EBG00001231874.
DR   EnsemblGenomes-Gn; EBG00001231875.
DR   EnsemblGenomes-Gn; EBG00001231876.
DR   EnsemblGenomes-Gn; EBG00001231877.
DR   EnsemblGenomes-Gn; EBG00001231878.
DR   EnsemblGenomes-Gn; EBG00001231879.
DR   EnsemblGenomes-Gn; EBG00001231880.
DR   EnsemblGenomes-Gn; EBG00001231881.
DR   EnsemblGenomes-Gn; EBG00001231882.
DR   EnsemblGenomes-Gn; EBG00001231883.
DR   EnsemblGenomes-Gn; EBG00001231884.
DR   EnsemblGenomes-Gn; EBG00001231885.
DR   EnsemblGenomes-Gn; EBG00001231886.
DR   EnsemblGenomes-Gn; EBG00001231887.
DR   EnsemblGenomes-Gn; EBG00001231888.
DR   EnsemblGenomes-Gn; EBG00001231889.
DR   EnsemblGenomes-Gn; EBG00001231890.
DR   EnsemblGenomes-Gn; EBG00001231891.
DR   EnsemblGenomes-Gn; EBG00001231892.
DR   EnsemblGenomes-Gn; EBG00001231893.
DR   EnsemblGenomes-Gn; EBG00001231894.
DR   EnsemblGenomes-Gn; EBG00001231895.
DR   EnsemblGenomes-Gn; EBG00001231896.
DR   EnsemblGenomes-Gn; EBG00001231897.
DR   EnsemblGenomes-Gn; EBG00001231898.
DR   EnsemblGenomes-Gn; EBG00001231899.
DR   EnsemblGenomes-Gn; EBG00001231900.
DR   EnsemblGenomes-Gn; EBG00001231901.
DR   EnsemblGenomes-Gn; EBG00001231902.
DR   EnsemblGenomes-Gn; EBG00001231903.
DR   EnsemblGenomes-Gn; EBG00001231904.
DR   EnsemblGenomes-Gn; EBG00001231905.
DR   EnsemblGenomes-Gn; EBG00001231906.
DR   EnsemblGenomes-Gn; EBG00001231907.
DR   EnsemblGenomes-Gn; EBG00001231908.
DR   EnsemblGenomes-Gn; EBG00001231909.
DR   EnsemblGenomes-Gn; EBG00001231910.
DR   EnsemblGenomes-Gn; EBG00001231911.
DR   EnsemblGenomes-Gn; EBG00001231912.
DR   EnsemblGenomes-Gn; EBG00001231913.
DR   EnsemblGenomes-Gn; EBG00001231914.
DR   EnsemblGenomes-Gn; EBG00001231915.
DR   EnsemblGenomes-Gn; EBG00001231916.
DR   EnsemblGenomes-Gn; EBG00001231917.
DR   EnsemblGenomes-Gn; EBG00001231918.
DR   EnsemblGenomes-Gn; EBG00001231919.
DR   EnsemblGenomes-Gn; EBG00001231920.
DR   EnsemblGenomes-Tr; Bcav_R0001-1.
DR   EnsemblGenomes-Tr; Bcav_R0002-1.
DR   EnsemblGenomes-Tr; Bcav_R0003-1.
DR   EnsemblGenomes-Tr; Bcav_R0004-1.
DR   EnsemblGenomes-Tr; Bcav_R0005-1.
DR   EnsemblGenomes-Tr; Bcav_R0006-1.
DR   EnsemblGenomes-Tr; Bcav_R0007-1.
DR   EnsemblGenomes-Tr; Bcav_R0008-1.
DR   EnsemblGenomes-Tr; Bcav_R0010-1.
DR   EnsemblGenomes-Tr; Bcav_R0011-1.
DR   EnsemblGenomes-Tr; Bcav_R0012-1.
DR   EnsemblGenomes-Tr; Bcav_R0013-1.
DR   EnsemblGenomes-Tr; Bcav_R0014-1.
DR   EnsemblGenomes-Tr; Bcav_R0015-1.
DR   EnsemblGenomes-Tr; Bcav_R0016-1.
DR   EnsemblGenomes-Tr; Bcav_R0017-1.
DR   EnsemblGenomes-Tr; Bcav_R0018-1.
DR   EnsemblGenomes-Tr; Bcav_R0019-1.
DR   EnsemblGenomes-Tr; Bcav_R0020-1.
DR   EnsemblGenomes-Tr; Bcav_R0021-1.
DR   EnsemblGenomes-Tr; Bcav_R0022-1.
DR   EnsemblGenomes-Tr; Bcav_R0023-1.
DR   EnsemblGenomes-Tr; Bcav_R0024-1.
DR   EnsemblGenomes-Tr; Bcav_R0025-1.
DR   EnsemblGenomes-Tr; Bcav_R0026-1.
DR   EnsemblGenomes-Tr; Bcav_R0027-1.
DR   EnsemblGenomes-Tr; Bcav_R0029-1.
DR   EnsemblGenomes-Tr; Bcav_R0030-1.
DR   EnsemblGenomes-Tr; Bcav_R0031-1.
DR   EnsemblGenomes-Tr; Bcav_R0032-1.
DR   EnsemblGenomes-Tr; Bcav_R0033-1.
DR   EnsemblGenomes-Tr; Bcav_R0034-1.
DR   EnsemblGenomes-Tr; Bcav_R0035-1.
DR   EnsemblGenomes-Tr; Bcav_R0036-1.
DR   EnsemblGenomes-Tr; Bcav_R0037-1.
DR   EnsemblGenomes-Tr; Bcav_R0038-1.
DR   EnsemblGenomes-Tr; Bcav_R0039-1.
DR   EnsemblGenomes-Tr; Bcav_R0040-1.
DR   EnsemblGenomes-Tr; Bcav_R0041-1.
DR   EnsemblGenomes-Tr; Bcav_R0042-1.
DR   EnsemblGenomes-Tr; Bcav_R0043-1.
DR   EnsemblGenomes-Tr; Bcav_R0044-1.
DR   EnsemblGenomes-Tr; Bcav_R0045-1.
DR   EnsemblGenomes-Tr; Bcav_R0047-1.
DR   EnsemblGenomes-Tr; Bcav_R0048-1.
DR   EnsemblGenomes-Tr; Bcav_R0049-1.
DR   EnsemblGenomes-Tr; Bcav_R0050-1.
DR   EnsemblGenomes-Tr; Bcav_R0051-1.
DR   EnsemblGenomes-Tr; Bcav_R0052-1.
DR   EnsemblGenomes-Tr; Bcav_R0053-1.
DR   EnsemblGenomes-Tr; Bcav_R0054-1.
DR   EnsemblGenomes-Tr; Bcav_R0055-1.
DR   EnsemblGenomes-Tr; Bcav_R0056-1.
DR   EnsemblGenomes-Tr; EBT00001577274.
DR   EnsemblGenomes-Tr; EBT00001577275.
DR   EnsemblGenomes-Tr; EBT00001577276.
DR   EnsemblGenomes-Tr; EBT00001577277.
DR   EnsemblGenomes-Tr; EBT00001577278.
DR   EnsemblGenomes-Tr; EBT00001577279.
DR   EnsemblGenomes-Tr; EBT00001577280.
DR   EnsemblGenomes-Tr; EBT00001577281.
DR   EnsemblGenomes-Tr; EBT00001577282.
DR   EnsemblGenomes-Tr; EBT00001577283.
DR   EnsemblGenomes-Tr; EBT00001577284.
DR   EnsemblGenomes-Tr; EBT00001577285.
DR   EnsemblGenomes-Tr; EBT00001577286.
DR   EnsemblGenomes-Tr; EBT00001577287.
DR   EnsemblGenomes-Tr; EBT00001577288.
DR   EnsemblGenomes-Tr; EBT00001577289.
DR   EnsemblGenomes-Tr; EBT00001577290.
DR   EnsemblGenomes-Tr; EBT00001577291.
DR   EnsemblGenomes-Tr; EBT00001577292.
DR   EnsemblGenomes-Tr; EBT00001577293.
DR   EnsemblGenomes-Tr; EBT00001577294.
DR   EnsemblGenomes-Tr; EBT00001577295.
DR   EnsemblGenomes-Tr; EBT00001577296.
DR   EnsemblGenomes-Tr; EBT00001577297.
DR   EnsemblGenomes-Tr; EBT00001577298.
DR   EnsemblGenomes-Tr; EBT00001577299.
DR   EnsemblGenomes-Tr; EBT00001577300.
DR   EnsemblGenomes-Tr; EBT00001577301.
DR   EnsemblGenomes-Tr; EBT00001577302.
DR   EnsemblGenomes-Tr; EBT00001577303.
DR   EnsemblGenomes-Tr; EBT00001577304.
DR   EnsemblGenomes-Tr; EBT00001577305.
DR   EnsemblGenomes-Tr; EBT00001577306.
DR   EnsemblGenomes-Tr; EBT00001577307.
DR   EnsemblGenomes-Tr; EBT00001577308.
DR   EnsemblGenomes-Tr; EBT00001577309.
DR   EnsemblGenomes-Tr; EBT00001577310.
DR   EnsemblGenomes-Tr; EBT00001577311.
DR   EnsemblGenomes-Tr; EBT00001577312.
DR   EnsemblGenomes-Tr; EBT00001577313.
DR   EnsemblGenomes-Tr; EBT00001577314.
DR   EnsemblGenomes-Tr; EBT00001577315.
DR   EnsemblGenomes-Tr; EBT00001577316.
DR   EnsemblGenomes-Tr; EBT00001577317.
DR   EnsemblGenomes-Tr; EBT00001577318.
DR   EnsemblGenomes-Tr; EBT00001577319.
DR   EnsemblGenomes-Tr; EBT00001577320.
DR   EnsemblGenomes-Tr; EBT00001577321.
DR   EnsemblGenomes-Tr; EBT00001577322.
DR   EnsemblGenomes-Tr; EBT00001577323.
DR   EnsemblGenomes-Tr; EBT00001577324.
DR   EnsemblGenomes-Tr; EBT00001577325.
DR   EnsemblGenomes-Tr; EBT00001577326.
DR   EnsemblGenomes-Tr; EBT00001577327.
DR   EnsemblGenomes-Tr; EBT00001577328.
DR   EnsemblGenomes-Tr; EBT00001577329.
DR   EnsemblGenomes-Tr; EBT00001577330.
DR   EnsemblGenomes-Tr; EBT00001577331.
DR   EnsemblGenomes-Tr; EBT00001577332.
DR   EuropePMC; PMC3035217; 21304633.
DR   EuropePMC; PMC3073058; 20033048.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00634; SAM-IV.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01688; Actino-pnp.
DR   RFAM; RF01747; msiK.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001618.
DR   SILVA-SSU; CP001618.
DR   StrainInfo; 118815; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4082741
CC   Source DNA and organism available from Hans-Peter Klenk at the
CC   German Collection of Microorganisms and Cell Cultures (DSMZ)
CC   (hans-peter.klenk@dsmz.de)
CC   Contacts: Jonathan A. Eisen (jaeisen@ucdavis.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-LANL
CC   Annotation by JGI-ORNL and JGI-PGF
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Beutenbergia cavernae HKI 0122, DSM 12333
CC   Culture Collection ID :: DSM 12333, ATCC BAA-8, IFO 16432, NBRC
CC                            16432
CC   GOLD Stamp ID         :: Gi02225
CC   Greengenes ID         :: 26352
CC   Funding Program       :: DOE-GEBA 2007
CC   Isolation Site        :: "Cave soil in Guangxi, China"
CC   Isolation Country     :: China
CC   Oxygen Requirement    :: Aerobe
CC   Cell Shape            :: Rod-shaped
CC   Motility              :: Nonmotile
CC   Sporulation           :: Nonsporulating
CC   Temperature Range     :: Mesophile
CC   Temperature Optimum   :: 28 C
CC   Biotic Relationship   :: Free living
CC   Diseases              :: None
CC   Habitat               :: Soil
CC   Phenotypes            :: L-Lysine containing
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4669183
FT                   /organism="Beutenbergia cavernae DSM 12333"
FT                   /strain="DSM 12333"
FT                   /mol_type="genomic DNA"
FT                   /note="type strain of Beutenbergia cavernae"
FT                   /db_xref="taxon:471853"
FT   gene            322..1791
FT                   /locus_tag="Bcav_0001"
FT   CDS_pept        322..1791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="PFAM: Bacterial dnaA protein helix-turn-helix
FT                   domain; Bacterial dnaA protein; TIGRFAM: chromosomal
FT                   replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78267"
FT                   /db_xref="GOA:C5BUP3"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUP3"
FT                   /protein_id="ACQ78267.1"
FT                   /translation="MAAADSSNGDVPGEDSLEGNWARTVTVLGESGSLGAPQLAFVRLT
FT                   RPLGLIDETLLLAVPSDFAKEFLETRAREQIMRALAASFGRTLRFAVTVDPSLQDAVPA
FT                   ESSAEEMRDAEAAAPEPIERSARAQQRADALASQARTAGSDGARLNATYTFDTFVIGSS
FT                   NRFAHAAATAVAEAPAKAYNPLFIYGDSGLGKTHLLHAIGHYAQRLYPGIAVRYVNSEE
FT                   FTNDFINSIRDDKAEAFQRRYRSVEVLLVDDIQFLQGKEQTMEEFFHTFNTLHNANKQV
FT                   VITSDVAPKYLEGFADRMRSRFEWGLITDIQPPDLETRIAILRKKAGSERLSAPDDVLE
FT                   YIASRISTNIRELEGALIRVTAFANLNEQQVDLALAEMVLKDLITDDDTTEITPAVIMA
FT                   QTANYFGVSIDALCSADRTRVLVNARQIAMYLCRELTDLSLPKIGQIFGGRDHTTVMHA
FT                   NRKIRELMAKQRSTFNQVTELTNRIKQQNRA"
FT   gene            2331..3467
FT                   /locus_tag="Bcav_0002"
FT   CDS_pept        2331..3467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="PFAM: DNA polymerase III beta subunit, N-terminal
FT                   domain; DNA polymerase III beta subunit, C-terminal domain;
FT                   DNA polymerase III beta subunit, central domain; TIGRFAM:
FT                   DNA polymerase III, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78268"
FT                   /db_xref="GOA:C5BUP4"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUP4"
FT                   /protein_id="ACQ78268.1"
FT                   /translation="MKFRVDRDVLADAVTWTARTLPTRPSIPVLAGVRIEADPQGALRL
FT                   SSFDYEVSALSEIAADVPDAGTVLVSGRLLAEISRALPGKPVDVELDGTRVVLTCGSSR
FT                   FTLLTMPLDDYPSLPAMPPASGTVDAGTLAEAVAQVTIAASRDETLPLLTGVRVEIEGD
FT                   KLTLLATDRYRLAMRELSWNPASPGLEATALVRARTLSEVAKSLTSAGAVSISLPNGDG
FT                   KDLVGFEAGGRRTTSLLVEGDYPPVRRLFPEATTSHAVASTNELVEAARRVSLVAERNT
FT                   PIRLTFSEGQVVLEAGQGDDAQASEAIESTLTGEPITTAFNPGYLLDGLGVVGTEFTRL
FT                   SFTHGTKPAVLTGQPKLEDDDADRDVFRYLIQPIRFAS"
FT   gene            3525..4418
FT                   /locus_tag="Bcav_0003"
FT   CDS_pept        3525..4418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0003"
FT                   /product="6-phosphogluconate dehydrogenase,
FT                   decarboxylating"
FT                   /note="PFAM: NAD binding domain of 6-phosphogluconate
FT                   dehydrogenase; 6-phosphogluconate dehydrogenase, C-terminal
FT                   domain; TIGRFAM: 6-phosphogluconate dehydrogenase
FT                   (decarboxylating)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78269"
FT                   /db_xref="GOA:C5BUP5"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUP5"
FT                   /protein_id="ACQ78269.1"
FT                   /translation="MHIGLVGIGRMGANMQERLREHGHEVTGYDQDPGVSDVASLEQLV
FT                   AALPAPRVVWVMVPAGEITHAVIGDLRGLLAAGDLVIDGGNSNFREDKVHADDLAGHGI
FT                   RYLDVGVSGGVWGRENGYGLMVGGAPDDVAEVMPVFDALRPEGDRDEGFVHVGPVGAGH
FT                   YAKMVHNGIEYGLMQSYAEGYEILAARDDLVADVGGVFKAWQRGTVVRSWLLELMVRAL
FT                   EQDPDLEQISGWTADSGEGRWTVQEAVEHAVPAPVISAALFARFASRQEDSPAMKAVAA
FT                   LRQQFGGHATKPAADG"
FT   gene            4429..5622
FT                   /locus_tag="Bcav_0004"
FT   CDS_pept        4429..5622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="PFAM: RecF/RecN/SMC N terminal domain; TIGRFAM: recF
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78270"
FT                   /db_xref="GOA:C5BUP6"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BUP6"
FT                   /protein_id="ACQ78270.1"
FT                   /translation="MYVSDLALTDFRSYADLVIGLEPGITAFVGPNGQGKTNLVEAIGY
FT                   LGTFSSHRVSGDAALVRWGAERAVVRAKVVRRARPTLVELEIVAGRANRARVDRSPVSR
FT                   VREAAGIARSVIFAPEDLALVKGDPDGRRRFLDDLLVQLSPRLAGVRSEYERVLRQRTA
FT                   LLKSAGPARRRSGDGEPAALRTLDVWDGHLARAGAELVAARVRLVQDLRPHVGATYEQV
FT                   SAAQSEARISYRASVEEARPDDAPTEVVESVETELTRADLVEARLLEAMARLRTREIER
FT                   GVSLVGPHRDDLVLTLADMPAKGYASHGESWSYALALRLASYALLRDDGEAGGGGEPVL
FT                   VLDDVFAELDARRRTRLASIVASAEQVLVTAAVAEDVPEELEGARMDVMGGEVLRVR"
FT   gene            5612..6133
FT                   /locus_tag="Bcav_0005"
FT   CDS_pept        5612..6133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0005"
FT                   /product="protein of unknown function DUF721"
FT                   /note="PFAM: Protein of unknown function (DUF721)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78271"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUP7"
FT                   /protein_id="ACQ78271.1"
FT                   /translation="MSGEGEDAAPDDGVEAAAAALGRARRAAEERGIRPGTRPRPRRGG
FT                   ASLPGATSRDARDPELVASTLGRVLAERGWTASLSVGSVVGRWREVVGDQIADHCAPET
FT                   FDGGRLVVRTTSTAWATQLKLLLPQLERRLAAEVGEGVVEEITVLGPGGPSWRRGPRSV
FT                   PGRGPRDTYG"
FT   gene            6462..8519
FT                   /locus_tag="Bcav_0006"
FT   CDS_pept        6462..8519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0006"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="PFAM: Toprim domain; Histidine kinase-, DNA gyrase
FT                   B-, and HSP90-like ATPase; DNA gyrase B subunit, carboxyl
FT                   terminus; DNA gyrase B; TIGRFAM: DNA gyrase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78272"
FT                   /db_xref="GOA:C5BUP8"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUP8"
FT                   /protein_id="ACQ78272.1"
FT                   /translation="MADTHETVEDTIDTTNGSASGYDASNITVLEGLEAVRKRPGMYIG
FT                   STGERGLHHLVSEVVDNSVDEALAGYATRIDVTLTEDGGVRVVDDGRGIPVDIVESEGK
FT                   PAVEVVLTVLHAGGKFGGGGYAVSGGLHGVGVSVVNALSHRLEVEVRVQGSVWRQSYTD
FT                   GVPDAPLERGEATDVTGTTVTFWPNGDIFETTVFDFETLRGRFQQYAFLNKGLEISLTD
FT                   ERRESGTGDEVAGEHADEETSVQLRDESHERTVTYRYDDGLVDYVRHINAAKRADLVHP
FT                   EIIDFEAEDVERTISLEIAMQWTSAYSESVHTYANTINTSEGGTHEEGFRAALTTLVNR
FT                   YAREKNLLKEKDDNLTGEDVREGLTAVLSIKLGEPQFEGQTKTKLGNTEARTFTQKVVF
FT                   DQLGDWLASHPNEAREIVRKAIQASAARMAARKAREATRRKGLLEGVGMPGKLKDCSSR
FT                   DASVSEVFIVEGDSAGGSAVQGRNPETQAILPIRGKILNVEKARLDKALGNQEVQALIT
FT                   AFGTGIGEDFDLSKLRYHKIVLMADADVDGQHICTLLLTLLFRYMRPLVEHGHVYLAMP
FT                   PLYKLKWTNGPHDYVYSDRERDALLEAGRAAGRRLPKDGGIQRYKGLGEMDYRELWETT
FT                   MDPDTRTLKQVTIGEAAMADEIFAVLMGEDVESRRSFIQRNARDVRFLDI"
FT   gene            8610..11267
FT                   /locus_tag="Bcav_0007"
FT   CDS_pept        8610..11267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0007"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="PFAM: DNA gyrase/topoisomerase IV, subunit A; DNA
FT                   gyrase C-terminal domain, beta-propeller; TIGRFAM: DNA
FT                   gyrase, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78273"
FT                   /db_xref="GOA:C5BUP9"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUP9"
FT                   /protein_id="ACQ78273.1"
FT                   /translation="MTQPPETPDERDAETTDAVVSAAGASALRDRVEQVDLQLEMQRSY
FT                   LDYAMSVIVGRALPEVRDGLKPVHRRVLYAMFDGGYRPDSAFSKCARVVGDVMGNYHPH
FT                   GDTAIYDALVRLVQPWSMRYPLVAGQGNFGSPGDDSAAAPRYTECKMAPLAMEMVRDID
FT                   KDTVDFGDNYDGRTQEPLILPARFPNLLVNGSAGIAVGMATNIPPHNLREVAEGVEWFL
FT                   EHPDATNEELLGALLLRIKGPDFPTGAQILGHRGIEDAYRTGRGSITMRAVVEVEEIQG
FT                   RQCLVVTELPYQVNPDRLAAKIGEMVREGRISGIADLRDETSGRAGQRLVIVLKRDAVA
FT                   KVVLNNLYKHTQLQDTFGANMLALVDGVPRTLSLDAFVRHWTMHQIDVIVRRTRYLLAE
FT                   DERRIHILRGLLKALNALDEVIALIRRSPSSDEARTGLMELLEIDEVQATAILDMQLRR
FT                   LAALEQQRIMDEHAAIEARILDYQDILASEERQRSIVRSELGAIVERYGDERRTTILPF
FT                   DGEMSVEDLIPEEDVVVTITRGGYAKRTRTDNYRAQRRGGKGVRGAQLREDDVVDHFFV
FT                   TTTHHWLLFFTNLGRVYRAKGYELPEGGRDAKGQHVANLLAFQPGEKIAQVLALRDYDQ
FT                   ADYLVLATKRGLVKKTRLAEYDSSRTGGVIAINLRTDDGGAVDEVVSARIVGAEDDLLL
FT                   VSRKGQSIRFTATDEALRPMARATSGVTGMKFRADDELLAMDVVETDADLFVVTEGGFA
FT                   KRTALGEYRVQGRGGLGIKVANLVEARGDLVGALVVDSDDEVLVIMERGKIVRSAVDEV
FT                   TRTGRNTQGVTFAKPDAGDRIIAIALGEERAVADAGEEPVEESAEGAPTTDPAEGDGVP
FT                   SSPEAAPEAEEGQA"
FT   gene            11264..11980
FT                   /locus_tag="Bcav_0008"
FT   CDS_pept        11264..11980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0008"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78274"
FT                   /db_xref="GOA:C5BUQ0"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUQ0"
FT                   /protein_id="ACQ78274.1"
FT                   /translation="MSSETSRNDAARAQSYPPAHPPAQRPSQNGQVPARKPVRQSATAR
FT                   GAAPAPVTQAPATQAPATRAPAAAPSAQTTTDSTRVRATEAPAAVPPAAETSAPSSARP
FT                   GRPPVTKPGTTKGGGPRRVRLSVSRVDPWSTMKLAFLLSVAIGIGIVVAAAVSWQVLDS
FT                   MQVFSDLDSLVTDLGAQDQFGDLLEYLQFRNVISAATIIAIADVAIITALATLGAFLYN
FT                   IVASLVGGLHLTLTDD"
FT   gene            12111..12184
FT                   /locus_tag="Bcav_R0001"
FT   tRNA            12111..12184
FT                   /locus_tag="Bcav_R0001"
FT                   /product="tRNA-Ile"
FT   gene            12213..12335
FT                   /locus_tag="Bcav_0009"
FT   CDS_pept        12213..12335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0009"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78275"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUQ1"
FT                   /protein_id="ACQ78275.1"
FT                   /translation="MKKLLLLAAIAAVGYVVWRKAAEERAERDLWAEVTDPLEG"
FT   gene            12447..12522
FT                   /locus_tag="Bcav_R0002"
FT   tRNA            12447..12522
FT                   /locus_tag="Bcav_R0002"
FT                   /product="tRNA-Ala"
FT   gene            complement(12602..12961)
FT                   /locus_tag="Bcav_0010"
FT   CDS_pept        complement(12602..12961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0010"
FT                   /product="YCII-related protein"
FT                   /note="PFAM: YCII-related protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78276"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUQ2"
FT                   /protein_id="ACQ78276.1"
FT                   /translation="MTQYLIFFNQQWVGEHSAEWFRSRVEPSVAVIEEIKAAGAYVFAG
FT                   GLEEDLDEAFSADATSGTLAFTDGPYVETKEYLGGFTIVDVPDEATARMWAGKIAEGCG
FT                   WPMEVRRFKPYGSPD"
FT   gene            13097..13498
FT                   /locus_tag="Bcav_0011"
FT   CDS_pept        13097..13498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0011"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/Bleomycin resistance
FT                   protein/Dioxygenase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78277"
FT                   /db_xref="GOA:C5BUQ3"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUQ3"
FT                   /protein_id="ACQ78277.1"
FT                   /translation="MDTPGGLGALRSLDYTMLLCDDVAMMRAFYADVLGLDVQREVPGR
FT                   YVELRVGSATLALRRRGRPYDGPAPLAASASVQLAFRVPPNDVDIAAAQLVAGGAELLE
FT                   PVRSFPEFGHRAVFFADPEQNVIEIYAEV"
FT   gene            complement(13509..13895)
FT                   /locus_tag="Bcav_0012"
FT   CDS_pept        complement(13509..13895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0012"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78278"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUQ4"
FT                   /protein_id="ACQ78278.1"
FT                   /translation="MDQERDVPRLVGDTRRAWTRPPDAVGAVWALDVPDRDLDANVIRI
FT                   PPGERIEEFAGPDLDILWVVLDGEAHLTSGTTVVEMLPGAIVWLPSGSRRGVVPGPDGV
FT                   RYLTVHLRKEPTVLRPTVRPVGRR"
FT   gene            complement(14046..14252)
FT                   /locus_tag="Bcav_0013"
FT   CDS_pept        complement(14046..14252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0013"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78279"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUQ5"
FT                   /protein_id="ACQ78279.1"
FT                   /translation="MVGVHDDDAVAALRRWEAFGAVWRVLGRGPDGVTVAMCRCDDGEE
FT                   MARFTSADPGLEEFLAGRTSSAD"
FT   gene            14291..15325
FT                   /locus_tag="Bcav_0014"
FT   CDS_pept        14291..15325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0014"
FT                   /product="transcriptional regulator, LacI family"
FT                   /EC_number="5.1.1.1"
FT                   /note="PFAM: Bacterial regulatory proteins, lacI family;
FT                   Periplasmic binding proteins and sugar binding domain of
FT                   the LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78280"
FT                   /db_xref="GOA:C5BUQ6"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUQ6"
FT                   /protein_id="ACQ78280.1"
FT                   /translation="MTTVRPQGARRATVKEVAALAGVSPKTVSNVLNDFEGVRPQTRER
FT                   VQAAMVELDFVPNLAARGLRNGRSGIIGLALPDLSTPYSAMALQHVVEAARRAGWGVQV
FT                   EETGAEPSREHELVARARDRLVDGLILNPIVLERSIVRFGSDLPPVVLIGEVEDQHVDH
FT                   VGVDSRAAAADVTAFLVSSGHRRILALGTAPRAEAATAHLRLEGYRDALAAAGLDEDVR
FT                   LEVHVPAWSPQAAEAAVERVVADDVRFDAVFAFTDSMAIGALRALTRAGLRVPDDVSLV
FT                   GFDDVPLAASLVPSLTTVAGDYDDLAATSVRFLGERVAGATVPPRTHFIAHRIVDREST
FT                   RSRL"
FT   gene            15643..17055
FT                   /locus_tag="Bcav_0015"
FT   CDS_pept        15643..17055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0015"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: Bacterial extracellular solute-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78281"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUQ7"
FT                   /protein_id="ACQ78281.1"
FT                   /translation="MPPRNTPTGRAGVAPAGPNPHGTAPESAGRATPSSLTRRRLLTGG
FT                   AGLLGAGALASLAACGTPSASGATQQNLSFWHLLSGPDGVTMGSLVDGFNGSQDVASLT
FT                   QTVLAWGSPYYTKLAMASAGGRAPDVAIMHAARVPGYAPGGLLDSWDMDLFAELGIREE
FT                   DFPERIWAKSLHDGELTAVCLDSHPFVLYYNTEIAEAAGALGSDGLLEEATTPEQFRDL
FT                   AARLGDASDGGHGLAFGYLGDGSNMWRMFSTYYTQMGGTVELPIGGTMQYDEGLAVDTL
FT                   EWILSLIDGDIGNASHDGGTAISEFITGKAGMFYGGVWETGNYKAQGVPFDISLVPNVF
FT                   GTPAAYADSHAFVLPHQTNPDPERRRLVHEFVAYVLKNSLDWAAAGHIPAYSPVVDDPA
FT                   YDDLVPQSHYADATDYLVYDPEAWFSGSGSDFHRYFGDHMQNVFMRTVPPIDGLNGFVE
FT                   RINALLAKPSPV"
FT   gene            17126..18061
FT                   /locus_tag="Bcav_0016"
FT   CDS_pept        17126..18061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0016"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78282"
FT                   /db_xref="GOA:C5BUQ8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUQ8"
FT                   /protein_id="ACQ78282.1"
FT                   /translation="MTAQLGTPPRALTEAVRPERTRRRRTENLRGWIYCAPFALAFILF
FT                   LVWPTIYGLWMSFTGRSLTGANSSWLGVENYVEAFADPEVWSSLGNTVWFTVLSTIPLV
FT                   LIALGIAVLVNLGIPGQWFWRLSFFLPFLLASTVVSLFWKWLFNPQLGLINDMLGNFGI
FT                   PPVAWLNDPNTAMHAVVITTVWWTIGFNFLLYLAALQNIPDQLYEAASLDGAGSWRKFV
FT                   SITLPQLAPTTVLVGVLQILASLKVFDQIYQMTGGGPAGATRPILQYVYEVGFTGYRLG
FT                   YASAISYIFFFLIIAVSIVYSVIAARRTVK"
FT   gene            18061..18963
FT                   /locus_tag="Bcav_0017"
FT   CDS_pept        18061..18963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0017"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78283"
FT                   /db_xref="GOA:C5BUQ9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUQ9"
FT                   /protein_id="ACQ78283.1"
FT                   /translation="MTAQTLSHPAATSQAGAPSGTARRRRGVRPARVVAFAILVVLALA
FT                   WLIPVLWAVLTSFKTEADAAAFPISIWPTQGFTLEAFRTTLAEGMVPRWAWNSLLTSTA
FT                   VTVITVVISSLAGYAMSRFDFAGRRMLLAVTVASIMIPGQILIVPLFQQMLTFNLVDTY
FT                   WGIILPQVIAAPMVFILKKFFDQIPRELEEAALMDGASRLRILWQIVVPLSRPILGAVS
FT                   IFVFIGAWNNFLWPFIVVNKAELMTLPVGLQTVISAYGIQYAQNMAQAVLAALPLIVVF
FT                   LFFQRQIIKGISTTGIAGA"
FT   gene            complement(19117..19905)
FT                   /locus_tag="Bcav_0018"
FT   CDS_pept        complement(19117..19905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0018"
FT                   /product="mucin-associated surface protein (MASP)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78284"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUR0"
FT                   /protein_id="ACQ78284.1"
FT                   /translation="MSRKKKHVDPEQIKEQATEAGKSALHLAEQGKDWATPRVEAAIDW
FT                   AAPRIEKAWRAGVLAAAPKVEQAAEKAKDATDSAHDTLVDVVIPKIVAAMQEAADAAAA
FT                   GANGAADKAKAATAAVVEFVEPPKKSHVGRTIGWIAVGGAVAVAGYAVWRRTQPLDDPW
FT                   AEEYWEDAAGDDAQAAVDDAFASGTSTVTDAAAETTGAAKDKVEDAADAVADTAKDAAD
FT                   TAAEKVDAAAGEVEDVVAEAKDAAAKPTRRRTTKKADDAG"
FT   gene            20057..20578
FT                   /locus_tag="Bcav_0019"
FT   CDS_pept        20057..20578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0019"
FT                   /product="Peptidylprolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="PFAM: Cyclophilin type peptidyl-prolyl cis-trans
FT                   isomerase/CLD"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78285"
FT                   /db_xref="GOA:C5BUR1"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUR1"
FT                   /protein_id="ACQ78285.1"
FT                   /translation="MDAIIHTSAGDIRVELLPNHAPKTVANFTGLATGTKEWTDPETGQ
FT                   PANRPLYDGVVFHRVIPNFMIQGGDPLGTGRGGPGYQFDDEIHPELNFTQPYVLAMANA
FT                   GKIAGRGTNGSQFFITTGPTTWLQGKHTIFGRVTDEASVAVVDAIGTTATGAQDRPLED
FT                   VVISSIEIVE"
FT   gene            20631..21578
FT                   /locus_tag="Bcav_0020"
FT   CDS_pept        20631..21578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0020"
FT                   /product="Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78286"
FT                   /db_xref="GOA:C5BUR2"
FT                   /db_xref="InterPro:IPR000315"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUR2"
FT                   /protein_id="ACQ78286.1"
FT                   /translation="MSGFGGYGAAPPPGGTPPPGGYGAVPPGEQPPGQGVPSYGVSAPV
FT                   CPRHPDRISYVTCQRCGRPVCPECQRPAAVGVQCVDCVREARSRTPRTRTPLGGRARAG
FT                   RPVITLTIIVICAAIELLRYVAPGLYSEVYQAMAFSAAIGEVQPYRFLSAAFLHGGLLH
FT                   LAFNMYALWIVGGFLEQMLGRWRYAALFLLSAIGGSVGYLLLADPLSRAWTIPVVGASG
FT                   AVFGLFAAIVFVLRSTGRNASQILVLIAINVVIGFVVPGIAWQAHLGGMVTGALLAVAF
FT                   VYAPPRIRSWSSPAACVAVAVLLVVASFAKYAAV"
FT   gene            complement(22157..22402)
FT                   /locus_tag="Bcav_0021"
FT   CDS_pept        complement(22157..22402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0021"
FT                   /product="protein of unknown function UPF0233"
FT                   /note="PFAM: Uncharacterised protein family (UPF0233)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78287"
FT                   /db_xref="GOA:C5BUR3"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUR3"
FT                   /protein_id="ACQ78287.1"
FT                   /translation="MPESKSRKKPAYTPPPKSAEAKPNPAWYVPTFLTLLIVGLVWVVV
FT                   TYISQSNYPVPGIGNFNLAIGFAFILVGFVMTMRWR"
FT   gene            22526..23257
FT                   /locus_tag="Bcav_0022"
FT   CDS_pept        22526..23257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0022"
FT                   /product="protein of unknown function DUF881"
FT                   /note="PFAM: Bacterial protein of unknown function
FT                   (DUF881)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78288"
FT                   /db_xref="InterPro:IPR010273"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUR4"
FT                   /protein_id="ACQ78288.1"
FT                   /translation="MTEKPARARTSLAVGVVAAVAGVLFATSASVFADDGERRPQDLRG
FT                   LVAEENSRLGDINADVEALRSEVAELEAEVGAPPQPADADTAMGAGFVAVTGPGLVVEL
FT                   SDAPTGGTLPQGARADDLVVHQQDLEAVVNALWAGGAEAMTIQGQRVTSTTAVRCVGNV
FT                   LLLQGKTYSPPYRVAAIGDPAELRDAVDDSPTVQVYLEYVEAYHLGWSVTQQAEIEMPA
FT                   YDGDRTLTYSTVPGEGGDGDS"
FT   gene            23244..24074
FT                   /locus_tag="Bcav_0023"
FT   CDS_pept        23244..24074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0023"
FT                   /product="sortase family protein"
FT                   /note="PFAM: Sortase family; TIGRFAM: LPXTG-site
FT                   transpeptidase (sortase) family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78289"
FT                   /db_xref="GOA:C5BUR5"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042003"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUR5"
FT                   /protein_id="ACQ78289.1"
FT                   /translation="MATPEIDSWDAVVGTDDRARPARRARQDPARRRRRPVKQSFGSRL
FT                   VGFVGELLITVGVLLGLFVVWQLWWTDVEAIREQGHLIAELEETFTPSPEQAGEVRTDE
FT                   PPVMTAPPLGETFAELWVPRWDADDPYRRTIAEGVDRATVLDVIGIGHYPDTAMPGDVG
FT                   NFATAGHRQTFGRPFFAVDQLQTGDSLIVSTAEAWYVYTVTETAIVAPTQVSVIAPNPS
FT                   DPSAEPTERLITLTTCHPLFSTRERFIVHGVLDHWVPRESGRPAELIAAEEGTG"
FT   gene            24077..24241
FT                   /locus_tag="Bcav_0024"
FT   CDS_pept        24077..24241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0024"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78290"
FT                   /db_xref="GOA:C5BUR6"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUR6"
FT                   /protein_id="ACQ78290.1"
FT                   /translation="MYGWIWRVLPGPAWFKAVEALVLVAAVVAVLFLWVFPEIAPHLPI
FT                   NQQTVGEDG"
FT   gene            24238..24885
FT                   /locus_tag="Bcav_0025"
FT   CDS_pept        24238..24885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0025"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /EC_number="4.1.3.27"
FT                   /note="PFAM: Glutamine amidotransferase class-I; TIGRFAM:
FT                   glutamine amidotransferase of anthranilate synthase or
FT                   aminodeoxychorismate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78291"
FT                   /db_xref="GOA:C5BUR7"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUR7"
FT                   /protein_id="ACQ78291.1"
FT                   /translation="MSRILVIDNYDSFVYTIVGYLQQLGAETVVLRNDATGDVPEDLAG
FT                   YDGVLVSPGPGTPHEAGTSMEIIRRCASNGVPMLGVCLGHQALAEVYGGVVTHAAELMH
FT                   GKTSRVEHDGAGVLAGLDSPFTATRYHSLAVVTESVPAELSVTAWTGAGTTPIVMGVQH
FT                   RELPLYGVQFHPESVLTEGGHRLLANWLAITGDADAVDRSRGLAPLAPVSPR"
FT   gene            complement(24999..26804)
FT                   /locus_tag="Bcav_0026"
FT   CDS_pept        complement(24999..26804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0026"
FT                   /product="serine/threonine protein kinase with PASTA
FT                   sensor(s)"
FT                   /note="PFAM: Protein kinase domain; PASTA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78292"
FT                   /db_xref="GOA:C5BUR8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUR8"
FT                   /protein_id="ACQ78292.1"
FT                   /translation="MDELPRVLAGRYEVGELIGRGGMAEVHIGRDNRLSRRVAIKVLRS
FT                   DLARDPTFQARFRREAQSAAALNHPAIVSVYDTGEDIVMSPTGVETHLPFIVMEYVEGH
FT                   TVRDLLRDGAALPIDEAVDIVSGVLSALEYSHHAGIVHRDIKPANVMITPTGDVKVMDF
FT                   GIARAMADSAATMTQTQAVVGTAQYLSPEQARGEVVDARSDVYSTGALLFELLTGRPPF
FT                   IGDSPVSVAYQHVREEAPTPSSIAPDVPEELDRIVLTALAKDRDVRYQSAAEFRSDLEA
FT                   ARAGGVVGAPSVGAIRAANAGPATEATQVLGAPAAAAATAAVLADDGAGEDEGGGPRKW
FT                   WIWVLAILGVLLIGAIIWALLNRGDDPGGNETPTPTQVAVPNVEGMTQDDAREALEALE
FT                   LEPDFSRTEASDTIEQDLAIRSDPAAETQVDPGTTVYVYISAGPDTITVPEVRNQTQQQ
FT                   ARDTLIEAGFDAANISTAPVDDADLAQNQAAGTDPAAGQEVAPNATIVLQIATGNVAVP
FT                   DLTGLTEAEAQQLLQDNNLVFARVEQPTGDIDPGIVVDWTPNTIVPRFSTITVSIAIAP
FT                   PEPTPTPTETPSATEGPTEPPDEEP"
FT   gene            complement(26807..28228)
FT                   /locus_tag="Bcav_0027"
FT   CDS_pept        complement(26807..28228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0027"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Protein kinase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78293"
FT                   /db_xref="GOA:C5BUR9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUR9"
FT                   /protein_id="ACQ78293.1"
FT                   /translation="MLLGGRYELRERIAMGGMGEVWSAVDTHLGRQVAAKVLREEFAGD
FT                   EMFLERLRTEARNSANLAHPNIAMLHDYGEVDGVGYLVMELVAGEPLSDLLERRRTLPP
FT                   DQLLPILAQTARALQVAHAAGVVHRDVKPSNLLITADSRVKITDFGISLGANQAPMTAA
FT                   GMVMGTAQYLPPEQAMGRAATPAGDIYALGIIAYEALAGQRPFTGTTQVDIAFAHVSEP
FT                   VPPLPQFVHAELRELVMSMLEKEPGRRPASAAELAVRLDEIAAAIGAEEWNPDAVQGRW
FT                   RPTAADRRRQRELPADGEAPGSDGAGADAAAASPRAAGAGTGAEAQTRRARRGRPPAHD
FT                   VPAAAAAAGTTAPGPLGRATARSAHRAGPRRGRAASEPQLPAWLAEPLGRVVAWFRRIS
FT                   WPDWTENRWLLAGAVIAVVAVLTLLVLAIGTLGTPTSLGSGATGVRPIGGVAAEEAHGA
FT                   ELAADAVGGSRVEGL"
FT   gene            complement(28243..29724)
FT                   /locus_tag="Bcav_0028"
FT   CDS_pept        complement(28243..29724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0028"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: Penicillin binding protein transpeptidase
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78294"
FT                   /db_xref="GOA:C5BUS0"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUS0"
FT                   /protein_id="ACQ78294.1"
FT                   /translation="MNAPLRRLSAVVMSMFLVLMVGVTWVQYVQAPGLNDDPRNVRTTY
FT                   REYGRDRGPIVVAGTPVAESVPVDDPFGFQRTYVQGDVYAPLTGYHSIVFGSSMIEDAA
FT                   NDVLNGTASSLWLERLQSLVTGRQPRGGSVELTIDPVAQQAAWDALAGRAGAAVAIDPR
FT                   TGAILAMVSTPSYDPNTLAAHSSSAVNEAWDALLADPARPLDNRAIAGNQYAPGSTFKL
FT                   VDTVALLATGDFAPDTQVPAPTTYRAPGAGADIRNPGGGTCGGDTVTLEYALQESCNTP
FT                   FAQLAVEELGDEALREQAEAFGFGQELHVPMTVTPSRFPQGVDGELDPAFLALAAIGQY
FT                   DVRVTPLQMAMVSAAIANDGVLMTPYTIATERGPDLGVLSQTTPSEFSQPMSADVAETM
FT                   TQLMTNVVENGTGQTAQIPGVAVAGKTGTAESGIEGDGPEANPHAWFTAFAPADDPQVA
FT                   VAVVVENGGSLSSEYTGAQLAAPIARSIMQAVIDQ"
FT   gene            complement(29721..31205)
FT                   /locus_tag="Bcav_0029"
FT   CDS_pept        complement(29721..31205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0029"
FT                   /product="cell cycle protein"
FT                   /note="PFAM: Cell cycle protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78295"
FT                   /db_xref="GOA:C5BUS1"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUS1"
FT                   /protein_id="ACQ78295.1"
FT                   /translation="MATIAPEAAPNRRWAELALLVPALALGIYAYVQVGLNTSGVIPAN
FT                   TLRDSVVFTLLTLGLHLLLRWRAPYADPIMLPLAVALGGIGLAMIARIDIAEQLRGNAG
FT                   TAANRQLVWMILGMVLAAAVLLFLRDHRTLRRFTYTAMVVALGLLLLPLVPGLGLNING
FT                   ATIWISVGPFTFQPAELAKICLAVFFAGYLVTNRDTLTLAGPRVLGLQLPRLRDMGPIV
FT                   LAWIVSIGVLVQQSDLGTSLLLFGMFVAMLYVATERLSWVIIGALLFGGGAVAAAVASP
FT                   YVLARFTVWLHAFDPEIYNRDPGGSGQLVRGLFGMASGGLFGTGWGLGHPILVPYANSD
FT                   FIVASLGEELGLTGLLALLLCYLLLAQRGLRTAIGVRDGFGKLLASGLAFTIAFQCFVV
FT                   VGGVTRLIPLTGLTMPFLAAGGSSLVSNWIVLALLLRISDAARRPAVAAEPVPDDLPGV
FT                   DDAAADDGERVTARGAGSADDADGADTAVTEVVRTE"
FT   gene            complement(31205..32593)
FT                   /locus_tag="Bcav_0030"
FT   CDS_pept        complement(31205..32593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0030"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="PFAM: Protein phosphatase 2C"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78296"
FT                   /db_xref="GOA:C5BUS2"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUS2"
FT                   /protein_id="ACQ78296.1"
FT                   /translation="MTIALRYAARSDVGLVRSVNQDSGYAGPHLLVLADGMGGPAGGDI
FT                   ASSVAIAHLAGLDGESHGADDLLDHLDRAVQDAHEELRDLAAEDPELAGLGTTLIAMLR
FT                   SGNKLAMVHVGDSRAYVFRDARLERITSDHTFVQHLVDIGRLTEEEAEHHPQRSVLLRV
FT                   LGDSGPDVVLDESVREARVGDRYLLCSDGLSSYVSADTITTTVGEVRDPAACAEALIEL
FT                   ALRAGAPDNVTCVVADVVDVDALPDGAAPDPTPQVVGAAATDRHRPTRGGSGAAARAAA
FT                   LNPAADVEPDEDPKPARRRWVRPVLVVALVLAILAGAGYGFSRWTQTQYYVAASGDYVA
FT                   IYQGIPQEIGPVRLSHVVVTTDLRVEDLPPFAQDRLTETIVTGSFESARGIVRGLEEQS
FT                   TAPEDPTASPTPTPSPSPTAPGQGGTPAPSLPPASPAPTEPPDDTTGAPAGPTGDVPAV
FT                   VGSA"
FT   gene            complement(32598..33083)
FT                   /locus_tag="Bcav_0031"
FT   CDS_pept        complement(32598..33083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0031"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: FHA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78297"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUS3"
FT                   /protein_id="ACQ78297.1"
FT                   /translation="MSELVVTLLRLSYLALLWLLVLSAISVLRKDIFGTRVVARLTARR
FT                   SRGADARDAAPAEPPHGARARPVTLAVLAGPLAGTRLSLSSSAVLIGRSPGCTLVLDDD
FT                   YASGRHARIFPHDGRWLVEDLGSTNGTYLADHRIGGPEPMELGMPLRIGQTVIELQR"
FT   gene            complement(33106..33813)
FT                   /locus_tag="Bcav_0032"
FT   CDS_pept        complement(33106..33813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0032"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: FHA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78298"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUS4"
FT                   /protein_id="ACQ78298.1"
FT                   /translation="MGVIDRFERGVERVVSGAFAKAFRAEVKPVEIASAIRRAMDDRTA
FT                   VVARGRTLVPNEFEIELSPGDLQRVVDWGEEALADEMVSAAADHAADQGYTLVGPVTVG
FT                   FSQDDELETGRFRVRSETVRGAVAPATAPAAPSQRHPIVDIDGQRYLLTGPVTVIGRGS
FT                   ESDIIVDDTGVSRRHLEIRITPDGVVATDLGSTNGTYVEGHQITAATLVDGNTITLGRT
FT                   RILFWSGDADGAA"
FT   gene            34239..34325
FT                   /locus_tag="Bcav_R0003"
FT   tRNA            34239..34325
FT                   /locus_tag="Bcav_R0003"
FT                   /product="tRNA-Leu"
FT   gene            complement(34416..34676)
FT                   /locus_tag="Bcav_0033"
FT   CDS_pept        complement(34416..34676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0033"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: Helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78299"
FT                   /db_xref="GOA:C5BUS5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUS5"
FT                   /protein_id="ACQ78299.1"
FT                   /translation="MPIVVDVDVMLARRKLSVGELAERVGITPANLAVLKNGRAKAVRF
FT                   TTLEALCEVLECQPGDLLRWEATTNGDPPSPVTSARDDPST"
FT   gene            complement(34676..35173)
FT                   /locus_tag="Bcav_0034"
FT   CDS_pept        complement(34676..35173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0034"
FT                   /product="transmembrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78300"
FT                   /db_xref="GOA:C5BUS6"
FT                   /db_xref="InterPro:IPR021354"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUS6"
FT                   /protein_id="ACQ78300.1"
FT                   /translation="MGVLAIRALRVVIVGLFAGLLFGQIVIAPLMAVDISEEVPDAGAL
FT                   PWVVAGIGIAGLTTIEVALVCVWQLLTMVRRDTVFSRAAFRYVDVIIGTAVVATLLALA
FT                   LGVILAPGEAVPPGMVLMLGTAAAGCAGIALLVLVLRVLLAKAVALDTTATTLRAELDE
FT                   VI"
FT   gene            complement(35244..35999)
FT                   /locus_tag="Bcav_0035"
FT   CDS_pept        complement(35244..35999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0035"
FT                   /product="sortase family protein"
FT                   /note="PFAM: Sortase family; TIGRFAM: LPXTG-site
FT                   transpeptidase (sortase) family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78301"
FT                   /db_xref="GOA:C5BUS7"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042003"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUS7"
FT                   /protein_id="ACQ78301.1"
FT                   /translation="MARPGAIYRCLMEPAVPDGEHANAHVPRPGHAAAAGRTRARRWLT
FT                   AAAGVVVAGALLAGCAPAARELATVPAPASSPPQTLPTLPAEEPTPELAAEAPQVEGAT
FT                   FATLTVPRFGADWSVPVHEGITDPILDRDGVGHFPDSALAGEVGNFALAGHRTLSFAPL
FT                   YDIDLLAVGDEIVVTTETGRYTYAVSSSEIVTPDAMRVVGPDPQNPGAPATQAILTLVA
FT                   CHPKGSVEFRWITYATLVGSEPLTGGASG"
FT   gene            complement(36084..36938)
FT                   /locus_tag="Bcav_0036"
FT   CDS_pept        complement(36084..36938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0036"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="PFAM: Periplasmic binding proteins and sugar binding
FT                   domain of the LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78302"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUS8"
FT                   /protein_id="ACQ78302.1"
FT                   /translation="MSDVTRGAGAVGFVLARPAWMLGVEPFHMELIAGIEGRLSGEGHS
FT                   LLLHVVPDADAEIATYRRWAEGQLVDAVIVTNLGRDDRRLEVLAEIGLPTVVVGGPRRD
FT                   LPFTNVWIDNAHAMRDAVAYLAGLGHRSLAQISGPSGLAHTQSRVETFRQECAERGLTG
FT                   VVVESDYTEEGGARATRSLLGRAGTPSAIVYDNDVMAVAGLGVAAEMGVAVPANLSLLA
FT                   WDDSTLCRLANPPLSVMSLDVHGMGALAADCVLNVLAGGPVVSHTAPQPHLVPRGSTAP
FT                   PAA"
FT   gene            complement(36935..39430)
FT                   /locus_tag="Bcav_0037"
FT   CDS_pept        complement(36935..39430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0037"
FT                   /product="beta-mannosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78303"
FT                   /db_xref="GOA:C5BUS9"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUS9"
FT                   /protein_id="ACQ78303.1"
FT                   /translation="MHSRDLHDGWTIHAHGAEVPDAVADAEIPVTVPGTSHTALLDAGL
FT                   IPDPYIGTHELDVAWMHRADWRFTTTFDEAGAAADERVDLVFAGIDTVATVSLGGRELG
FT                   RTANMHRSYRFDVRDLADGGAHDLVVDVRSALSYGEAERDRLGARPAAYPHPLNMVRKM
FT                   ACSFGWDWGPDLQTAGLWRPVHVERWRVARLASVRPLVGIRLDGVPYVRVHVDVERSGL
FT                   TDAGPLTIRAAVAGAAREVTIPADASTAVVEIAAPEAELWWPVGHGEQPLYELDVELVD
FT                   GEVRDTWQRRIGFRTVDVDETPDEHGTPWTLRVNGTPIFVKGANWIPDDHLLTRITRER
FT                   LERRIDQALGANLNLLRVWGGGIYESRDFYELCDERGVLVWQDFLLACAAYPEEEPLAG
FT                   ELEAEARENVARLTPHPSLVVWNGGNENVWGFLDWGWRAELDGATWGYGYATELLPRVV
FT                   AELDPTRPYSWNSPSSPGFALDERHPNDPDHGTHHQWEVWNRLDYTHYASEIPRFCSEF
FT                   GFQGPPAWATLERAVRPADGVWSTEDAAFLLHQKAADGNAKLDAGLAPHLGVPEDFADW
FT                   HWATQLNQARAVAFAIEHYRSWWPRTAGAIVWQLNDCWPVTSWAAVDSDERVKPLWFAL
FT                   RHAFADRLVRVVERDGVPVVALVNDTAAPWSGAARATRETFAGEVLAEEAFDVVVAPRS
FT                   VALVPLPTALRTPLDAAAEAVVVRFGDERTVHLFVEDVDAALDPASISAEVTPVEGGYR
FT                   VEVRARSLTRDVALLVDRLDPAASVDDALVTLPAGESVTFHVRTAVALDSAALTSAPVL
FT                   RTANDVVGAALGRSGSALV"
FT   gene            39798..41504
FT                   /locus_tag="Bcav_0038"
FT   CDS_pept        39798..41504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0038"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: Bacterial extracellular solute-binding
FT                   proteins, family 5 Middle"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78304"
FT                   /db_xref="GOA:C5BUT0"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUT0"
FT                   /protein_id="ACQ78304.1"
FT                   /translation="MSFRTRRRYRRPALLAGAAVAAIALGLTACSSGEDPEGDASGDTG
FT                   DDGATTSISVAFGEIIENWNPFSPTALQPTRGVIFETLYWYNLASEADPTEMLGAGFEW
FT                   NEDGTQLTITTREDVQWSDGAPFTANDVAFTFNLIAETPELNTSGTAATAEVVDDTTVV
FT                   LTFPETSFMQEPSILGNTAIVPEHIWSQITDPTTNVNSDAIGTGPFTLSEFSTQSFVLT
FT                   ANENYWNGAPAVDEVRYIPLESADANAAALVAGEIDWMSAFIPGLEQLLTDDETLSYVN
FT                   TPALTASIFTCSNADLGCTGPQTDPAVRQAIYWAIDRTQLNELAGGGFAETASPTLLIP
FT                   ARDESWIADGENVTTPEGADVDQANQILDDAGWVLGSDGIREKDGERLSMTIQTVSGWS
FT                   DFISLNDAMTQQLAEVGIELQPTQVAWNEWNNNQTMGTFQLSLDSIGLGASSNPYFTYN
FT                   GKYHTANTLPVGEGAIGGNSARYSNPVVDEALDAAARTADEAEQAEQYAIVQTEIVRDL
FT                   PYIPIYVNSMLTEFNTSRATGWPTDDDRYAMPATWKAWDNGIVLHRIVPAE"
FT   gene            41614..42603
FT                   /locus_tag="Bcav_0039"
FT   CDS_pept        41614..42603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0039"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78305"
FT                   /db_xref="GOA:C5BUT1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUT1"
FT                   /protein_id="ACQ78305.1"
FT                   /translation="MRYLLQKLGFYVIALWAALTLNFFLPRWMPGNPVDILVSKLAQRG
FT                   EVTPATRQAIALLLGMDEEKPLWEQYIGYLQQVFSGDLGVSVAFFPTPVSEVIAQTIPW
FT                   TIGLVGISTLLSFILGVGLGMIAGWKRGSWIDNLIPATTLLQSVPYFWLALVLLFLFGS
FT                   VWQIFPLYGGYDVTSTSPAFSWEFLSSIVYYGTLPALTIVVSSIGGWMLGMRNMMVSTM
FT                   SEDYILTAEAKGLRSSRIRFTYAARNAVLPSVAGFAISLGFVVAGSVVTESVFSYPGIG
FT                   SALISSVNNADYALMQGIFLVITLSVLGANLLVDLLYSVIDPRTRARA"
FT   gene            42614..43576
FT                   /locus_tag="Bcav_0040"
FT   CDS_pept        42614..43576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0040"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78306"
FT                   /db_xref="GOA:C5BUT2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUT2"
FT                   /protein_id="ACQ78306.1"
FT                   /translation="MSIATQDPELAAAEAAALPRKKARILPPMTPKLAVGLVIAGLITI
FT                   FGLVGPWFVGDPSTVNDVGLAPPSSEFWLGTTQTGQDVFAQLAYATRGSLIIGVIVGAL
FT                   TLVMSAFFGVVGAFAGGWTDEAFSLVTNVMLVIPGLPLVIVISSYVSEKSVLLVAVVLA
FT                   LTSWAGSARVLRGFTLSVRNRDYVLAARVSGEPSWRILAVEILPNLIPLLASQVVFAVI
FT                   FGILGEAGLSFLGLGATGSFTWGTMLYYAQNGLALRLGAWWWFVPPGLLLAVFGAALSL
FT                   INFSIDTIINPKLRDSTREVRKGWRMTRQQLRKAEEEVV"
FT   gene            43573..44448
FT                   /locus_tag="Bcav_0041"
FT   CDS_pept        43573..44448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0041"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: Oligopeptide/dipeptide transporter, C-terminal
FT                   region; ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78307"
FT                   /db_xref="GOA:C5BUT3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUT3"
FT                   /protein_id="ACQ78307.1"
FT                   /translation="MSHPVLEISSMSVDYLVDPVVHAVRDVSLTLARGEVLGLAGESGC
FT                   GKSTLAYAVTRLLKPPASIVGGRALFHSREGYAIDLGELHGEELRAFRWDKVAMVFQGA
FT                   MNSLNPVIRIRDQLEDVFTTHRPDVDKRRRRERCAELLTRVGVDPGRLNAYPHELSGGM
FT                   RQRVMIAMALALDPQVLIMDEPTTALDVVVQREILQEITRLRAELGFAVVFITHDLPLL
FT                   LEISDRIAVMREGRIVELADARTLYTAPTHEYTRQLLDSFPSLTGTRGGFVRDGSQASP
FT                   AAPARTEVAS"
FT   gene            44445..45248
FT                   /locus_tag="Bcav_0042"
FT   CDS_pept        44445..45248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0042"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: Oligopeptide/dipeptide transporter, C-terminal
FT                   region; ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78308"
FT                   /db_xref="GOA:C5BUT4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUT4"
FT                   /protein_id="ACQ78308.1"
FT                   /translation="MTTLDLRNVVKTYRLRHGLRHTDLRAVDDVSFTLEPGRTTALVGQ
FT                   SGSGKSTVAKLLLQLERPTSGEILVDGVSLHGSRAATKAYRSAVQMVFQDPFASLNPYH
FT                   SVAHHLARPVKLHHPGLTGAQVEERVLSLLSRVRLDPPEEFARRRPHELSGGQRQRVAI
FT                   ARALAPGPGILIADEPVSMLDVSIRLGILNLLSELQREENLGVLYITHDLATARHFSDE
FT                   ILVMYRGVIVERGPADDVILNPQHEYTKLLREAAPDPERRLRELA"
FT   gene            45255..46520
FT                   /locus_tag="Bcav_0043"
FT   CDS_pept        45255..46520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0043"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78309"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUT5"
FT                   /protein_id="ACQ78309.1"
FT                   /translation="MTRVSTESAGAQQTRSRSAILDVVRAAGTISRVELTRATGLTGAT
FT                   VSTVVRRLIDEGLIVEVGRAESTGGKPRTLLRLEPRARFAVGVHLDVAGITYVLANLGG
FT                   GVVARWRTAGTAGDGPEDVVARVVAEIGDMFSRVGVEKDRLLGVGLVGPGPLSGGTAVT
FT                   WVADPASSGMAPFPFGEAIEAALDMPVLLDNDATAAAVGEYWAGGIESTSALGALYMGA
FT                   GIGGGVVVGGVAFRGASSNAAEIGHVCVDLAGPECWCGARGCVEAVAGPAAVVAAARAR
FT                   GVDLGPAGRPAAEDFATLARAALRGDAVASSILEFSARYVAVAAQTFANLMDLDLIVLT
FT                   GPAFGIAGSLYLPVVTEHLERAFFARDSHPVHVRISSSAHEAAAIGAAALVLQSELAPR
FT                   PTTVRMPAERHVASVAVPAPGA"
FT   gene            complement(46563..47999)
FT                   /locus_tag="Bcav_0044"
FT   CDS_pept        complement(46563..47999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0044"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain"
FT                   /note="PFAM: Bacterial regulatory proteins, gntR family;
FT                   Aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78310"
FT                   /db_xref="GOA:C5BUT6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUT6"
FT                   /protein_id="ACQ78310.1"
FT                   /translation="MGASQTDLAWDTLVDLAPAGGDTGPLHVRLTSALRSLIASGVVPD
FT                   GAALPPSRTLARDLGCSRWAVTEAYAQLAVEGYLTARSGSVTRVRSGVAPPASPPAAML
FT                   DDVARRAPYDLAPGVADLRAFPRHRWVEATRTVLSALPADDLARAVPGGHPRTRRLLAE
FT                   YLRRSRAVDTGAAALVVTAGAGSAMGWLARRLVAAGHTRLAVEEPSWPVLPDLARRAGL
FT                   ETVPIAVDDDGLCVDDLRAHPDVRAVLLTPAHQFPTGAAMSPVRRAEVTAWARERDGVV
FT                   IEDDYDAEFRYDRKPVAALQALDPQHVVLLGSLSKSLSSAVGLGWLVGPTALLADVAEP
FT                   GGAPPTPGVLTEQIVAEMIERGWYERHLRSVRTGLRRRRDALVAALGRRLPDCPVSGLA
FT                   AGMHLVLRLPADVRAADVVARAAELDVGVVPMSRYLGGGVAGHGGVARSDQLVLGYGNL
FT                   ADSRVEDAVARLAVAVRSRG"
FT   gene            48068..49036
FT                   /locus_tag="Bcav_0045"
FT   CDS_pept        48068..49036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0045"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: Aldo/keto reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78311"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUT7"
FT                   /protein_id="ACQ78311.1"
FT                   /translation="MRELTLTSGDTHLSVSALCLGTMLMGTQTDAETSFAILDRYYEAG
FT                   GRFLDTANNYNHWGDGHGRDSEELLGRWLAARGTAGEMVVATKAGAAKKDPALPLSTTP
FT                   PTNYQGLEASIVRREAEQSLRTLGVERLDVYYGHVDDRDLGVEEIAQTFGELAKAGTIG
FT                   VPGLSNTTTWRFAEARAAAARVGLPEFGAIQQESTYLQPRPGSRAANYVNGELLDYADS
FT                   HPDVTILAYAPQSQGVYANPAKSLRPELDHPATPSRWAVLRDVAEELGATQNQVVLAWL
FT                   LGGDVPQLPVFGASSVAQLDEALGALTLEIPAELRARLDAA"
FT   gene            49220..49780
FT                   /locus_tag="Bcav_0046"
FT   CDS_pept        49220..49780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0046"
FT                   /product="nitroreductase"
FT                   /note="PFAM: Nitroreductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78312"
FT                   /db_xref="GOA:C5BUT8"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUT8"
FT                   /protein_id="ACQ78312.1"
FT                   /translation="MSTPTEPAPSSDEFLPELRALRQSRFFTDRPVPREDLERILDIAR
FT                   WTGSAKNSQPWHLVVVEDRETNAELATYGAFTQFLAGVAASIVIVLDGDGRSQAYDEGR
FT                   LSERAMLAAAHLGLGSGTAWFGTSEARAQVRELLGIPEHLHPYSAVGLGYTDASRAQAA
FT                   PALRGRKPFEEIVSWGRYSGPAT"
FT   gene            complement(49746..50270)
FT                   /locus_tag="Bcav_0047"
FT   CDS_pept        complement(49746..50270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0047"
FT                   /product="GCN5-related protein N-acetyltransferase"
FT                   /note="PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78313"
FT                   /db_xref="GOA:C5BUT9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUT9"
FT                   /protein_id="ACQ78313.1"
FT                   /translation="MIIRDATAADWPAIWPFLREIVAAGEAYCWPRDTSEEAARAWWTG
FT                   KPGGRVFVAVDERVDDDVPVPLVVGTAELHPNQPAAGAHVANAGFMVDPAHAGRGIGRA
FT                   LAQHVLGAACQEGYRAMQFNAVVETNTAAVRLWRSLGFDVLATVPRAFDHPSAGPVGLH
FT                   VMWRDLSTGPS"
FT   gene            50312..51277
FT                   /locus_tag="Bcav_0048"
FT   CDS_pept        50312..51277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0048"
FT                   /product="peptidase U61 LD-carboxypeptidase A"
FT                   /note="PFAM: LD-carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78314"
FT                   /db_xref="GOA:C5BUU0"
FT                   /db_xref="InterPro:IPR003507"
FT                   /db_xref="InterPro:IPR027461"
FT                   /db_xref="InterPro:IPR027478"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR040449"
FT                   /db_xref="InterPro:IPR040921"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUU0"
FT                   /protein_id="ACQ78314.1"
FT                   /translation="MWVAGRTVRRVSLPTPIATARPDASLLPRRLVPGDAVALVSPAST
FT                   PSAEWIDWSVGTLESWGLEVRVGAHALDAQGILAGDDAARLADLNAALRDPAVRAVLTT
FT                   RGGVGSMRLIPGVDVDALVSDPKLLVGFSDITALHQVWQGVGVPSLHGAVAGAHADGVR
FT                   RLLMTDEPAVVGTQAGTLTAELTSGGRAEGSLAGGSLEQLARCVGVVDVPWDGRVLLLE
FT                   ANRASGLGMIERPLAQLALSGVLSRVAGVALGSFDEFTDHVDRGWTVLDVLRSWLDPLG
FT                   VPVLGGLPLGHLEDTLTVPLGVPCTLDADAGTLTVSPGVR"
FT   gene            51326..52558
FT                   /locus_tag="Bcav_0049"
FT   CDS_pept        51326..52558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0049"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: Major Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78315"
FT                   /db_xref="GOA:C5BUU1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUU1"
FT                   /protein_id="ACQ78315.1"
FT                   /translation="MTTPRFSGARSGAGLLLLAVLLCALNLRAAITALPPVVGDVSAEL
FT                   GLTAGQVGLLTGVPVLCFAVATPAASGALGRWGVSRCGTVALVAIAVGSLVRSVDGFAV
FT                   ALAGTVLIGLGITIGNVTLPFLIGRDFPSAVAMVTGLYTAALNVGTTLTTSLTAPLAGL
FT                   TGWRFAIASWSLLAVVALAVWWRAFARRPAPEVPPPPAAGTPSSPPPQQGERSVLRLGI
FT                   TWLLAATFATQAFSFYGVTAWLPTLLRDTVGIPADSAGGAAAVFQVFAIVGGVGVPLAL
FT                   ARRASIRAVALTMSAFWLTLPIGLLLRPESWAWWASIAGISQGGMFAVIFTLVAWRAPS
FT                   QSASRRTSATVQTIGYSVAALAPPLLGVVHTGTDGWTAPLVVVLCALLAMTGCVAVASA
FT                   APSARGREKPA"
FT   gene            complement(52568..53443)
FT                   /locus_tag="Bcav_0050"
FT   CDS_pept        complement(52568..53443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78316"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUU2"
FT                   /protein_id="ACQ78316.1"
FT                   /translation="MVPRRAAALACALAASLAAAACTPPAPFPHEALDGLSVEVYQGRI
FT                   DWGERVIELRITNDGEVPLVVTGANLEAPITAQNEPKTADRTVALRPGITRAMYVRLGV
FT                   PLCGEIGDGGAHAVLDVETEDGLAARVEVPAADPDGYLDRAHSEDCAEQAFAAGATATF
FT                   GDDVRIEERDGHLVGGLELTVVPVPGGPEVSVAEVGGTQLLAPLGGPVWSDPALLDLPD
FT                   DGARVTLWFTAVRCDQHAYADDKRGKFVPIRSVVDGVAEDLFYVHLPQATRRSLGEYFA
FT                   LACGWDVDLG"
FT   gene            53603..54091
FT                   /locus_tag="Bcav_0051"
FT   CDS_pept        53603..54091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0051"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78317"
FT                   /db_xref="InterPro:IPR025326"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUU3"
FT                   /protein_id="ACQ78317.1"
FT                   /translation="MAVVVPPEGAPPACDPGVLAVRLHGADAFTGHRLLGLAVRNAGDT
FT                   ACSLSGYPDLAFRAASGELVDASVLDGDPFGARDLGARPLVLDPGAEAFAVAGWGAMST
FT                   SLDPDVTVAVLLTPPGGANPVELPVTSIPGYAPGSSLDVLDGGEVTVTAWAARFEDLL"
FT   gene            complement(54095..54730)
FT                   /locus_tag="Bcav_0052"
FT   CDS_pept        complement(54095..54730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0052"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: Uncharacterized conserved protein (DUF2174)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78318"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUU4"
FT                   /protein_id="ACQ78318.1"
FT                   /translation="MPGKNGDVPFDVKRELPALYAPKNRAWDLLDVPPQQFLAVDGEGD
FT                   PNTSEAYARAVEALYAVAYTLRFASKRDGFEFVVGPLEGLWWSPDPAVFTARAKEKWHW
FT                   RMLITLPERLTGAQVTQAAAAAQAKKGLPAISDVRLERMHEGLCAQVLHLGSYDDETPV
FT                   LAELHERYLPQLGLVPTGHHHEIYLGDPRRTAPEKLRTVIRQPVAPAP"
FT   gene            complement(54916..56190)
FT                   /locus_tag="Bcav_0053"
FT   CDS_pept        complement(54916..56190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0053"
FT                   /product="putative alpha-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78319"
FT                   /db_xref="GOA:C5BUU5"
FT                   /db_xref="InterPro:IPR002241"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUU5"
FT                   /protein_id="ACQ78319.1"
FT                   /translation="MGWNSWDCYGTTVTEAEVVANAEFMATHLRAHGWDTVVVDIAWYD
FT                   PTAKAHGYNDDAPLELDAHGRQLPAPNRFPSAADGAGFGPLAAKVHELGLRFGLHVMRG
FT                   IPRLAVDRDLPIAGTGWTARDAADTSSICPWNPDNYGLDHTHPAAQAYYDAQVAQFAAW
FT                   GVDFVKADDMLWPYHHAEIEAYARAIERSGRPMELSLSPGRDISLAHLDHLRASSAMWR
FT                   VSDDLWDRWDDVEAQFARMARWAPHQSPEGWADADMLPLGRIGIRAERGDDRHSRLTPA
FT                   EQVTLLSLWVISRSPLMMGGDLPTSSPETIALLTNDAVLDVLRTSRASREVLREGDLVL
FT                   WTAEGADDGGTRLVPSGAPVRYAAVFHLGDEPTRVRLALGDVGGLPTDAVVDVWSGEQV
FT                   PTVAGALELDLPAHGAHLLRLSPRS"
FT   gene            complement(56587..57105)
FT                   /locus_tag="Bcav_0054"
FT   CDS_pept        complement(56587..57105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0054"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78320"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUU6"
FT                   /protein_id="ACQ78320.1"
FT                   /translation="MRQVAARRVHLLRHAMPAARPDADPRAWPLSDEGRAAAARLAGTL
FT                   PAGLLLSSTEAKAVETITLAAGPPTTDARFGEVSRPGEPFDDAVVARRRAWVESRLDVR
FT                   HAGWETPDEAAARFDAGVRAYPGEDMVIATHGMVMVAWLARVGVVSAGAAAGELWIGLA
FT                   FPDLVTVCV"
FT   gene            57164..58135
FT                   /locus_tag="Bcav_0055"
FT   CDS_pept        57164..58135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0055"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: Bacterial regulatory proteins, lacI family;
FT                   Periplasmic binding proteins and sugar binding domain of
FT                   the LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78321"
FT                   /db_xref="GOA:C5BUU7"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUU7"
FT                   /protein_id="ACQ78321.1"
FT                   /translation="MRDVAALAGVSVKTVSRVVNLEPHTRPEVVRRVRAAIAELDWVPN
FT                   GSARTLRTGRTGLVAVAVTELRRPHLAMLGEALVDEIGRRGLQAAVEPTHGDPARLRDL
FT                   LDARGRIFDGLVLIGDPGEDLLTGLRAQHPVVLVHGGGRGTVDAVDADLVEAASLVARH
FT                   LVVMGRSRPVLLGLDRGAGGVEAMRAALASAGVTEPAPAIGGVRTRADGADVVDRARRE
FT                   RPDLDTLVCGSDEVALGALAALARDGVAVPDDVAVIGFDDLDDGQFTTPSLTTVDPGPG
FT                   RLARAAIDLLADRLSGTAPAEPRRVISPVELIRRESTLGGMS"
FT   gene            58132..59139
FT                   /locus_tag="Bcav_0056"
FT   CDS_pept        58132..59139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0056"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: Bacterial regulatory proteins, lacI family;
FT                   Periplasmic binding proteins and sugar binding domain of
FT                   the LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78322"
FT                   /db_xref="GOA:C5BUU8"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUU8"
FT                   /protein_id="ACQ78322.1"
FT                   /translation="MKAPTLADVAAVAGVSAKTVSNVLLGRPGVSARTRESVREAIAQV
FT                   GYAVNPAGRGLASGRTGRVAVVVPMLYQPYFAEMAERLILALEAHGLATTLRIAPDGRS
FT                   ELDAVLGVSTRDVDAVVICPHLLSAELIGDAVLPRPVVQVGGGPVDRIDGVIMGERAGA
FT                   EAVARHLLDGGRRRIALVWNAPRGEMPSGSRYEGYRSVLAEHGIDVDPALIARGSDWDR
FT                   RVSGYEAMVGLLQSGARFDAAMCVNDAVAVGALRALRGHGRRVPEDVAVTGFDDTDEGE
FT                   FTTPSLTSVSPHQEDMVAAAVAMLVERLGGYDGAARHVQTSAHLVVRDSSRPPV"
FT   gene            59501..61432
FT                   /locus_tag="Bcav_0057"
FT   CDS_pept        59501..61432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0057"
FT                   /product="protein of unknown function DUF1680"
FT                   /note="PFAM: Putative glycosyl hydrolase of unknown
FT                   function (DUF1680)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78323"
FT                   /db_xref="GOA:C5BUU9"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012878"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUU9"
FT                   /protein_id="ACQ78323.1"
FT                   /translation="MTTTPAPPTHALVAAPATPRAAVAQHRPLDVRAVRLSSAGPLGAW
FT                   QERNATATIPHCIEQLEASGVLDNFRRVIGESGAPYRGFVFADSDLYKVIEAVAWEIAR
FT                   SGTGRWDAWLDDVVGLVARTQDDTGYVMTWIQGLHPEKRFAELEWTHEMYVLGHLVQAA
FT                   VALDRATCRADLLRIAERFVALVDRRFGPGREEGICGHPEIETALVELYRHTGDERHLA
FT                   LAQRMIDLRGRGLLKAGSFGPRYFQDHAPVREARTAVGHAVRQLYLDAGVTDVYLETGE
FT                   PELLDAMRAQWVDAHERKMYLTGAFGSRHRDEAFGDAYELPSERAYAETCATIADLHWT
FT                   WRLQLVGGTAAHADVVEREIHNALAASVDATGTRFFYSNPLQLRPDRHSEENAPRERAA
FT                   WYSCACCPPNIARVVAQLAAYVASSTAETLWLHQYADAEIDLPEHLGTGVLEVRTDYPR
FT                   SGVVDLAVRGTPAPGAHLALRVPAWSTRTLLDGVPVAAEDGYVRVDLADGAAWRLELDV
FT                   TPRWTQAHPRVDAARGCLALERGPLVYCVEQADVPDGVAVDDLVVDPAAAPVERTRDDG
FT                   ALVLDVTCRTSGTPTQLYRTAAAGTPSSTTGDGAARRVPVTAVPFATWGNRAPGAMRVW
FT                   LPAPESTD"
FT   gene            61486..63141
FT                   /locus_tag="Bcav_0058"
FT   CDS_pept        61486..63141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0058"
FT                   /product="extracellular solute-binding protein, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78324"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUV0"
FT                   /protein_id="ACQ78324.1"
FT                   /translation="MSRTTTARRRPGRTRAATGAAAGLAAASLVLTACTGGGGGEGDGG
FT                   GEADGDSGGGETIQILVLKHPLTGPMADMGWVADLEEAADVTIEWEEVSADWDQKKSTM
FT                   LAAGDIPDLIVGTNAITNSDFATFQGLFEDLSDDLDALPNVQGMFEALPETEIMATQPD
FT                   GTIYGLPGYRRFWPQTATRQYVNQEWLDNLGLETPTTLDELFDVLVAFKDEDANGNGDP
FT                   NDEIPMDWSPTGTGGFGFFQPTAFLGSFGLPISGGGGAGYFVEDGEVGNFLTDERYRDV
FT                   VEFLHECYAAGLISEEVMTQDYSAYQSVGRGDGDTARVGFSWGWTSSDRFGAQLAPQYA
FT                   ATGPMVVEGVDPVWSFDSYGLNYGINQVTMSASTDVKDAALRVIDAFYDQDMSLQVLWG
FT                   EFGQNIEQIDDSTYEVLPPADGTSDPSTWKWTTTLADNGPSWIRDDIDVTAPADLLESA
FT                   EQEEPLGEALDNIDIENNVWPGELIKMDQADLSTVSLNNTNVLNIAMQKWAEWITGGGA
FT                   TDQWDDYVAQLEGSGLTQNIEIHQRYYDEYVENR"
FT   gene            63248..64210
FT                   /locus_tag="Bcav_0059"
FT   CDS_pept        63248..64210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0059"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78325"
FT                   /db_xref="GOA:C5BUV1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUV1"
FT                   /protein_id="ACQ78325.1"
FT                   /translation="MAVTLREVAPPSVLKAPRKRGRLSRHIGRYWQLWAMVAPAIAFIA
FT                   VFMYVPMYGIQLAFREFNFATGITGGAWVGFTYFIQFFESPLFWTLMRNTVVISVSTLV
FT                   VGFVTPIVLALIVNQVIGRRRKKFMQTATYLPHFISIVVIVGMLQVFLSPSSGLITRFL
FT                   EALGITGVNFLGDTTAFVPAYVISEAWQHTGWNSIIYLAALASVSPQLYEAAKIDGANR
FT                   MQIIRHVDFPALVPTMIVLLILNMGGVLATGFEKIFLMQNPLNLGISEVIATYVYKIGI
FT                   IGNQFSYGTAIGLFNTLINFAFLVVTNQVAKRVSNTSLW"
FT   gene            64225..65181
FT                   /locus_tag="Bcav_0060"
FT   CDS_pept        64225..65181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0060"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78326"
FT                   /db_xref="GOA:C5BUV2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUV2"
FT                   /protein_id="ACQ78326.1"
FT                   /translation="MALFSRPAATAGAPGGSLLSTLRPRTGGDLAFMIGLGLVCVVILF
FT                   ATLYPIYFVAIASVSDPTLVSTGRVSFWPRGINWFGYEQIFADARIWTGYRNTLLYTVV
FT                   GTALNLVVTLPAAYALSRREFAPRRFLMLFFAFTMFFSGGLIPTYLLYRDLNLLDNWLV
FT                   FVLPSAVNVYNLIIARAFFEHSLPEELFEAATLDGSTYFQFFFRMAVPLSMAIISVIGL
FT                   YYLVQHWNDFFTGLVFVRDYSKQPLQIVLRDILISNQAFSGGAGGSGGSGGGSYAQQYA
FT                   DQIKYGVIIVSTLPVILLYPFLQRYFEKGVMIGSVKG"
FT   gene            65181..65867
FT                   /locus_tag="Bcav_0061"
FT   CDS_pept        65181..65867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0061"
FT                   /product="protein of unknown function DUF624"
FT                   /note="PFAM: Protein of unknown function, DUF624"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78327"
FT                   /db_xref="GOA:C5BUV3"
FT                   /db_xref="InterPro:IPR006938"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUV3"
FT                   /protein_id="ACQ78327.1"
FT                   /translation="MGAVLTWHQRLGRLGIQLLGAQLLWFAWTLRGGILLGAFPATAGV
FT                   HAAARDVVLAHRRGAEPPSFRDMRDRVRRTWHDDFAVANRLGYGLALAWAFLVLDRRLV
FT                   ESVDLGGAAPVLAGLVTVLGIALGVVTVNAWVLQAHFTDGALALLRRGAVLAAARPAAA
FT                   LLASLGVAVVLCLYYLVPGLIPVFGVVAPAAVATASVWGSGVLTAPQSTPDATSGTPSS
FT                   PLVGAR"
FT   gene            65896..67686
FT                   /locus_tag="Bcav_0062"
FT   CDS_pept        65896..67686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0062"
FT                   /product="protein of unknown function DUF1680"
FT                   /note="PFAM: Putative glycosyl hydrolase of unknown
FT                   function (DUF1680)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78328"
FT                   /db_xref="GOA:C5BUV4"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012878"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUV4"
FT                   /protein_id="ACQ78328.1"
FT                   /translation="MTAPETPPSRSAVSAVLRPLGYTGRVRITDGPLADRIADAAETYL
FT                   GMSPDDVVHGFRLQAGLPAPGNPMTGWSSRTSQPTFGQWVSGLARLGVTAGVAEASQRA
FT                   VDLVDAFAATVGDDGDARMGLYGYEKLVCGLADTALYAGHEDALALLGRTAEWASRTFE
FT                   RARPAASPNDFAGGRIGPASHARTMEWYTFAENLYRGWLAGADDAVREFASEWHYDAYW
FT                   DRFLTPPPPGQPWDVPTWLHAYSHVNTFASAAAAYEVTGEVRYLDILRNAHTYLTTTQT
FT                   YATGGYGPSELTLPEDGSLGRSIEWRTDTAEIVCGSWAAFKLSSALLKHTGEARYADWV
FT                   EQLVYSGIGAVTPVRPGGRTPYYQDLRLGIATKLPHWDDWPCCSGTYLQAVSHLPDLVY
FT                   FGDDDGGLAVALYVPSTVSWESAGSTVTLTQRTAFPVEDTSTITVGGSGRFRLRLRVPP
FT                   WSEGFRVSVNGVAVDGVATPGDWFVLERDWADGDVVTVTLGAGLRVLPVDRWHPNRVAF
FT                   AHGPVVLAQNADWTMPMSLPTPWEMVDLDAAFERGEGLRYAPVGVGTARLPLGELRPLA
FT                   DVPERVPYRVYADLDDPRIV"
FT   gene            67871..68305
FT                   /locus_tag="Bcav_0063"
FT   CDS_pept        67871..68305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0063"
FT                   /product="GCN5-related protein N-acetyltransferase"
FT                   /note="PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78329"
FT                   /db_xref="GOA:C5BUV5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUV5"
FT                   /protein_id="ACQ78329.1"
FT                   /translation="MRVANLPEGYEASFDAARLDVERVHTWLSEDSYWARGRARETQEA
FT                   AIAGSLNLGVYESATGEQVAYARIVTDGATFGWLCDVYVARRVRGLGIGTALVRLVREE
FT                   GERLGLRRIVLATADAHAVYATAGFAPLEDPSMWMALQLR"
FT   gene            complement(68461..68988)
FT                   /locus_tag="Bcav_0064"
FT   CDS_pept        complement(68461..68988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0064"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78330"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUV6"
FT                   /protein_id="ACQ78330.1"
FT                   /translation="MPAAADAVLVTGTVGVGKTSVGESLSAYLEHAQVSHALIDTDAVR
FT                   RMWPSPADDPFHLALELANVAAVAANYRGAGAQRFVVTGVLERGEDRARYAEALGAERL
FT                   FVARLTADEHVVRRRLIARHDDDPDGLRWHLARRGELEAILDAAQLEDVLVDTTRLSPR
FT                   DAAERIAASADW"
FT   gene            69197..70729
FT                   /locus_tag="Bcav_0065"
FT   CDS_pept        69197..70729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0065"
FT                   /product="Alpha-N-arabinofuranosidase"
FT                   /EC_number="3.2.1.55"
FT                   /note="PFAM: Alpha-L-arabinofuranosidase C-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78331"
FT                   /db_xref="GOA:C5BUV7"
FT                   /db_xref="InterPro:IPR010720"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUV7"
FT                   /protein_id="ACQ78331.1"
FT                   /translation="MTTTARAVIDLDVPGPTISRHLYGHFAEHLGRCIYGGFWVGEDSD
FT                   VPNEGGIRLDVVEALRALQIPNLRWPGGCFADEYHWRDGIGPRSERPRMVNTHWGDVVE
FT                   DNSFGTHEFMALCELLGTEPYVNGNVGSGTVREMSEWVEYLTRPGTSPMADLRRANGRD
FT                   EPWKVPFWGIGNEAWGCGGNMRAEAYADLARQYATFCRDHGDNSLYRIAAGASNGDYAW
FT                   TEALMKAISCLGCTREPRGFFQGISFHYYTVPGPWHDKGSALEFDTDDYYTTMVKARGV
FT                   EEIIRGHAAVMDVYDPGKTVGLVLDEWGTWWNVEPGTNPGFLYQQNTLRDALVASVHFD
FT                   AFHRHADRLFMANIAQTVNVLQAMILTDPESGALVLTPTYHVFEMNTGHHDAAALDVHL
FT                   TGAGTKAVGDGELELISASASVKGDTALVSLTNLDADGAASVVLDLRGRSVVASRGRIL
FT                   TADSLQTHNTPDAAAVAPSSFDAVSVTDDAFGHGLAVEIPAHSYVTLELDLA"
FT   gene            complement(70799..71659)
FT                   /locus_tag="Bcav_0066"
FT   CDS_pept        complement(70799..71659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0066"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: Bacterial regulatory helix-turn-helix
FT                   proteins, AraC family; AraC-like ligand binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78332"
FT                   /db_xref="GOA:C5BUV8"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUV8"
FT                   /protein_id="ACQ78332.1"
FT                   /translation="MGMQRDDQGPDFELVLPGHLDVGAEYATHRPHGLPEWVVMLTITG
FT                   RGEVLPEARRADVAASLAVPPGTAVALHPHTPQRYGTAPAPGTWELLWVHVRPPMAWLP
FT                   LLDWPQHAPGIGVVRLSPVQAERAAAAMERAVAAHRAALPLAREFAVNAVEEALLWCAL
FT                   ANPHRERTDATVRAFVEHVSAHLEEQHSVSSIAAALGLSGSHLAHVVKEATGDPVMAHV
FT                   QRLRMDAACELLERTDLSVTQIAARVGYPDPLYFSRRFRAHTGDAPRDWRRARRPPRAE
FT                   VVLRG"
FT   gene            71731..72546
FT                   /locus_tag="Bcav_0067"
FT   CDS_pept        71731..72546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0067"
FT                   /product="Phytanoyl-CoA dioxygenase"
FT                   /note="PFAM: Phytanoyl-CoA dioxygenase (PhyH)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78333"
FT                   /db_xref="GOA:C5BUV9"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUV9"
FT                   /protein_id="ACQ78333.1"
FT                   /translation="MSTLTAPPSVRRERYETDGIIQVDGLIGQDEVAVIRDAFMEQVEL
FT                   DRTAVGSVHEVPEDDILARFPRFMHPHRRADLEVGRLARRYMTDRRVVDVLTELVGPVW
FT                   GAQSMFYFKPPTARGQAMHQDNFFLRSHPETCVAAWLAIDDCDADNGGLAVVPGSHAME
FT                   VVCPEEADAELSFTKGLVRPPEGMEAVQSEMRAGDVLFFHGSLVHGSLPNTTADRFRRS
FT                   LIFHYVPQGSTEISRSYNPLVDVETGEELTIADATGGGPCGDAWEGSAH"
FT   gene            72704..74308
FT                   /locus_tag="Bcav_0068"
FT   CDS_pept        72704..74308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0068"
FT                   /product="ankyrin"
FT                   /note="PFAM: Ankyrin repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78334"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUW0"
FT                   /protein_id="ACQ78334.1"
FT                   /translation="MSELPAHPDLDHLRKQAKRLLRGYRAGDPEAYARLRHALPAAAGL
FT                   DDAALAARGFALHDAQSCVAREHGAASWVELRDVVEARAANAGGDATARWLRLVYAGDT
FT                   LGGTYAAQPRSAARWLTERPDLLGDDPWLACAVGDETTIRAALRDPGWVNRAGGPLGLP
FT                   PLVALTHSSLVRQPEYADGIRRCARLLLDAGADPNQSTLTRWSEPGDDEPGEYPLSALY
FT                   GAAGLTHDRELTAQLLAAGADPDDGESLYHSLDDPDCARLLLDAGATITGTNAMYRVFD
FT                   VGDRDDVGLLRLLLDAGGDPNEPSEGWGAPLLFAIRRRRSVAHVRTLLDAGADPRATTH
FT                   GVSAYRLARLFGLVEVAELLRAAGAADDLSPAEEFAAACAAGDRPTVRRLLGERPDVVG
FT                   TLSAEQLRLLPDLAEEGAGEAVRVMVEAGWPVDVRGSWDGTALNHAVFRGDAALTAFLL
FT                   DHGADWRARHGFGDTVLGTLSWASLNREDAAADWPGCARALLHHGVEVPDGYVFADDVA
FT                   EVVAEAPGQVRVESGHA"
FT   gene            complement(74423..76042)
FT                   /locus_tag="Bcav_0069"
FT   CDS_pept        complement(74423..76042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0069"
FT                   /product="Amidohydrolase 3"
FT                   /note="PFAM: Amidohydrolase family; D-aminoacylase,
FT                   C-terminal region; Amidohydrolase family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78335"
FT                   /db_xref="GOA:C5BUW1"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUW1"
FT                   /protein_id="ACQ78335.1"
FT                   /translation="MPSRVVFAGIDLIDGTGAPARAADVVVDGDSITAVVPPGSGPLDG
FT                   ARVVDGALPDGRRATLTPGFIDMHAHSDLALVHDREHLAKVSQGVTTEVVGQDGIAYAP
FT                   LVLGGSDVTSDVVRQIAAWNGTGDVAWRTVPEYLRAVDGAAVNAAFLVPQGNLRMLVVG
FT                   QTDRPASPAEVAQMRELLAAGLDAGARGMSSGLTYTPGMYATADELAALAAVVAERGGY
FT                   WAPHTRGYGGHALDAYREVLDVGRRTGCPIHLTHATMNYPPNRGRAAELLALVDAALAD
FT                   GVDVTLDTYPYTPGATTLAALLPSWAAAGGPDATLARLRDTTPSGPRAAILDALDVTGS
FT                   DGNHGEVVDWAGIQVSGVTTASLAGAVGLTIAELASRRGLPPSTAALELMVADGLGTGI
FT                   LMHVGDEDNVRAVMRHPRHCGGSDAILVGARPHPRAWGTFPRFLGHYARDLGVLSMPEM
FT                   VRHLTSNPAARLGLTDRGVVAPGMRADLVLLDADAVLDGATFDAPRTPAVGISHVMVNG
FT                   EFVLDDGVRTSATPGRVLRSRG"
FT   gene            complement(76072..76380)
FT                   /locus_tag="Bcav_0070"
FT   CDS_pept        complement(76072..76380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78336"
FT                   /db_xref="GOA:C5BUW2"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUW2"
FT                   /protein_id="ACQ78336.1"
FT                   /translation="MASTLPLVAGALSTIIFAVSTLPMLAKAARTKDLSSYSLGNLGLS
FT                   NVGNAVHSLYVFSLPAGPIWVLHSFYVAVAVLMLAWYLRYEHRRRAPVPADDPDALV"
FT   gene            complement(76410..77810)
FT                   /locus_tag="Bcav_0071"
FT   CDS_pept        complement(76410..77810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0071"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD binding domain; Berberine and berberine
FT                   like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78337"
FT                   /db_xref="GOA:C5BUW3"
FT                   /db_xref="InterPro:IPR006093"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR012951"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUW3"
FT                   /protein_id="ACQ78337.1"
FT                   /translation="MSALDTGPDAVVAELRQMIHGRTVGPTDPDYDTARRVYNGAVDRR
FT                   PAAVVRVSDVADVIRCVELARDRGLPLAVRGGGHHGAGFGVWDDALVIDLGDLRSVAVD
FT                   PQGGTVRVAAGCTWAEVDRATGEFGLATPSGFVSTTGVAGLTLGGGTGYLTRHYGLTVD
FT                   NLLSANVVLADGDVVTASATAHPDLFWALRGGGGNFGVVTSFTFACHPVGDAGEIVGGP
FT                   VLYDLSDTEEVFRWYRDLVPALPDELNGWIGVLEVPSAAPFPEELWARKVCGIVWCYSG
FT                   PRDRADEVLAPVREFGSPLLTGLAPMPYATLQSAFDGLLPAGLQWYWKADFFEEITDAA
FT                   IALHRTYGESIPTPLSTMHLYPISGAASRVPADATAFAYRHGGWNGVIAGIDPDPANLA
FT                   KVTDWARRYWEELHPTSAGGAYVNMMGDEGQERVRAAYRDNYERLVELKRRYDPHNLFR
FT                   INQNIEPA"
FT   gene            77983..78951
FT                   /locus_tag="Bcav_0072"
FT   CDS_pept        77983..78951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0072"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: Bacterial regulatory helix-turn-helix
FT                   proteins, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78338"
FT                   /db_xref="GOA:C5BUW4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR032783"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUW4"
FT                   /protein_id="ACQ78338.1"
FT                   /translation="MDVLSDVLLAVRLTGAVYFDIEARSPFVAESPPTDKIAAKVAVDA
FT                   DHLIAFHVLTSGSCWVEAVDEPEPAVLLRAGEMVIFSSGEANILASAPGMRGQPDASRY
FT                   YRPVNEALPFVIDITGDAAADRCRIVCGYLACDKGPFNPLLDSLPRMVHAPVSERSWGW
FT                   MTSLLDAAIVASDERDAGQEAMLAKLSELMFVEALKTHIEGLPADTRNWVAGLRDREIG
FT                   SALRLMHGRFAEPWTLEHLARDVGMSRSSLAERFTAYVGVPPMTYLARWRLQLAARLLQ
FT                   SGSGVAQAASAVGYQSESAFNRAFKRQVGEAPGVWRRRLRA"
FT   gene            79071..79679
FT                   /locus_tag="Bcav_0073"
FT   CDS_pept        79071..79679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0073"
FT                   /product="bifunctional deaminase-reductase domain protein"
FT                   /note="PFAM: RibD C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78339"
FT                   /db_xref="GOA:C5BUW5"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUW5"
FT                   /protein_id="ACQ78339.1"
FT                   /translation="MKLTTMTQVTLDGVMQGNGAVSDDRRGGFERGGWARGAGDDETRA
FT                   FIAQTYQRAAAFLFGRRTYEMFAGSWGSLGSMRAHPIGVALNEAPKYVASTTLAAARWK
FT                   GTAVLRGELATAIRELKAEVGGDLQVHGSGALTRWLLANDLVDEMTLITIPVILGQGAR
FT                   LFPDTGPDRALDMIESRVDSKGVTIQVYRPAGRPRYATD"
FT   gene            79722..80045
FT                   /locus_tag="Bcav_0074"
FT   CDS_pept        79722..80045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0074"
FT                   /product="YCII-related protein"
FT                   /note="PFAM: YCII-related protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78340"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUW6"
FT                   /protein_id="ACQ78340.1"
FT                   /translation="MQYLVSVIDDKSAPGSTDRRPAISAFNERLIAGGYWVFAGGLADP
FT                   DDATVIDNRGEKAVLSDGPFVETKEYLAGVWVWDVPDRDVALRLAAEASKVCDRKIEVR
FT                   PFQ"
FT   gene            complement(80053..80652)
FT                   /locus_tag="Bcav_0075"
FT   CDS_pept        complement(80053..80652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0075"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78341"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUW7"
FT                   /protein_id="ACQ78341.1"
FT                   /translation="MATRHLYLARHGDADAFGELTPSGRHQAALLGERLAGVPVDALWH
FT                   SPLPRAVASAHEIARHLSGVPVAEAAELVDHIPYVPEPDELPDAWAPFFDGMDAAEAAA
FT                   GARTADALVARFARPAPRDADLHEVLVTHAYQIAWLVRHALDAPPARWLGLDSANAALT
FT                   VIEHRPGLPPGVVMVNDMSHLPAELRWTGFRGVVRP"
FT   gene            complement(80687..81913)
FT                   /locus_tag="Bcav_0076"
FT   CDS_pept        complement(80687..81913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0076"
FT                   /product="pyruvate phosphate dikinase PEP/pyruvate-binding"
FT                   /note="PFAM: Pyruvate phosphate dikinase, PEP/pyruvate
FT                   binding domain; PEP-utilising enzyme, mobile domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78342"
FT                   /db_xref="GOA:C5BUW8"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUW8"
FT                   /protein_id="ACQ78342.1"
FT                   /translation="MLLRDATATAGGGKAGALGTLVRAGLPVPDAFVIPFDAWRDAVRR
FT                   LDLPTSPHGPGAAAARRAIADAPLDPALVEAIARGLERLGDPPVAVRSSAAGEDTAHAS
FT                   AAGAHESVLAVRGVAAVADAVRACWASLLSARALAYWDAAGPGLPAGDPEMAVLVQRLV
FT                   DAEVSGVLFTPDDDGDATRIEASWGLGPSVVGGTVTPDAYLVAAGGEVTSTIADKRTRQ
FT                   DRRGTRLVVSDVRHDLRHRPALDHATVTRLAGLGHAVADALGGPQDVEWALADGEAWIL
FT                   QARPVTAAPPRGPAVATERGPAVLTGTPGSHGSATGTARVVTGPDDFSRVAPGDVLVCP
FT                   WTDPAWTPLLRIAAGVVTETGGVLSHAAIVARERRIPAVLAVADATTRIRDGGTVTVDG
FT                   TAGTVTTLA"
FT   gene            81971..82366
FT                   /locus_tag="Bcav_0077"
FT   CDS_pept        81971..82366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0077"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78343"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUW9"
FT                   /protein_id="ACQ78343.1"
FT                   /translation="MPRKDDLAEAAQSDHARAGVEQRARERLLELGADELDDRPWRPAP
FT                   VPPSAVDLAQFALWRAADLDPADLLRALALLPAARDEVEGIEAGLLFTARGAGLTWAQI
FT                   ADALGFNSPQACQQHFHRLTARAGDAP"
FT   gene            82363..83007
FT                   /locus_tag="Bcav_0078"
FT   CDS_pept        82363..83007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0078"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78344"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUX0"
FT                   /protein_id="ACQ78344.1"
FT                   /translation="MTRESPADLLALHAVRITGFADTPVLADRVGLGTAAATEALEDAE
FT                   ARGWVRRAAFADLAGWSLTDAGRAENERALAAELAATGRGDDVRAVYRDFLPLNARLQR
FT                   ACTDWQLRPAPGGRLAANDHTDQEWDAGVVRELAALDTEVGPLAARLEAVLTRFRGYDA
FT                   RFGSALRRVRAGDDSWVDGTDVDSCHRVWFELHEDLVATLGIDRGAEPCVS"
FT   gene            complement(83000..83779)
FT                   /locus_tag="Bcav_0079"
FT   CDS_pept        complement(83000..83779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0079"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: Phosphotransferase enzyme family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78345"
FT                   /db_xref="GOA:C5BUX1"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUX1"
FT                   /protein_id="ACQ78345.1"
FT                   /translation="MSDDAEVPLSGGFANTVVKRGDTVRRNTGPWTPTVHALLRHLRST
FT                   GFDLVPEPLGIDDDGREILGFLPGDVAWWPWPPVLQRDEGIRAVASAVRQMQAALRTFD
FT                   EPADAVWHGGPRTDARHQIRHGDLAPWNTLWVGDRLTGIIDWDTADPAPAGWDAAQGAW
FT                   YFVPLRPLTGYRTAGPAPTIRERAHRLAVWCDELGEDPAHLLDVLDDVQRYERDRIRER
FT                   GGAGEEPYATFLAKGAADDVEQERTWLAAHREELLAS"
FT   gene            83922..84074
FT                   /pseudo
FT                   /locus_tag="Bcav_0080"
FT   gene            85484..86029
FT                   /locus_tag="Bcav_0081"
FT   CDS_pept        85484..86029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0081"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78346"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUX2"
FT                   /protein_id="ACQ78346.1"
FT                   /translation="MTQRTHRRVGLGFGPSPGGRKWRDEVATRAAERQRAWLAELGHID
FT                   NEPAEAPHDDHDERKGPAAENPDAVTSADAIRRGAAEALRPFAAHVREKPRSANPWRIL
FT                   YGTPRGEELGAVLATRFAAAGLQPVDLIHEHPSAERGWGPVLVTLVQAPDGETMRFEDE
FT                   DQVEHAVQWAREHATFYW"
FT   gene            complement(86628..87593)
FT                   /locus_tag="Bcav_0082"
FT   CDS_pept        complement(86628..87593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0082"
FT                   /product="transcriptional regulator, TrmB"
FT                   /note="PFAM: Sugar-specific transcriptional regulator TrmB"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78347"
FT                   /db_xref="GOA:C5BUX3"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR002831"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUX3"
FT                   /protein_id="ACQ78347.1"
FT                   /translation="MLEGIGLDEESARVYRALVERPSSTSAELAPDVGLAPSRVAEILG
FT                   ALETAGLAARQGADSERAVASPPGVALRALLAEQERRLDAVRSDLVDLEAVYREALAGR
FT                   TVPDVVDLVLGADAVRQRFAQLQAAAGQQVRAFVRSDVPFVSAEENAEEERALLRGVRY
FT                   RVLVERGVLDNPRFLAAAREALPYGEYVRVAPTLPTRLLIIDDDLALLPMRRPTDDRYG
FT                   AILVHPSSLLDLLVEVFETTWSRAARLTDEGEPGAVDNLEELDGSLLTLLMVGLTDSRI
FT                   ASQLGVSTRTVQRRVSALMDLTRVATRFQLGAEAVRRGWV"
FT   gene            87706..91791
FT                   /locus_tag="Bcav_0083"
FT   CDS_pept        87706..91791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0083"
FT                   /product="LPXTG-motif cell wall anchor domain protein"
FT                   /note="PFAM: PA domain; Subtilase family; TIGRFAM:
FT                   LPXTG-motif cell wall anchor domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78348"
FT                   /db_xref="GOA:C5BUX4"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUX4"
FT                   /protein_id="ACQ78348.1"
FT                   /translation="MRAPSTPTSSRARHQRRTLLAGLAATAVVLSSSALASAEPDDGSG
FT                   TSEPPGAGPGAVSADGTAGRHTVTLITGDVVTLTNLADGTQTVDVEPVDPGAVVQTYVA
FT                   DGDIHVVPEAALPYLAAGALDDDLFDVTQLVEYGFDDASVDATPVIVEYTEARGFSAAP
FT                   VTGLDLELALSSIGGAAGGADRDAAEQAWAELTSGPQAFGAGAATFAGGIEAIHLDAPV
FT                   EAYLDTSVGYIHAPEAWAAGFDGSGVRVAVLDSGVDAGHPDLADVVVETQSFVPGEGVE
FT                   DVNGHGTHVASTVAGSGAASDGAYRGVAPGADLLVGKVLSDVGEGLSSWIIAGMEWGAA
FT                   NADVVSMSLGSREASDGTDIMSEALNTITAETGTLFVVAAGNNGAPGTIGSPAAASGAL
FT                   TIGSIDDLTGDLSWFTSQGPLSGSGALKPDVSAPGSQITAARSQYSPGEGAYTTMDGTS
FT                   MATPHVSGAAAIALQADPTLTGAQLKDLLVSSATDLGFTAYQAGSGVVDALAVVKRDVF
FT                   ATGSADFGMLPWGESSGPLEREVTFTNRSDADVTLDLALTVAVETPGDGDGGGGIEPGA
FT                   LAAEDAVVLPQNQVTVPANGTASVTLSGDHSAIEPGQQLSGTLVASVAGEPVTRTSIGM
FT                   ITEAERYDLTLRATGIDGQPAALYAMFFNLDTQSAESIPVDGETTLRLPAGRYSAMAFP
FT                   DVETAPGVDAVALVGDPDIVLDGDTVVDLDVRAADPVTVDVGRDGLAFENRRMDYSVEG
FT                   MMGSAMIPILVDELLAQPLVAESAESFGFTTRWRLREPRVTLTLDGTNLEPVEQVAAPY
FT                   LDGDVSGPATDLGTGSADDVAGVALDGGIAVVRGSAEVSPPERAVNAAAAGSSLLVVVQ
FT                   PEDVFEWYGDELGNDAPLPVVVVSGERGEALLAALAAGEVTLDAVGKPVADDVYDVLLY
FT                   TDGEIPENPTKIADDLALITTTYHGTEDRLVGEFRYDFAPGVDVGQGFPFATQRPSVRR
FT                   EWVSTTDARWYQDVLDVDSTWSVRDVVRSYAPGEELEASWFAPIVRPFVGAGYWAPFRQ
FT                   ADAVQINVPGWADGGSVQHTGAMDTWSGMPGFSQNGQLYVDGVLVKEQAAQGLTVWDLP
FT                   AGESRFRFVNTTTHDASVIPTSTSTVTEWEFDSSASQEEAVLPMIQAFYDVDAAIDGTV
FT                   GGERAYGEPVPLGLELGHLAGAAGAAPLTSVAAEYSTDDGATWQPLELAEAGAGSGTLA
FT                   PTAAFVGEREHVRAFDAAVPVPDAGGAVSLRVTAADEAGNAFSQEIATAFVAAPAQEEP
FT                   VDPGPEPTDPTDPGDPGVPGPGDGDPTDAGPAPDGDGPSGSLPSTGASIGLLVLIAAAA
FT                   VAGGVLLRRRFAARSTQG"
FT   gene            92007..93005
FT                   /locus_tag="Bcav_0084"
FT   CDS_pept        92007..93005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0084"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78349"
FT                   /db_xref="GOA:C5BUX5"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUX5"
FT                   /protein_id="ACQ78349.1"
FT                   /translation="MATLPIVDDGVPQDLGSPRERGAAPAASTTYDPRGPLDLGATLAP
FT                   LRHGPYDPTVALGPRGGWVALRTPHGTATLRIEARDAVVHADAWGAGAEWAVASVPELC
FT                   GAGDDVSDFDAAAHPAVREARRRQPGLRLTRTSRVLDALAPAVLEQLIHSSEAHRAWRT
FT                   LVRKHGVPAPGSGPDGPAPGGLMVAPDADGWRRVPVWDWRRAGISETRGAMIARAAAVA
FT                   PALERTLALGRGGPEASRRLRSLPGVGAWTAAETLQRAHGDPDAPSFGDLHVPAAVGWA
FT                   LTGSAVDDAGMAELLVPWAGHRQRVVRLLLRAYGFPPRRAPRAAVPRHRRW"
FT   gene            93074..93916
FT                   /locus_tag="Bcav_0085"
FT   CDS_pept        93074..93916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0085"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78350"
FT                   /db_xref="GOA:C5BUX6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUX6"
FT                   /protein_id="ACQ78350.1"
FT                   /translation="MSPIGWQEREVTVGERPVFVRLGPEVPGTVPIVHVHGFGVSGVSL
FT                   MPTAELLADRWTTFVPDLPGHGRSVGWGPGLDIPAIAHGLLGLLDELELERVVLLGNSM
FT                   GSPVILEVAHEARDRVAGAVLVSPAGGVHNQPLARALRQLGRDAVRENPRMATIVVPDY
FT                   VRFGLPSTFRLFRELTRFPSLERLLRTPVPTLAVIGTRDPLMPPPWRVREVGRLAPDHV
FT                   TVVVIEGAAHVVNFSHPAELAHVVASWLDGVEIVDDPEAPGVSRVLRLPRGGRDPAVR"
FT   gene            complement(93928..94485)
FT                   /locus_tag="Bcav_0086"
FT   CDS_pept        complement(93928..94485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0086"
FT                   /product="GCN5-related protein N-acetyltransferase"
FT                   /note="PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78351"
FT                   /db_xref="GOA:C5BUX7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUX7"
FT                   /protein_id="ACQ78351.1"
FT                   /translation="MPVELRPWRPEDAPHLRRARATSPDLATQLGAVDLSTDEACSEFI
FT                   AGHLGLSTTATHHAIVSDGVVVGNVGLTHIDRRHDTAWVSYWLSAAARGRGLAAPAAAT
FT                   VARWAFRDLDLYRLELGHRLNNPASCRVATAAGFVPEGVERAKLRYGDERFDVETHARL
FT                   RTDVPPALEKLSFTPPVPALSG"
FT   gene            94888..95649
FT                   /locus_tag="Bcav_0087"
FT   CDS_pept        94888..95649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0087"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78352"
FT                   /db_xref="GOA:C5BUX8"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUX8"
FT                   /protein_id="ACQ78352.1"
FT                   /translation="MDRTFDELVAEAASEPVEGWDFSWLDGRATEERPSWGYARLLGER
FT                   MARASATLDIQTGGGEVLAGVLTKPPLAVATEGWPPNVAKATALLHPLGVVVVADDDDD
FT                   PPLPFADAAFDLVTSRHPVRAHWTEISRVLAPGGTYLSQEVGPSSVFELSEFFLGPQPQ
FT                   EAHLSRHPDHAVAAATAAGLDVVDVRLERLRMEFRDVGAVVYFLRKVIWIVPGFTVGAH
FT                   RDRLRELHDLIQTNGPFVAHSSRFLIEARKP"
FT   gene            complement(95721..96236)
FT                   /locus_tag="Bcav_0088"
FT   CDS_pept        complement(95721..96236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0088"
FT                   /product="protein of unknown function DUF437"
FT                   /note="PFAM: ASCH domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78353"
FT                   /db_xref="InterPro:IPR007374"
FT                   /db_xref="InterPro:IPR009326"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUX9"
FT                   /protein_id="ACQ78353.1"
FT                   /translation="MGTDRTPAAALDVATATRMWQAYAEARPAAVAACPEYTVERFGDS
FT                   AALADELLSWVLGGGKRATSELVAEFGARGDDLPRIGSHWIACDGAGTPRVILRSVELR
FT                   IGTMDSVDEDFAVDEGDGTREIWLEEHSAYWTRTCAARGAVLTGDDEVVFERFRVVWPP
FT                   EHADPDLA"
FT   gene            complement(96241..96795)
FT                   /locus_tag="Bcav_0089"
FT   CDS_pept        complement(96241..96795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0089"
FT                   /product="YceI family protein"
FT                   /note="PFAM: YceI-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78354"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUY0"
FT                   /protein_id="ACQ78354.1"
FT                   /translation="MDESSASLLGDWDFDPAHTRIGFSAKHAMVTTVRGAFNDVTGFIH
FT                   ADLEDLSQSSVNVTLGAASVDTRNSQRDDHLRSPDFFDVEKWPEITFVSTNIDQIEDQD
FT                   FAVSGDLTIRDVTRQVMLPITLIGVQQDATGSLRAGLEGSRRINRRDFGLEWNMPLDAG
FT                   GLLVSERITLEFEISAIKRAE"
FT   gene            96966..98300
FT                   /locus_tag="Bcav_0090"
FT   CDS_pept        96966..98300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0090"
FT                   /product="Pyrrolo-quinoline quinone"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78355"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUY1"
FT                   /protein_id="ACQ78355.1"
FT                   /translation="MTSDARLHRRRLVATTLGLVLPAVLLASCATEGEGGTGDDGAAPA
FT                   ATEEAPTSDATEAATATPRLAVTYDGGIQVLDAATLEVVDDIELAGFNRLNPAGDGRHL
FT                   VVSTSGGFQVLDAGAWAVAHGDHAHYYTAPPVLTDVVYEAGTPGHVVVHDGRTALFDDA
FT                   TGHVVVTGSGDVALGDVDREHTTPSAHHGVAVELSDGTLVVSEGTEEARTGIRVLDAAG
FT                   QEIAASDECPGVHGEAVAADEAVVVGCEDGVLVVLDGVVTKVASPDAYGRIGNQAGSEA
FT                   SPIVLGDYKSDRDAELERPTRVSLVDTRSGEMRLVDLPASYTFRSLARGDDGEALVLGT
FT                   DGQVHVIDPATGDLTASIPVIEPWEEPEEWQSPRPAILTLDGSVYVTDPATNRVLAVDV
FT                   PTGEVWQSAELGVTPNEIAGVSGDVEAGASAEHEHEDEHEDGHDH"
FT   gene            98409..99344
FT                   /locus_tag="Bcav_0091"
FT   CDS_pept        98409..99344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0091"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: Aldo/keto reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78356"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUY2"
FT                   /protein_id="ACQ78356.1"
FT                   /translation="MKTFTLPGTELVVPNVVLGLMRIAEMSDDDVRHLVRTARDAGIDF
FT                   VDHADIYGGDHGCERRFAEAMRLTPSQRAEIVIQSKAGIVPGAGGLRYDFSYDHLVGQV
FT                   DGSLAALGTDYLDILLLHRPDALVEPEEVARAFDDLASAGKVRYFGVSNHTPGQIELLK
FT                   KYVTQPLVANQLQLSITHASLIAQGVSANMAGEDQAVDRDGGVLDYCRLHDITIQAWSP
FT                   FQAGFFTGVFLGSPDHPELNAVIDRLAAAYDVPPIAVATAWITRHPAQMQVVLGTTTPE
FT                   RVTGAAQGSDLPLTRAEWYELFRAAGHLVP"
FT   gene            complement(99423..100733)
FT                   /locus_tag="Bcav_0092"
FT   CDS_pept        complement(99423..100733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0092"
FT                   /product="alanine racemase domain protein"
FT                   /note="PFAM: Alanine racemase, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78357"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR026956"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="InterPro:IPR042208"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUY3"
FT                   /protein_id="ACQ78357.1"
FT                   /translation="MAHASSSDALGTTPPRLGPEHKSFPPRAWGRTAAGAGLRLRDLAT
FT                   PVLTLDAAALEHNLATLAAWCAEHGVDLAPHGKTTMAPQLWHRQLDAGAWAITVATPWQ
FT                   AQVARAAGVPRILLANALVDPAGIAWAAFAVADDAGPTELLSWVDGVDGVARLEDALAS
FT                   HGAPVPLDVLVELGTARTGARGVDAALAVAAAVRRSPHLRLAGVAGYEGAAAHDRSDEA
FT                   VAAVRAYVADVVALHDAVDGSYEVPTPVLTLGGSAFPDLVVDGVAGLRDGVRVVLRSGA
FT                   YVLHDDGFYASVTPFGRGAAGGDVPLRSAMHAWARVVSRPERGLALLDAGKRDVPYDEG
FT                   LPTPQLVAGAGVVGRAALAGAHVSALNDQHAFLRLPRDDAWGAADDPLGVGAVVRLGLS
FT                   HPCTAMDKWRLVPVVVGSADEDPDLDAPVTDAVATYF"
FT   gene            100822..101265
FT                   /locus_tag="Bcav_0093"
FT   CDS_pept        100822..101265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0093"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; TIGRFAM:
FT                   endoribonuclease L-PSP, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78358"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUY4"
FT                   /protein_id="ACQ78358.1"
FT                   /translation="MSEQTSTAADAAPSSGAKVAILTSDAPPPAHTFSQGVRKGPILQV
FT                   SGQGPVDAATGAYRHPGDVAAQTTLTLRNVKAIVEAGGASFADVVMLRVYLRHEGDFAS
FT                   MNEAYGAFVAEHAGEVLPSRTTVFTGLPRPEMLVEIDALAVVD"
FT   gene            101273..101482
FT                   /locus_tag="Bcav_0094"
FT   CDS_pept        101273..101482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0094"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78359"
FT                   /db_xref="GOA:C5BUY5"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUY5"
FT                   /protein_id="ACQ78359.1"
FT                   /translation="MQPRTRRVVAWLVVLALAAPAILGAIAASRYYDVRLPVLGVALVV
FT                   LLVIYLRSRRRDDGRRREPADPWG"
FT   gene            101916..102167
FT                   /locus_tag="Bcav_0095"
FT   CDS_pept        101916..102167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0095"
FT                   /product="glutaredoxin-like protein NrdH"
FT                   /note="PFAM: Glutaredoxin; TIGRFAM: Glutaredoxin-like
FT                   protein NrdH"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78360"
FT                   /db_xref="GOA:C5BUY6"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011909"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUY6"
FT                   /protein_id="ACQ78360.1"
FT                   /translation="MSITVFSKPACVQCDATHRALRKHGLDFTVVDLTMDAEALESVKA
FT                   LGYQQAPVVLANGDHWAGFRPDKIRALAEGAGSVAAVA"
FT   gene            102268..102684
FT                   /locus_tag="Bcav_0096"
FT   CDS_pept        102268..102684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0096"
FT                   /product="NrdI protein"
FT                   /note="PFAM: NrdI Flavodoxin like; TIGRFAM:
FT                   ribonucleoside-diphosphate reductase 2, operon protein
FT                   nrdI"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78361"
FT                   /db_xref="GOA:C5BUY7"
FT                   /db_xref="InterPro:IPR004465"
FT                   /db_xref="InterPro:IPR020852"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BUY7"
FT                   /protein_id="ACQ78361.1"
FT                   /translation="MSRLVYFSSVSENTHRFVAKLGLAADRIPLRPTEPFLRAEDEYVL
FT                   IVPTYGGGNGLGAVPKQVIKFLNDPGNRSLVRGVIAAGNTNFGEAFCIAGDIIAAKCDV
FT                   PYLYRFELLGTDQDVLRVREGLGRFWLQRSQIPA"
FT   gene            102705..104810
FT                   /locus_tag="Bcav_0097"
FT   CDS_pept        102705..104810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0097"
FT                   /product="ribonucleoside-diphosphate reductase, alpha
FT                   subunit"
FT                   /EC_number="1.17.4.1"
FT                   /note="PFAM: Ribonucleotide reductase, barrel domain;
FT                   Ribonucleotide reductase, all-alpha domain; Ribonucleotide
FT                   reductase N-terminal; TIGRFAM: ribonucleoside-diphosphate
FT                   reductase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78362"
FT                   /db_xref="GOA:C5BUY8"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR013554"
FT                   /db_xref="InterPro:IPR026459"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUY8"
FT                   /protein_id="ACQ78362.1"
FT                   /translation="MDYHALNAMLNLYGPDGRLQLDKDRSAAREYFLQHVNQNTVFFHN
FT                   LKEKLDYLVEHGYYESEVLGKYSREFVEHIFDVAYAKKFRFTTFLGAFKYYTSYTLKTF
FT                   DGKRYLERFEDRVVMVALTLADGDEQLALELVDEVISGRFQPATPTFLNAGKAQRGELV
FT                   SCFLLRIEDNMESIARGINSALQLSKRGGGVALLLSNIREYGAPIKKIENQSSGVIPVM
FT                   KLLEDSFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSLGVVIPD
FT                   ITFELAKKNEDMYLFSPYDVERVYGVPFSEISVTEKYYEMLDDARIRKTKIKAREFFQL
FT                   LAEIQFESGYPYIVFEDTVNRANPIKGRITMSNLCSEILQVSTASSFNDDLSYADTGKD
FT                   ISCNLGSLNIAHAMDSPDLGKTVGVAIRSLTAVSDQTHIWSVPSVEKGNNDSHAIGLGQ
FT                   MNLHGYLARERIHYGSAEGVDFTNIYFYTVLYHAIAASNQIAIERGSAFAGFSESQYAS
FT                   GEFFDKYTDGVWEPATDRVAQLFADAEVHIPTQSDWQALKASVMEHGIYNQNLQAVPPT
FT                   GSISYINHSTSSIHPIVAPIEIRKEGKIGRVYYPAPYLSDDNLEYYADAYEIGYEKIID
FT                   TYAAATQHVDQGLSLTLFFKDTATTRDINKAQIYAWRKGIKTLYYIRLRQIALEGTEVE
FT                   NCVSCVL"
FT   gene            104823..105629
FT                   /locus_tag="Bcav_0098"
FT   CDS_pept        104823..105629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0098"
FT                   /product="hypothetical protein"
FT                   /note="TIGRFAM: group I intron endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78363"
FT                   /db_xref="GOA:C5BUY9"
FT                   /db_xref="InterPro:IPR003611"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUY9"
FT                   /protein_id="ACQ78363.1"
FT                   /translation="MIDELVARLTLVGSVYGIRRVDSLEYRYVGITTKPIDVRLAQHVK
FT                   NARLGTKTPLCDWLRKHGSDAIVVDLLDQVYTGPEDLGDLEIGWIRQLREGGHRLLNVS
FT                   EGGLGPTGVVWTQEQREAARLRSTGRKGVSRPGELNPFHGRHHSPEQREQWARQRKGTN
FT                   AGPANPNFGKFGPDHPSFGHVMSLESREALSKARRGEGNPNFGKVTSPETRAKQSAATK
FT                   GIPRPKSARSAHTRYHTNKGRTSTACKYCVEDGAASSGTSEGTMLP"
FT   gene            105626..106606
FT                   /locus_tag="Bcav_0099"
FT   CDS_pept        105626..106606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0099"
FT                   /product="Ribonucleoside-diphosphate reductase"
FT                   /EC_number="1.17.4.1"
FT                   /note="PFAM: Ribonucleotide reductase, small chain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78364"
FT                   /db_xref="GOA:C5BUZ0"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR026494"
FT                   /db_xref="InterPro:IPR030475"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUZ0"
FT                   /protein_id="ACQ78364.1"
FT                   /translation="MTPTGKLKLVSRVSAINWNRLQDEKDLEVWNRLVNNFWLPEKVPV
FT                   SNDIPSWGTLTDVEKTLTMRVFTGLTLLDTIQGTVGAVSLIPDALTPHEEAVYTNIAFM
FT                   ESVHAKSYSSIFSTLCSTREIDDAFRWSEENSNLQRKAEIVMEYYRGDEPLKRKVASTL
FT                   LESFLFYSGFYLPMYWSSRAKLTNTADLIRLIIRDEAVHGYYIGYKFQRGLEALAPEQR
FT                   EEIKSYTYELLFELYENEVQYTEDLYDEVGLTEDVKKFLRYNANKALMNLGYEALFPKD
FT                   ETDVNPAILAALSPNADENHDFFSGSGSSYVIGKAVNTEDDDWDF"
FT   gene            107385..109178
FT                   /locus_tag="Bcav_0100"
FT   CDS_pept        107385..109178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78365"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUZ1"
FT                   /protein_id="ACQ78365.1"
FT                   /translation="MSTETAAVAEIMRILSRCPHLEGVLASHDRVPLTDGHIDVYSSLS
FT                   RANKDWLGRVNVQIKGRASRKGTAASFSLKREVLEAHLRNAGVLLLCVDVDQKRAKATP
FT                   RYAALVPFEIRRILASAPEKQKSVAIPLRKLPRLPGAVERIVEVIRVGARQNPFATTDP
FT                   RLFESIKHITISTAEEVDFNVPTRLRPGEGAFAVEVTTENGSQVPLDGEFEILPEDYVA
FT                   RERDVRVVAGNAAFDSFVVQRISSDQTCVALGEGLSIVIHEGGEGRGVDINITCPSNFV
FT                   ARKRAVEFMVGIFDNGEIALGDRTLTLGEVPASKGPDIEEIRGHLAFLCRLQEVFDKFQ
FT                   FDGALIDLEGMTERDIEHLDVLYRVFVEGVAPCNTSGESGRMLVNFGPWAVMLVAVRGH
FT                   EPGTWRFIDPFDPASPQMLRWAAQNDRDVTIPVTAYDIVEPEHLPKVLNLRLDLIDAAY
FT                   ERIAHSESTVTIANQCVRDLLNCADSGGARQEEFLHGAARLNDWIIRRDGERDVHRLNQ
FT                   WQIAWRRHGLTDVDRTEIRRMKRASANSQDEMAVHQELACALLLGDREESEFLANQLTT
FT                   AQRDVMEGWPIWELRRHLVRT"
FT   gene            complement(109692..110036)
FT                   /locus_tag="Bcav_0101"
FT   CDS_pept        complement(109692..110036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0101"
FT                   /product="hypothetical protein"
FT                   /note="PFAM: Predicted membrane protein (DUF2078)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78366"
FT                   /db_xref="GOA:C5BUZ2"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUZ2"
FT                   /protein_id="ACQ78366.1"
FT                   /translation="MSIEALPALADGATHWGGPFPFFWIFPLFWLVVIGLLIWAFARRR
FT                   SRGHWGPPWAWGPPAAGSAAPSAEQVLADRFARGDINEQEYRARLGVLRSTGSTPPGVP
FT                   PQQPPAPPAG"
FT   gene            complement(110175..110840)
FT                   /locus_tag="Bcav_0102"
FT   CDS_pept        complement(110175..110840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0102"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: Bacterial regulatory proteins, luxR family;
FT                   Response regulator receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78367"
FT                   /db_xref="GOA:C5BUZ3"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUZ3"
FT                   /protein_id="ACQ78367.1"
FT                   /translation="MIRVLIADDQALIRGGFRSLLDAEDDVEVVAEAADGAEAVRLAAE
FT                   TRPDVVLMDIRMPKLDGLEATRRIVADPRASGAHIVVVTTFELDEYVAEAIRAGASGFL
FT                   VKDTEPAELVRAVRVAAAGDALLSPTVTRRLLAQVAESTRAVKAVPGLDHLTDREREVL
FT                   VTVAEGLSNDEIAAKLFLSPSTVKTHVSRTMTKLAARDRAQLVVAAYESGLVRPGWGS"
FT   gene            complement(110837..112018)
FT                   /locus_tag="Bcav_0103"
FT   CDS_pept        complement(110837..112018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0103"
FT                   /product="histidine kinase"
FT                   /note="PFAM: Histidine kinase; Histidine kinase-, DNA
FT                   gyrase B-, and HSP90-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78368"
FT                   /db_xref="GOA:C5BUZ4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUZ4"
FT                   /protein_id="ACQ78368.1"
FT                   /translation="MVPPQAAPPDRTFPARRLTVPTLVLGFFTVAGTWGAHRFQSDERS
FT                   FGLGTLVLVLAVVACLPLAARRPHIAAPLAVALTLGYLALGFAHGPILFAAGVVIALAT
FT                   ATGRPPVAYASAAAYAVGFVVIAALQDGAPTWSAAGAALAFGGLPVLVGLLLRTWRDRA
FT                   MARRALRAAEERTSLADERLRLARELHDVLAHSLSAIAVQAGVAAHLLDRDPDLARRAL
FT                   LDIRTQSTESLDEVRSLIGILRADGDADAGARAPGADLDAIPTLVERTRAGGIAVDLVL
FT                   TVPDGVAVADAVSRAAYRVVQEGLTNVRRHSAARAARVRVTGDTAGLTISVHDGGPPAA
FT                   GESSPGSSAGWGLRGMRERVEQLGGTVEAGPDSDGGFTVRVRLPYAAAREGTS"
FT   gene            112173..112868
FT                   /locus_tag="Bcav_0104"
FT   CDS_pept        112173..112868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0104"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78369"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUZ5"
FT                   /protein_id="ACQ78369.1"
FT                   /translation="MATSLPLFPVDGAMNNARWCDAVCTALGLPSSTGRRVWSAGGRPP
FT                   AGYPDAVTLAADATVPEVLDVVEPGPGATVKDSFATLDLAPQGFHVLFDAHWIVRRSAQ
FT                   SVPTHSWARVSKPAALAVWAEAHGGGPTFAPSLVDHPDVRFLALVDDGAVRAGVVLSTS
FT                   PGRKGTVVGVSNVFHVDGDVAAVWADVVALTGRAWPGAPLVGYEADADLAPALAAGFVA
FT                   AGPLRVWAR"
FT   gene            complement(112870..113592)
FT                   /locus_tag="Bcav_0105"
FT   CDS_pept        complement(112870..113592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0105"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: Phosphotransferase enzyme family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78370"
FT                   /db_xref="GOA:C5BUZ6"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUZ6"
FT                   /protein_id="ACQ78370.1"
FT                   /translation="MSGGAGRLASAANLLGRGRTADVYDLGDGLVLRRYRDGYDAEREA
FT                   EIQAHVAEHGFPAPAVVEAHGPDLVMARVAGPTMLGALVAGDARPDEAAHLLADLHDRL
FT                   HALPAPAGPREPGDVVVHLDLHPDNVMLDPERGPVLIDWANARLGTADLDVAMTALILA
FT                   EVAVAPPDSELAAQAGPALAAVPALGAAFLAAVDGDARLGLAGALAMRAANPTLDAAEK
FT                   ERLSTAVRAVREWADAAG"
FT   gene            complement(113589..114629)
FT                   /locus_tag="Bcav_0106"
FT   CDS_pept        complement(113589..114629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0106"
FT                   /product="Luciferase-like monooxygenase"
FT                   /note="PFAM: Luciferase-like monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78371"
FT                   /db_xref="GOA:C5BUZ7"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019951"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUZ7"
FT                   /protein_id="ACQ78371.1"
FT                   /translation="MRFGFHTGYWSAGPPPGAADAVRLADELGLDSVWTAEAYGSDAFT
FT                   PLAWWGSTTQRVRLGTGIAQMSARTPTATAMAALTLDHLSGGRFILGLGASGPQVVEGW
FT                   YGQPYARPLARTREYLKIVRDVLRREAPVTAPGPAYPLPLPDDAVGATGEGKPLRSTVH
FT                   PLRADLPIHLAAQGPRNTALAAEIADGWLPAFFSPRLNEDAAEALEDGFARRDPHLAGR
FT                   EHFEVSASVPVALGRDVEEAADRLRPQIALYVGGMGSAATNFHRAAIARLGYADPIEKI
FT                   TRLYAAGDRAAAAAAVPTDLVLDVALAGTPLDVAAQLEEWRTTVVTTLIVQTDPRALPA
FT                   LAEVLR"
FT   gene            114794..115174
FT                   /locus_tag="Bcav_0107"
FT   CDS_pept        114794..115174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0107"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: Bacterial regulatory proteins, gntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78372"
FT                   /db_xref="GOA:C5BUZ8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUZ8"
FT                   /protein_id="ACQ78372.1"
FT                   /translation="MLRLDTASAVPFADQIAAQVRHGLVTGELRPGSRLPSARELGAML
FT                   DVNLHTVLRAYQQLRDEELLELRRGRGATIRAGAAVDRARLGELARDLLAEARRLGMTT
FT                   DAVVALVRDAARTSPSSFGRTP"
FT   gene            115171..116184
FT                   /locus_tag="Bcav_0108"
FT   CDS_pept        115171..116184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0108"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78373"
FT                   /db_xref="GOA:C5BUZ9"
FT                   /db_xref="UniProtKB/TrEMBL:C5BUZ9"
FT                   /protein_id="ACQ78373.1"
FT                   /translation="MTTPDRPAARVPEARVVRPAPWRRPLALGLVWLPVVLLAVLGSVW
FT                   LPRLPDVTASHWSGSGAADGFTASVPFWAWTTAVAAAIAAVATIVAYARRVLPFVAVWC
FT                   VVGGAFVTALAALLWTASAAATLRAPGPEQALLGAGGVAALFVPFAWAGLAFLAHGRPA
FT                   VVRPEPASIEPLPLADTERAAWSTTLTSRMFLYLAAGVGVLGGLMTFSAANGNPETRGI
FT                   FVPLAVLFVGVAFMLLVLARVRVSVDGRGLRLTSWLGFPVTRIPLDDVAAARAEQLEPG
FT                   EWGGWGYRWMPGRTAFVLRRGPALVVDRRDGRQFAVTLDDPATPAALLERLRADVA"
FT   gene            complement(116343..117266)
FT                   /locus_tag="Bcav_0109"
FT   CDS_pept        complement(116343..117266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0109"
FT                   /product="Luciferase-like monooxygenase"
FT                   /note="PFAM: Luciferase-like monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78374"
FT                   /db_xref="GOA:C5BV00"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019952"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C5BV00"
FT                   /protein_id="ACQ78374.1"
FT                   /translation="MQLRIFTEPQQGASYDDQLAVAQATERLGFDAFFRSDHYLTMGGD
FT                   GLPGPTDSWTALAGLARETSRIKLGTMVTSATFRHPGVLAIQVAQVDQMSGGRVELGLG
FT                   AGWFEREHAAYGIPFPAKRFGLLTEQLELITGLWSTPVGETYSFSGEHYQLVDSPALPK
FT                   PVQSPLPIIVGGNGPKRTPALAARFAAEYNTSFPEIADIPRRFDAVRAACDEAGRDPSS
FT                   LVYSAALVLCAGATEAEFARRAAAIGREPAELREHGIAGTVSEVVDRLGQLREWGAGRV
FT                   YLQVLDLADLEHLELVAADVAPQLPA"
FT   gene            117321..118043
FT                   /locus_tag="Bcav_0110"
FT   CDS_pept        117321..118043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0110"
FT                   /product="phosphoesterase PA-phosphatase related"
FT                   /note="PFAM: PAP2 superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78375"
FT                   /db_xref="GOA:C5BV01"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:C5BV01"
FT                   /protein_id="ACQ78375.1"
FT                   /translation="MTDDGGEQASPSSRRPRALGIVGGTLVLLVVTAGGLLRLDQQRWA
FT                   RLDDAASRAIGDADPAVDTVADVLSQALDAFDSWPGYLLIAAMLGVLALQRRWWHLAAA
FT                   ASTALGGVITSQLIKLWVDRLRPEGTQVDTHDASFPSGHSTLAACFVVVVGMCLGSAAR
FT                   RWWWPTGGLLLVAMMLSRVHVHAHWLSDTIAGALLGIGVGMVVWWAMYPQLERELLSEE
FT                   HRTDVGARAGKNPRAADR"
FT   gene            118280..119230
FT                   /locus_tag="Bcav_0111"
FT   CDS_pept        118280..119230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0111"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: Phosphotransferase enzyme family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78376"
FT                   /db_xref="GOA:C5BV02"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C5BV02"
FT                   /protein_id="ACQ78376.1"
FT                   /translation="MRLAYDRGMVDVEPAGRASEALPAYVAVAVAGVPEVDVVAVAPLA
FT                   GGTGAATADVARVTARTPDGRELTLVRKSVRPLRAGRHAEAARAPEHWAYWRREPLAYA
FT                   SGVLPSGPGLRAPRCFGVETAADTLTLWLEDVVGPEAEPVAAARALASWQASAPVPDVP
FT                   WLGGHQLAQRLAVTDLDWTQVDADPRVARVWAARHELMAALDGVPSVLSHGDAGLGNLR
FT                   EATGDVVALDWGTFGVAPVGSDAAHLALSAQADVLGPYVDALDGTFAVDDVRRGYRTTL
FT                   ALVGASRVHWMLAAGVSVPRGYVDLLWRLRPDGVR"
FT   gene            complement(119240..120073)
FT                   /locus_tag="Bcav_0112"
FT   CDS_pept        complement(119240..120073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0112"
FT                   /product="Siderophore-interacting protein"
FT                   /note="PFAM: Siderophore-interacting FAD-binding domain;
FT                   Siderophore-interacting protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78377"
FT                   /db_xref="GOA:C5BV03"
FT                   /db_xref="InterPro:IPR007037"
FT                   /db_xref="InterPro:IPR013113"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="InterPro:IPR039374"
FT                   /db_xref="UniProtKB/TrEMBL:C5BV03"
FT                   /protein_id="ACQ78377.1"
FT                   /translation="MARTNTAAARVKPAVSELLTLHVLRRATVSPHLVRVTLGGGDAAR
FT                   FRYLGFDQWFRLFIPVSQDSLARLPNKLDTIAYLKYLAISATSRPVLRNYTVRAYRADG
FT                   PDGPELDVDFVLHGSAADGTAGPAASWAESCAVGDAVAIIDEGITFTPPEGLERVLIVA
FT                   DETGLPAVAGILASLPRGSRGHALVEIPSEADAQPLDAPDGVVVTWVARTDPHDVPGRA
FT                   VLAAAQALPLGDEPFYGWVVGEQALPSALRRHWVHAGVPKHHITFTGYWKAKRHR"
FT   gene            120261..121772
FT                   /locus_tag="Bcav_0113"
FT   CDS_pept        120261..121772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0113"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: Polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78378"
FT                   /db_xref="GOA:C5BV04"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:C5BV04"
FT                   /protein_id="ACQ78378.1"
FT                   /translation="MRAAGGRGPHIEGHGAGAALLVALVLAVAIACTAPSGDPGAPSPD
FT                   GLVRADALAALDPSSVPGLESSTESSTDPDHTVAISTVVAPGLDDLNALTTAFVERWRP
FT                   LGAAGTDLDVGWNVALAVRSVLALRVHAALEVGSADAVRGAATFYADATRGAAWSGREL
FT                   FTDDGASSLAEALAAAELRAATRAPGAPAPSITPTSSPYPDDLPGTGVLDDVAFDARGD
FT                   LLVTRPDADGWLTWKVPADVASPWLSDAGRIVRGSVRSGGTFVGLPGQAAAPAPSDGPL
FT                   AVPLVPPPRPPDPPAGPDCAVVRCLALTFDDGPGPHTQRLLDELAAAGVPATFFLVGQN
FT                   AASRPELVAAIAAAGHQIGNHTWNHPDLTGLDAASVRDQLDRTASAIRDASGVTAPLVR
FT                   PPYGAIDDDVRAVLAQRGSPAVLWSVDTEDWRHRDAAETTRRAVEQAEPGAVVLLHDIH
FT                   PSTVEAVPGIVQQLTDAGYTFVTVSQLFAGQTLEAGHGYSQRAAG"
FT   gene            121777..123000
FT                   /locus_tag="Bcav_0114"
FT   CDS_pept        121777..123000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0114"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: Amidohydrolase family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78379"
FT                   /db_xref="GOA:C5BV05"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C5BV05"
FT                   /protein_id="ACQ78379.1"
FT                   /translation="MVASVLAVTGGYVLPVSAPAIDGGTVVVTDGVITAVGGSDTPVPD
FT                   GATVVDATGKWVLPGFVESHGHLGVHEEGEGWSGNDTNEMTDPNGARFRALDGIDIEDE
FT                   GFRDALLGGVTSAVIKPGSGNPIGGRTVAIKTWGGRTVDEQVIAADVSVKSALGENPKR
FT                   VYGDKKVTPSTRLGVAAVLREAFVAARNYAEKRAAAATKGEPFERNLTHETLAAVLDGD
FT                   LVWDQHCHRHDDIATAIRLSEEFGYRLVINHGTEGHKIADVLAEKDIPVIFGPMLTSRS
FT                   KVELRDRAIRNLALIAAAGVRVAITTDHPVIPINFLVHQASFAVKEGLPRETAFEALTV
FT                   NPAAFLDLDERIGALEAGRDGDVVVWSGDPLDITSRAEQVFIDGRAALVTGDDGVPHVV
FT                   ERHERFSH"
FT   gene            123003..123497
FT                   /locus_tag="Bcav_0115"
FT   CDS_pept        123003..123497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0115"
FT                   /product="protein tyrosine phosphatase"
FT                   /note="PFAM: Low molecular weight phosphotyrosine protein
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78380"
FT                   /db_xref="GOA:C5BV06"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:C5BV06"
FT                   /protein_id="ACQ78380.1"
FT                   /translation="MSTGSAPFRVLVVCTGNICRSPMAEVVLGERFADAGLDGRVVVDS
FT                   AGISDGERGNPIDRRARAVLAEHGYPVPSREARQVTPSDVAEPDLLLAMTDAHARALRR
FT                   LGAREDQVRLYRSFEPDAGEAPLDVPDPWYGDREDFEECLATVEAGAPGIVAYVQERVG
FT                   G"
FT   gene            123589..124008
FT                   /locus_tag="Bcav_0116"
FT   CDS_pept        123589..124008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0116"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78381"
FT                   /db_xref="InterPro:IPR027392"
FT                   /db_xref="UniProtKB/TrEMBL:C5BV07"
FT                   /protein_id="ACQ78381.1"
FT                   /translation="MKCPIDDSPLVMTERSGIEIDYCPTCRGVWLDRGELDKIIERAAP
FT                   GAGTSLPPPVPDPAAPGPGPGPSPAAPRYEEPYDRPYDQPGYEPRFDGRGYDRGYDQRG
FT                   YGESYDPRRDPRSQDPRYRRKKKRGGFLEDLFDFD"
FT   gene            complement(124059..124547)
FT                   /locus_tag="Bcav_0117"
FT   CDS_pept        complement(124059..124547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0117"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/Bleomycin resistance
FT                   protein/Dioxygenase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78382"
FT                   /db_xref="GOA:C5BV08"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C5BV08"
FT                   /protein_id="ACQ78382.1"
FT                   /translation="MTTEASSDAVPYRPAGYSTITPFLCVDGAAAAVAFYTDVFGAHEI
FT                   ARAAAPDGTIAHAELQVGDGRLQLGDPNPAYGIVAPSGDDAVTFSLAIYVPDCDAVTEA
FT                   AARAGATVREQPSTFVTGDRFASIRDPFGIRWSIMTRVEDVSDEEADRRVREWMAAQG"
FT   gene            124632..125489
FT                   /locus_tag="Bcav_0118"
FT   CDS_pept        124632..125489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0118"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: Bacterial regulatory helix-turn-helix
FT                   proteins, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78383"
FT                   /db_xref="GOA:C5BV09"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:C5BV09"
FT                   /protein_id="ACQ78383.1"
FT                   /translation="MPADGRGALVHPHQLQRVLHRAVLPVIDPRLAPYVEHFWSVAWQR
FT                   HGEAPATSEVITRPVCHLTFENGVADDGGPLVRHGVTMPAAVVTTVWTRRFVVDLDGEG
FT                   RAFGVGFRPGGLAALAGRELLADLTLPADDVLPGAAALLPRVLAEDDDAARHAVVEGWL
FT                   VGLAAEPDPAYLDAVALIERVWTDSSIVRVEQIGEVAGLSARSVQRMFRRYVGVGPKWV
FT                   LVRARLRDAAARLDGEGEASVSLADLAAELGWADQSHLVRDFRRQLGTTPGRYARDARA
FT                   APTT"
FT   gene            complement(125517..126032)
FT                   /locus_tag="Bcav_0119"
FT   CDS_pept        complement(125517..126032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0119"
FT                   /product="phosphoribosyltransferase"
FT                   /note="PFAM: Phosphoribosyl transferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78384"
FT                   /db_xref="GOA:C5BV10"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:C5BV10"
FT                   /protein_id="ACQ78384.1"
FT                   /translation="MESFPTPDDHPDREVLTWPEFGHAARALARAVLDDGWTPDVVIAV
FT                   ARGGLVPAGAVAYALDTKAMGTLNVEFYTAVGETLPDPVVLPPLMDTSHLAGRRALVVD
FT                   DVADSGRTLALVMDLMRSHGAEARSAVLYTKPQSVIQPDYSWRETDRWIMFPWSSLPPV
FT                   GGGASRDA"
FT   gene            126099..126764
FT                   /locus_tag="Bcav_0120"
FT   CDS_pept        126099..126764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0120"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78385"
FT                   /db_xref="InterPro:IPR029010"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C5BV11"
FT                   /protein_id="ACQ78385.1"
FT                   /translation="MQSSTKQALIVRGGWDGHSPVATTDLAAAALTDHGYAVVVSDTLD
FT                   AYLDADALAATDLIVQCWTMGEITGDQVAGLRAAVAAGTGLAGWHGGIADAFRATPEYL
FT                   QLVGGQFVAHPGGIVDHSIEVAPERADHPIVAGFTSVALTTEQYWVLSDARNDVLATTT
FT                   LAPSPGGEWTEPFVSPAVWTRTWGAGRVFVCTAGHQLGDLETPEIAGIVERGMLWASR"
FT   gene            126761..127903
FT                   /locus_tag="Bcav_0121"
FT   CDS_pept        126761..127903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0121"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: Oxidoreductase family, C-terminal alpha/beta
FT                   domain; Oxidoreductase family, NAD-binding Rossmann fold"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78386"
FT                   /db_xref="GOA:C5BV12"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5BV12"
FT                   /protein_id="ACQ78386.1"
FT                   /translation="MSEGTAAAPVPWTTASLASPLRVGIVGAGAIHRAYTQTMARMPDV
FT                   AIVAVADLDPARAAASAAEHPGVRASGVDELLAADDVDLVLNLTIPAAHAEVALRALAA
FT                   GKHVYGEKPLAASVASAHAMVDAAAGAGRVLTCAPDTVLGTGTQTARHAIAAGTIGRPT
FT                   SATAFFTAPGHELWHPDPDFYYAPGGGPLLDMGPYYVTALVHLLGPVTSVVGAANRARA
FT                   ERTIGSGARAGVTVPVDVDTHVTGVLEHASGALSTLVMSFDTWRADLPNLLVHGTSGSL
FT                   SVPDPNGHGGDVRVAGPATDREWVEVPPAAGYVGAGRGIGVLDAARALAAGTTPRASDA
FT                   VALHVLDVMATLLQAAQGGGRADVSTTCEVPPLVPLTPVG"
FT   gene            complement(127916..128590)
FT                   /locus_tag="Bcav_0122"
FT   CDS_pept        complement(127916..128590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0122"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78387"
FT                   /db_xref="GOA:C5BV13"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5BV13"
FT                   /protein_id="ACQ78387.1"
FT                   /translation="MRTALVTGGASGLGSACAERLTDDGLRVVTVDVAAGADHVLDVSD
FT                   SDAVRDLAARLGPVDVLVNSAGIIGANVPLVDVADEDWQRVFAVNVFGTFALCRAFAPG
FT                   MVERGWGRIVNVASMAGKDGNPNLSAYSASKAAVIGLTKSLGKELATTGVLVNAVAPAV
FT                   IDTPMNAATEPEVLEHLRSLIPMRRLGRPEEFAALVSFLASDAVSFSTGAVYDLSGGRA
FT                   TY"
FT   gene            complement(128587..129372)
FT                   /locus_tag="Bcav_0123"
FT   CDS_pept        complement(128587..129372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0123"
FT                   /product="regulatory protein GntR HTH"
FT                   /note="PFAM: Bacterial regulatory proteins, gntR family;
FT                   FCD domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78388"
FT                   /db_xref="GOA:C5BV14"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5BV14"
FT                   /protein_id="ACQ78388.1"
FT                   /translation="MTEAGAETERSSGYSMRGLQGRVIEAIGLDVVGGRYRPGQLLPRE
FT                   AELMVEYGVSRTSLREAMKVLAAKGLVDIRQKVGTRVRPVEMWNAFDSDLLAWFHASGQ
FT                   GEAPMRDLVELRQVLEPAAARFAATRATMADLHDLERAQQAMLDTAHDHAGYAATDVAF
FT                   HLAVYGASHNALLRRFGHLVADFMHLSFDVQQHAAADGPADFTEDAQGHAAIFEAINRG
FT                   DADAAAEAMLQVVLDGKSALIKALSHRGTAESRGTRGAP"
FT   gene            complement(129369..130589)
FT                   /locus_tag="Bcav_0124"
FT   CDS_pept        complement(129369..130589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0124"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="PFAM: Mandelate racemase / muconate lactonizing
FT                   enzyme, N-terminal domain; Mandelate racemase / muconate
FT                   lactonizing enzyme, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78389"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:C5BV15"
FT                   /protein_id="ACQ78389.1"
FT                   /translation="MRIESVEFFYAAMPSITLEADGSQDALLVRVVADGVVGWGECEAS
FT                   PLVSLAAFVTPRSHGVCQPVSASVLGERLDSPADIARISALVARNSMDLLQAPHTYSGI
FT                   EMALWDLLGHAREEPVWRLLGYDASYPKVAYASLLFGDTPDETLSRARSATERGFRAVK
FT                   FGWGPFGEGTPEADADQLQAAREGVGRDTTLLVDAGQIWGEDVESAALRIPALEDARVT
FT                   WLEEPFPAHAYAEHAALAARTRTLRIAGGEGAHNLHMARNLVDYGHIGFLQIDTGRIGG
FT                   IGPAKAAADYAAGKGVTFVNHTFTSHLALSASLQPFAGLADHRISEYPAAPKALALDIT
FT                   RDHLLPDADGRIAAPEGPGLGVSVDLDRLGGYVRDVEILLDGDQLYRSPQVGGVAASSA
FT                   LHGIGRA"
FT   gene            complement(130636..131496)
FT                   /locus_tag="Bcav_0125"
FT   CDS_pept        complement(130636..131496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0125"
FT                   /product="SMP-30/Gluconolaconase/LRE domain protein"
FT                   /note="PFAM: SMP-30/Gluconolaconase/LRE-like region"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78390"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="InterPro:IPR039096"
FT                   /db_xref="UniProtKB/TrEMBL:C5BV16"
FT                   /protein_id="ACQ78390.1"
FT                   /translation="MNIDAIAATADELGESALWDAAEGALYWLDLARPTLHRWDGSGDV
FT                   RSSPVPLPAPLGALLPTSSREDLLLAAGRRLYRISRTSAAVAPLEPELGLTPGTHVNDA
FT                   KTDATGAIWLSTADVAERAPVGGLVRASDGTGAPERFVVTNGPAFSQDGSEVYVSDSVG
FT                   GRVLAYGLREGMLGEGRLVVQFSEDDGLPDGLAVDAEHGIWVAHWDAGCLSRHDPSGTL
FT                   TARVDLPARHVTSLAFGGPDLEDLFVTTARYELSPAEIAAHPGSGSVFRLRPGVRGVPA
FT                   EPASL"
FT   gene            131629..132372
FT                   /locus_tag="Bcav_0126"
FT   CDS_pept        131629..132372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0126"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78391"
FT                   /db_xref="GOA:C5BV17"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5BV17"
FT                   /protein_id="ACQ78391.1"
FT                   /translation="MPVRSTRRALVTGAASGIGAAVAHRLALAGMAVVCADVDVDGAGR
FT                   VAAETGGDPLELDLRSVPDDLGDRLGYLDVLVSCAGVADSTPTSDLDVAGYRRVMEINL
FT                   DGTVAVTLAVLPLLRAAASGRVLTISSVQGFRAAADTLAYATSKGALVTFTRALAVDVA
FT                   EDGVLVNALAPGFVDTPMARMPDGTREYDTPWFRSVYVEHARIPMRRPGTADEVAAAAE
FT                   FFVSPTNTYVTGQVLAVDGGLMATF"
FT   gene            132429..133757
FT                   /locus_tag="Bcav_0127"
FT   CDS_pept        132429..133757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0127"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: Bacterial extracellular solute-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78392"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C5BV18"
FT                   /protein_id="ACQ78392.1"
FT                   /translation="MRFTTRGALAVGAVLALGLAACSSGDPDAGEGGQTQIVIWDAGLL
FT                   TKSTEDGEIIEESSFLTQAVAMYEEEHPDIDIEVVQTTGDISATAAQFQAASIAGDGPD
FT                   IRTSFTGGNTISFAEFLLDLDGTFDDATVDDLSGWNTVREGYAEDGALLGMPYGGGSYF
FT                   YVFYNKELAEQAGLDLSEPPATWEDLLDVGQQVQDSGVEAAPFWIANLEGYVGAWVIAA
FT                   LVGGELGSDAFTQMYNQEIAVDDDAMVRAYEAYAELYSRGLTNPDAGSVSNGDASLGFV
FT                   QGDGVFYISGGWENASLTEAMGDNIGVFPIPVLEGAEYPNTAAGGPNIAISITNYSEVQ
FT                   EEAKDFLRFLAEPEMIDLYVELFQVEASNSASADPSVITNPLLQTQAEMLVDADAVVFP
FT                   FDNVMPQGLIDLFYRVNATTFLGTTTPEDAVGQLQDLASTELG"
FT   gene            133761..134696
FT                   /locus_tag="Bcav_0128"
FT   CDS_pept        133761..134696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0128"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78393"
FT                   /db_xref="GOA:C5BV19"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5BV19"
FT                   /protein_id="ACQ78393.1"
FT                   /translation="MGILAVREGGDVAAVTSPPSERQSRLARRGRMIGLAAVLPAFLVV
FT                   VGFMIYPVLFALYISFNDSNGLRFDWVGLANYLDILADPQVHQIFITNLKFLISVPLVI
FT                   FAALVVSILLFERIRGWRAFRVLFFLPNVLSAAVIGIMFKSVFGYNGPFMAALEALGGE
FT                   RIDPFVDGNLAIAVIVLALVWSGFGYQSLLLLSGLTAIDPAVFEAAALDGAGWWTRLWH
FT                   ITLPNIRRVLGFVFIINVLYTFSSLFGFVFVMTAGGPGFETTTLDYLVYLRAFSTSNLG
FT                   SGAALAVLLFMFIGLLTLVQARFFKLSEDD"
FT   gene            134698..135543
FT                   /locus_tag="Bcav_0129"
FT   CDS_pept        134698..135543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0129"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78394"
FT                   /db_xref="GOA:C5BV20"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5BV20"
FT                   /protein_id="ACQ78394.1"
FT                   /translation="MSASATSATLSRRARTPIFLLLVVGVVTVLYPIVFLLTSAFRSNA
FT                   DYLQNPYGLPGELTFRNFVVLWNSYGVGQAVMNSLTVVLIALVVELALAILAGYALAKY
FT                   DVPGAKLFRAGFVSVMLIPSQVLIIPIYLLLSRLNLVGEFAGLILVYIATGLSFATFFL
FT                   SLTFRGVPTELLEAARIDGAGFFRTLRSVAAPVGASGIATLAVLQFLAMWNELLFAYIL
FT                   LPDDDKTMLTPALAQIGGRYLSDQPLVSAGLLITALPPLLLLTFASRYVMQGLAAGVVR
FT                   "
FT   gene            135590..137599
FT                   /locus_tag="Bcav_0130"
FT   CDS_pept        135590..137599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0130"
FT                   /product="glycoside hydrolase clan GH-D"
FT                   /note="PFAM: Melibiase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78395"
FT                   /db_xref="GOA:C5BV21"
FT                   /db_xref="InterPro:IPR002252"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR031704"
FT                   /db_xref="InterPro:IPR038417"
FT                   /db_xref="UniProtKB/TrEMBL:C5BV21"
FT                   /protein_id="ACQ78395.1"
FT                   /translation="MSAQLDLVAGDQPTLAVRVGGRDAVVPSGLFRLEIDRRVVDGFDD
FT                   GSAEVLPGQAGVRGSVADGAAHVEWSAREIAGRGVWELAARITNTSDRPITLTRMDPLS
FT                   ARLAPGRWTTLHFRSAWGDEFAPERGTTDSHLRLDVRSGRSSHGRSPWLGLENGDAGVV
FT                   VAPAWSGNWHIDVIDGGRVDAGISTWRFATVLQPGESVTAPSVVLAAGSTLDDAAVALA
FT                   AAVGAAWIPRSPASEAMPVEWNHWWPYEDQEVDEGVIWRNAEVAASCGFDVATVDAGWF
FT                   GAPEADSVWMEQRGDWHQTNTARFPSGLAALGAGIRDRGVKAGMWIEAEAIGAAAELRR
FT                   SRPDVVALSEPSFRHDPSYGVQTVSLDPDDPSFLGYVCLGSPAGREHVSAALDALVTET
FT                   GAEWIKLDFNIDPDSGCRRTDHGHGADDGLFRHYEGLYAVLDAFRERHPEVVLESCSSG
FT                   GLRLDLGLARHVHCHFLSDPDYTEHHLQVLWGASLMLPPAAILHWSWSQWRGDYPPARK
FT                   DFAALGTDEFDAMLRAAMMHRFGVSLRLDELRPELLERLSAHVSLFHGSLADLVRSGSL
FT                   RRLSEQPVRGRRGERAPAFQLVAADRHAVFAFRLDGAEDLAPVHPVDIDDSRDYRVTDV
FT                   DSGDGFVRSGAELRRSGLSPAESRRSALWLLDAV"
FT   gene            137667..138623
FT                   /locus_tag="Bcav_0131"
FT   CDS_pept        137667..138623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0131"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="PFAM: Phosphoribosyl transferase domain; TIGRFAM:
FT                   ribose-phosphate pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78396"
FT                   /db_xref="GOA:C5BV22"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="UniProtKB/TrEMBL:C5BV22"
FT                   /protein_id="ACQ78396.1"
FT                   /translation="MRDIRVFAGQSGRAFAAEMCAGLGVPLSDSLLKRFANDCLEVQLL
FT                   ENCRERDVYLVQPIVAPTQENLMELLLMIDAAKGASARRITAVMPHFAYARSDKKDAPR
FT                   ISIGGRLVADLLETAGVDRVLTMTLHAPQVHAFFRVPTDQLHARRELAAHFAGADLSNT
FT                   TVVSPDLGNAKSATAFARMLGTRVAAGAKERFDDNRVVITSLIGDVAGRDIIVLDDEIA
FT                   NGSTIRAIVDLLDDAGVSSIRVACTHGIFSNGALDRIAGDDRITEVVTTDTVPQRAQHP
FT                   KLTVLGVAPAFADAVHRIHSGESVSALFDVRPEPADA"
FT   gene            complement(138627..139259)
FT                   /locus_tag="Bcav_0132"
FT   CDS_pept        complement(138627..139259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0132"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /EC_number="3.2.2.20"
FT                   /note="PFAM: Methyladenine glycosylase; TIGRFAM:
FT                   DNA-3-methyladenine glycosylase I"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78397"
FT                   /db_xref="GOA:C5BV23"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:C5BV23"
FT                   /protein_id="ACQ78397.1"
FT                   /translation="MTNTSPDDLRLDVGGIHTLRQADPPASGARCFGDGDPLYAAYHDT
FT                   EWGVPFTDSPDERELFERLSLEAFQSGLSWITILRKRDAFRAAFAGFVPEVVATFDDDD
FT                   VARHLADPGIVRNRLKVHATIANAHALAALHSEGGTLRALLEEHAPEPGPPPATFADVP
FT                   PETPGSRALTKVLKKRGFAFVGPTTLYSTMEAVGIVNDHLAGCPTRA"
FT   gene            complement(139350..139775)
FT                   /locus_tag="Bcav_0133"
FT   CDS_pept        complement(139350..139775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0133"
FT                   /product="Domain of unknown function DUF1801"
FT                   /note="PFAM: Domain of unknown function (DU1801)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78398"
FT                   /db_xref="InterPro:IPR014922"
FT                   /db_xref="UniProtKB/TrEMBL:C5BV24"
FT                   /protein_id="ACQ78398.1"
FT                   /translation="MATEPGDADVEAYVAAVEHPVRRRDAQRLLDLMGRISDERPRMWG
FT                   SSIVGFGQYHYRYPSGREGDGPTASFSPRKAAITVYLPDGVGPHADELARLGAHTTGKG
FT                   CLYLKDLDAVDLRVLEGIVRSSYETVTDGVFGSRAEG"
FT   gene            139835..142150
FT                   /locus_tag="Bcav_0134"
FT   CDS_pept        139835..142150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0134"
FT                   /product="alpha-1,2-mannosidase"
FT                   /note="PFAM: Glycosyl hydrolase family 92; TIGRFAM:
FT                   alpha-1,2-mannosidase, putative; glutamate--cysteine
FT                   ligase/gamma-glutamylcysteine synthetase, Streptococcus
FT                   agalactiae type"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78399"
FT                   /db_xref="GOA:C5BV25"
FT                   /db_xref="InterPro:IPR005887"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012939"
FT                   /db_xref="InterPro:IPR041371"
FT                   /db_xref="UniProtKB/TrEMBL:C5BV25"
FT                   /protein_id="ACQ78399.1"
FT                   /translation="MTASPPPSLVDDVDPLIGTTGEDPCEYGGMVPSTAPPFAMTRWTP
FT                   MTRENLISACPYHHDDERVIGFIGSHQPAIWMGDWGSVVVAPGVGEVRPDARDRGLVHD
FT                   RATEVAHPASYAVDLLVPGDIGRIRTRLTGTSRVGVLELVFDGADGVPLADAHVVVQAT
FT                   RAGFTGEVAIDPERREISGYNPERQDAHLGPPQAASFAGYFVARFDVETADDVAVDAFA
FT                   GVPAVAGTASLAAAVAAAAAPDPTASDVPAFASWGTAVGAELHEGETHRRDEHLAAWVR
FT                   FPAGTRRVVVRTGVSLISVEQARANLDAEVPDGVSVDDVVEQLRTAWAERLDLVRVEGA
FT                   SPEERTNLATALFHALQYPARLDEGDSGAAGARRYYNGYRDAVQATDRPVYTAFSLWDT
FT                   FRAQNALLTLLAPAELPDMMASLLASYSSSGWLPIWENLVETNIMVGTHADSILAEAVL
FT                   KGVDVDVPLAFEAAYKNASVPPDGDTERWWGDRELDPTPSARAGLTRYLENGWVAADET
FT                   AEAGSRTLDYAFDDHAVAVLADAAGRPEIAAELRERAQWYRNVWNAERGFMQSRNRDGS
FT                   WAEGGWTEGTQWPYTFQVLHDARGLRDLMGVDLFRARLDGHFAAGWNRHDNEPSHHIPY
FT                   LFSYAGQPWKTAEHTRRIARESYLATPDGLCGNDDLGQMSAWYVFTALGFYPVNPASTE
FT                   YVVGAPLFDRLEVDLPGAARPLVVVAPGAPTLPYVAALRVDGREVTTPFLQHAWIADGA
FT                   VVEFTMSAEPTDWGTELT"
FT   gene            complement(142143..142688)
FT                   /locus_tag="Bcav_0135"
FT   CDS_pept        complement(142143..142688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0135"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: Bacterial regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78400"
FT                   /db_xref="GOA:C5BVG0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVG0"
FT                   /protein_id="ACQ78400.1"
FT                   /translation="MDSTTAEQKLLDAADALFYDRGINAVSMDAIREVSGVSLKRTYQL
FT                   FPSKEHLVEAVLRVRDTAIRQDLAAYTSARTTPTEQILAVFDYLYDWFSTPEFRGCAFI
FT                   NSFAELRGSSPGVVDVVRTHKRAVADLIAVLVAEAGRPTTLAGQLLILANGAMVTAAIA
FT                   DSPQPAREARDAAERLLR"
FT   gene            142779..143648
FT                   /locus_tag="Bcav_0136"
FT   CDS_pept        142779..143648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0136"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78401"
FT                   /db_xref="GOA:C5BVG1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVG1"
FT                   /protein_id="ACQ78401.1"
FT                   /translation="MPHLATRHHTVAVGGQEVFYREAGDPSRPTLLLLHGFPTSSHMFR
FT                   NLIPALADEFHLVAPDHVGFGQSSAPSVEQFEYSFERLTEVTDALLRTLGIDRFALYLH
FT                   DYGAPIGLRIASRNPERVIGLIAQSGNAYMEGFTPFWDVLFAHAKDRSAHEPGVRRLLE
FT                   PDSTRWQYTHGVPADLLDRIAPDTWLLDQAGLERPGNQEIQLQLFWDYQFNLDLYPGFQ
FT                   AYFREHRPPTLVTWGRHDEIFGPAGAEAFGRDLPDAETHLLDTGHFALETHGDEIAGLV
FT                   RDFLRRAA"
FT   gene            complement(143684..145045)
FT                   /locus_tag="Bcav_0137"
FT   CDS_pept        complement(143684..145045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0137"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: Bacterial extracellular solute-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78402"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVG2"
FT                   /protein_id="ACQ78402.1"
FT                   /translation="MGTRFGTRGRTAARAGALTLAAALAVTLAACSPGSDDGGGGDDDG
FT                   DGEQTTVTFRLWDEAAAAAYRTSFDEFEEQNPDIRVEVETVPWANYWEALPLDISSGEM
FT                   ADIWWTNTSNFGRYADAGNLLDITQSVGDDHDEWSQAVADLYTRDETLWGVPQLQDSIA
FT                   LFYNKTVTDAAGIDPTTLRWDPSGEGDTFLPAAQAVTTDNAGNAATSPDFNPDDVDVWG
FT                   FNAQNDLQAIYIDFLGSNGAQYQDGDEFAFDSPEGVESFQYLVDLINTHHVSPPAADTN
FT                   ANGDLARDLFVQGRMAFFQSGQYSLPAMADIGEEFEWGIAPMLEGPEGRVSVVHGVAAL
FT                   GNAATEHPEETAEVLRWLGSVEGQLPLAETGAAFPGAVGARDAYLEYWAEQDVDISALQ
FT                   NALDGDTIAAPVGPNVNAGANAISPIFEEMFLGRIPVPDALAQAQAAGNEAIAE"
FT   gene            145230..145595
FT                   /locus_tag="Bcav_0138"
FT   CDS_pept        145230..145595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0138"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78403"
FT                   /db_xref="GOA:C5BVG3"
FT                   /db_xref="InterPro:IPR001607"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVG3"
FT                   /protein_id="ACQ78403.1"
FT                   /translation="MDDDAVRPGIDTAVPPSGPGCVECEAADPPAWWVHLRRCAECGHV
FT                   GCCDSSPNQHATAHFRGTGHRYMHSYEPGEDWYWDFVERTTFEGPELAPPTSHPADQAT
FT                   PGPADRVPANWADLIHR"
FT   gene            complement(145582..146796)
FT                   /locus_tag="Bcav_0139"
FT   CDS_pept        complement(145582..146796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0139"
FT                   /product="putative esterase"
FT                   /note="PFAM: Putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78404"
FT                   /db_xref="GOA:C5BVG4"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR021764"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVG4"
FT                   /protein_id="ACQ78404.1"
FT                   /translation="MSAPVSARPAWLDALAAAPDRVRAVREFWDSGGETPVVGRTVERD
FT                   GRAWCEVTFVWRQQSTDRSSVEVMVHVNGVTDAHRSDVTPALLERLPGTDLWHRSWWLP
FT                   ADGTWGYRFVEAPSIPRDAGATRDGWLAMHRAGRVDPGNPRRQPPAPGDGSSVLVLPGA
FT                   YQHPAWSPTPDPVATPDRWDVPDVDGRLRTVRRWAPPGRSSGRRLLVLFDGEQWSALGL
FT                   LDAVARAGLDVEVLLLDSHGQERRAADLPRPDRAATIVAAALARRAAETGQPIDAARVV
FT                   VAGQSFGGLAAAAVALARPDLARTAVVQSGSFWYADGSEPRRDNPVPGDLVRALRAGTF
FT                   GRPSARFVVQVGTHEGTMLEQARHFSDACRDAGARVSLDVVTGGHDYAWWKHHLLRALT
FT                   DVTGG"
FT   gene            complement(146793..147620)
FT                   /locus_tag="Bcav_0140"
FT   CDS_pept        complement(146793..147620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0140"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78405"
FT                   /db_xref="GOA:C5BVG5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVG5"
FT                   /protein_id="ACQ78405.1"
FT                   /translation="MTSTITPPGTDGRLRAEHVRLAYAARTVVEDLTLAVPDGGFTVIV
FT                   GPNACGKSTLLRALGRMLAPRSGEIVLDGRAIHSYPTKEIARRVGLLPQAPVTPDAITV
FT                   ADLVARGRYPHQRLLRQWSPADEEAVDAALTRVGMRDAADRLVDELSGGQRQRVWIAMT
FT                   LAQETPILLLDEPTTFLDVAHQIDVLDLCAHLHEGGRTLVAVLHDLNMAARYATHVVAM
FT                   RDGAVVAQGAAEDVFTPELVRAVFDLDALVLPDPETGRPLVVPRDRRRARAGS"
FT   gene            complement(147634..148674)
FT                   /locus_tag="Bcav_0141"
FT   CDS_pept        complement(147634..148674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0141"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: FecCD transport family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78406"
FT                   /db_xref="GOA:C5BVG6"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVG6"
FT                   /protein_id="ACQ78406.1"
FT                   /translation="MSTLPALTHDRVLRAGAFSVRVTPRLLVVGAALGVVALAAGVLTM
FT                   LHGTLALSPAEVLQALGGTGEEAAVRSVRGRRLPRLLTAFMVGGSLGVAGAVFQSLSRN
FT                   ALGSPDVIGFTTGAATGAVVQIVLFDGGVLPTAIAAVAGGVATALVVYLLARKDGVAGG
FT                   LRLVLVGIGVGAILGAVTSFLLVRASIDDATTVQQWTAGSLTGRGWPHALSVTAAVVVL
FT                   VPMLMLAARRLTLIEMGDDAAGALGIGVERQRFTALLLAVALTGVATAATGPIAFVALA
FT                   APQIVRRLTRRGGVVVLPSFFMGATLLVLADLLSQALDVGLRTPVGLVTSLLGGLYLVW
FT                   LLARRA"
FT   gene            complement(148671..149735)
FT                   /locus_tag="Bcav_0142"
FT   CDS_pept        complement(148671..149735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0142"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: FecCD transport family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78407"
FT                   /db_xref="GOA:C5BVG7"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVG7"
FT                   /protein_id="ACQ78407.1"
FT                   /translation="MTADVATTPRPPRQAPLSRSAGAVRRFGLLVAASLAVIAVGTLLG
FT                   LAIGSHQVGLRTVVEALVAYDPGVDDHRIVVLSRLPRTVLALVVGLALGMAGTLMQSVT
FT                   RNPLADPGLLGINAGASAAVVVAIAYLGVTTVQGYVWFAFAGAAAAAVVVYAIGSAHRS
FT                   AATPVRMALAGAAVSVAVAAVTNAVLLSDERAFNSFRYWAVGSLQGRGLDVTTAVLPFV
FT                   VVGLAIALLLARPLNAVALGDDVSRAVGATPGLARLGSALAVVLLAGAATAAAGPIGFV
FT                   GLAAPHIVRGVVGPDHRLLLPGVLVVAPAFLLLADVLGRVAVAPGELQTGIAVAILGGP
FT                   LFVALVRSRRVAAL"
FT   gene            complement(149737..150750)
FT                   /locus_tag="Bcav_0143"
FT   CDS_pept        complement(149737..150750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0143"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: Periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78408"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVG8"
FT                   /protein_id="ACQ78408.1"
FT                   /translation="MRTTARAAIAVLATSAVLALSACSTPESDAADSTDAPSDAAAAGD
FT                   DTGSWPRTVEHEAGTAEIPEQPLTIVSTSITLTGTLLAIDAPVTASAATSVSPLTDDAG
FT                   FFTQWADVAAERGVEVLYPDLELDLEAIELAEPDLIIGSTIGADTTLEAYDQLNEIAPT
FT                   IMLDYGSHSWQDLAATLGEATGLEEEADAVVETYDAWVAEQADLLELPEQPVTALAYNG
FT                   ADGGRVFSDVSAQADVLTALGFTYVAAPEELASEVRSDTSAVTQENLPAALDGVQTIFV
FT                   AAGGDQDAAAVLEDPLLANQAAVAAGRVLPLGPTSFRIDYYSATDMVEVLVAEYGS"
FT   gene            150978..151766
FT                   /locus_tag="Bcav_0144"
FT   CDS_pept        150978..151766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0144"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78409"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVG9"
FT                   /protein_id="ACQ78409.1"
FT                   /translation="MDATASPLDRLLDAHAILALEHQLHLEDLVEGAAWDVDLGAGTVT
FT                   FATAAPLTCTVQFVGSAASDSETWMWGWNNVNGFPDSVIRAAQQVRDFAQEHDVAELLE
FT                   AQAPLADDTVDRNVLAAKAVSGQLTHVVARANPVAQVALLLDHPSLALPAPSMPRVSRT
FT                   VLQAIQSGLVRDHRLAVTAYAQARDGVELAWDDAVGVLTVPDGVARLTFDGLGRLTDTT
FT                   FRAGPATPDAPAAPDAPAVHAAPAVPAEPKREKRGWFRRR"
FT   gene            complement(151784..152695)
FT                   /locus_tag="Bcav_0145"
FT   CDS_pept        complement(151784..152695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0145"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78410"
FT                   /db_xref="GOA:C5BVH0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVH0"
FT                   /protein_id="ACQ78410.1"
FT                   /translation="MTSQHQESAPSSALSTPTAHGGRTAASASRSRAWANVLTYAFLLA
FT                   AGVIVLAPFLFSVMTSLKTPRQFNTTWPLTLPDPWTIENYTALFGERYDFVVPIAVTAQ
FT                   VVVVLVLTQMLTSVLAAYAFAVLDFPGRDALFWVYVACLMIPAVVIIIPLYSMMTSVGL
FT                   KNTFAGLVVPFLFAGPYAIFLLRENFRSVPTDILDAAKLDGAGVLRTLFRIMLPMNVPI
FT                   LTTLLLITVVTQWNNFMWPLVIAPKTEWNVITVATAALQTQYEGNWTLVMAASTIALLP
FT                   LVILFLVFQRRITSAIGITGLR"
FT   gene            complement(152706..153584)
FT                   /locus_tag="Bcav_0146"
FT   CDS_pept        complement(152706..153584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0146"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78411"
FT                   /db_xref="GOA:C5BVH1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVH1"
FT                   /protein_id="ACQ78411.1"
FT                   /translation="MSTRRRADTAAAYALLTPSLIGVGLFLLVPVVIVIGISFTRWDLV
FT                   SPPQWVGLDNYVYIFGWPTFRNSLWVSVLFTALTIPTTIALGLILAVAINRRLPGTNAL
FT                   RVLYVLPWVCAPLALGVVWRWIFDPTNGALNALLGRRVEWLTDLNLALPSVAFVQVWSS
FT                   VGYVSLFFLAGLQQIPNQVYEAARLDGASAPRTLWSITVPLLRPTMFFVLVTSIISSFQ
FT                   VFDSIYAMTRGGPGVPGRTDVIAARIYDEAFVALRLGRAAAMAVVLFAVLVTITLLQQR
FT                   YFRRRITYDMS"
FT   gene            complement(153677..154480)
FT                   /locus_tag="Bcav_0147"
FT   CDS_pept        complement(153677..154480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0147"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78412"
FT                   /db_xref="GOA:C5BVH2"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVH2"
FT                   /protein_id="ACQ78412.1"
FT                   /translation="MLAGMSEPALAEYSAFFQAMAGASATLIGLLFVAISVNPAAAAVD
FT                   GRDVRPWIRAASALFALINVLAVSAFALLPGAGVGPLAVAGGFAAVVSSVGMIVISVRY
FT                   RQWARAAAGSRWTRALVALRYLSWQLGLLVTYAAQAIAGLGIVRMTAAGTADDQPDAVE
FT                   ALLLIISSALIVMLLVAITRTWEAVGASMPRLLDLLVASRRPEMLPPDRRRDPDEPLHL
FT                   PDDAGDAAEPADAPDPVDGARVAAENGDDRPERGGTSADVGRTAD"
FT   gene            complement(154623..156869)
FT                   /locus_tag="Bcav_0148"
FT   CDS_pept        complement(154623..156869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0148"
FT                   /product="HNH endonuclease"
FT                   /note="PFAM: HNH endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78413"
FT                   /db_xref="GOA:C5BVH3"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR003870"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVH3"
FT                   /protein_id="ACQ78413.1"
FT                   /translation="MFDAAEQWIGTPVPGPVSRARGDHCFPGYALVGAAAAGAILEVRA
FT                   IFGGATHKSRSDAADTAPSPADPASIAEPHAWESLSAEPPTRESLSAEPPTDQSAIAES
FT                   HAGVPGSLDTSDAAAAPTPRADDVANTATTSTGGTAAAIPEHATDDPELAAMVGSAAAG
FT                   AAALAAQLAALDATRLSTEELLGVVAAWRRVEAAAAAQVRYAAAALAERTEMNPPALAR
FT                   RSTNGCLAPDELATTLGVSRRAAGTLVHTGQAFTGPLADVGRALAGGLIDAGKAAVYAG
FT                   VLADLPVAVVLAVVDATLPNAPAWPHHTLKTKLRDAVTTATGADAAQLHAHAAKDRHLR
FT                   RPEPLPAGMAKLVAVLPAPDAQTIWTACDAAAWSARTTGADPRTLDQLRADTLTLLAQH
FT                   ALATGVIGSPDSREDTSSDDAVPTEATPADDADRKEAINSDVIGRTGPSTEDAERAEDD
FT                   DGSDGGRRSGECAAPVTAGGIAETDHIGEARPAPHTASTAGGCGLPVMRLGRPGRARPA
FT                   IQVVVAATTLLGLDDHPGVLTGYGAIDAATARRIALADEPPWQRLLTDPVTGTLLEISP
FT                   SSYRIPDALARHVRARDRQCAVPGCTTPSDRCDLDHVIPFPLGPTTADNLAPLCRRHHL
FT                   LKTHGGYALSREPDGAYRWSTPFGNENAAPPERLVPDPAPIDPAFLEDHPLSSSTPPPA
FT                   PSPEPDSDPGHRDPAPRRSDPDSDSDRLDPAPRPEPEPGPDHDPDRGSDEPPPF"
FT   gene            157388..157633
FT                   /locus_tag="Bcav_0149"
FT   CDS_pept        157388..157633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0149"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78414"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVH4"
FT                   /protein_id="ACQ78414.1"
FT                   /translation="MSKLFATVVAVLALGGAVVAARAATRKPAPRSPAVGNSAPSNSAT
FT                   RNSATRNPAEESTSRVSSLTFPRRSSLELLMRSARI"
FT   gene            complement(157727..158125)
FT                   /locus_tag="Bcav_0150"
FT   CDS_pept        complement(157727..158125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0150"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78415"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVH5"
FT                   /protein_id="ACQ78415.1"
FT                   /translation="MALRWYTTVVESRDHQAQARWWAQVLGWDVRFSTEEEAVIVPPWA
FT                   DELGPLLRFEQVPPGLVFVPVEHEKTTKNRLHIDLAPHTSDDREAEIERLVSMGASRID
FT                   VGQGPEVTWEVLADPEGNEFCVLSSRPN"
FT   gene            158228..159127
FT                   /locus_tag="Bcav_0151"
FT   CDS_pept        158228..159127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0151"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="PFAM: Helix-turn-helix domain, rpiR family; SIS
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78416"
FT                   /db_xref="GOA:C5BVH6"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVH6"
FT                   /protein_id="ACQ78416.1"
FT                   /translation="MALLTGEIPEVADAAVLTRLPGLLPTLRSSERRIAEAILDDPQAV
FT                   SRDTIEQLAARCGTSKTSVTRFCRTIGLAGYTELRLALAGDVGRRRDESWRAELGSSAD
FT                   PQNPADVVVDELLTANVRALTETVRTLDRAALAASVDALASAGRIDLYGIGGSGTVAAD
FT                   LQRRFHRIGRVAHAWSESHDALTGAAMLGASDVAIALSHTGETSEVAAALALARDRGAT
FT                   TIAVTNYPGSAVAAAADLVLVTAAHEERARADGLAGRHAQMFVVDCLYVLVAGVLHDES
FT                   QSGLRRTSEAVRSTRRAR"
FT   gene            159153..160559
FT                   /locus_tag="Bcav_0152"
FT   CDS_pept        159153..160559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0152"
FT                   /product="conserved hypothetical protein"
FT                   /note="TIGRFAM: Tat (twin-arginine translocation) pathway
FT                   signal sequence"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78417"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVH7"
FT                   /protein_id="ACQ78417.1"
FT                   /translation="MHEAEPGSTLARLTRRNLLRATAAAAVATGIGVSGMGAAAARAGA
FT                   TRTPRERPAPAATSDLPLVGGEEFPIGLFWPPPPFETNVERYTEIKDAGFTFLITGNYL
FT                   FDAHIVRHALGVADEVGLKVLVSDDLAVKIAAQRFTIDDAGGRLTLTREEAGAFIREAH
FT                   GNYAAHPSFAGLNFFDEPFPERYPTLGAAFDLYRETSGAHLPYANLLPNIFGDGYDDYL
FT                   NGFVEQVRPSVVSFDRYPLLAGGAEDADYFDNWARVRRVGLAHDVPTWVFIQTLAYANH
FT                   REPTAAELAWQVNVSLAYGAKGIQYFTYWTPDPARGEGFEPALVTVDGELTPRYDAARD
FT                   LNTRWLRQVGKQLKPLRPETVGHANETPLPNGTEAWQPDTWVRAVTGDPVLVSRFSSGD
FT                   AGDPTQWLFLANRSHGARARVAVDLAAQHVEEAQRFDARTERYRPGRRKRKIEATLEPG
FT                   GAELHRLVLK"
FT   gene            complement(160552..161529)
FT                   /locus_tag="Bcav_0153"
FT   CDS_pept        complement(160552..161529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0153"
FT                   /product="Helix-turn-helix type 11 domain protein"
FT                   /note="PFAM: HTH domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78418"
FT                   /db_xref="GOA:C5BVH8"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR028349"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVH8"
FT                   /protein_id="ACQ78418.1"
FT                   /translation="MADTAARMLDLLALLQMRPGWSGSELAQRLSVSTRTIRADIERLR
FT                   RLDYPVEGVRGRAGHYRLGVGAKLPPLLLDDDEAVAVAIGLRAATGLSGVEESTARALA
FT                   KLEQVMPHQVRRKVHALATATSQGPVNTDSNVADPVVDAGVLSSIAAAIRDLEWLRFSY
FT                   RDDAADAPPRAVEPYRLVSWQRRWYLVARDTTSTAWATFRVDWMDLRMRTGRHFVPSPL
FT                   SEAEYSDLVVRTVASTGWAVHTRILVHAPAGEVLARINPAVGVVEPVDAATSVLVTGGD
FT                   TVEIVAVWIGMLGLDFEVEEPPELVEAIRVQARRYAAAVGDSTT"
FT   gene            161596..162726
FT                   /locus_tag="Bcav_0154"
FT   CDS_pept        161596..162726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0154"
FT                   /product="Epoxide hydrolase domain protein"
FT                   /note="PFAM: Epoxide hydrolase N terminus"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78419"
FT                   /db_xref="GOA:C5BVH9"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR010497"
FT                   /db_xref="InterPro:IPR016292"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVH9"
FT                   /protein_id="ACQ78419.1"
FT                   /translation="MATIENTRPFRIEIPQADLDDLHERLARTRLPRPAVGDDWTYGTP
FT                   NHYLADMVQRWKDFDWRAVEERLNAFPGFLTEIDGQTVHYLHVRSPEENATPLLLVHSY
FT                   PGTVYDFVDMIGPLTDPVAHGGKAEDAFHVVVPSTPGYGFSTPLADNGWTMARVARTYD
FT                   ALMRDLGYDSYGEHGSDGGALVGRELGLLEPEGYLGSHVLQAFSFPSGDPAEFESLTPR
FT                   DHAALEHLQWFQDVGGYNAINASRPQTVGVGISDSPVGLLAWNELFNSFGNGTALMTPD
FT                   QILAEVTLEWLTNTGATAGRYHYEEAHAGAEPRVNHSRMGVAIFADDFKSIRTFADRDN
FT                   DNIVHWVEHPTGGHYASLEVPDAVTEDIRTFFRPVR"
FT   gene            complement(162728..163138)
FT                   /locus_tag="Bcav_0155"
FT   CDS_pept        complement(162728..163138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78420"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVI0"
FT                   /protein_id="ACQ78420.1"
FT                   /translation="MTDAVTDAPTQQTAEAEVTAVVVAMYRALGDRAAFDAHLHPEITI
FT                   WESDADALLHGLTALDELRDVRRERGADGPAPTSVGPEEIRADVWGDVAVVRYLLRATF
FT                   PAPTADERFRVTDVLRREQTWRIVHHHAEKLA"
FT   gene            complement(163135..164802)
FT                   /locus_tag="Bcav_0156"
FT   CDS_pept        complement(163135..164802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0156"
FT                   /product="protein of unknown function DUF885"
FT                   /note="PFAM: Bacterial protein of unknown function
FT                   (DUF885)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78421"
FT                   /db_xref="InterPro:IPR010281"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVI1"
FT                   /protein_id="ACQ78421.1"
FT                   /translation="MSAATGGPGAVSAVADGYLRERARLDPEAADVLGEHDVLRIGDLS
FT                   DATFEARVDLDRRTLAELSALGADAGGAAEQRLAAAMTERLGADVALDEVGFTRRLLAP
FT                   LATPVHLVRQVFDGLPSTTPDERAVVERHLREVPRALAQYRDTLLAAAARGDVVARRQV
FT                   LGVARQCDSWVASGFYAGVAGDDERLAGPARDAAAATASFADDLRERLLPLAPERDAVG
FT                   RDVYATTSAAFLGAVVDLDELYAWGWEEIRRLQAEAAAIATELVGSPDVAAAVRSLDAD
FT                   PARRVPTGEPLRAWLQGRIDDVTDVVDGRWFAIPPRLRHVEARLVTAESGVMYYTPPDA
FT                   GLTRPGRVWWTVPAGAADVTTWREVSTVHHEGVPGHHLQHAITYGLDDLHPWQRNLCHV
FT                   HGYAEGWAHYAEQLASEIGLLDDPGERLGAVFAQLWRACRIVIDIGLHLELPIPPGTGV
FT                   LDAGRWTPEVGVAALVSIAEVEPSTATFEVDRYLGWPGQALAFKVGARLWQQARADVAA
FT                   SLGDAFDLRTFHAEALGLGPMGLGPLQDQLARGQEIPS"
FT   gene            complement(164799..165803)
FT                   /locus_tag="Bcav_0157"
FT   CDS_pept        complement(164799..165803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0157"
FT                   /product="5,10-methylenetetrahydromethanopterin reductase"
FT                   /EC_number="1.5.99.11"
FT                   /note="PFAM: Luciferase-like monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78422"
FT                   /db_xref="GOA:C5BVI2"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVI2"
FT                   /protein_id="ACQ78422.1"
FT                   /translation="MSVELTLALQSDKTWARYTDLGALTQELGFDGVSVYADLGFQPPL
FT                   PALLAVAGASSTLRLGPACLNPYLLHPIEIAGQHAALDEASDGRAYLGLARGSWLDRVG
FT                   VAQSRPLAALEDAVAIVRRLLAGDTSGYEGQVHSLPAGTHLEYEPLRPDVEVLLGVWGP
FT                   RGAALAGRIADEVKIGGTANPAMVRQMRTWLDAASLAAGRGAGAVRITAGAVTVVDDDG
FT                   ARAREHARRMVASYVDVVAPLDPTIDVDPGLMERLRELLRAGDDAAAGALLPDDLLDAF
FT                   AFAGTPHDVAASAVELAEAGADRIEFGTPHGLDEARGVRLLGSQVLPVVRSAS"
FT   gene            complement(165800..166156)
FT                   /locus_tag="Bcav_0158"
FT   CDS_pept        complement(165800..166156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0158"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78423"
FT                   /db_xref="InterPro:IPR023811"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVI3"
FT                   /protein_id="ACQ78423.1"
FT                   /translation="MSGAGSAEGAGRHGGDVTELADLRIVVDRIEGRSVCGMSPGDWCE
FT                   VTHSSRLRIPDGGHFCLYALAAALPLIPAKQRALDPGDWLAQDAEVACPDPEERLVMRI
FT                   ERTGTRRLPTEDLT"
FT   gene            complement(166153..167400)
FT                   /locus_tag="Bcav_0159"
FT   CDS_pept        complement(166153..167400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0159"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: Amidohydrolase family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78424"
FT                   /db_xref="GOA:C5BVI4"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVI4"
FT                   /protein_id="ACQ78424.1"
FT                   /translation="MSNRPLAVTDATVWDGLAEESRADGGVLVGDDGRIVAVGGSTEIL
FT                   ERAREIGADVVEARGGVVVPGLVNGHVHLSLALPGPMQDAIHGADSAQLALFMAGNARE
FT                   TLHAGVTTVRLVGEARFADMALKKAIEVGAVPGPRIRTAGHALCCTGGHGHDADGQEAD
FT                   GADGFRRATREQLRAGADLIKVCISGGIAGEHESIDTPQLTDDEMAAVLSTAHDWGRKV
FT                   TAHAGPAPVIERAVALGLDAVEHGYELTPELCALMAERGVWYTPTITVSRCEEFFLANG
FT                   VPRWMIDRALGAGPRHWESLQHAIAAGVPISMGTDMPPHAAYDGTTATVREIEFMVDAG
FT                   MTPLEAMRASTSAGAAWMGEEGAYGALVPGAAGDLIVLDADPLADISALRTLHGVVQAG
FT                   RVVRDDRGTLRPGAAA"
FT   gene            complement(167397..168359)
FT                   /locus_tag="Bcav_0160"
FT   CDS_pept        complement(167397..168359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0160"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="PFAM: ABC transporter; Oligopeptide/dipeptide
FT                   transporter, C-terminal region"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78425"
FT                   /db_xref="GOA:C5BVI5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVI5"
FT                   /protein_id="ACQ78425.1"
FT                   /translation="MSALTVTEAHVEYRSRGRGLVRAVDGVSLTVQAGQIVGLVGESGC
FT                   GKSSLARAVVGMEPVTSGEIALDGRPVPPLGWRRRSGPDLRLQMVFQNPYASLNPRRSV
FT                   GDQITDGLAVPREEQGREVARLLELVGLEPEAADRYPHQFSGGQRQRVAIARALAARPD
FT                   VLVADEPVTALDASSQAQIVNLLTSLVDDLGLGMLFISHDLALVREIADVTAVMYLGRI
FT                   VEHGPTEQVWSQPRHPYTRTLIEALPRISADAHLPVGLRGEVPDGAHVPTGCRFRTRCP
FT                   AVMPICTTEPPVVVDGEHTVACWLADESTLRASATEGAR"
FT   gene            complement(168356..169414)
FT                   /locus_tag="Bcav_0161"
FT   CDS_pept        complement(168356..169414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0161"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="PFAM: ABC transporter; Oligopeptide/dipeptide
FT                   transporter, C-terminal region"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78426"
FT                   /db_xref="GOA:C5BVI6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVI6"
FT                   /protein_id="ACQ78426.1"
FT                   /translation="MSALLEVRDLAVTLPGPDGDLPVLHDVSLHVDPGEIVGIAGESGS
FT                   GKSMTAQTLLGLLPPGARTSGSARLGDTELLGLRGAQWNTVRGRRVAMVFQDATAALHP
FT                   MLTVGRQLTEHMQVHLGLRRRAADARARELLELVRIPDAPSALRAYPHQFSGGMRQRVA
FT                   IAVALACDPELLVADEPTTALDVTVQAGILELLDDLRRQVGLSVLFITHDLGVLAALTA
FT                   RTYVFYAGRVMESAPTAEVTLAPRHPYTAALLRARPHADASWDLTGAPAPAAAQRAAAG
FT                   PPRPAGRRRLATIPGSAATPASAPAGCPFAPRCAYREDRCQAAIPPLDAVAPGHDVACV
FT                   VRPDLRAVEVAG"
FT   gene            complement(169411..170379)
FT                   /locus_tag="Bcav_0162"
FT   CDS_pept        complement(169411..170379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0162"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78427"
FT                   /db_xref="GOA:C5BVI7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVI7"
FT                   /protein_id="ACQ78427.1"
FT                   /translation="MSALPPAGEPDVMPPADPVAVDLVGVADEDPRAARALGRRRRFGR
FT                   LRRGGRGFWTQPAVVVAVCILGIWVLVAAAAPWLAPYDPIAQSADLYAAPSSAHWFGTD
FT                   ELGRDVFSRVLYGARLSIPLAAIIVAAALAIGGVLGLVAGYLGRFADEGLMRLTDLVFA
FT                   FPQIILAMAISAAFGPSARNAVVALVIVSWPVYARVIRSAALAIRGSDYLASARLLGVG
FT                   PLRALRRDVVPNAVGPAVVLATLELGNAVLLLAALSFLGLGPRPPAAEWGAMIAAGSRD
FT                   LSSWWMSGFPGLAILTVVLAFNVLGDALRDRLDPRFARSPR"
FT   gene            complement(170376..171461)
FT                   /locus_tag="Bcav_0163"
FT   CDS_pept        complement(170376..171461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0163"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78428"
FT                   /db_xref="GOA:C5BVI8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVI8"
FT                   /protein_id="ACQ78428.1"
FT                   /translation="MTTSALPAVRAPRRTARGSGSAHTLGRFLLRRLVITVFLLLGVTA
FT                   VTFLLVQLVPGDSMTATLSETALADPEVVAAYRAKWGLDEPLLTQYGIYLSNLLQGDLG
FT                   VSTQTGRPVLGDLLTYVPATLEIALPAMVLSVVIGTAVGLYAAVRQGRAGDQVVRVGTL
FT                   LGLSTPPFWLSLVALYVFFYLLGVAPSGGRLSTYLSPPPRVTGMFTLDALLAGQWMVWW
FT                   DAVQHLVLPVAVLTCLTVATLVRFVRSAMLEVLDQDYIAAARAKGLPTSVVLRRHVLRA
FT                   GLVPVITVSGLAFAALLSGTVLVEQIFSWPGVGQYAYRAASGLDLPAVIGVGLFVAVVY
FT                   TIVNLVVDLLYGVIDPRIRLS"
FT   gene            complement(171458..173110)
FT                   /locus_tag="Bcav_0164"
FT   CDS_pept        complement(171458..173110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0164"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: Bacterial extracellular solute-binding
FT                   proteins, family 5 Middle"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78429"
FT                   /db_xref="GOA:C5BVI9"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVI9"
FT                   /protein_id="ACQ78429.1"
FT                   /translation="MEHHEPRETIVRHHPARRRSVAALAGAATLALAGCTAGGSQGGEP
FT                   SGDDGEAPSGGTLTVSTSFVINSIDPGQVYEATGALAVHAMYDTLVTFEGSDVTTPVPL
FT                   LAESWEANDDATEFTFTLRDDVTFSDGSELTAQDVAFSINRLHNLAGSPSVTVEGLSAA
FT                   APSDDVVVVTSETPNPNVPTILAMPAAGVLNSEEATANGATDAEDAATTDSATAFLDGA
FT                   SLGSGPYVLDSFDPASEIVLTANPEYWGDAPEFDRVVIQNTEAQNQKLAIERADGAMIA
FT                   LDLSGRLLDGLAEGLQTSASQDTFYFVTLHQDPAVSEVTSNPEFVQALRASIDYAGLAA
FT                   LFGEDARPAAGMVPTAFPGALSEDEVQVQDLDAAADHLAASGLTDPTVSLMFPAMTYRG
FT                   VDLATIATKIQNDAAQAGITIELDPQPIAAFLDAQSAGNVAFRFSPQSLNYPVASSLVN
FT                   NFAPGQPSAMRSGWSADLASPEMIAAGDAVTASIDPDEQVTAMQEWQRLLNAESPFITL
FT                   AYNSGTVVATADLSGADYSPAGWQVDLRAVGRG"
FT   gene            173165..173770
FT                   /locus_tag="Bcav_0165"
FT   CDS_pept        173165..173770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0165"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: Helix-turn-helix; Cupin domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78430"
FT                   /db_xref="GOA:C5BVJ0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVJ0"
FT                   /protein_id="ACQ78430.1"
FT                   /translation="MHGRDTYSLTEHVHRNETSPGGHVLGDRLRDLRRQHGLTLRDVAG
FT                   QTGLSVALLSQIENGRTDPSITSLRKLARAFDAEVATLFHEPDAPSVHISRPGERFLLS
FT                   APAGLIAYERVTPGRGDLEVLRSVLAPGDVSAEGPRGHASTECVYVLAGEVVVTIGESD
FT                   HRLVAGEAATFDSRQPHRYRNDSAANAEILVVVTPPTP"
FT   gene            173821..174225
FT                   /locus_tag="Bcav_0166"
FT   CDS_pept        173821..174225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0166"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/Bleomycin resistance
FT                   protein/Dioxygenase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78431"
FT                   /db_xref="GOA:C5BVJ1"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVJ1"
FT                   /protein_id="ACQ78431.1"
FT                   /translation="MPRPSLRVTSVTIGTDRPNDLAHFYAELLGWPVSADEPAVPGDPV
FT                   RGGWAQIRPPEGESGPTLNFEFERYFTAPVWPAEEARQTASQHLDVWVEDLDAAVGWAV
FT                   EHGARLAEVQPQDDVRVLFDPSGHPFCLFL"
FT   gene            174586..175443
FT                   /locus_tag="Bcav_0167"
FT   CDS_pept        174586..175443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0167"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78432"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVJ2"
FT                   /protein_id="ACQ78432.1"
FT                   /translation="MTVPGDLVVPAGESCTLDGTTVEGRVVVQTGADLIVSDGVFNGAV
FT                   VVAADGYFDATGTLIAGNVSNRAGYGLYLESSTVGGNYIGAADAPDTFLIAYDAQFDRR
FT                   VEASAGEVTLESSWVAGAVTGTGTEYLDVLDSTLLADLTVTESIDGAVLCGSEVDGDVT
FT                   YTGNGGVQVGPGELFWTCEDSAYVGGNLTISGTSVGVTLNDTIVRGDLGGEGNDPAPTG
FT                   AGNRVRGEVSGQFVDLEPASDAQLRSLLAEVGDRTSADATLADAMERRDSATAAATAAG
FT                   DAGL"
FT   gene            175560..176444
FT                   /locus_tag="Bcav_0168"
FT   CDS_pept        175560..176444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0168"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: Aldo/keto reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78433"
FT                   /db_xref="GOA:C5BVJ3"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVJ3"
FT                   /protein_id="ACQ78433.1"
FT                   /translation="MLTRTIGNDTVGSDDVGSVGLGLMTFDQSGPQPREQLLDTVRAAL
FT                   DAGVTLFDTADAYGPGEQLGAACQGENEKLIASLLDELGVRDRVQLATKGGCVRTDGGG
FT                   WARDSSPEHLNAAVDGSLRRLGVDQLWLWQHHRPDETRDYAETVDVLSAIADSGKVRAI
FT                   GLSNVDPEQIRAAHAVLGERLVSVQNQFSPAFLSSRPEIDVCAELGLAFLPWSPLGGLG
FT                   DAKQLAERHPAFAEIARERGVSPQQVALAWELAQAPVVIPIPGAKRPASIADSAAAADL
FT                   ELTPDELARLDAA"
FT   gene            complement(176508..176858)
FT                   /locus_tag="Bcav_0169"
FT   CDS_pept        complement(176508..176858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0169"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78434"
FT                   /db_xref="GOA:C5BVJ4"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVJ4"
FT                   /protein_id="ACQ78434.1"
FT                   /translation="MVLTAASAALLGGGALLAPLLGDSQLRVVRDLAHASGVMQVVALG
FT                   AFAAIASFRPILGRVLRIPGIAVGALALVALPALVVHAGTAVLLAARVAFLAWALAAAV
FT                   ALAFRTRLRRIT"
FT   gene            complement(176988..177152)
FT                   /locus_tag="Bcav_0170"
FT   CDS_pept        complement(176988..177152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78435"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVJ5"
FT                   /protein_id="ACQ78435.1"
FT                   /translation="MISHAPRRSRWNRAGPWAAALGLIALTAAQYVATSRGASGFEVRD
FT                   TSDVLLHDY"
FT   gene            177285..177929
FT                   /locus_tag="Bcav_0171"
FT   CDS_pept        177285..177929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0171"
FT                   /product="protein of unknown function DUF1211"
FT                   /note="PFAM: Protein of unknown function (DUF1211)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78436"
FT                   /db_xref="GOA:C5BVJ6"
FT                   /db_xref="InterPro:IPR010617"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVJ6"
FT                   /protein_id="ACQ78436.1"
FT                   /translation="MTYERRGEPRSLERFVFFSDAVVAIAITLIVLPLVDSARDLPPGT
FT                   TTADFLGENAYALLAAGISFFVIGGFWSGHRRLFDRATGLAPGVQLLNLAWLATIVLLP
FT                   LATVLEVSAEPGDRLGVLLYVGTMLLSLVVIQVQELLLARAGQLSPTPTRGDLASGWVA
FT                   VVLMLLALLLAVAFPALSLYPLLLLVLTGPLSRLVRRRAGEGPPAAVGDAE"
FT   gene            177941..178438
FT                   /locus_tag="Bcav_0172"
FT   CDS_pept        177941..178438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0172"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78437"
FT                   /db_xref="GOA:C5BVJ7"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVJ7"
FT                   /protein_id="ACQ78437.1"
FT                   /translation="MGAIPEGWGEFGVAAAGATAALAGLLIVAMSVNVAEILATRAVVA
FT                   GARSTIASLVLAIATSLLLLPPGMTLVGLGVATLVLTGVAIVIQVVGIAAQWTRASEGV
FT                   TGPVRAFIVALAAVEHVPFLVGGILLVAGLDAGLWGIVAGMVAVVVVSMVNAWALLIEV
FT                   RR"
FT   gene            178539..179561
FT                   /locus_tag="Bcav_0173"
FT   CDS_pept        178539..179561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0173"
FT                   /product="lipolytic protein G-D-S-L family"
FT                   /note="PFAM: GDSL-like Lipase/Acylhydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78438"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVJ8"
FT                   /protein_id="ACQ78438.1"
FT                   /translation="MTDDVIIAPQADSEIWRGAVAWEERDGRARAWRLLPERAARAHAP
FT                   ELVRHATMAAGVRALVTTDASEARLELDFEHDADARLDVLLDGELYRRVEVTSGLTDLR
FT                   VPLPDGEHDLAIWLPQVGQSWVGPLTLVGASTAAPTPPAAPRWTTYGSSITQCSAADGP
FT                   SETWPAVAARALGWDLTCLGFGGQCHLDPIAASTIAAVPADVVSMCLGINIYGGATFSP
FT                   RTFAAHASAFVERVRAAHPDATLVVITPIASPARETTPNAVDFTLEQMREDLRSVVDVL
FT                   QAEGDANLHLVDGLSLLGLDEVHLLPDALHPDGEGYRLMGERVALAMGALTGAAPATVR
FT                   "
FT   gene            complement(179627..182167)
FT                   /locus_tag="Bcav_0174"
FT   CDS_pept        complement(179627..182167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0174"
FT                   /product="polysaccharide lyase 8 alpha-helical"
FT                   /note="PFAM: Polysaccharide lyase family 8, C-terminal
FT                   beta-sandwich domain; Polysaccharide lyase family 8, N
FT                   terminal alpha-helical domain; Polysaccharide lyase family
FT                   8, super-sandwich domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78439"
FT                   /db_xref="GOA:C5BVJ9"
FT                   /db_xref="InterPro:IPR003159"
FT                   /db_xref="InterPro:IPR004103"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR011071"
FT                   /db_xref="InterPro:IPR012970"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR038970"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVJ9"
FT                   /protein_id="ACQ78439.1"
FT                   /translation="MQLSRRQVLAMVPAGALLAIAAPMRAYADTPADHARLLANAVAIF
FT                   AGTAESNARPEAAAKLAAIQTTARTRLAELDAAGPGELFAGVPLGTSDPNLNTSFLRLY
FT                   EIALATCTPGVASELVGSTEVRRRVIDGLVWLHENYYGDQAAGYYGNWFTWEIGISASV
FT                   SKTLVLLDDDVAAYRPELVGTYVASMDAYLRNGVGGDVNLDSRFHTGANLADITTNRVL
FT                   QGALTADDARVSKAIADQSTVFATIDPYDLQHGNTDGYYADGSFIQHHSVAYTGSYGRT
FT                   LLTRVVQTVKLLDGTAAAPGTELADVVHGWVRDGFAPVIVEGWMAEIVKGRAVSRTGTG
FT                   YADVATVVEAVVDLADYASAENALALRGYVRYLEAASPTPADPTRFVSPVSIVRYADIL
FT                   ADDALPTQDLNPAERTVAFNAMDRTVHRRTGYTFALARSSDRISRYEYMNGENLMPWFQ
FT                   GDGMHYLYLAGQDQTQAFGVDFFTTVSPYRLPGTTVPVEERQTIPELYGRFWYENPDHP
FT                   LGFTSSSESQNTYVYFPRGTNAFSGGATLGTYGVAGMVLSDDVPYVDAQAGVLPDDFVV
FT                   YANARATKSWFLLDDEIVVLAADVHDPHRRDVVTTLDSRIAAPGDGVVVTGARRGGRAW
FT                   SPDDGPERLEWLRWENPAQGVVVGYALLDAGPVAVTLEDVTRSRRVIRVSNPDTAATKR
FT                   VFTASVAHPRRGRSELAYAIVPGGSAEQLAAYQRGPVQVLRNDGRIQAVRHSGLGLVAA
FT                   NVFAGGTQQVRNVAIDGPASVLVRETDDGGTSVALSDPTMDRRSVTVTIRGRRLEAESA
FT                   DDGVEVRRVPGGTEVRADVREAYGASFTATLRPR"
FT   gene            182313..182777
FT                   /locus_tag="Bcav_0175"
FT   CDS_pept        182313..182777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78440"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVK0"
FT                   /protein_id="ACQ78440.1"
FT                   /translation="MARGTWTQLWRLLKRYGPLALAAWRQVDKYLKEHPDVSAASKQQI
FT                   LRWRDQVIAVKNRRSVEGRLRGTLEVVDRLAAEHASSGRPERVATARDWADRAADITRA
FT                   LDMAVTRTGTQKKLMLDRIAARTDALAAEAFESLVDDDGGPPVEIPPRRP"
FT   gene            182956..184095
FT                   /locus_tag="Bcav_0176"
FT   CDS_pept        182956..184095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0176"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78441"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVK1"
FT                   /protein_id="ACQ78441.1"
FT                   /translation="MPQGLQHTAPPRAGHEARILDHLRRRGRASRGEIATALGLSRATV
FT                   STVTGQLVRTGTLVVAPATESGRLGRRPEVLSLDPSSGLVLGLDFGHTHVTVVATDASH
FT                   TVVGSGTRRFPATTSWTRRREIAVGMATHVLATTDRPESLAAVGIGVAGSIAGRPAVLE
FT                   AIEATFADAFAVPVRTDNNARLAGLAEWLWGAAQGATDVMYLRLSHGVGGALVIDGRMR
FT                   RGPRASGGEFGHVCVDPAGPACRCTNRGCLERYVGLDAVLAEAGADDVGALLAALDRGD
FT                   DRAVATLGTASDRIGLVLGNVATVLDTPRVVLGGELAALGDHLVVGVRRAMSRHVLPDK
FT                   ADALDVRPAALGARAGALGGVALVLQDTSIPLPGAPRPA"
FT   gene            184128..185645
FT                   /locus_tag="Bcav_0177"
FT   CDS_pept        184128..185645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0177"
FT                   /product="sulfatase"
FT                   /note="PFAM: Sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78442"
FT                   /db_xref="GOA:C5BVK2"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="InterPro:IPR032506"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVK2"
FT                   /protein_id="ACQ78442.1"
FT                   /translation="MTPHHHERPVALTNILFFLTDQHRKDTLGAYGNATVRTPNLDALA
FT                   ADGTTFDRFYTPTAICTPARASLLTGAAPFRHKLLANYERNVGYQEELSEGQFTFSEDL
FT                   AEAGYHLGLVGKWHVGTHRTAGDLGFDGPHLPGWHNPVDHADYLAYLEENDLPPYRISD
FT                   EVRGTFPNGAPGNLLAARLHQPLEATFEYFLAERAIDLLRTYARDHRTSGRPFFLATHF
FT                   FGPHLPYILPSEYLDMYDADDVELPLSVAETFAGKPPVQGNYSAHWTFDTLGDETSRKL
FT                   IAAYWGYVTLVDSQVGRILDAARELGVYDDAAVFFSADHGEFTGAHRLHDKGPAMYEDI
FT                   YTIPGIVKLPGGVPGQRSDRLAHLIDLTATILDVAGRDPARAVDGVPVTPLVRGEETPW
FT                   REDLVAEFHGHHFPHPQRMLVTERWKLVVNPESVNELYDLVRDPDELQNRYTHPETAAV
FT                   RAELLGRLYRQLRERGDNFYHWMTSMYPVGEKDYDTSLSMFEGAHRP"
FT   gene            185642..186991
FT                   /locus_tag="Bcav_0178"
FT   CDS_pept        185642..186991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0178"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: Bacterial extracellular solute-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78443"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVK3"
FT                   /protein_id="ACQ78443.1"
FT                   /translation="MTRLTTTASPAFRRPGGAVSRRAMLGLLGAGAAGLTAACSASIGG
FT                   GIAPDPAAFFSGDYDGDPVRLDFWNPFTGGDGPAMGAIVDAFNAAHPQIDVRMSSINAD
FT                   QMYAKLLPAVGAGQGPDVVAMHLDQLATFAIRGTIVSLDDIVEGLELDGADFVAQAWEA
FT                   TVFQDRRFGIPLDFFTAAQYWNVEAFDAAGVRAPWDGSSYLDVMAGLQASGVANPFWVS
FT                   PAWQTFVGLLGQFGGSLFDADGTTATMGSDAGVEALTWICDVVADGFSPAGVTDVRPPF
FT                   KNGSCVTMTDLPAAIPDLTLTAPDLEWGVGPFPQVGPQPGTFANSHTFTITQQTQADDD
FT                   VAQAAQVFVHWVSQNSGQWAAGGLTPASTSVRESAEFAATPQSVLATEEVFASAVFLPQ
FT                   IPSSRDIAANSYQRAVSEAVLGQATPADALAFAQRTAQSQLDDVRRLFES"
FT   gene            187050..187997
FT                   /locus_tag="Bcav_0179"
FT   CDS_pept        187050..187997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0179"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78444"
FT                   /db_xref="GOA:C5BVK4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVK4"
FT                   /protein_id="ACQ78444.1"
FT                   /translation="MAQIPIAMVRSSGPTRGSDSRGWRVTPYLFVAPFLALFVLFVVVP
FT                   IGAAAWASLHAWSLGLPNQPFVGLENYADLFGGTSVLSVEFWKGMKATGLFTLLSVPLL
FT                   VIVPLALALLLNQKFPGRTFFRAAYFAPYVLGVAVIGLLWHFLLDRQLGPVNQILRALG
FT                   LGGDIAWTTSLPAGWVALVGATIWWTCGFNAVIYLAALQNVPEELYEAVKVDGGGAWRR
FT                   FTTVTLPSIARVLQFVVAITIIASANMYGQSALITQQQPGTSTRTAIGFIAQTGIQGFN
FT                   IGASSAMSIILALSLMVVSGLVLLAFRKVGDSDS"
FT   gene            187994..188893
FT                   /locus_tag="Bcav_0180"
FT   CDS_pept        187994..188893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0180"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78445"
FT                   /db_xref="GOA:C5BVK5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVK5"
FT                   /protein_id="ACQ78445.1"
FT                   /translation="MSQTVATSRPTPTRDQGERSDAATPRRRRPRIALGLTLGALTAAF
FT                   VVPLLLMLSTSFKSPQEANSLTFRLFPENPTLSAYSEILNNPEIPILRWLGNSLLVAVL
FT                   HCVLVVVLAALAAYALAKMDFRFKKAIFAAIVATMFAPGVIFLIPHFLIVNQLGWLNTY
FT                   ASLVVPSAAGAFGVFFLRQFFLGVHPSIEEAARMDGCNRWATFRRIAVPLAMPAIATLA
FT                   VLAFLSSWNDFLWPVFVLFSSEMQTLPAGLAQLQGENAARFDLMMAGAVIASLPVLLVY
FT                   VFAQRYIIDGVAAGGVKG"
FT   gene            188916..190565
FT                   /locus_tag="Bcav_0181"
FT   CDS_pept        188916..190565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0181"
FT                   /product="Alpha-N-arabinofuranosidase"
FT                   /EC_number="3.2.1.55"
FT                   /note="PFAM: Alpha-L-arabinofuranosidase C-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78446"
FT                   /db_xref="GOA:C5BVK6"
FT                   /db_xref="InterPro:IPR010720"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVK6"
FT                   /protein_id="ACQ78446.1"
FT                   /translation="MTSIATIRIAPLPGEARIDQRIYGHFLESAFFGNIEGGVFDEGSP
FT                   LAVNGPGPLAGCRRDVIEAFRELGLPVVRWPGGNFTSPYWWQDGIGPRDERPRRLELAW
FT                   GSEESNRFGTPEFLAWCEAVGTTPYLAHHARQVDDGVRWVEYTNYAGDTTLTRQRAADG
FT                   HPDPHDVPIWGLGNEVYGPWQMGHRRVGDYVDAAREHARFMRAVDPSIAFVAVGDTHED
FT                   WNQAVVAGLGELVDWVSLHLYGASRHLVDPSAEEFDAVVAQAVFFEQEIAAQAQTIGDT
FT                   QVEHGLTRPLAIAMDEWNIRHLEPRAWPEPQAGDDGGVAAREEAASAPDGFDVEGFPGG
FT                   HVRVNRYSPRTLADALFYAGVFHAMHRTAHQSVPVTMANTVNLVNANGLLAVRPGGVVR
FT                   QSTFHVWDLYQNHTGPVPLAADVSGPSRTARVRHGDHRRSDGEFRTSPAVVGQLDVSAS
FT                   TSEDGRTLYVTGINRSATDDVNAQIVLDGVTLPETATVRRIGAGVDDLFAVNTMAAPDV
FT                   VALSAPASVSLAGGVHTFPAHSISVLEIALEG"
FT   gene            complement(190625..191068)
FT                   /locus_tag="Bcav_0182"
FT   CDS_pept        complement(190625..191068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0182"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78447"
FT                   /db_xref="GOA:C5BVK7"
FT                   /db_xref="InterPro:IPR025058"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVK7"
FT                   /protein_id="ACQ78447.1"
FT                   /translation="MSPDERLRRAAGLGAAVTLAAIGGTHLAWGAGSSWPARTRADLAD
FT                   AVVGSPQVPGPIPCAVVGSGLIALAALSLQRTGLGQAARVAGTAGLLGRGIVGGVTSAR
FT                   MLRLPSPSERFRRLDARLYRPLCVAAGLALAVGAPSGSRGSRA"
FT   gene            complement(191130..192947)
FT                   /locus_tag="Bcav_0183"
FT   CDS_pept        complement(191130..192947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0183"
FT                   /product="glycoside hydrolase 15-related protein"
FT                   /note="PFAM: Glycosyl hydrolases family 15"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78448"
FT                   /db_xref="GOA:C5BVK8"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVK8"
FT                   /protein_id="ACQ78448.1"
FT                   /translation="MAQRIEDYGLVGDLQTAALVGRDGSIDWLCVPRFDSPACFAALLG
FT                   DADNGFWRIGPAGGGPCTRRRYRPDTLVLESEWDTADGTVRVIDFMPPRGEAADLVRIV
FT                   EGVRGRVPVTMDLRLRFDYGSVLPWVTVGRGETTAIAGPDAAVLHTPAEVTRDDGDLRA
FT                   RVEVAAGERIPFVLTHHLSHLAPPRPVRAEHSLRSTEKFWTSWVGRIDYDGPWSEAVRR
FT                   SVITLKALTYAPTGGIVAAATTSLPEELGGERNWDYRFCWLRDAAFTLQSMIGTGYVEE
FT                   AKAWREWLLRAVAGDPADLQIMYGLDGRRRIPEYTVDWLGGYEGASPVRVGNAAADQLQ
FT                   LDVWGEVLDCLHVAREAGLAPSHDAWALQHALLDYLEGHWQDPDNGLWEVRGPQRPFVH
FT                   SRVMAWAGVDRVVRAVEERGREGPLDQWRALRARIHDDVCTQGFDARRNTFTQFYGSEG
FT                   LDAALLLIPRVGFLPWDDPRVVGTVDAVQRELTEDGFLMRYRTVDDGGVHGVDGLSGRE
FT                   GAFLACSFWLADALFGIGRRDEAVALFERLLALRNDVGLLSEEYDPRTGRHLGNTPQAF
FT                   SHVGLVNAALHLGRELPAGTTTAPAEDVR"
FT   gene            193064..195967
FT                   /locus_tag="Bcav_0184"
FT   CDS_pept        193064..195967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0184"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: 4Fe-4S binding domain; FAD linked oxidases,
FT                   C-terminal domain; FAD binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78449"
FT                   /db_xref="GOA:C5BVK9"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVK9"
FT                   /protein_id="ACQ78449.1"
FT                   /translation="MSHASTLEVLRAVAGSDHVSDRATDRARMSHDASHYLLTPEAVVT
FT                   PSSAPEVAALLATAHKHHVPLTFRSGGSSLSGQAGTDGVLVDTRRHFGGVQVLDGGARV
FT                   RAEPGAVLRRVNAALAPYRRRLGPDPASEGACTIGGVVANNSSGMTSSTTATAYRTLAG
FT                   LELILPSGTFLDTGSPDADRRLAALEPDLHAGLGRLRDQLRGDAALRARIEHQFSMKNT
FT                   MGYGINAFLDHTAPSGILAHLVVGSEGTLGFVASATFDTLPVLPRVATALLVFASLDAA
FT                   IDALPALVAAGANAVELMDATSLRVAQADPLAPALIRGLRVEHQTALLVEVAAADDAAL
FT                   AHVSDAVGAVIATLPLAVPGALSSDAAERAAAWHVRKGLYATVAGARPQGTTALLEDVV
FT                   VPPAALGPAVRELQGLFERYDYADAVIFGHARDANLHFMITPRLDDAGQLDAYAAFTED
FT                   LVDLVLGADGSLKAEHGTGRIMAPYVRRQYGDELYAVMREVKALCDPHGILAPGVLLDD
FT                   DPQAHLRHLKSVPAVDPALDRCVDCGYCEPVCPSRNTTTTPRQRIALLREIAVAPPRLR
FT                   DELERDYAYEAVQTCAADSLCVVACPVNIDTGLAMKARRAQGLPAPAQRAGAVAADHWG
FT                   VGLGAARAGLGVASVVPGPVLSGVTTAARALLGSEWVPHADGALPGPGRPRPSAFTSRV
FT                   RGERASAGRHAPHSDADPALGGEHDVVFFPACIGELFAPERDASGAPGEGATTAFLALA
FT                   ERAGLRVAIAEQTPDLCCGTPWASKGLTAGADLMAQKLFAALWPLTDGGRLPVVADASS
FT                   CTHGIHGLASHLPEPDAERWSRVRVVDAVAYARAELLPRLGAVADERLLDRLVLHPTCA
FT                   SVHLGEVDDLAALGGAVAREAVVPENWGCCGFAGDRGLLHPELTRGATEAEAGTVAALG
FT                   RADAYASCNRTCELGMTRATGKPYRHVLELLEEATRP"
FT   gene            complement(196209..196433)
FT                   /locus_tag="Bcav_0185"
FT   CDS_pept        complement(196209..196433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0185"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78450"
FT                   /db_xref="GOA:C5BVL0"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVL0"
FT                   /protein_id="ACQ78450.1"
FT                   /translation="MAEQMKWQDLEPSRRAGVVTLAAVQIALAVAAWRDLARREAQDVR
FT                   GPKPLWAAIIAVNWVGPASYFLVGRRRHA"
FT   gene            196506..196985
FT                   /locus_tag="Bcav_0186"
FT   CDS_pept        196506..196985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0186"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related protein
FT                   FMN-binding"
FT                   /note="PFAM: Pyridoxamine 5'-phosphate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78451"
FT                   /db_xref="GOA:C5BVL1"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVL1"
FT                   /protein_id="ACQ78451.1"
FT                   /translation="MVELTTDAVWRVLAKQNFMVIGMISARGQARTVGVMPLVLERTLW
FT                   FTTNTQEWHAKHLAANPEVSVTVAIPKRVPFVPWIKIPAATITFSGVAEILPAAQMPRE
FT                   AREKLVRGLELGGDERGALIGVGVRPTSDFVTYGVGVSVLGMRDTEKARGRAPSG"
FT   gene            complement(197006..199282)
FT                   /locus_tag="Bcav_0187"
FT   CDS_pept        complement(197006..199282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0187"
FT                   /product="hypothetical protein"
FT                   /note="TIGRFAM: Tat (twin-arginine translocation) pathway
FT                   signal sequence"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78452"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVL2"
FT                   /protein_id="ACQ78452.1"
FT                   /translation="MRTSQVSESHESPSPLRPALPPISRRGLLGIGAATIAAFGAAGIA
FT                   GAGPAAATSEGTVLPLVDPLPAGAPDRTQFDPHEQVFASYLMILAPLANSVVDDDPELY
FT                   GWMEDGWWRTPNDPINSRIMEHVATLAWFLTHDRPWNPYYLDANLTGRLDAALGYYLSL
FT                   QGPRGAWPVTYESESLATTGFGLVSLAHTYRDLDSAGLLPARLAEIDTAMRAAAVWLMD
FT                   LDLDHWNLPLQLHNQLVGGLAGVGHAATVTGDPGIAADLADRIELLVEAAQAPAGYFHE
FT                   PLGYDHGYNFAVALPDVGDLYEQTGNPLLVEHVRRWADFAQYVVLPEPNAPGFVHLGAA
FT                   SMRNSTSVLTITPDDDKDRAALGRVFVPEVPLLAAFHASSEAKAAARAAWAAETAPVEP
FT                   RAKGDTSPRLYAHVPQAPDNVTAAERDDVVAALRPVAEPVFTEYRTGTIDQQLLFVRRP
FT                   GYYLATLLGNRGNARVRSGPGLFWHPAAGSVIASFNNAADDHWTTLTASGVAVAQTNIV
FT                   SSTFHDGEDATAPVIAPEDLGGVSGVFTGRYVAHVGKVTTDVTHRHDGVVRSVSAGDAA
FT                   SELVPLLVRDDDVLEFADGTRPARGTAASTTASGFSLTRGDVRVHISWGSERSASLTPS
FT                   GRVYLGALAHHLLRVEHDGDLTVEVTTVDVTQLAGSRVAAAASAHAWTALDGTHRLGVH
FT                   VVNLENEAVDVRVTGPVGPWTTTDLAPGAGAYRVFRSHRPLTRAVAVVTTRGRRPRIAV
FT                   RRLEG"
FT   gene            complement(199426..200721)
FT                   /locus_tag="Bcav_0188"
FT   CDS_pept        complement(199426..200721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0188"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: Oxidoreductase family, NAD-binding Rossmann
FT                   fold"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78453"
FT                   /db_xref="GOA:C5BVL3"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVL3"
FT                   /protein_id="ACQ78453.1"
FT                   /translation="MISIGISGAGMFAEAFIPLFAQHPLVERVVLADLVPERLAEVAQR
FT                   HGLVETVGSHAELCASDVDAVAIFAQRHLHGPLTLEALDAGKHTYCAVPIASSLDDVGR
FT                   IVSAVERTGLVYASGETSYYYPHTIYCRDRYARGDFGAFVYAEGNYLHDMAHGFYAAFQ
FT                   HSGGEQWRRVAGYPPMLYPTHSTGAVLGVTGARVTDVSCLGYADVEEDGVFGVGANEWD
FT                   NPYSNQTALMRTDDGGMLRVNEFRRIGWRGTHGGNPLTIYGTRASFEENAGSQVWVDRD
FT                   GGPTDVTGLLACAKHVEDTADDGAAGAAAAGSPGDVAAEHAGLHEVLREDFSSRYSAVH
FT                   PVHRLPQAYARLRNGHLGSHHFLADDFVRAVVTRTVPPVNVWEAAAYAAPGIVAHASSL
FT                   AGGDRLPVPDFGRPPTDRPLLAVDVPAEELVG"
FT   gene            complement(200787..203045)
FT                   /locus_tag="Bcav_0189"
FT   CDS_pept        complement(200787..203045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0189"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78454"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVL4"
FT                   /protein_id="ACQ78454.1"
FT                   /translation="MTSSTSRAAVALPPLSRRGFLGGVGAASLATFAAQGLAAPSAFAT
FT                   SEGTVLPLVAALPDGEPDRTLFAPNEQVFAAYLMILAPLANSVIDDDEELFGWMEDGWQ
FT                   RLPNEPFNARIMEHVATLSWFYAHQREWNPYYLDANLLGRLDAALTYYLKIQHDDGSWP
FT                   EYRWDEHGLAPTGFGTVALSAALRDLLATNALPERRAEIEAAIRASSAWLVDTSRPHWT
FT                   FPVQFVNQVVAGLAGVAQASAVLADPDIAASLADRCALLLEHGQAPAGFFNEPRSYDAG
FT                   YNFTVMLPDLGHIYEQTQDPSVVELTRRWAEWFGYVVVLEPGETRGFYVGAFSARNASA
FT                   AFETSPVDDLDRGALGRVFLPLVPALGSFYATAEEKVASRAAWTASPDPVEPREKQDSS
FT                   ARLYMHVPLAPDGVSAAERDAQVAQLPYLRAATFTQVREGTLDQHFVFARRPGYYLAAM
FT                   YGVRPYARQRTGTAHLWHPAAGTVVAAGNNVADDAWTTITAAGVSSALSAVVATHHEGP
FT                   DATGEPIARPDLHAHEGVFTTRYVTADGVITTDVAHWPGGIRRSVDAGGPATEQIPLVV
FT                   RADDVLAFSDGTSVTPGTTASATASSLTLTRGGTRFVIGWGEELPVTLTATDRTFFADA
FT                   SRRHHVLTVAHAGSITTEVTAVDLAHADGRVSFGAAAQVTPGRGGRGQLATHVVNTDDV
FT                   AVDVRLVSAAGAVTYRDVAPGSSVYDLREARVPVRSVVAVVTTRDGGLPRVAVRRLAV"
FT   gene            complement(203085..204038)
FT                   /locus_tag="Bcav_0190"
FT   CDS_pept        complement(203085..204038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0190"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78455"
FT                   /db_xref="GOA:C5BVL5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVL5"
FT                   /protein_id="ACQ78455.1"
FT                   /translation="MRSEATTATLAARDGVGLASRRTGDDAESGARGPESTRARRRGTV
FT                   TKVVLYALLVVLSVPFVYPTIWMVFSAFKPADEIFALPPTILPREWTLDGVSKIFTVTP
FT                   FAQQYLNSLYIATRVTVGSIIVCALAGYAFARIRFPFAGKIFLVLMAGMMVPGEVTIIP
FT                   IFRWVAELGLMDTHWPLIIVPIFGPAAIVGVFIFRQFFLSLPTELEEAGRLDGLGRLGI
FT                   FARIAFPLAGPAIAAVAIMKFLASFNMYFEPLIFLRSEHLFTVSLGLTRYQDAYGEPIY
FT                   NTQIGATALTVIPILIVFLFAQRQFVEGLSRTGLKG"
FT   gene            complement(204028..204981)
FT                   /locus_tag="Bcav_0191"
FT   CDS_pept        complement(204028..204981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0191"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78456"
FT                   /db_xref="GOA:C5BVL6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVL6"
FT                   /protein_id="ACQ78456.1"
FT                   /translation="MTADVGRVADQLARHPRRGSSGPASRRLARLDAVIGLSFVAPVVI
FT                   GVVALGLVPFGFVIWYALHDWSPLIGEFTWTGTENFTRLFADAAVWEAFGTTLKFAALL
FT                   MVLNICLAMALALLLNTKLRGTTTFRTFFFSPVIVSTVAWVLVWNYLVAANGGVNGFLA
FT                   MIGIQGPNWLRDPAWALVTLVVIQVFKGVGMNMILFLAALQNVPGDLKEAARIDGASPT
FT                   RVFRSITLPLITPTILLVTMITMIGAMDVFAPIQIMTQGGPGRSTTVISYLLYKTAFEQ
FT                   QDFGYASAIGVALFVVVLVFAALQWGSRKKWVHDEV"
FT   gene            complement(204984..206318)
FT                   /locus_tag="Bcav_0192"
FT   CDS_pept        complement(204984..206318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0192"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: Bacterial extracellular solute-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78457"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVL7"
FT                   /protein_id="ACQ78457.1"
FT                   /translation="MTSPFTQDMKHPTIRRRALVVGAALSAGALVLTACGSGGDGGGGD
FT                   ADGPVDLRMVMWSANEGHHAIFEEIADAYIEANPDLVSSVTFEPITGGDYVGALTTQIA
FT                   GGDAPDLAWVTEAYAAQFVDAGVFSDVTATFTDTSGYEFDDLLPGAMELWSADDNVYGY
FT                   PFSNSPFGIYVNSDLLAAAGQPDPRELLASGEWTWDAVLEIAGATAESQGVAGFQAPAD
FT                   PYTQWNDALGAMWLSWGAAPWSEDGTQCTMSSPEMVEFFDWFHTQVFDNGAVPGPGEEF
FT                   DFASGQVAVRMSQLSASTALGEDFAWDFLPLPEGPAGTVPVVGQGGVGVVSQGDNPEIA
FT                   ADFLAYFTNPESSELLAQYFPPPRASLLNVETLSAAAPALTEEQIQGTVIDQALDAVTK
FT                   VGHPKMSEINDPVRVDLDALWVPDGDAQTVLDQVCATLEPIIAGS"
FT   gene            complement(206447..207469)
FT                   /locus_tag="Bcav_0193"
FT   CDS_pept        complement(206447..207469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0193"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: Bacterial regulatory proteins, lacI family;
FT                   Periplasmic binding proteins and sugar binding domain of
FT                   the LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78458"
FT                   /db_xref="GOA:C5BVL8"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVL8"
FT                   /protein_id="ACQ78458.1"
FT                   /translation="MADRSTRRKKPSLAEVAEIAGVSISTVSKVANGSVDVSDVTRERV
FT                   ERILSERGYVATKKRRGSLMPVAILARDMHSPYTLDVIRGAVDAAGPVQVDVTVARHPD
FT                   DAADLRWIDEIHAAGRRGIIAITSMLDEAQRARVAHHGLALVVIDAVNNPDEATFSVGA
FT                   TNWAGGLGATEHLLDLGHRDVAMLSGLPQTMASRARVSGYRAALNGFEGDHAPARVLPG
FT                   DFTYDSGLELGAQLLAGKARPTAIFAASDFQALGVLEAARRAGLRVPEDLSVVGFDDLI
FT                   MAQMSSPQLTSVRQPLEQMGATAVETIVALLGGATGRPHHTELATRLVVRGSTAPPPER
FT                   "
FT   gene            207614..209218
FT                   /locus_tag="Bcav_0194"
FT   CDS_pept        207614..209218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0194"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78459"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVL9"
FT                   /protein_id="ACQ78459.1"
FT                   /translation="MELRADVAVIGGGLGGVSAALAALQAGRRVVITDPTRWLGGQLTS
FT                   QLVPSDEHRYIEDDGANRSYRDFRDALREYYRRHYPLTDAARADPHLNPGHAWVSPVSL
FT                   DPRVAVAVIDDLLAPYRSSDRLVVLMETEPVEVATDGDLVTGVVVRSASGELTSITAPY
FT                   YLDATELGDLLELGGVEHRSGRESREQTGEPGAADTADPTDMQGVSWCFAIDHLEGEDH
FT                   TIERPDDYAYWRDLRPPQLGGRHILGWGDPVKADGSPGRRWAFTPNLDDDEIDLDHRNM
FT                   GLAPELWNYRRIAARRNFTPGFYRSDVVVVNWPMNDYVGGALFGVPDAQQHWDGAKALS
FT                   RSLLYWLQTDAPRADGGTGWPGMRLRGDVAGTDDGFAMYPYIRESRRILALKTIVEQEV
FT                   STAFRGDGGAERYPDTVGVGHYYWIDRHATTVRGTSPGGTPHPFEIPLRSLIPQRVRNL
FT                   LPACKNIGTTQITNGCYRLHPVEWSIGEAVGALAAHCLDTGTEPHAVAGDDDGVAAFQR
FT                   VLTACGVQLRWDETKRW"
FT   gene            209274..210800
FT                   /locus_tag="Bcav_0195"
FT   CDS_pept        209274..210800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0195"
FT                   /product="Alpha-N-arabinofuranosidase"
FT                   /EC_number="3.2.1.55"
FT                   /note="PFAM: Alpha-L-arabinofuranosidase C-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78460"
FT                   /db_xref="GOA:C5BVM0"
FT                   /db_xref="InterPro:IPR010720"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVM0"
FT                   /protein_id="ACQ78460.1"
FT                   /translation="MVTARITVDRDFTVGLVPRRLFGSFVEHMGRCVYSGIYEPGHPTA
FT                   TPEGFRQDVLDLTRELGVTVVRYPGGNFVSGYDWEDGVGPVDQRPRRLDAAWHSVETNA
FT                   FGLHEFVAWAGTADVEVMEAVNLGTRGVDEARRLVEYANHPGGTALSDLRRANGAEEPF
FT                   GISLWCLGNEMDGPWQIGHKTAEEYGHLAVETAKAMRWVDPGLELVAVGSSGRGMPTFG
FT                   DWERVVLRHAYSEVDYISLHAYYGESDGDAASYLASGVDMDRFIDGVVATVDAERARGK
FT                   HRKVVNLSFDEWNVLHPPAGDDAPADVPADWPEHPPIAEHTYDVTDAVVVGTLLHSLLR
FT                   HGDRVTVANQAILVNVLGPIRSEEGGPAWRQATFWPFARTAALARGAILRTAVTSERAE
FT                   TEKHGEVDVVDAAATWDAERGRVALFLANRDLAADAAVELVLRGLDVTRVVSAEVLAGP
FT                   DGDRTVTNDVENPERVGLRPLDGVLADGDAVRVRLPPVSWAVVELEVTTA"
FT   gene            complement(211128..212855)
FT                   /locus_tag="Bcav_0196"
FT   CDS_pept        complement(211128..212855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0196"
FT                   /product="Dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="PFAM: Dehydratase family; TIGRFAM: dihydroxy-acid
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78461"
FT                   /db_xref="GOA:C5BVM1"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVM1"
FT                   /protein_id="ACQ78461.1"
FT                   /translation="MKQLRSQQWYAGQGRDAYIHRAWMRRGLPNDAFDGTHPHVAIANT
FT                   ASDLSPCNAHLTEVARSVADGVLAAGGVPLVMPVPSLGETQMRPTAMLWRNMSAMAVEE
FT                   MIRGNPIDGVVLLGGCDKTIPALLMGASSVGLPAVVVPGGPMLTGTFQGVALGCGTDVW
FT                   RLSEEVRAGTLSEEQFTRSESAMIRSRGHCNTMGTASTMGLLAEALGMVLPGLAGTPAP
FT                   DSRLLEGAHATGRLAVELVAADRGPADVLTKASFHNAIVTLAAIGGSTNAVVHLLAIAG
FT                   RLGIDLTVDDFDRIGSHVPLLVDLQPAGRFLMDDLYRAGGLHAVLREVRDLLDPAALTV
FT                   TGKPLVDYLDDADVWDREVIRTIAEPVQPDAGIAVLRGNLAPGGAIVKPAAATPELLQH
FT                   TGRAVVFDSIEDLHARLDDPDLDVDPSSVLVLRGCGPRGYPGMPEVSNMPMPKKLVEAG
FT                   VRDMVRICDGRMSGTAYGTVVLHVTPEAAAGGPLARIRTGDLVRLDVPGRRLDVVGPDG
FT                   APVELDAREPAPAALASFAAPARGWERLYVDHVQQADTGADLDFLVGSSGHRVGRESH"
FT   gene            212956..213969
FT                   /locus_tag="Bcav_0197"
FT   CDS_pept        212956..213969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0197"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES-like domain;
FT                   Zinc-binding dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78462"
FT                   /db_xref="GOA:C5BVM2"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVM2"
FT                   /protein_id="ACQ78462.1"
FT                   /translation="MKALVLTGPHAWAVEDVREPVAGPGQVVVDVARVGVCGTDLELFS
FT                   GDMAYLRDGQAAYPLRPGHEWCGTVSEVGDGVDGGLEGRRVTGDTMLGCGTCARCRAGR
FT                   HHVCANRYEIGIRGGWHGALAERLLVPANALHRLPDAVDDVVGALVEPGGNALRAVRAA
FT                   ATGPGEPLLVVGPGTIGLLAALFARDAGADVHLLGVDDRSLAFARSLGFAQAWTTASLP
FT                   ELPWAAVIDASTGHDVPRRAVELVEPAGRVVLIGISDAPSTLDTRELPLRDLTVVGILG
FT                   GSAGLAGAIERYASGAVDPGPLVAATVGLGEAGDVLGGWRPDDAGPGPKLHVDPRR"
FT   gene            complement(213990..214607)
FT                   /locus_tag="Bcav_0198"
FT   CDS_pept        complement(213990..214607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0198"
FT                   /product="pentapeptide repeat-containing protein"
FT                   /note="PFAM: Pentapeptide repeats (8 copies)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78463"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVM3"
FT                   /protein_id="ACQ78463.1"
FT                   /translation="MAERRGGSPDPETTTTVRGEDWYGREVGAEQYAGVRFVDVDLTEA
FT                   STRGTVFSECVFSNVAFNVSHHASTAFVNCTFRRCNFFDATFTGCKLVGAMFDGCSFGI
FT                   MKVDRGDWSFAGFPGADLEGVEFTGVRLRESDLTHARCARSVFAGCDLSGSWLHGADFT
FT                   DADLRGSALGEIDPRVVTLRGATITADQAIAIAAGLGLVVDV"
FT   gene            complement(214639..215259)
FT                   /locus_tag="Bcav_0199"
FT   CDS_pept        complement(214639..215259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0199"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78464"
FT                   /db_xref="GOA:C5BVM4"
FT                   /db_xref="InterPro:IPR009339"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVM4"
FT                   /protein_id="ACQ78464.1"
FT                   /translation="MIDALLTCGAVGAVLFVVVFTVDGATRPGYRPAEHAVSALALGPR
FT                   GWIQRWNFVTSGAATAAGGVGVALALDGFPGRATGVVIAAFGVALAASGVWSMDPMRDY
FT                   PPGAPAHPTTFSRAHERHDQAGAVVFAALPVACVTAAFAYADAVPAFAIVSGVAAVGLG
FT                   VASYRFGVLWERESRRVGLVQRLYIVAGWAWVAALCLVTVTMR"
FT   gene            215442..215912
FT                   /locus_tag="Bcav_0200"
FT   CDS_pept        215442..215912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0200"
FT                   /product="GCN5-related protein N-acetyltransferase"
FT                   /note="PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78465"
FT                   /db_xref="GOA:C5BVM5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVM5"
FT                   /protein_id="ACQ78465.1"
FT                   /translation="MTAGELDVVGALRVAAYSVDGLLDASPEYVEELRGLGGDGHGQVL
FT                   VAVGSGDAVVGTLMLEDFGAHSEVAREAGEIEIRGFAVDPAMRGRGVGRALLAEAEQRA
FT                   AVRGHRMVLSTLPAMTAARSLYLAQGYEREPDRDWEPLPGLQLLAYGKDLPG"
FT   gene            complement(215951..217543)
FT                   /locus_tag="Bcav_0201"
FT   CDS_pept        complement(215951..217543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0201"
FT                   /product="beta-lactamase"
FT                   /note="PFAM: Beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78466"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVM6"
FT                   /protein_id="ACQ78466.1"
FT                   /translation="MTTDDKGAVVPRDVETVAAELEQRVPRLLAEHAIPGVAIGVCDAS
FT                   RILWSAGFGTTTADGSQPITTDTTFGLQSGSKMYTATAVLRAVGDGLVDLDAPITDYLP
FT                   DFRVRTRFEPNPERRITLRHLLAHTAGFTHEAPVGNNYVVGNASFAAHCRSIGDTWLRF
FT                   DVGHHHEYSNLGYDLAGHVLERVSGEPFHRHLERALLEPLGLARTTADVATLKADRDHA
FT                   LGHGTSARVPFRVPMVPAGGVHASVDDACRFAQLHLRGGADLLPSELAEEMTAVPGHPE
FT                   RDQGYGLGVALIRVGDLVIRGHSGGGFGFLSDIYWAPEAGLGVVVLTNSTKHPLQFRLA
FT                   TEILRDLTGADLAPRPAAPTAHPDGGPRPPAAIAGEYVGRVGTLTLAVDGDGVVVRSGG
FT                   TSRSARLVTPHELAVDGDSPQRYVLRDVDADGRPGMLESAIDGQVHHRNDPPPDAEPTA
FT                   SGPWNRDYSIRDGTAVTRTRLRHEGGLASIDWEGHRLQLERHTDDVWFSSTGEALDLAS
FT                   QPPTYANVRLHPR"
FT   gene            complement(217540..218049)
FT                   /locus_tag="Bcav_0202"
FT   CDS_pept        complement(217540..218049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0202"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: HxlR-like helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78467"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVM7"
FT                   /protein_id="ACQ78467.1"
FT                   /translation="MTTPRSGCPINLSLEVFGDKWSLIILRDMVFGGRRHFRELLTGSI
FT                   EGIASNVLAARLKKLVALGMLTKRDDPSHKQKAIYSLTEASIELVPVMAALGTWGSRWL
FT                   PVSEELSVRATTLADGGPQVWERFMVELREEHLGVPAGPPADGRTVREKLQEAYLAVVE
FT                   RERRGA"
FT   gene            complement(218053..218967)
FT                   /locus_tag="Bcav_0203"
FT   CDS_pept        complement(218053..218967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0203"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78468"
FT                   /db_xref="GOA:C5BVM8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVM8"
FT                   /protein_id="ACQ78468.1"
FT                   /translation="MSTRMTADRGASAPGRQGRERVADVNDVHLCLQSFGDDADAALLL
FT                   IAGATWSMDWWDDELCRRLAAGGRHVLRYDQRDTGRSSHDPAGAPTYTGADLVRDAVGI
FT                   LDHEGIDSAHVMGLSSGGGVAQHLALTAPHRVASLVLISTSPAVPAASGELRLPPASSA
FT                   VRETFDDPPPEPDWSDPDDVARYVVDAERPYAGSLGFDEARVREVARRVVERTLDVRAS
FT                   LTNFWLAADGEPVPGTLADIAAPTLILHGTADPCFPYEHAEALAREIPHTTLVPLEGGG
FT                   HEMPAAVFHDIVVEAVLAHTRRD"
FT   gene            219056..219616
FT                   /locus_tag="Bcav_0204"
FT   CDS_pept        219056..219616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0204"
FT                   /product="bifunctional deaminase-reductase domain protein"
FT                   /note="PFAM: RibD C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78469"
FT                   /db_xref="GOA:C5BVM9"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVM9"
FT                   /protein_id="ACQ78469.1"
FT                   /translation="MAQLTYTAVGSLDGYIADVDGNFDFAAPDAELHAHVNATEGGVGT
FT                   YLLGRRTYELMTYWDTASTGEDVPAVEREFTELWQATDKVVYSRTLENVDAPRTRLERD
FT                   FDVDAVRSLVAAADRDVSIGGPVLAAHAIRAGLVDTFHMYVAPTIVGGGLRGLPDGVRL
FT                   DLELVDERRFAGGTVYLRYVPRR"
FT   gene            complement(219640..220791)
FT                   /locus_tag="Bcav_0205"
FT   CDS_pept        complement(219640..220791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0205"
FT                   /product="Epoxide hydrolase domain protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; Epoxide hydrolase N
FT                   terminus"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78470"
FT                   /db_xref="GOA:C5BVN0"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR010497"
FT                   /db_xref="InterPro:IPR016292"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVN0"
FT                   /protein_id="ACQ78470.1"
FT                   /translation="MTADTQIRPFHINVPQADLDDLRDRLARTRWPDELPGVGWSYGVP
FT                   VTYLTGLAEHWRTTYDWRTHEARLNAFPQFTTTIDGQNIHFLHVRSPEPDALPLILTHG
FT                   WPGSVVEFMKIIGPLTDPRAHGGDPADAFHVVAPSMPGFGFSGPTHETGWDMARIARAW
FT                   AVLMDRLGYERYGAQGGDTGSVISPMLGGIDSVHVVGVHVNGSLGFPTGDPAELAALTE
FT                   VEQARLAALHQQMQDGTGYAVIQSTRPQTLGFGLADSPSGLLAWIVEKFKEWTDPAADL
FT                   PEDAVDLDQLLTNVSLYWLTGTATSAARLYKEGQASWGQEATRSEVPSGVAVFPGDAGI
FT                   RVVAERENNVVHWSEFERGGHFPAMEVPDLLVGDVRTFFSGLR"
FT   gene            220853..221809
FT                   /locus_tag="Bcav_0206"
FT   CDS_pept        220853..221809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0206"
FT                   /product="Helix-turn-helix type 11 domain protein"
FT                   /note="PFAM: HTH domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78471"
FT                   /db_xref="GOA:C5BVN1"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR028349"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVN1"
FT                   /protein_id="ACQ78471.1"
FT                   /translation="MTRTTGRTLALLGYLQTHREWSGAELCRRLEVSPRTLRRDVDDLR
FT                   ELGYVIDSSRGIGGGYRLGAGSSVPPLLLDHEEAAAIAVGLRGAALSAVNGIEDAAARA
FT                   LVKLEQTLPSAVRHRVRDLERAIVPLAGAPSVDVDALLAVAAAIRDARRLRIDYTRHDG
FT                   AEVRREIEPHRIVRTQDRWYVIAWDPERAAWRTLRLDRMRPREPLGTRFTAREIPKDEL
FT                   LERTTRSIATAPYPHHVEVVVRAEVDAVRAKFGPTVAEVRDLGDGTTLLRSGSVDLDEA
FT                   AMYLGMSGFAFTVRSPAALRERLVVVAQRLREAAGPA"
FT   gene            221972..222865
FT                   /locus_tag="Bcav_0207"
FT   CDS_pept        221972..222865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0207"
FT                   /product="bifunctional deaminase-reductase domain protein"
FT                   /note="PFAM: RibD C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78472"
FT                   /db_xref="GOA:C5BVN2"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVN2"
FT                   /protein_id="ACQ78472.1"
FT                   /translation="MSEVDGRHGDTDGEGVSIMAGEHGVAALTDGRPDDGERDRPYVVV
FT                   SVTTSVDGRVTFAPDRLLMLEPHSSAWRALGGESADRVQAARAADLEREHPHQATLEGS
FT                   GSLVPPDAGPVGGLDPVPPEERDALYADHLPEAVVARPGRTKWFTVVDGRGRVRWTMKS
FT                   VGEFDVLVLASRATPIEYLGYLRREGICYLVAGEERVDLAAALRRMRERLGVTTLVSTA
FT                   GGGLNGALLRAGLVDELDLVVLPTAIGGAGTPTVFDGPVLPEGATPAALRLRSVRVEDD
FT                   GVLRLRYLVERADAGR"
FT   gene            222971..223939
FT                   /locus_tag="Bcav_0208"
FT   CDS_pept        222971..223939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0208"
FT                   /product="deoxyribose-phosphate aldolase"
FT                   /EC_number="4.1.2.4"
FT                   /note="PFAM: DeoC/LacD family aldolase; TIGRFAM:
FT                   deoxyribose-phosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78473"
FT                   /db_xref="GOA:C5BVN3"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVN3"
FT                   /protein_id="ACQ78473.1"
FT                   /translation="MLDALDEARIREIAASPASLRQFLHGLPGVDQVGAEARAATLGTR
FT                   SIKTTAKAEAIDLAIRMIDLTTLEGQDTPGKVRALCAKARRPDPSDASVPQVAAICVYP
FT                   DLVTVARDALAGSGIHVASVATGFPSGRTSLAVKLADTRDAVDAGADEVDMVIDRGAFL
FT                   TGRYTDVLAEIVAVREACVRSDGTRAHLKVILETGELATYDNVRRASWLAMLAGADFIK
FT                   TSTGKVSPAATPPVTMIMLEAVRDFRDATGRQVGVKPAGGIRTTKDAIKNIVLVNEVAG
FT                   EDWLSPEWFRLGASSLLNDLLMQRQKLRTGRYAGADYFTLD"
FT   gene            223952..225385
FT                   /locus_tag="Bcav_0209"
FT   CDS_pept        223952..225385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0209"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /EC_number="1.2.1.8"
FT                   /note="PFAM: Aldehyde dehydrogenase family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78474"
FT                   /db_xref="GOA:C5BVN4"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVN4"
FT                   /protein_id="ACQ78474.1"
FT                   /translation="MVLSYAPAPESRAVVDIDSSYGLFIDGEFTDAASGSAFKSVNPAT
FT                   EEVLADIAEAGPDDVDRAVAAARRAYDRVWSRMSGRDRGKYLYRIARIIQERARELAVL
FT                   ESIDNGKPIRESRDVDVPLVAAHFFYYAGWADKLPYAGFGVDPRPHGVAGQVIPWNFPL
FT                   LMLAWKIAPALAAGNTVVLKPAETTPLTALLFAQICQQADLPPGVVNIVTGAGETGRLL
FT                   VEHPGVDKVAFTGSTEVGKAIARAVAGTDKKVTLELGGKAANIVFDDAPLDQAVEGIVN
FT                   GIFFNQGHVCCAGSRLLVQESVYDDVLARLKRRLGTLRVGDPLDKNTDIGAINSSEQLQ
FT                   RIRTLSDVGEAEGAERWSPACDLPDRGYWFPPTVFTGVTQAHRIAREEIFGPVLSVLTF
FT                   RTPAEAVEKANNTPYGLSAGVWTDKGSRILWMSNQLKAGVVWANTFNKFDPTSPFGGYK
FT                   ESGYGREGGRHGLEAYLAH"
FT   gene            225375..225599
FT                   /locus_tag="Bcav_0210"
FT   CDS_pept        225375..225599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78475"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVN5"
FT                   /protein_id="ACQ78475.1"
FT                   /translation="MPTEPAPATGSASTTGSVSTTGSPSTPASTVRPGDLVTAPAGMRH
FT                   RPVADDGLANALHIETPWTKQYGEEGAPA"
FT   gene            225596..226627
FT                   /locus_tag="Bcav_0211"
FT   CDS_pept        225596..226627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0211"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde dehydrogenase family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78476"
FT                   /db_xref="GOA:C5BVN6"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVN6"
FT                   /protein_id="ACQ78476.1"
FT                   /translation="MSEARRRGAADGSAETAAARATRRPSTTASVRQAAESPRLDVRKT
FT                   YKLYVGGKFPRSESGRSYEVTDSRGRFLANAALASRKDARDAVVAARKAVPGWSAATAY
FT                   NRGQVLYRVAEVLEGRRAQFVDEVAAGEALTRARAERVVGEAIDRWVWYAGWSDKLAQV
FT                   VGGTNPVAGPYFDFSVPEPTGVVAVLAPQRSSLLGLVSVIAPVILSGNTCVVVASSARP
FT                   LPAVTLGEVLATSDVPGGVVNLLTGRVAEVAPWLASHMDVNAIDLTGLAGVAADEDAAR
FT                   AAGFGSVADASAAAVELERAAAENLKRVTRPPSTEPDWTGEPGLDRMTAVLETKTVWHP
FT                   IGI"
FT   gene            complement(226673..227194)
FT                   /locus_tag="Bcav_0212"
FT   CDS_pept        complement(226673..227194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0212"
FT                   /product="protein of unknown function SprT"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78477"
FT                   /db_xref="InterPro:IPR006640"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVN7"
FT                   /protein_id="ACQ78477.1"
FT                   /translation="MELFAARHLALGLMRQHGLGRWKLTFDRAKVRAGQCRFDRHEISL
FT                   SRPLTLLHDEAEVTETVLHEIAHALVGPSHHHDDVWKAKARALGARGETTLRTDKRPPA
FT                   AWVGTCPAGHEVHRHQRPSRPRSCARCSRTFDLDALVTWRWNGQVVPMTSAYQAELAEV
FT                   RQLYGVARGA"
FT   gene            227342..228628
FT                   /locus_tag="Bcav_0213"
FT   CDS_pept        227342..228628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0213"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: Subtilase family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78478"
FT                   /db_xref="GOA:C5BVN8"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVN8"
FT                   /protein_id="ACQ78478.1"
FT                   /translation="MPRTHLPSTMPRRAAAVVAVAAAVVLSTAPFATPAHADSWRDAQW
FT                   YLDEFDIEAIHDVSTGEGVTIGIIDTGTDVTHPDLQGAHVTPATGYGTIADPFSDPENH
FT                   GTSMAALMVGQGHGPDGADGVLGLAPDADLVVTSLNWDSETRADAELWQAQAVTELVEL
FT                   GVDVIATSIGGGSGAQEEMLAALESAREAGVPVVVAAGNSETYVLPGCTQDPCPWADAP
FT                   TEDVTNHVDGLQAPAWYPNAIPVFAYAPDGSRWENSPDVTPSLQLAISAPGHDLVATNA
FT                   GGGYAIRSGTSGAAPLVAATFALVKSVHPDATWDQLVGLVYGAAHDAGEPGFDEAYGWG
FT                   RIDPLAALSAPLPDPVTTPAADTPPPAVGAGEGAADDDGATVPGEPPLWLQHAISAAVL
FT                   AVVVGGVIALVTWLRRRRRRARMSAVSGA"
FT   gene            228851..229366
FT                   /locus_tag="Bcav_0214"
FT   CDS_pept        228851..229366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0214"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78479"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVN9"
FT                   /protein_id="ACQ78479.1"
FT                   /translation="MRHNSKILRRILAAATLATATLGLMAAPSSAQATGDGVTPAAGHI
FT                   CRQEPSNCWTDVGSHRQAIPKDAGGTNAFTYYGYTGPRGMYSVSAHFQAFDELLHINAI
FT                   PSRGSVARVNVWIEGQGWVSYRADPGTRREGIELGYDGDIAEGSSVRIQVCWGNSDDFC
FT                   TGYARATA"
FT   gene            229419..229955
FT                   /locus_tag="Bcav_0215"
FT   CDS_pept        229419..229955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0215"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78480"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVP0"
FT                   /protein_id="ACQ78480.1"
FT                   /translation="MRRQSKILRRALAAATLTTAALATSAAAAGTGTTASETPAGASSA
FT                   APMAGGHICRQEPSNCWTDVDDDPPMPGDSGGRDGHAHYRYSGPRGDYGVYTSFDAFDE
FT                   HLYINAWWSRGSVARVNVWIEGQGWVTYRAAAGTNREAIEIGYGGDVAEGSEVWIQTCW
FT                   GESDAFCTGYAKARA"
FT   gene            complement(230076..230747)
FT                   /locus_tag="Bcav_0216"
FT   CDS_pept        complement(230076..230747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0216"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78481"
FT                   /db_xref="GOA:C5BVP1"
FT                   /db_xref="InterPro:IPR021315"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVP1"
FT                   /protein_id="ACQ78481.1"
FT                   /translation="MHPAAEVLGATLPLAVAIALSPLPVIALLLLLSGPRGTAAGTLFA
FT                   LSRVIALAVLLGIVVAASDAVEHLTGAASLPAVVRLVIGAALVVLGLTRWRPRPDDGEP
FT                   ELPRWLASITEAPPSRGLVLGAIVTISNPKELAFLLAAGVSLGGSAVSGLQEVGIAALL
FT                   VVISALSVLAPLVAMVVAPHRVAPALDRLRRWLTTNTSLVMGVLLIVIGTVVVGGAIGD
FT                   L"
FT   gene            complement(230965..231732)
FT                   /locus_tag="Bcav_0217"
FT   CDS_pept        complement(230965..231732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0217"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: MerR, DNA binding; MerR family regulatory
FT                   protein; TipAS antibiotic-recognition domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78482"
FT                   /db_xref="GOA:C5BVP2"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012925"
FT                   /db_xref="InterPro:IPR036244"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVP2"
FT                   /protein_id="ACQ78482.1"
FT                   /translation="MDWSIQEVARRSGTTSRTLRHYGDLGLLAPSGTGPGGIRYYDDDA
FT                   LVRLQRILLLRELGLSLAAIREVLDGERDATQALRTHLELLELERSALDRRIASVRTTI
FT                   DKREGGERLMAQEVFDGFDHTQYEEEVTRRWGRDAYASGDRWWRGLSTDERAEWKARVD
FT                   ALSHDWIAAARSGVAPDSAEAQALARRHVEWLTGTPGTPTATPGGDAKGYVVGLAEMYV
FT                   ADPRFGANYTADDVPHGAEFVRDALTAYAEREL"
FT   gene            complement(231954..233000)
FT                   /locus_tag="Bcav_0218"
FT   CDS_pept        complement(231954..233000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0218"
FT                   /product="putative RNA methylase"
FT                   /note="PFAM: Putative RNA methylase family UPF0020"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78483"
FT                   /db_xref="GOA:C5BVP3"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVP3"
FT                   /protein_id="ACQ78483.1"
FT                   /translation="MKVLGTHTAGLGELVAESLRADVRAEVLYADDSAALVSTGAPESA
FT                   VAQLSYLKNAFVVLGSTPRRGDLRQAVEKIARAVPAWGLRRTGRQFRLTFSEDGRLAAV
FT                   PAASRVRLETAVARATGGRFTPRGGGAVEEYWTITRRDLDEVLFARRIARPPRPAVPKG
FT                   SLAPEIAELVVNAAGPAGADDVVLDPFAGSGALVAARVRRPFRKAICSDVGYADGTVRR
FT                   LPELARAARVVQLPEDARVLASVPDGSVDVVVTDPPWGEFESGPAPDEEFFAATLTSMR
FT                   RVLRPRGRLAMLLSRRLVRDVRAQWIDHGLVPEKSFDLLVNGHPATLLVGHREAGPGPA
FT                   ALETGAGA"
FT   gene            complement(232997..234799)
FT                   /locus_tag="Bcav_0219"
FT   CDS_pept        complement(232997..234799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0219"
FT                   /product="Citrate transporter"
FT                   /note="PFAM: TrkA-C domain; Citrate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78484"
FT                   /db_xref="GOA:C5BVP4"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVP4"
FT                   /protein_id="ACQ78484.1"
FT                   /translation="MSDLVITLLVLAAAIALFVWNRISVGVVAVGVSLALLVTGVIGPE
FT                   TVLAGFGDPVVIFVGTLFVLAEGLEASGVTAWAGRVLVDRFGSSRARLLGAVMLLAAVL
FT                   AALVTPNGAAAAIVPIVVVAARRLKEPSSQLLIPVAFAASAGALLTLSGSTVNVIVSDA
FT                   LLEETGEPFGFFEFALMGGPLIVVTLVVAALLGPRLLPRRAVDSIQADFSKHTATLVEH
FT                   YRLDRGFYRLRVATGSPLTGSRVADVATPDDVTVLGVQVRTGDLADPDHELEPGDVVVV
FT                   TGDSDRVRDLVRDLRLAVVMTPLTRRTREALLGKDVGLAEVVVRPRSRLVGRTVFPGAV
FT                   RGDVTILGVLRLGTDRGAQPTRLAEGDAMLVHGTWQAVGALEDDDDLLVVDSPDLVRRQ
FT                   AVPLGPRAWRALAVIAATVTLLASGVTSPAIAGLAGAAAMVAFRVVTPQQAYRAVSWQV
FT                   LVLLGGLIPLSVAITDSGLADAVADVVVGLVGGGSPLLLLAALFALTALLGQVVSNTAT
FT                   VLIVTPIALAAAAQTEVAAAPVLMLVAVAGASSFLTPIATPANMIVMAPGGYRFGDYWK
FT                   LGIVTMVAWLAVALLLIPLIWPLS"
FT   gene            complement(235000..236655)
FT                   /locus_tag="Bcav_0220"
FT   CDS_pept        complement(235000..236655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0220"
FT                   /product="TAP domain protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; TAP-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78485"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR013595"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVP5"
FT                   /protein_id="ACQ78485.1"
FT                   /translation="MPRRPDRRPVRLTAAVAAAALLVVGAPVTANADPPHAGAEPARQV
FT                   EARVPDLSWEACGEGLEAFECASAEVPIDYDRPRGDTTTIALTRLPATDPAQRIGSLFL
FT                   NFGGPGGPGVATLHQIGDAFLDPSVRERFDIVAFDPRGVGLSDPVTCFPDAETEAEFLA
FT                   DGDAFPTDRREEARFQALFATLSASCALLSGDRIAHASTANVARDMDLLRQAVGDEQLS
FT                   YLGYSYGTVLGATYGALFPDRVRALALDGTLDPEAWSGGEGSIGLRTGQGVAASETFDE
FT                   FLRLCAEAGPEGCALAALGDPRQVVEDLFAQLDASPVPVPMPDGTVVEFGYDDAVALAF
FT                   SSLYSPVAWADLAAALAALAAPQTLSAHGPPSIGELLRELGLIEDYPSIGGALASMCVD
FT                   GEHPLDPWDYAAQADAADAEAPHFGRFRSWVGLQCEHVPFTDADAYTGPWDQGTDAPVL
FT                   VIGTRYDPATPYAFTQPYADRWNDASVLTVEGYGHTTLGLSSCATAAIAAYLVDLEATD
FT                   GATCAQDVAPFQAAAPQSDDDVARPSWWGHPAGV"
FT   gene            complement(236713..237807)
FT                   /locus_tag="Bcav_0221"
FT   CDS_pept        complement(236713..237807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0221"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: Domain of unknown function DUF20"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78486"
FT                   /db_xref="GOA:C5BVP6"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVP6"
FT                   /protein_id="ACQ78486.1"
FT                   /translation="MGVVAVFVGILSWYALGSLQGLGVNLVIAFFVALALEPAVVWLVR
FT                   HGWRRGAAAGVALLGSIIVIAVVLALFGNLFVQQLIQLVSNLPDVYATIQEWVEGQFGV
FT                   VVPDSDDLIRQALEQWGDDVASGALAVGAGIVGGLFAASVILLVAYYLLAAGPKFRASI
FT                   CRWLTPNRQEEVLRMWEITQVKVSDFINTRIVLAALSTTFTFVFLLIMGTPYALPLAVF
FT                   TGVVSQFVPTIGTYIGGALPVVVALAAQGIGYGLAVTAFIVGYQQVENLIFSPKVSARA
FT                   LEMNPAVSFVAVLAFGAVFGPLGAFLALPIAATIQAIGNTYMRRHELIDSHMLRDPDSH
FT                   HEGHEGHEGHDRKKPGEPHDAPAG"
FT   gene            238103..238708
FT                   /locus_tag="Bcav_0222"
FT   CDS_pept        238103..238708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0222"
FT                   /product="GCN5-related protein N-acetyltransferase"
FT                   /note="PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78487"
FT                   /db_xref="GOA:C5BVP7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVP7"
FT                   /protein_id="ACQ78487.1"
FT                   /translation="MTPTTRTTSASDVVVRPYTDDDGESWMRCRLLAFAHTQYYDDVRI
FT                   SPALDGPALRIVAEVRGDVVGLLDIEIDAEEHAATIDSVAVLPDHAGRGIASRMLDAAL
FT                   PLLGDGIATLDAWTREDAAANAWYGARGFTERFRYLHVYKGWDDPADGFTTPDGLSRPV
FT                   TAFLHADIEREAELRERFSRVYVCRQYVRALSAPRARA"
FT   gene            complement(238718..239422)
FT                   /locus_tag="Bcav_0223"
FT   CDS_pept        complement(238718..239422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0223"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: Bacterial regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78488"
FT                   /db_xref="GOA:C5BVP8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVP8"
FT                   /protein_id="ACQ78488.1"
FT                   /translation="MSDQPTRNEAGRRARERLVDAAERLVATRGPEVPVRQITRAAGQR
FT                   NNSAVTYHFGSRAGLLDAVWTRRTQRVNADRSAMMDELAADGRDADLHALVEAHVLPMA
FT                   REIGAGLPSYWARFNEVTLAAMPLAFLDTFDADLAQRVETEVPLRTLSDLFHRMRKHVA
FT                   DGAEPAAGLQVALMVRFVIAALASWERDQEAGRVDAASLEEFAHGLVELGHEMLVHPNR
FT                   HLADAVAHVGRA"
FT   gene            239535..239963
FT                   /locus_tag="Bcav_0224"
FT   CDS_pept        239535..239963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0224"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78489"
FT                   /db_xref="GOA:C5BVP9"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVP9"
FT                   /protein_id="ACQ78489.1"
FT                   /translation="MTEISQRKVNALRVGATARERVGGRSRRHAGDRPPTTPEQRAWLA
FT                   MCGIAAVFGATVLAWSAVLALPAGWVGTGLGLLLIAVVAAAAIGVVARARRPGRTPARR
FT                   ARVAERPGRKSARVAATVAVASSHSSSRGAREYLDRRA"
FT   gene            240031..242118
FT                   /locus_tag="Bcav_0225"
FT   CDS_pept        240031..242118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0225"
FT                   /product="adenylate/guanylate cyclase with integral
FT                   membrane sensor"
FT                   /note="PFAM: Adenylate and Guanylate cyclase catalytic
FT                   domain; HAMP domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78490"
FT                   /db_xref="GOA:C5BVQ0"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVQ0"
FT                   /protein_id="ACQ78490.1"
FT                   /translation="MRIEIQSKLLVMLLAMALVTALVVGWIGYRSGTQALEQAAYQQVT
FT                   QVRESRAREVASYFTGLERAVVLNSRTAENSMQAFEAGWRDLAGAQVSADQRAQVEAVY
FT                   SDVLLPQLAENAGQEFTVESFLPTSDAAWYLQAHYTDPALDYDATLAVDDAGDGSVWSA
FT                   AHARYHDTLREIVTQNEFEDLLLIDPDGNVVYSAYKGVDLGTNVLSGPYAGGSLEDTFR
FT                   ETVTSNGQDYVGLADFEPYQPLADSPTQFVMSPIQDDGLTVGVLAIQASTDRLNEVLTS
FT                   GGQWQQAGFGETGETYLVGPDGTLRSTSRLLVENPEEYVDRVVAAGTPRDVAETVVRLG
FT                   NPILRQSVQSPAIERALDGETGIVRTTGYRDTDVIVAYTPVDAPGLNWVIAAAVDPSEV
FT                   FAPVQDFQRQLVLSIAGMLLLAAVASLLLAQVFVRPIRSLVSGVRAVSAGDLDAQVRVR
FT                   TNDEVGDLAEAFNEMATSLRTKQELLEAEQAEKDRILLSLMPPAVAEQVKGGEETIAQD
FT                   FQDVSVVFADLVGFAGFTSGMDSHAALEHLNELVRAFDEAAERTGVEKVRSLRNGFLAS
FT                   CGLVIPRVDHARRIVQFTSELTEVVAAFNARHGSDLSLRAGINVGTVTSGIVGRASVVY
FT                   DLWGEAVDLAYRVHAEEPEPGIYVTDRIYDAVRDQYEFTEAGVVRSSDGEHPVWRLDER
FT                   R"
FT   gene            242124..243545
FT                   /locus_tag="Bcav_0226"
FT   CDS_pept        242124..243545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0226"
FT                   /product="cyclic nucleotide-regulated small
FT                   mechanosensitive ion channel"
FT                   /note="PFAM: Cyclic nucleotide-binding domain;
FT                   Mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78491"
FT                   /db_xref="GOA:C5BVQ1"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVQ1"
FT                   /protein_id="ACQ78491.1"
FT                   /translation="MLEEAWFAWAAAVVVGVPLALFLLTQWQDVLRRRGSALLAPVSFL
FT                   RNAVVPAFGIFVLVRFAAEFPPTNVWVRVLATVAGVALLVFALSALNAMMFAQAREGSW
FT                   RARIPSIFVEIARLVLVVLGMAVILSWVWGADVGGMFAALGVTGIVLGFALQGAIGSVV
FT                   SGLLLLFEQPFQIGDRLSAAGAVGRVVEVNWRSVHIETGEGVHIIPNSSLGGSSFVNLS
FT                   EPEGRFDVAIDAVFAADDPPATVIGVLRDVARDLPTLRSGARPSVALTAPHTYTTTLPL
FT                   HGPADESSATSVFRLWLWYAARRAGLSLDGGSAGPSAGDEASAAAMAEVQELFGLSDAV
FT                   VDGARDSAVLRVYGDGEILHHAGAVARGLLFVLAGRVQLSVSLGGEARAVEAPIERGGY
FT                   TGEACLAREPHGFTAHALGETRVLFVPAEVTRAAALAEPQLAQRIGAVADARRRLVREI
FT                   ARTGERGLRELDVPA"
FT   gene            complement(243599..244531)
FT                   /locus_tag="Bcav_0227"
FT   CDS_pept        complement(243599..244531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0227"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78492"
FT                   /db_xref="GOA:C5BVQ2"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR029059"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVQ2"
FT                   /protein_id="ACQ78492.1"
FT                   /translation="MRRVLAALPGLVLLGVVVWVVLTRWDVLRAGHPAYPITLAVAAVL
FT                   GAVLAIRGAQAPAERPAGGGRRVLRALGHAVGAVLVLASAAALAWLRPFPADDVALPAL
FT                   DVPDDASVAVVDEIGTIDLVPAEPLTTGLVFSPGARVDPRAYAHVLRPLAEAGYVVVIL
FT                   RPPYGIALANPTQSGAAISRHPEVETWFVGGHSIGGVAASWFAEREAAPDGAVDGLLLW
FT                   ASYPAADLSGTALRACSVTGTNDGLTTPADVADSAPLLPPTTVFTPIDGAIHAYFGDYG
FT                   PQAGDGEPAVPREEAQRQIVEASLACLDG"
FT   gene            complement(244592..249007)
FT                   /locus_tag="Bcav_0228"
FT   CDS_pept        complement(244592..249007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0228"
FT                   /product="ATP-dependent helicase HrpA"
FT                   /note="PFAM: Domain of unknown function (DUF1605); Helicase
FT                   associated domain (HA2); Helicase conserved C-terminal
FT                   domain; TIGRFAM: ATP-dependent helicase HrpA"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78493"
FT                   /db_xref="GOA:C5BVQ3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR010222"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVQ3"
FT                   /protein_id="ACQ78493.1"
FT                   /translation="MSGERSEQRAGPAGTPGRRRPNRRRGRGQGTGPRERRPARPAWRP
FT                   YSEEQLAVRRAALPTLAFPPDLPVSARRDDIAAAIRDHQVVVVAGETGSGKTTQLPKIC
FT                   LELGRGITGTIGHTQPRRIAARSVAERIASECDVELGGAIGYQVRFTDHVGPTTLVKVM
FT                   TDGILLSEIQRDPTLSRYDTIIVDEAHERSLNIDFILGYLRRLLPRRPDLKVIITSATI
FT                   DSERFAAHFAQRDGVVVPRIGDPGTPAPVIEVNGRTYPVEIRYRPLVPGEEDEEPDDGA
FT                   PRPPHDALDLDVLDDADLLAGLETDDARVLAALEAATAPDADPASAAGRGRATHTAPTA
FT                   TRRGTRRTPSSGPQQADEELDQPTAICRAVDELTALGPGDVLVFCSGEREIRDAADALA
FT                   SHLGTRYTAPGARNTAPGAVEVLPLYARLSAAEQHRVFAPHPYRRVVLATNVAETSLTV
FT                   PGIHYVVDTGLARISRYSQRTKVQRLPIEPISQASANQRSGRCGRVADGVAIRLYSRGD
FT                   FDRRPEFTEPEILRTSLASVVLQMAALGLGRMDAFPFVDPPDTRAIRDGVALLTELGAI
FT                   EEGQGDDAEDVRLTDVGRQLAQLPIDPRLGRMLVEAGRLGVVREVMVLVAALSVQDVRE
FT                   RPADHQQAADDKHRRFADPTSDFLTLYTLWTYLQDQQKAMGSSAFRRLCRSEFLHYLRV
FT                   REWQDVHAQLRQLGKGLGLRPEPRADDAPAGVGDVRKPKVDSDAVHRALLAGLLSHLGS
FT                   WDERRREYAGARGSRFVVFPGSSLARKPPAWIVAAELVETSRLFARTAARIQPEWAEQA
FT                   GEHLVKRTYSGPFWSAKQGAAMCHEKVLLFGVPIVADRVVPFARVDPAAAREMFLRNAL
FT                   VEGEWRTHHAFVRRNAEVLDEARQIEDRARRRGLLVDDEALVDFFDERVPESVTTARAF
FT                   DAWWKDARRADPDLLTYTLDLLVPTAHAVDDAGFPRTWTQGDLTLPLTYQFTPGTDADG
FT                   VTVHVPIAVLNRVRPAGFDWLVPGLLTDLVTATIRALPKQVRVQLVPAPDVAQAVVARL
FT                   PDWADVAPAPDGAPSFHEAFASAVREVRDVVVPAEALEEADERLPAHLRMTFRVLGERG
FT                   QELDEGHSLVALQRRLAAQAQSAVRSAVRAALADASRTAAVPAGPVASPETTPTTAESG
FT                   EQQGRTGGAEVDTVRTWADVPGEAIPAELATTGPAGLDIRGYPALVVEPDPDGGRTRVA
FT                   LRVLADAERARAQHADGVRALLLQEFAIPTARVTSRWTGREALTLASSPYRDTDALVRD
FT                   VQVAAVAQLTAGTDLTTVRDAASYRRVRADVRDHLEDAVYGVVARVVEALQAHRELDSA
FT                   VRASTSMALLGTLTQVRDHAASLVYDGFVARTPPESLRHLARYLRADGYRLAKAAENPG
FT                   RDATLAWEVSELEDALASVRATHLSPDRAARAEAVRWQLEELRVSLFAQQLGTAQPVSA
FT                   KRIRTALAQV"
FT   gene            249124..250353
FT                   /locus_tag="Bcav_0229"
FT   CDS_pept        249124..250353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0229"
FT                   /product="monooxygenase FAD-binding"
FT                   /note="PFAM: FAD dependent oxidoreductase; FAD binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78494"
FT                   /db_xref="GOA:C5BVQ4"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVQ4"
FT                   /protein_id="ACQ78494.1"
FT                   /translation="MTPPTAVVVGAGIGGLTAAAALRRVGWSVRVLERSPEPQPTGAGI
FT                   VLLANAMRCLDEIGAGDAIRGLGAAAYPGGTRTASGRWLARVDAERVAARFGSGAVVIH
FT                   RAQLHDALAAVLGPDGVTYGAQVTDVEREPGPTPRALVRYLAGGTAQEVTGDVVVAADG
FT                   AASALRGRFWPGHADLEYTGSTAWRAVASVPPGTVTEMSETWAPGGAFGIVPMADGRVY
FT                   WFATALRPAGGREGDGAEELAEVRRLVAGWHDPIEAVLAATPPEAVLRHDISALRHALP
FT                   SYVRGPVALVGDAAHAMPPNLGQGGSQAIEDGIVLAASLATAAAPAEVRDGLARYDAQR
FT                   RPRSQQVQRLSWAMARFGAQLRHPAAVATRDAMVRIAPSAAVMRAASRFAGWVPPSLAA
FT                   AAGDAARGSA"
FT   gene            complement(250380..251414)
FT                   /locus_tag="Bcav_0230"
FT   CDS_pept        complement(250380..251414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0230"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78495"
FT                   /db_xref="GOA:C5BVQ5"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVQ5"
FT                   /protein_id="ACQ78495.1"
FT                   /translation="MTFLPIDADPAPDAVARLTIVPVLPDGTFAALVEGDGRVRLVTGD
FT                   MRPGEDWLLEGTLRLPKEAAGFRRQRVHVVGIDADHLLVWVDGDVRPDLRPPAPAAELG
FT                   VFAPEELSRRLAAQGDDDGARAVVQVAASRAGDTDEAYFADAMRLLAPAYLAATTAQGG
FT                   SGFGGDADAWARRRGQIADAVPADGTFLDLGCANGLLMESVAAWTAARGLRVEPYGVDL
FT                   SPELVELARRRLPHWADRLAVGNALDWTPADGRRFDVVHVLLDCVPRDRRRELVDHGRA
FT                   LVEPGGRLLVSHYIARGGTEPHVGVQLAAMGLAEPDGLAPERGGDVPMLAWYDRPDDGA
FT                   APAR"
FT   gene            251529..252506
FT                   /locus_tag="Bcav_0231"
FT   CDS_pept        251529..252506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0231"
FT                   /product="Gluconolactonase"
FT                   /EC_number="3.1.1.17"
FT                   /note="PFAM: SMP-30/Gluconolaconase/LRE-like region"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78496"
FT                   /db_xref="GOA:C5BVQ6"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVQ6"
FT                   /protein_id="ACQ78496.1"
FT                   /translation="MTTSPPLEQGVIRSLPLELDPAVGHEAELAALIAPGTSLDLLADG
FT                   GIWFEGPAWVSETEIVWSDVVGNRLLTWSPDAGAGILLEPSHHQNGHTLDGEGRLLAAS
FT                   HGERAIVRRELDGAWAVVVDRHDGRRFNSPNDLVVAADGAVWFTDPRYGIDKPEEGYGG
FT                   EVEMDGCHVYRVAPDGHVRVVARAQPGPNGLAFSPAGDVLYLADSEAGHVLAFPVTTAS
FT                   AVARDPRDGEPHLGAPTTFALIAPGAPDGVRVDSDGRLWVSSGSGVQVYVPGTPGGPGE
FT                   RLGTIRVPEPTANLAFGGPGRSVLAITATSGLYRVATTVRGVGS"
FT   gene            252546..253799
FT                   /locus_tag="Bcav_0232"
FT   CDS_pept        252546..253799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0232"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78497"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVQ7"
FT                   /protein_id="ACQ78497.1"
FT                   /translation="MTDSLRDETLALAAAALGAGLTGAQPLGGSDRSVVLRARVVAGTR
FT                   TDRLDSSAGTAHGRATTVIVKRFVAPGGVPAEFGRELVGLSRLDRTPSLLAVDEEHRLV
FT                   VMSDLGTWPTLADLLLADDADAAWEGARGWAEALGDLLGASAPEAPAVAAELARRGAGI
FT                   DGDLVGMLEQGARRVAELVGRADVPPELTAELAAITALVAPGPHDVVSPGDTCPDNAVL
FT                   APSGWAFLDLEGTATHHPALGAAYTVLPFATCWCVFDPPAGLTDDLLAAFTAGLGRHLP
FT                   DVVAEPGWSRDVDLACAAWILLTHTWAIDGALASNTPIGPDGVPSPSRRQLLAGRWRWA
FT                   VAHLQGVTPGLAALAQEALAWAEETWGADAAPAGPYRAFASQDDGSRTFGTLPTAVPDS
FT                   PFEDLPEEELRRWEGHSR"
FT   gene            253818..254804
FT                   /locus_tag="Bcav_0233"
FT   CDS_pept        253818..254804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0233"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="PFAM: Endonuclease/Exonuclease/phosphatase family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78498"
FT                   /db_xref="GOA:C5BVQ8"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVQ8"
FT                   /protein_id="ACQ78498.1"
FT                   /translation="MRVIGWLVVALVALAALALVDPARIGLSTTFPVTQVIAFRSVLAV
FT                   ASLGAAVVLAAVAIAVRASHHQARAAVVLALVFLLCGASHTWVLAARGLTATPLAPAAD
FT                   DGVTVLQLNTYGGASSPEDVARLAYAAQADVLTLPETTAESARAIAALLAAEGGDYQVF
FT                   THTTGPWAAFSTALLVSDELGTYHQVPGPPTRAGAVRAEPDDGVGPVLLAVHPTAPLRA
FT                   RMHQWSADLGAVTDACRATPGVIVGGDLNATVDHAPLRHLDPCASAAVLAGSGAVSTWP
FT                   TSQPSRLGTTIDHVLVDTRAWDVAAVSVVAAGGSDHRGVVVHLVPTG"
FT   gene            254856..256202
FT                   /locus_tag="Bcav_0234"
FT   CDS_pept        254856..256202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0234"
FT                   /product="drug resistance transporter, Bcr/CflA subfamily"
FT                   /note="PFAM: Major Facilitator Superfamily; TIGRFAM: drug
FT                   resistance transporter, Bcr/CflA subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78499"
FT                   /db_xref="GOA:C5BVQ9"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVQ9"
FT                   /protein_id="ACQ78499.1"
FT                   /translation="MATPAPIAHLVESTPSRSGRIPAALVLLLSALTAVGPLTIDLYLA
FT                   AFPDIATELGTSAATVQLTMTTTLIGLALGQLVIGSVSDALGRRRPLLAAFALYAVVSI
FT                   AIAFVSSIGALAALRGVQGFAASAGMVMSMAIVRDRFSGPRVAKVIARLMLVVGVAPIL
FT                   APTLGAQILRFGDWRTMFFVLAGVGAALLVLVALFLRESLPAQYRRTGGLGPALASYGS
FT                   LLRDRSFVALALLAGFYMAAMFTYVSTSTFVFQEGYGLTAQQFALVFGAGAIAVTAGSQ
FT                   INGALAGRVTPERILSVVVPTGVVLSLLLVVVAATAGRTVDGLLPLVGVLVLVLGTAGF
FT                   VMPSVPAIALERNAHQAGSAAALLGASQFGVGAAIAPVTGLFGEGDALTMALVMSGTIL
FT                   VAAGLLLVVARGWTREARAIPAPAPASDGVPSPAVAVAEAEAAVVAETA"
FT   gene            256357..257664
FT                   /locus_tag="Bcav_0235"
FT   CDS_pept        256357..257664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0235"
FT                   /product="histidine kinase dimerisation and phosphoacceptor
FT                   region"
FT                   /note="PFAM: Histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78500"
FT                   /db_xref="GOA:C5BVR0"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVR0"
FT                   /protein_id="ACQ78500.1"
FT                   /translation="MPDPDLARPAPPSSGGDGGTGARASVVVRAGVYLVLGGVVAAAYA
FT                   VLGVGLWQLVDAAPQVPLPMTVAIAVVAVPLGALPPFLAPIRELETAAARSLLGAGVDD
FT                   VPAPPGGQLRPDDRARAAAFFGAHLILGGAILVGLLAGLPTAVGLLGAALGVPSDGIQL
FT                   VPGESTAAALGPWAIPVALAILVALPLGTALAGSIMRALAPPLLGPGPEQRAAAERARI
FT                   AALAERNRLARELHDSVGHALTVTTLQATAAERLLSRDPDAVREALRAIQDTGRSALAD
FT                   LDHALGLLRSDDAAARPARAPDRTLDDLPRLVAESAAAGHTLGVDGDVPPGLPGVVSRE
FT                   AYAIVAEAAVNAWRHGSGPARVRLDASDSVLGLEIANPVPTTSGAGRADRAGRGVVGMR
FT                   ERAHVVGGTLEAGASDAPDGATWVVRARLPWRRADD"
FT   gene            257657..258331
FT                   /locus_tag="Bcav_0236"
FT   CDS_pept        257657..258331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0236"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: Bacterial regulatory proteins, luxR family;
FT                   Response regulator receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78501"
FT                   /db_xref="GOA:C5BVR1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVR1"
FT                   /protein_id="ACQ78501.1"
FT                   /translation="MTEQVRVAVVDDEPLVRAGLAAIVDAEPDLGVVGEAGDGADVRDL
FT                   VARTRPDVVLMDVRMPALDGIAATAALTRDADAPRVLVVTTFENDDYVLDALRAGASGF
FT                   LLKRAHPDRIVEAIRVVARGDAVLFPEAVRRLVAASPAGATPSPADGPHGAAIGRLTER
FT                   EEEVLRLVAAGMTNAEIAAQLWLGVETVKTHVGNVLAKLGARDRLQAAIVAYESGFVVP
FT                   GA"
FT   gene            258342..258833
FT                   /locus_tag="Bcav_0237"
FT   CDS_pept        258342..258833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0237"
FT                   /product="GCN5-related protein N-acetyltransferase"
FT                   /note="PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78502"
FT                   /db_xref="GOA:C5BVR2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVR2"
FT                   /protein_id="ACQ78502.1"
FT                   /translation="MADPAVPQGIEVRLARDDELEQVVRLRWRWSSERGTPVVAESDHV
FT                   AAAAAWAREHRDTHLPHIALDDGGVVVGMAWLALTPRVPGVGQLQRTSGDLQSCYVVPE
FT                   RRGAGIGGALTRAVLATALERGAEHVTVHASPSSVRMYARHGFAHSDRLLWAEAAIAEA
FT                   "
FT   gene            259040..260053
FT                   /locus_tag="Bcav_0238"
FT   CDS_pept        259040..260053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0238"
FT                   /product="Methylenetetrahydrofolate reductase (NAD(P)H)"
FT                   /EC_number="1.5.1.20"
FT                   /note="PFAM: Methylenetetrahydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78503"
FT                   /db_xref="GOA:C5BVR3"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVR3"
FT                   /protein_id="ACQ78503.1"
FT                   /translation="MTTSTLYTPARPTISFELYPPRTPAGEERAWETVEALVGADPDYF
FT                   SVTYGASGSTATASQSLVRRILTETDVPAVAHLTCVGLSREHARDVVGGFLDDGVRDFL
FT                   ALRGDPPAGNPDWRPAPGGLARACDLVALIRDLEDERFAGNAHADVANRLSIAVAAYPG
FT                   MQEHPGAEFRVRDCDLEALVAKQRCGADYAITQVFFDVRAYTALVDAARGAGVRIPLVP
FT                   GVLPLTDPRRIRRLCELNAIPLPAELLARLDAADDEERVAIGLTATLALVADLLAAGAP
FT                   GIHLYTFNRAEASLAVLEHAFGRVPGAARPGSAAPPSPDHAAPQALVAALPRRGNA"
FT   gene            260050..262386
FT                   /locus_tag="Bcav_0239"
FT   CDS_pept        260050..262386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0239"
FT                   /product="5-methyltetrahydropteroyltriglutamate/homocystei
FT                   neS-methyltransferase"
FT                   /EC_number="2.1.1.14"
FT                   /note="PFAM: Cobalamin-independent synthase, Catalytic
FT                   domain; Cobalamin-independent synthase, N-terminal domain;
FT                   TIGRFAM:
FT                   5-methyltetrahydropteroyltriglutamate--homocysteine
FT                   S-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78504"
FT                   /db_xref="GOA:C5BVR4"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR006276"
FT                   /db_xref="InterPro:IPR013215"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVR4"
FT                   /protein_id="ACQ78504.1"
FT                   /translation="MTQHLSQPEFPAATVLGYPRIGPHRELKKAVESFWAGRTDAHALE
FT                   ATASDLRARTRSHLAALGLGADDASVPLDFSYYDQVLDAALAIGAVPERFTDLVGDDGT
FT                   VDLAGYFTIARGEGDRAPLEMTKWFDSNYHYLVPEIGPATPIRFVGRRRVQEFTEALNA
FT                   GVRTRPVLVGPVTFLLLSKAADGAPAGFSPLDRLDDVVAAYAELLAALAAAGAPWVQLD
FT                   EPALTSDTWDVPRDEVKAAVARAYGTLAAPSSSRPALFVATPYARLGCAIRELAASGVE
FT                   AIGVDLVRGSAPDEDVAGIENVTLVGGVVDGHNIWRTDLDAAAEKLAALEGVGAARVTT
FT                   STSTSLFHVPHTLDDEPNLDPTLKSWLAFADEKVGEVLALAAGPDGAPEAFAASREVRS
FT                   TRPTTAGVRRPEVRERLAALTEADFHRAAYDARVAAQDAVLDLPPLPTTTIGSFPQTAE
FT                   IRRARAAHRRGELTDAQYAEEMRAEIARVVTLQEELGLDVLVHGEPERNDMVQYFAELL
FT                   DGFAVTENGWVQSYGSRCTRPSILWGDVSRPAPMTVEWSAYTASLTSAPVKGMLTGPVT
FT                   ILAWSFVRDDQPLGDTANQVALALRDEIADLQAAGIGIIQVDEPALRELLPLRRADQQA
FT                   YLDWSVRSFRLATSGAVEATQVHTHLCYSEFGEVIEAIDGLDADVTSIEAARSRMEILP
FT                   DIERSGFARGIGPGVYDIHSPRVPSQAEVTELLSAALGSVGARRLWVNPDCGLKTRGYA
FT                   ETVDSLRNIVAATREVRAGLGVPTA"
FT   gene            complement(262544..264427)
FT                   /locus_tag="Bcav_0240"
FT   CDS_pept        complement(262544..264427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0240"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="PFAM: haloacid dehalogenase-like hydrolase; E1-E2
FT                   ATPase; TIGRFAM: heavy metal translocating P-type ATPase;
FT                   heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase;
FT                   ATPase, P-type (transporting), HAD superfamily, subfamily
FT                   IC"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78505"
FT                   /db_xref="GOA:C5BVR5"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVR5"
FT                   /protein_id="ACQ78505.1"
FT                   /translation="MRLLVLAARHYPWVVGTLLVAAAAAVMMATPARELVPWLLGGYAL
FT                   VVAARSAWGMVRDLMAGTLGIDLLAVTAICATVAVGEYWAALVVVLMLTGGEALEDYAA
FT                   HRARRDLTSLLSHAPERGHQIRPDGTTEDVPIADVRPGDRLVVRPHETVPVDATLVSPS
FT                   GTFDESTLTGESLPVDLTVGQEVLSGAVNGSSAVTIAATRSAADSQFQQIVALVAEAAE
FT                   SKSRVVRLADRFAVPFTAVALGIAGTAWWLSGEAVRFAEVLVVATPCPLIIAAPVAFMA
FT                   GMSRAAREGVIVKSSATLEVFHRARTVAFDKTGTLTWGRPDLTDVRPSDAFEADDVLRL
FT                   AASAEQYSAHTLAASVVAGAQRRGLARSPAEHADEVTAGGVRARVDGRDVVVGKRSFVA
FT                   EAVGSDIAATPLTSGELAVYVAADRTYTGALVLRDEVRPNARATIADLRRQGIRHILML
FT                   TGDAEATAQHVAAELAIDDVRAGCLPADKVAAVRAVTPRPVVMVGDGVNDAPVLATADV
FT                   GIAMGARGSTAASESADVVILRDDISRVARALAVGRETVDVALQSIWFGISLSVALMLV
FT                   AAFGVLPAIVGAWLQEAVDVVSILWALRAVGSRGTRGVRTAETPRAEPSRV"
FT   gene            complement(264511..265014)
FT                   /locus_tag="Bcav_0241"
FT   CDS_pept        complement(264511..265014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0241"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78506"
FT                   /db_xref="GOA:C5BVR6"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVR6"
FT                   /protein_id="ACQ78506.1"
FT                   /translation="MTEVSGLPAHVLLVHAVIVLLPLAALCVAVSAVWPAARRRLGIVT
FT                   PLLAIAVAILVPVTANAGEWLLPRVGGAPLAVEHAGFGRTMWWWSTALAVVAIAQYLWS
FT                   RRAARGARGEDAESGGGDGGGPRWVAVVLLVLALAVPAGAVFRTVQTGESGTRAVWEGS
FT                   FSTD"
FT   gene            complement(265011..265550)
FT                   /locus_tag="Bcav_0242"
FT   CDS_pept        complement(265011..265550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0242"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain; TIGRFAM: Tat
FT                   (twin-arginine translocation) pathway signal sequence"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78507"
FT                   /db_xref="GOA:C5BVR7"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVR7"
FT                   /protein_id="ACQ78507.1"
FT                   /translation="MDTARSDLLEHHEELRDTHLCVTRRGVVASGIAAVGAACLAACSG
FT                   GSPGEDPSTSGAEEPTADEPSSEGPTDESSEPGGESPAGAVVAQLDDVPVGGALSVEIA
FT                   GQPALLTQPEEGTVKAFSAICTHQGCTVAPGEGELACPCHGSAFALADGAVLGGPAQEP
FT                   LPEITVTVTDGAVVAS"
FT   gene            complement(265629..266294)
FT                   /locus_tag="Bcav_0243"
FT   CDS_pept        complement(265629..266294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0243"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78508"
FT                   /db_xref="GOA:C5BVR8"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVR8"
FT                   /protein_id="ACQ78508.1"
FT                   /translation="MGTDLVGTVERNNRRTRWLHAGVYVLVLVLLLTGWWLTLGQEGRP
FT                   SVLARLLRLPDAEIHTWAGWAFAAIAAAGVTLGWRAARTLLTDSVRFRRTDLGWFARWP
FT                   KAVLTGRFGRHDGHFDPGQRIANLVMLALLLALIVSGVGLWAVSGGPAFVWFNRVHRWS
FT                   TWVITPVLLGHILIAAGVLPGYRGVWRAMHLGGRLRRRDAARVWPGWLERRDDDRAER"
FT   gene            complement(266284..266769)
FT                   /locus_tag="Bcav_0244"
FT   CDS_pept        complement(266284..266769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0244"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78509"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVR9"
FT                   /protein_id="ACQ78509.1"
FT                   /translation="MRTLSRLPAHRPGLLAAAAAVVVLTLAGCGGDGGDDGAEPAAGGD
FT                   GPTVEIIEPADGDSLSAPFTFVVSSSEELGTTESGNHHVHLYFDGDDSAYEVIESGNGE
FT                   EHEITADSPALEGLEQGEHTMNVSLRNADHSAAGAEDEITVTIETAGGDSGDTGDGY"
FT   gene            266978..267481
FT                   /locus_tag="Bcav_0245"
FT   CDS_pept        266978..267481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0245"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="PFAM: Sigma-70, region 4; Sigma-70 region 2;
FT                   TIGRFAM: RNA polymerase sigma factor, sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78510"
FT                   /db_xref="GOA:C5BVS0"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVS0"
FT                   /protein_id="ACQ78510.1"
FT                   /translation="MDDEALLMRALHDAHAPALRRYVVALGVEGGGVDDVVQETLVRAW
FT                   RKPEVLDETQRSARAWLFTVARHLVIDEHRTARRRHERPAWDPPDVAVDDESDHLLDQW
FT                   LVADALAALTPEHRSVVVRAYYGGWSVAQIASAAGIPAGTVKSRLHYGLRALRLALQEK
FT                   GVTR"
FT   gene            267478..268257
FT                   /locus_tag="Bcav_0246"
FT   CDS_pept        267478..268257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0246"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78511"
FT                   /db_xref="GOA:C5BVS1"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVS1"
FT                   /protein_id="ACQ78511.1"
FT                   /translation="MTPTDQYADWDSAYVLGALAPAERDEYERHLAGCADCRAAVGELA
FT                   GLPGLLGALPADEALALVDPDDAGSEDAARGSDAARPAATTGGAVASPGLGPTVPLGPL
FT                   VERVRRGRRRRRLAAVVGACAGVAAVVALLLAVVVPGLRAPQEVDVTFATTAQAQGAPL
FT                   SASAQLAARDGGTRISSTCSYGSSGYGDVDGGGPARVFGLYVTDADGAVEQVSSWTAAP
FT                   GDTIEATGWTDLPLGAIAELDIREVGAPDALLRAPMP"
FT   gene            complement(268298..268933)
FT                   /locus_tag="Bcav_0247"
FT   CDS_pept        complement(268298..268933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0247"
FT                   /product="protein of unknown function DUF664"
FT                   /note="PFAM: Protein of unknown function (DUF664)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78512"
FT                   /db_xref="InterPro:IPR007061"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVS2"
FT                   /protein_id="ACQ78512.1"
FT                   /translation="MTTTTPTSRTAEDERTLLLTSLAAQRQLLRTATFGLTEDEVRVTP
FT                   SASTLSLGGLVKHVALTEQDWSDRVRDADRVARGLPSRLDQDGDRTEAWAAYARGFRLD
FT                   DDETLAGALAFYADVAAETEATVSAVDLDLIVPVPPDPWFAPGEVWTARRVLVHLLAET
FT                   AQHTGHADIVRESLDGATAYPLRAAAEHWDAGGWVTPWERRRDDAPTG"
FT   gene            complement(268996..269226)
FT                   /locus_tag="Bcav_0248"
FT   CDS_pept        complement(268996..269226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0248"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78513"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVS3"
FT                   /protein_id="ACQ78513.1"
FT                   /translation="MLTRKEAYDLGGTPNVLSTVWIPCREAEVTVGGLRLAGRPDVDED
FT                   APMSSAFIAEAEVWGWTTGERGPGSTSPSSR"
FT   gene            complement(269643..270407)
FT                   /locus_tag="Bcav_0249"
FT   CDS_pept        complement(269643..270407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0249"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: Domain of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78514"
FT                   /db_xref="GOA:C5BVS4"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVS4"
FT                   /protein_id="ACQ78514.1"
FT                   /translation="MLIAALVMLAVLVGASMQRSAGMGFAMVAAPFLVLLVGPLPGVLL
FT                   VNFAGFTTSALILTRVWRDVSWRRIAVLVPSSLLGIVPGAFLAGAVDSSVLEIVVGAMV
FT                   LLGLSLALLFHGGSQVSGATPLVLAGAGGGLGSVTAGVGGPAMSVYAILSRWDQRTFAA
FT                   TCQPFFMATAAGSALVKLGTGTAVLPSFPAGVWIGIGACLLLGLLVGEWLAKVLAQSTA
FT                   RRLMLTLAYVGSITTVVHGILALTGVISPLPA"
FT   gene            complement(270506..274558)
FT                   /locus_tag="Bcav_0250"
FT   CDS_pept        complement(270506..274558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0250"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78515"
FT                   /db_xref="InterPro:IPR019993"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038720"
FT                   /db_xref="InterPro:IPR041679"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVS5"
FT                   /protein_id="ACQ78515.1"
FT                   /translation="MFLLDDRFIYSPTDIARAECPYAALCVADEKLGLAEPLVVEDAML
FT                   ERAARLGDAHEARVLAAYRARFGSFDPAQRRGVAEIGDDVERSGAEFRASLPRAREETL
FT                   AAIAGGADVVFQATFFDGRFYGRADFLLKTQDDSREATYAVVDTKLTEKVRTHALLQMA
FT                   AYADQLLAEGVQVEPTMSLHHGSGERTQHDLADVLEVYRHERRLLEALLDAHHARGVPA
FT                   SWLEWRGDVDPPELAALGLDALSRRACGRCDYCAREVERHRDTRLISGIRAAQRARLQE
FT                   VGIFTLDELAGSSGPVLGTSDAVLARLRRQAAMQVGQLERMADAEAAGLLVVDGARVEA
FT                   PDGAQAPERALFLPLVRAEVVDAAALRALPEPDAGDIYFDFEGDPMWTTSGAMEGGLEY
FT                   LFGLIEEPVTGGHPAHALDRAPEGSGERYVAFWAHDRAEEKQALVDFLAYVAQRRAQHP
FT                   GMHVYHYANYEKTALRRLAERHLVGADEVEELITSGVLVDLYPIVKNSAVVSQGSYSIK
FT                   KLEPLYMGAELRDSGGVTSGGDSVIQYASATLLRADGDEPGFAEIMESIADYNRYDCVS
FT                   TRRLTLWLRERAAEHGVLLGAGMPDVAMLAEQVAQVAAEQGAADSDSSGTDVVPDAAGQ
FT                   APGADRAAPTTAPPAPTPGAAGPPAPPAGPGGVEPTPAAPEPGTAEPDPERILTDRLLA
FT                   AAGPDRDARSADAQAYALLAAALDYHRREELPFWIEHYGRLADPIEWWSDAREVMVADA
FT                   VEVVTDWTPRASGKGSERVLKMIGLLGSGSSVDAGAEVFLVYAPPLPAGMVAPDGCVRA
FT                   TTYARVVERGISDDGAADVLVVTEGAGRGAGETPAVPMAVAPGAPPPARGIKAAITRLA
FT                   ENVVETLPAAPEQPWPPSADDAAPRPVPDPPRLPAQPGLDVLARREPRLVGTTSLPVVA
FT                   DEDYVTAITAATAALDRSALAVQGPPGTGKTYVGARVVGRLVRELGWRVGVVAQSHAVV
FT                   EHFLDEVVAAGLEPWRVGKAPQRPRDASGGDDASPARSSWTELARGGYADFLRDGIEGG
FT                   CVIGGTAWDFTNRSRVEAEGLDLLVVDEAGQFSLANTVATSTAARRLLLLGDPQQLAQV
FT                   SQGDHAEPIDSSSLAWISGGAEALPPTHGYFIERTWRLHPALCERVSALSYAGALLPQA
FT                   EVTARRHLDGLPPGVHLRTLRHRGNATSSQEEADEVVAQVRSLLGRTWTDPQFFPASRA
FT                   LSQADVLVVAAYNAQVALVRTTLDAVGLVDVRVGTVDKFQGQEAAVVLVTLAASSSREI
FT                   PRGVGFLLNRNRLNVAISRGQWAAVVIRSAGLTDAIPSNARALADLGAFLDLCARSLEL
FT                   EEAGAPA"
FT   gene            complement(274620..275483)
FT                   /locus_tag="Bcav_0251"
FT   CDS_pept        complement(274620..275483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0251"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78516"
FT                   /db_xref="GOA:C5BVS6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVS6"
FT                   /protein_id="ACQ78516.1"
FT                   /translation="MTEPATHTLDVPGAVLTYDVREPATSSGAPPLFALGSPMAAGDFA
FT                   TLANLLDDRVVITYDPRGMERSTRTEGGPVTPETHADDYHRVVEAVGLGQVDVFASSGG
FT                   ALNALAWVAAHPGDLRTLVAHEPPLTSLLEDSETVARVQADIVETYERDGYGPAMAKFI
FT                   QLVSYTGPLPDDYLDQSAPDPAMFGLPTEDDGSRDDLLMANMRTLPEFVPEADALRESG
FT                   VRIVPATGSEGEGTVARRGGEALAALLGLRAAQFPGGHGGFVVNAWSPDNDPTPFAARL
FT                   REVLAG"
FT   gene            275711..276250
FT                   /locus_tag="Bcav_0252"
FT   CDS_pept        275711..276250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0252"
FT                   /product="putative phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78517"
FT                   /db_xref="GOA:C5BVS7"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVS7"
FT                   /protein_id="ACQ78517.1"
FT                   /translation="MISLPEPPPVVVVTGAMAAGKSTVAQGLAERLPRAAHVRGDVFRR
FT                   FVVSGRAEPEPPLSDEATAQLHLRHDLAARVADTYAEAGFVAVVQDILLGDDLARFLER
FT                   LTTRPRYAVVLVPSPEALTERDVARDKTGYGGWDPTDFAELARATPLGLQVDTTGWSVE
FT                   RTVEHVLGHLADAEVT"
FT   gene            276269..277504
FT                   /locus_tag="Bcav_0253"
FT   CDS_pept        276269..277504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0253"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: Amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78518"
FT                   /db_xref="GOA:C5BVS8"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVS8"
FT                   /protein_id="ACQ78518.1"
FT                   /translation="MNLRRTLTTTDAVVVGLAAMIGAGVFVVFAPAAEAAGDALLLALA
FT                   AAAVVAYANATSSARLAARYPEAGGTYVYGRERLGPFWGYVAGWSFVVGKTASCAAMAV
FT                   TVGLYVWPGQEYLVAVAAVVALTALNFAGVQRSARVTRAAVAVVVAVLLAVVAVSLLNP
FT                   AGAVPVSDDGATGPLGVLQAAGLLFFAFAGYARIATLGEEVRDPSRAIPRAIAVALLVA
FT                   LGLYALVAVALLRVLGSGGLARATAPLVEAVQVAGAGGLAPVVRVAAALAALGALLALI
FT                   LGVSRTTLAMARDRHLPAPLAVVHPSGVPRHAELAVGGVVAVVAALMDVRAAIGFSSFG
FT                   VLVYYAIANASAWTLRRAEGGPPRVVSAVGLGGCLVLAFTLPTTAVLAGVGVLALGVLA
FT                   YVLGARRRRAAA"
FT   gene            277683..278765
FT                   /locus_tag="Bcav_0254"
FT   CDS_pept        277683..278765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0254"
FT                   /product="protein of unknown function DUF125 transmembrane"
FT                   /note="PFAM: Integral membrane protein DUF125"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78519"
FT                   /db_xref="GOA:C5BVS9"
FT                   /db_xref="InterPro:IPR008217"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR039376"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVS9"
FT                   /protein_id="ACQ78519.1"
FT                   /translation="MSTPVARHPDARDLRRWRRYLAEEQAEAAVYRDLAAKRDGEEREI
FT                   LLALADAEKRHERHWRELLGDDVGKPVRGTARTRALGWLARRFGSVFVLALAQRAEARA
FT                   VYAQERDATPQMIADERIHEEVVRSLAARGRAKLSGTFRAAVFGANDGLVSNLALVLGI
FT                   GATGVDPTVVLFTGVAGLLAGALSMGAGEFVSVSSQRELLEASTPDPLARQAIPHLDLG
FT                   ANELALVYRARGESADDAAAHAERTIREYRPGERSDSHRRGRDFAEIGSPWGAAFSSFC
FT                   FFASGALIPVLPYAFGMSGVAAVAVAAGMVGVALLATGASVGILSGASPLRRAVRQLAI
FT                   GFGAAAATYLLGLLFGTTLG"
FT   gene            complement(278877..279641)
FT                   /locus_tag="Bcav_0255"
FT   CDS_pept        complement(278877..279641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0255"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78520"
FT                   /db_xref="GOA:C5BVT0"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVT0"
FT                   /protein_id="ACQ78520.1"
FT                   /translation="MKARRLGAAVAVELRKAAASRVPLATAALVTLGTAALVTSLSLAA
FT                   DAGNQQVLAQLGDLAGAHGWARTTGVAAQIVSAGGALALGIVLSWLVGREFADRTVGAL
FT                   FALPVPRASTALAKLVVHAAFTVGLAVATPAALAVVGLAIGDGVPDAGAWQDLGRLAAL
FT                   ILLTGAVVVPAGWVATLGRGLLSGVAATIGIVVVAQVAVVAGTGAWFPFAAPALWAMGM
FT                   TTAVAPLGVTLAVAAVFAALTMRSWRRLQLDR"
FT   gene            complement(279638..280357)
FT                   /locus_tag="Bcav_0256"
FT   CDS_pept        complement(279638..280357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0256"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78521"
FT                   /db_xref="GOA:C5BVT1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVT1"
FT                   /protein_id="ACQ78521.1"
FT                   /translation="MADLPLQVRDLVRTFPGGAGLHGIDLDVAPGSVHALVGLNGAGKT
FT                   TLMKAVLGMLRPTSGTVRVFGADAAAARWDAVGHVVAGAATYAELTLRSNLLAAARWHG
FT                   LAGARAGDAVDRLLDELDLARYARVRTSRLSDGNRQRLALAGALVHDPALVVLDEPTNT
FT                   LDPSGVVLLRETLLRRVAVGAAVLVSSHHLDEVARIADRITVINRGRVVGALDPRGLDI
FT                   EREFFAIVHDDDQRASR"
FT   gene            complement(280350..280901)
FT                   /locus_tag="Bcav_0257"
FT   CDS_pept        complement(280350..280901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0257"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: Bacterial regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78522"
FT                   /db_xref="GOA:C5BVT2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041347"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVT2"
FT                   /protein_id="ACQ78522.1"
FT                   /translation="MTRRLRTREALQRSALDLFERQGYDATSVAQIAVDAGVTPMTFFR
FT                   HFAAKENVLLDDPYDPAIADAVAAEPLSLPPLVRAVRGLRRAWAHVPEPEDEHTRRRVR
FT                   IVAATPSLRGAVSRNNAETERVIADGLLAGGAEPLAAQVAAAAVIAALTAALYAWASAD
FT                   GRSLADAVTIALDTLEHADG"
FT   gene            281006..281890
FT                   /locus_tag="Bcav_0258"
FT   CDS_pept        281006..281890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0258"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78523"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVT3"
FT                   /protein_id="ACQ78523.1"
FT                   /translation="MRPPRTRGRSAAVLLAALAVVGLPACSLLAPEEPVGPVTVCSTDP
FT                   APTAGEPGDAEILLRAGFLVPGGPPRYVVYTDGSVFLVGAPELDGDAAGDAGGAHAVVA
FT                   PVPAMAPVPQTDVSETAYAGALPECALDQLVEQGDDLAGMVERLGGDLGQPMITDSGSP
FT                   WLEYRSSDGEVIVASAYALGHDDLDGVNREQRRARELMTALGDLVQVNATALEPTTVVR
FT                   LEVHSFTSGSAPEIDWPIDTPLDEIIGESGCGAVSGQEAADLIEAESTGHTFTANGGYL
FT                   SLNVLAPGEPACS"
FT   gene            281887..282786
FT                   /locus_tag="Bcav_0259"
FT   CDS_pept        281887..282786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0259"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78524"
FT                   /db_xref="GOA:C5BVT4"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVT4"
FT                   /protein_id="ACQ78524.1"
FT                   /translation="MTRRPAARAARIGAAMTTAALAVVGLPACSLIAPGDPIGPVTVCG
FT                   TEPAPGAGDPGDAEILLRAGFLIPGGPPRYVVYTDGAVFLVGLPEADADAAAVDAPDGA
FT                   VAAAAPALAVAPVPQSDLDEGAYAGALPRCALDQLEEYGDELAGLVERLGGELGAPTIT
FT                   DQGTSELEYRPPDGEPVVASAYALGEEHGTEGVDREQRRARELMVALAEVVHVNATALG
FT                   AVRVDHVEVHAYADDADQVDWPLETPLAEIVEIGDCGELTGADAAALVEAEGADHDFTP
FT                   NGGYVSINVLAPGESACT"
FT   gene            complement(282826..283437)
FT                   /locus_tag="Bcav_0260"
FT   CDS_pept        complement(282826..283437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0260"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78525"
FT                   /db_xref="GOA:C5BVT5"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVT5"
FT                   /protein_id="ACQ78525.1"
FT                   /translation="MTEARTRPNVLVTVLRAVVVALVLSAEIYLIVLIGEAFNPANHFS
FT                   YFTVLSNVLGAVVLGIGIFRPVPDVVRGAAATYLVVTFVVYGLLLRGVDVQTPSYANWV
FT                   LHFVVPILVTLEWLLAPPARRLAVRDVAWWLVFPAVYLVYTLIRGPIVGWYPYPFLDPR
FT                   EQGYAAVAGWCVAVAVAIVAIGALVAWVGNVRGARGRVRA"
FT   gene            283585..284901
FT                   /locus_tag="Bcav_0261"
FT   CDS_pept        283585..284901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0261"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: Major Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78526"
FT                   /db_xref="GOA:C5BVT6"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVT6"
FT                   /protein_id="ACQ78526.1"
FT                   /translation="MPRLLADTTPLRVSPAYRRLWWGLGISNIGWQLTVVAVGLQVYDL
FT                   TASTFAVGLLGICALVPLVLLGLYGGALVDAFDRRKVALASAIALWFVTAVLAAQAWLD
FT                   VGSVPLLYAIVAVQSAGYAINNPARTAIIPRLVGRELLPAANALQGLSGSLALTLGPLL
FT                   GAFLVATWGYAEAYTLDLALFTGALYALWRLPDLPPIETADDDGDESAARSAVRRRVGF
FT                   GSVLEGLRYLGTRPNVRMTFVLDLAAMVLAMPRVLFPAVGVLIIGGGAGTTGTLTAAIA
FT                   VGAVLASLFSGGLGRVRWQGRAIVVAIACFAVSVAGFGVVLVLAGAREPDTVVVPALVA
FT                   AFVLLALAGASDAVSAVFRQTVLQAATPDHMRGRLQGVFIVVVAGGPRLGDLVLGAEAT
FT                   WLGEGWAAVVGGLSCLVVVALLVAANRRFLSYDARDPQP"
FT   gene            284952..285317
FT                   /locus_tag="Bcav_0262"
FT   CDS_pept        284952..285317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0262"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78527"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVT7"
FT                   /protein_id="ACQ78527.1"
FT                   /translation="MDILSFDQLASRPGGTPTFIGADHGATVSFFVERAGPGEGPPKHR
FT                   HPYDETFVVIEGTLEFTVEGVTKGVGPGEIVVAPARAWHSFTNRTDAPALSVNIHAADR
FT                   METEWWSDRAEGTDAAR"
FT   gene            285420..285620
FT                   /locus_tag="Bcav_0263"
FT   CDS_pept        285420..285620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0263"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78528"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVT8"
FT                   /protein_id="ACQ78528.1"
FT                   /translation="MTTTRPDDVPESDYAEELAARQPGVDDPEVTASGEEPGEEWDADP
FT                   VDVVEQKAEVDLGDDAPEEPA"
FT   gene            complement(285653..286597)
FT                   /locus_tag="Bcav_0264"
FT   CDS_pept        complement(285653..286597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0264"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD dependent epimerase/dehydratase family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78529"
FT                   /db_xref="GOA:C5BVT9"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVT9"
FT                   /protein_id="ACQ78529.1"
FT                   /translation="MRVFVAGATGALGSNLVPLLVAAGHEVVGTSRSAAGLPALSAAGA
FT                   TGVIMDGLDADSVLRAVTDTQPDVIVHQLTALATMSGNPKYFDRDFAVTNRLRTEGTGN
FT                   LLAAARAAGVTRFLAQGYIGWPNERSGGWVKTEDDPLTVDPGREARQSLQALRYLERAV
FT                   TEAPGIDGLVLRYGSFYGPGQAASRTGTMGEMIRRRRFPLVGGGTGVWSFIHIADAAAA
FT                   TAAAVERGAPGVYNIVDDEPARVSQWLPYLAEQLGAKPPMRLPAWLARPMMGELGVAMM
FT                   TSVRGSSNAKATRELGWTPRYATWREGFRTGIG"
FT   gene            286679..287602
FT                   /locus_tag="Bcav_0265"
FT   CDS_pept        286679..287602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0265"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="PFAM: Sigma-70 region 2; Sigma-70, region 4;
FT                   TIGRFAM: RNA polymerase sigma-70 factor, TIGR02957 family;
FT                   RNA polymerase sigma factor, sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78530"
FT                   /db_xref="GOA:C5BVU0"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014303"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVU0"
FT                   /protein_id="ACQ78530.1"
FT                   /translation="MRDVSDLAELHDDLRPLMFSIAYRMLGSVAEAEDVVQEAFLRMHR
FT                   GAPDGLDVDNPEAYATTVTTRLAIDTLRSARVRRERYVGPWLPEPLLPSEDADPAHRIE
FT                   LDETVSTAFLVLLEALTPVERAVFVLREVLGYDYADVAAIVEKNESNCRQILVRARKRI
FT                   DAGRPRFDADREHRDRLAAQFIAAVTDGDLAGLERLLAADVVFVGDGGGRAPAIQRPLI
FT                   GMAGVVRFLGGMIRQGERFGAVIEAGEANGQLAMVVRTAQGDLLSVMTIDVADGQVVAL
FT                   RNQLNPDKLQHVGQVGDMFAFLRGEA"
FT   gene            complement(287618..289957)
FT                   /locus_tag="Bcav_0266"
FT   CDS_pept        complement(287618..289957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0266"
FT                   /product="MMPL domain protein"
FT                   /note="PFAM: MMPL family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78531"
FT                   /db_xref="GOA:C5BVU1"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVU1"
FT                   /protein_id="ACQ78531.1"
FT                   /translation="MSTLLYRLGKLAFRARGRVLLVWLVILGAVGVAIALNPPQTSTEF
FT                   RLDGTPSQEVLDQLTEEMPDASGSQASIVFVAPDGTRVDDPEAAAAIADAVAQINSSDI
FT                   VAPPAQQEAPADPSQMTPEQLEQAQAAAEAMTPVGDLQLLPLMLDETTAVPGVIISEDG
FT                   SVAMLSVQLTEQAMDLPEGATDGIVEAAESAEDAGLTVLPSSSLTTTFEVPIGTNEIFG
FT                   LLIAAVVLIITLGSLVVAGLPLVTALVGVGVGVGTAYALSSVIDMMSMTPILALMIGLA
FT                   VGIDYALFIVNRQRRLILDQGLSAHEAAGRALGTAGSAVFFAGLTVIVALTGLSVVGIS
FT                   FLTTMALIAAATVLVAVLVALTLLPAILGFVGERVVSAKQREKAVGHRHAERTTFATRW
FT                   ASGIARHKVLVTIGTVVALGAIAVPFGSMNLNLPTAATANFDTVERQSYDAITEGFGEG
FT                   FNSPLLVVASSENGEPIDVATIGTLKEDLFALDDVSAVMPTGLSEDGATATLTVVPESG
FT                   PNDAATRDLVEAIRALDATDGVELGVTGEAAINIDISQVLSDALVPYLVVIVVLSLLIL
FT                   LLVFRSVFVPVTATLGFVLSIGATLGATTAVFQWGWARELFGFDTPGPLLSFLPIIVTG
FT                   ILYGLAMDYQMFLVSSMRESHVHGHPGVKGVVHGYAMASRVVVAAAIIMISVFAGFIFS
FT                   HDAMIKQIGFALAIGILFDAFVVRMMLIPAVMSIAGEKAWWLPRWLGRILPNLDVEGDR
FT                   LVRSLEAADRGRHAAAGDDERELAKV"
FT   gene            complement(289977..290732)
FT                   /locus_tag="Bcav_0267"
FT   CDS_pept        complement(289977..290732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0267"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: Bacterial regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78532"
FT                   /db_xref="GOA:C5BVU2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVU2"
FT                   /protein_id="ACQ78532.1"
FT                   /translation="MTTTAGPETGSAPTGLRERRREETRAAFAHAAFELASERGLDGFT
FT                   IDELAEATGLARRTFFNHFTSKEEAVAHVVVLKVREVLAVIADSHEEHGEPEEHEGDDV
FT                   DDDAHVAALTCRLRTRYAGDLAATLGAVDEVTRSLLAPDVLTTLRAFAQLAERHPQLVP
FT                   HLFTVENDARTQAAELLRTPEHGGLTDLQAHLVPGAVISTIAPVVGGELLLVELDGDAP
FT                   GAITTDELVGQLITFLTRGIAAEHPAQPV"
FT   gene            complement(290836..291774)
FT                   /locus_tag="Bcav_0268"
FT   CDS_pept        complement(290836..291774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0268"
FT                   /product="GCN5-related protein N-acetyltransferase"
FT                   /note="PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78533"
FT                   /db_xref="GOA:C5BVU3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVU3"
FT                   /protein_id="ACQ78533.1"
FT                   /translation="MTNVVVDRLDEPLAAGLAAVHARDAVVDGIDPRSVAEQVPTADDL
FT                   QRTARDAEEFRLATGDGGEPVGWGARTSWVEDDGTRVVLLTGHVAAGYRGRGVGARLLR
FT                   DLEASARDARPGPTPRRTSVLGANASSHQDDRRALLESAGFAVATSMAEMRLDSGDAPP
FT                   PRAAPADVAVRDAVPGDAAALHTIARRAWAGREFFAMPPLASYADWLGRADLTLFRVAE
FT                   ADGVPIGYVAAEPRGGGVTELDDVAVDPAFQRRGIASALCRDVAGRAVARGARELRLVT
FT                   EADDPAGARSLYAGLGFDVVREHLRYRKPLA"
FT   gene            291912..292355
FT                   /locus_tag="Bcav_0269"
FT   CDS_pept        291912..292355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0269"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78534"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVU4"
FT                   /protein_id="ACQ78534.1"
FT                   /translation="MADVPPADGVDLIAVREALEASWSSRTSYGGVWDERNPALGQCYP
FT                   TARVVQHFFPSAEIVKGVVWTGVSHEVHFWNELRVGGGSVAVDLTWQQFPPGSVVVARQ
FT                   VLDRHALGDGATTLARCDSLLAGVRAHLGGTGGAPDAPRPDGR"
FT   gene            complement(292366..293466)
FT                   /locus_tag="Bcav_0270"
FT   CDS_pept        complement(292366..293466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0270"
FT                   /product="glutamate--cysteine ligase GCS2"
FT                   /note="PFAM: Glutamate-cysteine ligase family 2(GCS2);
FT                   TIGRFAM: uncharacterized enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78535"
FT                   /db_xref="GOA:C5BVU5"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011793"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/TrEMBL:C5BVU5"
FT                   /protein_id="ACQ78535.1"
FT                   /translation="MRTVGVEEEYILAGPDGRPVARAAAVLTNDAVATFAHPEAAPGDL
FT                   DEEFFQQQIEIGTPICSTLAEVSDALRACRARADAAAAHVRAGIVALGTSPFESETRTT
FT                   RGERYEQIAELLEQPARESPMSGCHVHVGIADDDEGVAVIDRIQRWLPVLLAMSANSPF
FT                   WNGEDTGYSSYRSQVWYRWPSAGPVAPFGSAAAYHEAVAALLRTGAILDPGMVYFDARL
FT                   SHRYPTVEVRVADVCLDVNDAVLLAVLVRALVETTAREARDGVPAPAGRAELLRLAAWR
FT                   AARTGLTERIVSPVSGTPEPAHDVVQELFAYLGRALADSGDLATATTLWHRLRERGTGS
FT                   EQQRRWYAESGDFGDVVARARERTMA"
FT   gene            complement(293548..294123)
FT                   /locus_tag="Bcav_0271"
FT   CDS_pept        complement(293548..294123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0271"
FT                   /product="bifunctional deaminase-reductase domain protein"
FT                   /note="PFAM: RibD C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78536"
FT                   /db_xref="GOA:C5BW78"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:C5BW78"
FT                   /protein_id="ACQ78536.1"
FT                   /translation="MRRLTYYIALSIDGYIAGPNDEVEFYPQSEEYSTWMAAEFPDAIP
FT                   THVRAHLGMPDTPNRHFDTIVMGRRTYTPALDAGVTSPYAHLRQYVVSTTQEQVDPDVT
FT                   IVRTDPIALVRELKAEDSQLDIYLAGGGTLAGALLSEIDRLIVKLYPVVAGAGKQAFGG
FT                   SAFAPTAFDLTDVTTFDGGNAVLTYDRA"
FT   gene            complement(294279..295817)
FT                   /locus_tag="Bcav_0272"
FT   CDS_pept        complement(294279..295817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0272"
FT                   /product="DNA ligase I, ATP-dependent Dnl1"
FT                   /EC_number="6.5.1.1"
FT                   /note="PFAM: ATP dependent DNA ligase C terminal region;
FT                   DNA ligase N terminus; ATP dependent DNA ligase domain;
FT                   TIGRFAM: DNA ligase I, ATP-dependent (dnl1)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78537"
FT                   /db_xref="GOA:C5BW79"
FT                   /db_xref="InterPro:IPR000977"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016059"
FT                   /db_xref="InterPro:IPR022865"
FT                   /db_xref="InterPro:IPR036599"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BW79"
FT                   /protein_id="ACQ78537.1"
FT                   /translation="MLLAEVAATSDAVAATRSRLAKRAAIADLLRRAPADDVEIVVAYV
FT                   AGELRQRRTGLGWRSLRDLPGPAEDPSLEVADVDATFAAMADLAGPGSATARAAAAAEL
FT                   FAAATEREQALLRGLVSGELRQGALDALVLDAVADAAGVPAPEVRRAAMFAGATGPVAR
FT                   AALAAAGPAEAVAALSGFMLTVGRAVRPMLAQSAPDVAAAFAKLPGGDVAVSVDVKLDG
FT                   IRIQVHKAGDEVRVFTRSLDDITGRVPEIVEAVRALPAGALVLDGEALAVDAGGRPRPF
FT                   QETASRSATRDADVAAAMTLTPFFFDCLHADGRDLVDAPLRERLEVLDAVAGPHVVTRL
FT                   TTSDPAAAEEFFAAAVRDGQEGVVVKATDTPYEAGRRGAGWIKVKPRHTLDLVVLAVEW
FT                   GSGRRRGWLSNIHLGARDPAGGFVMLGKTFKGMTDEMLAWQTERFLELETSRDEWAVHL
FT                   RPEQVVEIAFDGLQRSTRYPGGLALRFARVLRYRDDKTAAEADTIDTVRTLAGL"
FT   gene            295867..296181
FT                   /locus_tag="Bcav_0273"
FT   CDS_pept        295867..296181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0273"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78538"
FT                   /db_xref="UniProtKB/TrEMBL:C5BW80"
FT                   /protein_id="ACQ78538.1"
FT                   /translation="MTLGTESAVVPAAPEAVLATIRSVLEAKRYRVTDAPPGGRITFVT
FT                   RKTMLNWELDGIAQVAPVQGGTQVSVTLQSRSDRPQALMDGSKNAKAAKKLVKEIVEAG
FT                   "
FT   gene            complement(296329..297681)
FT                   /locus_tag="Bcav_0274"
FT   CDS_pept        complement(296329..297681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0274"
FT                   /product="uracil-xanthine permease"
FT                   /note="PFAM: Permease family; TIGRFAM: uracil-xanthine
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78539"
FT                   /db_xref="GOA:C5BW81"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR029935"
FT                   /db_xref="UniProtKB/TrEMBL:C5BW81"
FT                   /protein_id="ACQ78539.1"
FT                   /translation="MALMTWRRHGDGRTIAPGAVVAPDERLSWPRTIGIGMQHVVAMFG
FT                   ATFLVPLLTGLPPATTLFFSAIGTALFLLITRGRLPSYLGSSFAFIAPIGAAAGTYGMS
FT                   SALGGVVVTGALLAVVGLVVHVAGARWIDVVMPPVVTGTIVALIGFNLAPAAWGTCQQS
FT                   VVDGEIVESCTSGFRAAPVTATITLLAIVLVTVLFRGILGRLSILVGVVIGYVVATIRG
FT                   EVDFTAVSEAAWIGLPQFTTPTFTPAVLGLFVPVVLVLVAENVGHVKSVSAMTGTNLDG
FT                   VTGRALMADGLSTVLAGSGGGSGTTTYAENIGVMAATRVYSTAAYWVAAATALLLSLSP
FT                   KFGALIATIPAGVLGGAATVLYGMIGVLGARIWVQNKVNFADPVNLTTAAIALIIGIAN
FT                   FTWTAGDLRFEGIALGTAAAIGIYHLMRAIARWRGTSVAEPASPASVPAAD"
FT   gene            298427..299377
FT                   /locus_tag="Bcav_0275"
FT   CDS_pept        298427..299377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0275"
FT                   /product="Inosine/uridine-preferring nucleoside hydrolase"
FT                   /note="PFAM: Inosine-uridine preferring nucleoside
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78540"
FT                   /db_xref="GOA:C5BW82"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:C5BW82"
FT                   /protein_id="ACQ78540.1"
FT                   /translation="MRVILDTDMGMGAPGSEIDDGFALALLLADDTFDVELVTSVNGNI
FT                   DVESGTYLSIELLQRLGRPEIPVVRGAAAPLVEPEKVRAAPDSVREAFGHHVPAPGYAA
FT                   AEIARRVVESPGEITIVAIGPLTNVAAAIALDERVAGAVKEIVVMGGVFLGHTNARRMP
FT                   GEFNWWVDAHAARAVMRSGAPTRLVGLDVTTKVRLTREHAATMAASGRPFGQFAGDCTI
FT                   AWLDRLGREHPGEEDAGGSCAMHDPLAVAAISRPELLTWAPAHVDVVSNDEVGRGIAVA
FT                   DLLTGHDAPPANTTIATAVDADAFMAYFLDRITAY"
FT   gene            299449..300768
FT                   /locus_tag="Bcav_0276"
FT   CDS_pept        299449..300768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0276"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: Bacterial extracellular solute-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78541"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C5BW83"
FT                   /protein_id="ACQ78541.1"
FT                   /translation="MRRTTPAVGALAAAVMLVTAACSSGGSSGGDGGDDAAWALPDEDP
FT                   TATVQVLGHQDAADLQPVFDAFSEAHPSITVEYEAVPFDQLNSVLDARIANKDGNPDVY
FT                   WADQPRIPALSARGYAEDITEQFAPDAEAWDPAPLESSSFDGHQWAVPIANSTQLLYYN
FT                   KDLLDAAGAEYPSAAVEDRMTWEEITERAGAAVDAGAQNGLLFGQVNRYYQLQPLPMSL
FT                   GGSAGGTGEGNLTPDVTSDAWVEAMTWYGSLFADGLSPQGVAPEQSDAEFLTGNTAYMV
FT                   QGPWLLPQLTEADFEWGVAAHPYFEGGDAVTPTGSWSLAMSPFSDDKEAAAVFMRWMSV
FT                   EEGGGYAAYYASPELPANVEGKTQYFEREVFASPSGQDAVSIIDAETSTTAVPRLQTVG
FT                   YVEFEEILGRAFSDVANGADPAGALASASSELETAWAQYR"
FT   gene            300776..301744
FT                   /locus_tag="Bcav_0277"
FT   CDS_pept        300776..301744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0277"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78542"
FT                   /db_xref="GOA:C5BW84"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5BW84"
FT                   /protein_id="ACQ78542.1"
FT                   /translation="MTVQSSPRAAATSSRGAGAAPPARAYRNRRRTKELTWAAVFLAPA
FT                   LLAIATLRIAPSVEAIVSSLYSGFPGGVLEPVFSGLANYSDLFANDAFRATVVRTIVFN
FT                   LIINPLQIAIALLIAVLMTRRIATPGLWRTLIFIPAVVPMVGSSIVWGIALRPEGPVNA
FT                   IISALGGNPQPFLTSPDQALASIMLIISWIGIGYWMLFLISGLQTIPEEYYEAAKLDRA
FT                   GPIRTFFQITIPLLKRPLLFVLVADTVANFVLFVPIQMLTNGGPQNSTTMQMFNAYRTT
FT                   YTYGSKNLGAAEVVILTLIMLVFVAAQFRLLREDRAPRRRR"
FT   gene            301741..302619
FT                   /locus_tag="Bcav_0278"
FT   CDS_pept        301741..302619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0278"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78543"
FT                   /db_xref="GOA:C5BW85"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5BW85"
FT                   /protein_id="ACQ78543.1"
FT                   /translation="MTAVTTQPRAARPTRRGRSERRSISLTVIAVAVAALFILPALWLL
FT                   VGSVRPSQEIFSSLSPLSWRILVPSSVSLDNYVSLFTGPFGRALAVSFIVCFLTVAIGL
FT                   VVCALAAYALAVLNFPGRGAVFAFVVISFMVPFEAIAIPLSQLFTSWGLTNTIMGLVLP
FT                   GIGNGLAIFNLRQYFLAVPTSYREAATIDGASEPRVLWSVYAPLGGSALVNSALLIFLG
FT                   QWSAYLWPLLVVSESRLQVAPVALSRTFGEHTFDYGQNFAGAVVLSLVPALMMFILQRS
FT                   FGGLSLATGEK"
FT   gene            302616..303578
FT                   /locus_tag="Bcav_0279"
FT   CDS_pept        302616..303578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0279"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: pfkB family carbohydrate kinase; TIGRFAM:
FT                   ribokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78544"
FT                   /db_xref="GOA:C5BW86"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C5BW86"
FT                   /protein_id="ACQ78544.1"
FT                   /translation="MSAQNDESQGAGSASAPITVVGSANQDYLLRVEASPSPGETVLAH
FT                   GMRKNPGGKGANQAVAAARLGGDVRFVGCVGDDDDGALLLRELRAEGVGTSDVEIITRE
FT                   HTGLAIVAVDTTGENSIVVVPGANFALTESRVTRVVRRDAAGGVVVLQAEVQPRIIAGA
FT                   VAAADDAGARVVLNLAPFVALAADVVAACDPLVVNESEASAMTGLPVSTLDDAHAAAGE
FT                   LLGRARSVVITLGARGAVWADGDGTGHVPAPALDRVVDTTGAGDAFVGALAVRLSEGAA
FT                   LEDAVELGVRAGTYSVAREGAQSSYAMAADLRHAEARTA"
FT   gene            303685..304725
FT                   /locus_tag="Bcav_0280"
FT   CDS_pept        303685..304725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0280"
FT                   /product="transcriptional regulator, LacI family"
FT                   /EC_number="5.1.1.1"
FT                   /note="PFAM: Periplasmic binding proteins and sugar binding
FT                   domain of the LacI family; Bacterial regulatory proteins,
FT                   lacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78545"
FT                   /db_xref="GOA:C5BW87"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C5BW87"
FT                   /protein_id="ACQ78545.1"
FT                   /translation="MAVTRADVAAMAGVSPALVSYVINGGPRPVSDQARRRVEAAIEAL
FT                   GYRPNAIASALRGGMTRSIGLLTPSPVNPFFAEMAEALVLELFQRGNTLSIGITDDDPA
FT                   RETLYLRSFLDRRVDGLIVTSSRAMTSLQRLHADPVPAVVIDRVDDLGVAGGPSSVHVD
FT                   NLHAATYAVEHLQAHGHRVIGCIAGPWPVALSAERIAGWRAQQERIGADASDALVEHAE
FT                   FSESGGREAALALLGPEARRRSARASGPTALFVASDVQAFGAIVACAELGLRVPDDVAI
FT                   VSLDGTATARFSRPPLTSVRQPVVDMVRAAVGHLLDHIADPELAPAHTVLRGNLVVGRS
FT                   CGCGER"
FT   gene            304722..305207
FT                   /locus_tag="Bcav_0281"
FT   CDS_pept        304722..305207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0281"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78546"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C5BW88"
FT                   /protein_id="ACQ78546.1"
FT                   /translation="MTTYLLGPTSAATIVSRSATALEAEVRYAPRSRPPPVHLFPTQSG
FT                   HVEVLEGELSARLGRTTRTYRAGESFDVPAGTRHTMWNASPEPTRTTWRTAPPGRSAEW
FT                   LASLDAAVRAGGGVAAVALVTREFRDVLRLAGVPGVVLPLLAVVGRLRARFGVDRGR"
FT   gene            complement(305214..305915)
FT                   /locus_tag="Bcav_0282"
FT   CDS_pept        complement(305214..305915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0282"
FT                   /product="protein of unknown function DUF899 thioredoxin
FT                   family protein"
FT                   /note="PFAM: Bacterial protein of unknown function
FT                   (DUF899)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78547"
FT                   /db_xref="InterPro:IPR010296"
FT                   /db_xref="UniProtKB/TrEMBL:C5BW89"
FT                   /protein_id="ACQ78547.1"
FT                   /translation="MTSTAAPRTDLPAVVEPDDWRAALDDLRVREKAATRELDAIAAQR
FT                   RRLPMVRLPEYTLVGANGPVRLADVFEGRSQLITYHHMWNPGAEWQCGGCTGLTSQYTR
FT                   LDFLDDYDARFVIVTQGAIDEALAYREKVGNRMEWYSTADSPFGADVDAPPGGGFAVNV
FT                   FLRDGDDVYRTWHTNGRGTEQLSHTFPLIDLLPWGRQEEWQDSPEGWPQRAAYDGWLDS
FT                   PDIARLYGPKG"
FT   gene            306029..306664
FT                   /locus_tag="Bcav_0283"
FT   CDS_pept        306029..306664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0283"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: Bacterial regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78548"
FT                   /db_xref="GOA:C5BW90"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025996"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C5BW90"
FT                   /protein_id="ACQ78548.1"
FT                   /translation="MTERSSYHHGNLREALLAAGLDATRSAGVAGLALRDLARRVGVSP
FT                   NAAYRHFADRESLLGEVARRLQGDVAARMDAELEDALASARPGGSPERAALRAVGLGYI
FT                   DYALEEPGWFEVAFADTPPRDPWHLVEEPGPELLPPPLARLVTALDGLVASGELAPGRR
FT                   AGAEWPCWSAVHGFALLVLQGPLRAMPVHEQRRAAEQTVDAIVAGVLA"
FT   gene            306792..307412
FT                   /locus_tag="Bcav_0284"
FT   CDS_pept        306792..307412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0284"
FT                   /product="Carboxymuconolactone decarboxylase"
FT                   /note="PFAM: Carboxymuconolactone decarboxylase family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78549"
FT                   /db_xref="GOA:C5BW91"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:C5BW91"
FT                   /protein_id="ACQ78549.1"
FT                   /translation="MSTTRVPPTEITGPLGWLVKTMGRRMMGEVPESAGVMWHHPAVFK
FT                   DLMGLGRKSEKWGRLDENLSVYASMAAAAEVGCSACLDYHYFMTRHKHLDEAKAREVPR
FT                   WRSSDVFTPTERRVMEYAEAMCQIPVAVTDEMSAALLDDLGPAGLIELTTKVGLMNATA
FT                   RSNIALGIRSQEFAASCGLPPLASRPATDPAGQPNVTAHPVAG"
FT   gene            307417..308295
FT                   /locus_tag="Bcav_0285"
FT   CDS_pept        307417..308295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0285"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="PFAM: Sigma-70 region 2; Sigma-70, region 4;
FT                   TIGRFAM: RNA polymerase sigma-70 factor, TIGR02957 family;
FT                   RNA polymerase sigma factor, sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78550"
FT                   /db_xref="GOA:C5BW92"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014303"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C5BW92"
FT                   /protein_id="ACQ78550.1"
FT                   /translation="MSDDPFVTHRSLLFTVAYEMLGSAADAEDVVQETWLRWADVEHGE
FT                   VRNPRSYLVRVVTRQALNRMRTLARRREDYVGEWLPEPLLTSPDVADDVELAESVSIAM
FT                   LTVLETLGPTERAVFVLREVFDVPYDEIGEAVGRTPATTRQIARRARGHVAARRPRIEV
FT                   DRAEQERVLARFLTAARTGDLQGLMDVLAPDVVAVADGGGLIRGAARRPVAGARRLATA
FT                   LLRGLGSVSPERLTVTRLWLNGAPGVRFDVEGEVTVALSVTIADGRITQIFGVSNPHKL
FT                   ARLDVEEALAR"
FT   gene            complement(308307..308918)
FT                   /locus_tag="Bcav_0286"
FT   CDS_pept        complement(308307..308918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0286"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: Response regulator receiver domain; Bacterial
FT                   regulatory proteins, luxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78551"
FT                   /db_xref="GOA:C5BW93"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C5BW93"
FT                   /protein_id="ACQ78551.1"
FT                   /translation="MSTIRLLLADDQALVRGALAALLDLEPDLDVVAQVGRGDEVLAAA
FT                   RAARCDVALLDVEMPGEDGIAAAASLAAGYPRCRSLIVTTFGRPGYLRRALDAGASGFV
FT                   VKDTPADQLADAVRRVHAGLRVIDPDLAVASLTVGDSPLTERERDVLLAAASGGTVADV
FT                   ARATHLSEGTVRNYLSSAIGKTGARTRAEAARLAQEHGWL"
FT   gene            complement(308915..310027)
FT                   /locus_tag="Bcav_0287"
FT   CDS_pept        complement(308915..310027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0287"
FT                   /product="histidine kinase dimerisation and phosphoacceptor
FT                   region"
FT                   /note="PFAM: Histidine kinase; Histidine kinase-, DNA
FT                   gyrase B-, and HSP90-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78552"
FT                   /db_xref="GOA:C5BW94"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C5BW94"
FT                   /protein_id="ACQ78552.1"
FT                   /translation="MSHAGRSRAWRFLGPLLAIVWVAFLAEPLSAALAADDLWVRVVSV
FT                   VGVVGVGITFAFSMLFVRREQQSPSMIVLLVALELFFTAISCLGAHEHGLVGLVYVSAT
FT                   VHVLTRSPRAFVTTILCAAAAFVLPRVIPGWDPADGTVAAVVLASLATFGFTQLIRRNR
FT                   QLLAAQREIAELAAARERARLARDVHDLVGHSLTVVAVKAELARRLVSRDPDAATGELA
FT                   DIHELARSALADVRSMVQATRGVTLPGELVAARQALDAAGIEAQLPGAVDVVPDPLREP
FT                   FAWVVREGVTNVLRHAGASRVVVTLAADRLVVEDDGRGPGPDSGAAGAPAPGQGIAGLT
FT                   ERLRAVGATLETGTSSLGGFRLAARAGGAA"
FT   gene            complement(310098..310895)
FT                   /locus_tag="Bcav_0288"
FT   CDS_pept        complement(310098..310895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0288"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78553"
FT                   /db_xref="GOA:C5BW95"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:C5BW95"
FT                   /protein_id="ACQ78553.1"
FT                   /translation="MTTTIPTAPDLQTRRPPSYVPRGMSSTYLRLELRRRVRNVRTMIF
FT                   SLLMPPVFFLMFGTSQAYRDEPAGNGNVTAYVLVSMALYGALLSATSGGAGVSVERAQG
FT                   WTRQLRLTPLRPWAYVATKLLAAMALGALSVVVTLLVGSFVGAEMPLGVWIASGLIAWA
FT                   GSFVFAAFGLFMGYLLPSENVMQILGPGIALLAFAGGLFVPLGDGWFADVAKLMPTYGL
FT                   AELTRAPLTGEGFTLTSVLNVVVWAALFSLGAAWRFRKDTARV"
FT   gene            complement(310892..311923)
FT                   /locus_tag="Bcav_0289"
FT   CDS_pept        complement(310892..311923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0289"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78554"
FT                   /db_xref="GOA:C5BW96"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5BW96"
FT                   /protein_id="ACQ78554.1"
FT                   /translation="MSWPAGDTRRGDGAPDASTVDTMNTSTLRTPALRLSALRKDFIAP
FT                   GGTVRAVDGLTLEVMPGEIVAFLGPNGAGKTTTIDMVLGLSEPTSGEVAVFGQSPAAAI
FT                   SAGRVAAVMQTGGLLSDITVAETVELTAALFGSDAHPQPYLARAGIADLADRRVGKCSG
FT                   GQQQRLRFAMALVSEPDLLLLDEPTTGMDVEGRRDFWAAIRQDAAQGRTVVFATHYLEE
FT                   ADAYADRIVLVSHGRIVADGSAAEIKNLASGRTVSARLEDRERGPVADRLRGLDGVASV
FT                   EERGSRLLVRTSDSDAAARLLLTTTRARELEISADSLEDAFVALTSDTASRTRTAATEG
FT                   ALR"
FT   gene            312210..312836
FT                   /locus_tag="Bcav_0290"
FT   CDS_pept        312210..312836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0290"
FT                   /product="GCN5-related protein N-acetyltransferase"
FT                   /note="PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78555"
FT                   /db_xref="GOA:C5BW97"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C5BW97"
FT                   /protein_id="ACQ78555.1"
FT                   /translation="MSATAKVTATADAEYAVVPANEAAWEDLQAVLGIRGPASRCQCQR
FT                   YKLHRLESFGGFPAEERAHRLREQTECGFPDAPSTSGLVAYLGEEAVGWCAVEPRTAYE
FT                   GLVRNNRVPWTGRDESKADDTVWAVTCVFARAGFRRRGVSRALVAAAVEFAASRGARAL
FT                   EGYPMTTTRAIDEELHVGTLSTFLAAGFREVGRPTQRRAVVRIDF"
FT   gene            312957..313805
FT                   /locus_tag="Bcav_0291"
FT   CDS_pept        312957..313805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0291"
FT                   /product="Peptidoglycan-binding domain 1 protein"
FT                   /note="PFAM: Putative peptidoglycan binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78556"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:C5BW98"
FT                   /protein_id="ACQ78556.1"
FT                   /translation="MDELVMDDDVGTVVIEDVTTEGPAESEIQDPDAPDPDDPTVIPVD
FT                   PPGDGDQGLLPGRPGGLPRAERTGSAAIQKSLTLAGDGYRGLCLQFVRLCFGVPARHRS
FT                   AHDAWVAARVRHPGSGTDAPAGTAVFWNITAGKNAPYDHVAISLGGGVCRSTSVTASGI
FT                   GNVRIADLTARWRMAPYGWTEDLNGYRIVGGGRPPKVVVAQGAAGLKNGDRGPRVKALQ
FT                   QALNRWRSDLPALVADGVFGDLTERRLREWQTRNRGGAYPAAAQIDGVAGPLTLAALDL
FT                   A"
FT   gene            313834..315546
FT                   /locus_tag="Bcav_0292"
FT   CDS_pept        313834..315546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0292"
FT                   /product="Glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /note="PFAM: Phosphoglucose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78557"
FT                   /db_xref="GOA:C5BW99"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/TrEMBL:C5BW99"
FT                   /protein_id="ACQ78557.1"
FT                   /translation="MTFDAAAPIDPTSTPAWADLLAHHDALDVDLRAWFAADPKRAERM
FT                   SHRLADLHVDLSKNTVTPATLDLLVQLARETNVPERLAAMFAGEHVNTTEDRAVLHTAL
FT                   RRPAGAEPPLVVDGQHVDDDVQAELAKMYAFAEKVRSGTWRGLTGERVRTVVNIGIGGS
FT                   DLGPVMAYEALKPYVQEGVEVRFVSNIDPTDIARATRDLDPATTLFVVASKTFTTLETL
FT                   TNARLARAWLWARLEAAGDVDDATSRAAAVAHHFVAVSTALDKVAAFGIDPANAFGFWD
FT                   WVGGRYSVDSTIGTSLAIAIGPDAFAQLLAGFHAVDEHVRTTPIERNVPVLMGLLNVWY
FT                   VNVVGAHTHAVLPYSQYLHRFPAYLQQLTMESNGKSVRWDGSPVTTQTGEVFWGEPGTN
FT                   GQHAFYQLLHQGTRIVPADFIAFATPNDPLRDGANHDADVHSLLLANFLAQTKALAFGK
FT                   TPDEVRAEGTPEHLVPARTFAGNRPTTSIMAPLLTPSVLGQLIALYEHITFVQGAVWGI
FT                   DSFDQWGVELGKTLALQIAPALTGDAAALAAQDPSTAALIAYSRAHRGPDPEA"
FT   gene            complement(315500..316645)
FT                   /locus_tag="Bcav_0293"
FT   CDS_pept        complement(315500..316645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0293"
FT                   /product="esterase/lipase"
FT                   /note="PFAM: alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78558"
FT                   /db_xref="GOA:C5BWA0"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWA0"
FT                   /protein_id="ACQ78558.1"
FT                   /translation="MTDIPFGYLFGTALVALATAFALWPVRRPRPLSTISYFLGLALAE
FT                   LPVFALVLLTASSVLAVSEGDVAGPGGQVVLALALLTSVGLAVVLARALPATAVLTAAL
FT                   QHDLGVAPGAARTPRRVPTWLRALQGPVVVRPRNVTRVANIAYGPAGRRQQLDVLHRRD
FT                   VPQGAPVLVYWHGGGYYSGSKNREARPLLHRLAQRGWVCVSANYRLRPQAGFAEHLADA
FT                   KSAIAWAHAHAAEFGGDPSTLVVAGSSAGAHLASICALTPDTSVSAAVCLYGWYDSYYG
FT                   TGPADAPASSPFAYVNPDAPPFFLTHGDHDTYAPVETARGFVRELRDASRQPVVYAELP
FT                   GAHHAFDVFHSIRSEAVTDAVETFLDVTLRDRDRGVRGSTR"
FT   gene            complement(316721..317149)
FT                   /locus_tag="Bcav_0294"
FT   CDS_pept        complement(316721..317149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0294"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78559"
FT                   /db_xref="GOA:C5BWA1"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWA1"
FT                   /protein_id="ACQ78559.1"
FT                   /translation="MSRTTPEVSAGPTAELASAAPARRLPRWIVPFAAAAAGAAVWLVG
FT                   AAAGVGPVVVDGTEVGVVAVVVAGLVAGLLGWGVRALVGRIARRRGRTGQVGWLVTCAV
FT                   VLLLSLSGPLGAEGGAAVTVLVAEHVVVGAVIALGLRR"
FT   gene            317397..318566
FT                   /locus_tag="Bcav_0295"
FT   CDS_pept        317397..318566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0295"
FT                   /product="histidine kinase"
FT                   /note="PFAM: Histidine kinase-, DNA gyrase B-, and
FT                   HSP90-like ATPase; Histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78560"
FT                   /db_xref="GOA:C5BWA2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWA2"
FT                   /protein_id="ACQ78560.1"
FT                   /translation="MLSWAGVVVLTALTVAGAFDATGVLPLGGGLDVVVALAALALVPF
FT                   LWTRRQLPVAYALAALAVLGPTATPASTVAVLAIARSRSVRTALPVAVVGFAAHAVQGL
FT                   WRPIPLPYGWWLLCAAAVFAALLGWGAYWKARAELLLSLRERARRAERDQAERVERARH
FT                   DERTRIAREMHDTLAHRLTLIAATAGALEYRPDAPPEQAAAAAARVRDAVSGALDDLRG
FT                   ILRLLRAGPDELRPAPGLADLGQLVAEARAAGGAVRYDDGGTLDGVEAPPALALAAYRV
FT                   VQEGLTNARRHAPDAAVSVTIAREPDGMRVAVVDDGATAPAAGASDGSGTGLVGLAERV
FT                   ELLGGTLDVGPRPDGPGFAVVAWLPWGGWERASGSRSSTTTPSSEQRCD"
FT   gene            318566..319162
FT                   /locus_tag="Bcav_0296"
FT   CDS_pept        318566..319162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0296"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: Bacterial regulatory proteins, luxR family;
FT                   Response regulator receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78561"
FT                   /db_xref="GOA:C5BWA3"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWA3"
FT                   /protein_id="ACQ78561.1"
FT                   /translation="MLDGADGIVVVAEADDGAALPAVLDAHPLDVVLMDLRMPRVDGIA
FT                   ATREVRRRRDAPAVVVLTTFDTREEVEGALHAGAVGYLLKDAPPARIAEAVRAAALGEP
FT                   VLSPQVARRLMTSAADAGAARSTARAALGRLTARGREVALEIGRGASNADVGARLHLSV
FT                   PTVKAYVSSVLAKLGVENRTQVALLVHEAAEEPPS"
FT   gene            complement(319244..319615)
FT                   /locus_tag="Bcav_0297"
FT   CDS_pept        complement(319244..319615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0297"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78562"
FT                   /db_xref="GOA:C5BWA4"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWA4"
FT                   /protein_id="ACQ78562.1"
FT                   /translation="MDFFWLLIYAFLLFAYLMVLFQIIGDLFRDSKLSGWWKAVWIFFL
FT                   IILPFLTALVYLIARGRGMGERQVAAIQQAKTDTDRYIQSVATQTSPAEQIGHAKSLLD
FT                   AGTITQAEFDTLKAKALAS"
FT   gene            complement(319769..320143)
FT                   /locus_tag="Bcav_0298"
FT   CDS_pept        complement(319769..320143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0298"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="PFAM: STAS domain; TIGRFAM: anti-anti-sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78563"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWA5"
FT                   /protein_id="ACQ78563.1"
FT                   /translation="MTISDLAHGGITHTRNGGGVVIRIWGEVDAALRDDASAAMAAVLA
FT                   DPGPVVIDARDVTFIDSTGLAFILQLHKHGSEESREVVLRDPAPRLTELLELAAVGDLV
FT                   RVERTPVPPTEQTSQSLSSR"
FT   gene            320732..321349
FT                   /pseudo
FT                   /locus_tag="Bcav_0299"
FT   gene            complement(321495..321881)
FT                   /locus_tag="Bcav_0300"
FT   CDS_pept        complement(321495..321881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0300"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78564"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWA6"
FT                   /protein_id="ACQ78564.1"
FT                   /translation="MVSRISHTTLDAQDPYTLSLFWSAVLGYAEDPDDPNMPEHEENMI
FT                   FSPDRSHRVLFIRVPEAKSGKNRMHFDLIPTDRTRDEEIERVRGLGATDVHDLREPDGG
FT                   WLVMADPEGNEFCILRGDIERAEA"
FT   gene            complement(321941..322939)
FT                   /locus_tag="Bcav_0301"
FT   CDS_pept        complement(321941..322939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0301"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78565"
FT                   /db_xref="GOA:C5BWA7"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWA7"
FT                   /protein_id="ACQ78565.1"
FT                   /translation="MMEDIAALQDVDLRITAALLAHPRARVGAIAAAAATSAPTVSRRL
FT                   ATLLDDDVVRVVGVVDQQRADAGFAAFLRLRCVPGASVDVAQALARWPESGYVALIGGD
FT                   LDCAAQLHVRSTRHLLEITGGRLKALPGVVGSSTLKIIRRFSTPHGWTGGLVPDRALAT
FT                   LRADRMDHWSEERPHTRHDLDELDRGVVAALAEDGRMSWRELAERLGVQPATASRRAEA
FT                   LMSKGLLRLRAVVQPARIGQPVIAFIWLRVAPSRLEAAGRALAAHPNVLNIAATTGQPN
FT                   LCGEVAVGGDEELYTFLTDDVGSLPGVMAVDVSDGLDVIKRASLVFDERAA"
FT   gene            323054..324448
FT                   /locus_tag="Bcav_0302"
FT   CDS_pept        323054..324448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0302"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: Oxidoreductase family, NAD-binding Rossmann
FT                   fold; Oxidoreductase family, C-terminal alpha/beta domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78566"
FT                   /db_xref="GOA:C5BWA8"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWA8"
FT                   /protein_id="ACQ78566.1"
FT                   /translation="MRPGREDEALSAVTLSVIGAGHRGGDAYGDYCLRHPEHARVVAVA
FT                   EPDDRRRAEFADLHGIPAERQYATWEELLAAGRLSDGLVVSSPDLVRQGPVVGGARLGY
FT                   GLLVEKPFAPDEAQLDAMVAEIARTDALVGVAHVLRYTSFYATLKELVEQGTIGRLVHL
FT                   DQTEDIGYWHFAHSYVRGSWRKAADATPMLLAKSCHDLDIITWLVGLDCTHVESTGSLT
FT                   HFRPEQAPDGAPERCTDGCPAASTCPFYAPRLYLDRLADHHQLPVTAVTREPGRAARLE
FT                   ALRSGPYGRCVYRSDNDVVDHQTVTLTFAGGVLATLRTAAFTASNTRTIRLLGSHGEIS
FT                   GRLDTGEIEVRRFLPAPGQEIGTWHPWDRDALGRSGPRDDETWTVNAGPVDDPDLEGRP
FT                   GRRASDGHAGGDDGLMREFVERLRLRREGAAVSMPTHVRDAERSHRIAFAAERSRREGR
FT                   TVEMSA"
FT   gene            324445..326700
FT                   /locus_tag="Bcav_0303"
FT   CDS_pept        324445..326700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0303"
FT                   /product="Alpha-N-acetylglucosaminidase"
FT                   /EC_number="3.2.1.50"
FT                   /note="PFAM: Alpha-N-acetylglucosaminidase (NAGLU)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78567"
FT                   /db_xref="GOA:C5BWA9"
FT                   /db_xref="InterPro:IPR007781"
FT                   /db_xref="InterPro:IPR024240"
FT                   /db_xref="InterPro:IPR024732"
FT                   /db_xref="InterPro:IPR024733"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWA9"
FT                   /protein_id="ACQ78567.1"
FT                   /translation="MSSRTNAAPAAGVVHSDAVRALAGRVLGAAAERVVVGPLDDGSER
FT                   GADGAPEGAAEFAYAASGGELVVRASDTPAAAAGLYHYLKHAGGRQVTWDRLRPEALTR
FT                   LPDAPPTRRSTPAAARYDLNVVTTGYTAPYWDWARWEREIDWMALHGITTPLMVVGHET
FT                   VLLRTFTALGLDPGDVVAWLGSAAHLPWTLMGSTSSFGGPLPDSWFERRAELGRRILER
FT                   QRELGMRAVLPAFGGHVPDGLGAGARTHWQGFSTALLGPDDDAFAVVAAEFARQQRELF
FT                   GTDHLYAADPFIESVPPSGEPEDLAAFAAATYAGMSAADPEATWVMQAWPFHYHRRFWT
FT                   AERIAAVTDAVPRDRLLLLDLWAEHAPVWDDGRGIAEHQWLWCAVHNFGGRFSVHGDLH
FT                   GLARDLGGVLDDGARTGGFTGVGMAMEALENNPVFYELLTDLVWERPDVDAWVGRFVDQ
FT                   RYGFADGTAARDAVHGAWAILLRTLYGPGMTRSIPSPVIARPADVVAPFHTQRLAGEFL
FT                   DPDAPVIVSANIDAEADPRVEGDLPEIARAAALLREAAGSSDAGGPLAHDLADLLTHVV
FT                   AQRTRAPIRAIVAAARAGDADAVRANGALLAAAIADLDAVAATQPDRLLGTWLAAAQRW
FT                   ADDDGERRVLLRDARRQLTVWGEQTSGLHDYSGRHWSGLLGGFYAPRWQLWVDWLAEAA
FT                   ESGSEPDPQELRRAVVALEESWVARDETGPTDPAGDLAALADRVLATYSAPLEVSGR"
FT   gene            326697..328190
FT                   /locus_tag="Bcav_0304"
FT   CDS_pept        326697..328190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0304"
FT                   /product="sulfatase"
FT                   /note="PFAM: Sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78568"
FT                   /db_xref="GOA:C5BWB0"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWB0"
FT                   /protein_id="ACQ78568.1"
FT                   /translation="MSDRPNVLLVMTDQQRWDTLGSAGGPVETANLDHLAAQGTTFTHA
FT                   YSATPSCTPARASLLTGQDPWHTGILGMGAGQPPMAGLENTLPEALADAGYHTQGVGKM
FT                   HFSPQRALHGFHATTIDESLRVEEPGFTSDYTQWFERHAPADVRQADHGLDFNSWLARP
FT                   FHTGEHLHPSTWTVTESIRFLERRDPTRPFFLMTSFARPHSPYDPPAFYYEHYLRRHHT
FT                   GDLPPAVVGDWASVHDVGGAEGMDPNAWRGRRTADEIGRARAGYYGSIHHIDHQIGRLM
FT                   RYLRDRRLDAETLVVFTADHGDMLGDHHLWRKTYAYEGSAHVPLVVRLPAGMRSAGDAE
FT                   VVDDPVCLQDVMPTILDACGVDVPASVDGASTLPLVTGERVPWREFVHGEHSTCYHPSQ
FT                   EMQYLTDGAWKYVWFPRGDGPGSPREQLFDLRSDPYEERDLAPRSDHAAVLRRWRARLV
FT                   DVLAPRDAGLTDGGALVPQDGRPPLVSPHAASRVAERLA"
FT   gene            328187..328363
FT                   /locus_tag="Bcav_0305"
FT   CDS_pept        328187..328363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0305"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78569"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWB1"
FT                   /protein_id="ACQ78569.1"
FT                   /translation="MTRQRWAPTQATDCSISPQNSLVSFITTRFMDAPARGAVRSVARP
FT                   TDGATIVHPEEDS"
FT   gene            328360..329781
FT                   /locus_tag="Bcav_0306"
FT   CDS_pept        328360..329781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0306"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: Bacterial extracellular solute-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78570"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWB2"
FT                   /protein_id="ACQ78570.1"
FT                   /translation="MRKSTARPRRVHRAAGAAVVAAAAIVLAACSGGGGGGEGDDGDAP
FT                   AESITFWTPHVTPERLAAQEAVAEQFTEETGIEVEVVALAGPDQNTTLVAGAASGDVPD
FT                   VILHGFDQAAAWVDQGLLDQEAAQAVIDELDPSTFAEAALNLSSIDGVPTGVPMDGWGH
FT                   MLVYRTDLFEAAGLDAPESIEDVAAAATRLHEDGYTGIALGTQAGNPFTRETMEAMLLA
FT                   NGCELVTDGTVTLDSPECVEGLRLYQEMAASGGSGELDVEAARAAYLAGDAAMLVFSSH
FT                   ILDELAGLDPNNPVTCDECTENPQFLLENSGFAMGLSGPDNDEPQLFGNILQLGIPVGA
FT                   HTEEAQQFAEFLLSDGYMESVGSATEGRIPVRLGTPENPTEYTEAWANLPFGAAGDGSS
FT                   IAEVYGQDVADLISGGSESYARWGAGTADALLASVVAQQNVIPQNLGSFFTGGDPAEVA
FT                   TGLQTAVESAQQDAG"
FT   gene            329778..330746
FT                   /locus_tag="Bcav_0307"
FT   CDS_pept        329778..330746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0307"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78571"
FT                   /db_xref="GOA:C5BWB3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR017756"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWB3"
FT                   /protein_id="ACQ78571.1"
FT                   /translation="MTAESLAAPRRRGRPASSTRARQDDRAGRLLVAPTALVVGFVVLL
FT                   PFAAVLVLAFQDIRLAELSRITFADLGFDLEAFLSTFRRDGFWDSLRATLVFASLTAIG
FT                   SVALGVAVALALRTPFRGRAIVRGLILMPYVLPVVAAAQTWRTLLNTQYGFVNEFGMRF
FT                   LGWDGPIAFLTTPSASVLGVEVPLALLSVVLVQIWGTFPLAFLFATARLHAVPGDLEEA
FT                   ASLDGAGAWQRIRYVVLPELSGVIGLLLLLRFIWTFQTFNEVYLLTGGAAGTQVLGVRV
FT                   YNELIGRADIGSASGVGVAITVMLAGFIALYLILARRRGER"
FT   gene            330743..331675
FT                   /locus_tag="Bcav_0308"
FT   CDS_pept        330743..331675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0308"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78572"
FT                   /db_xref="GOA:C5BWB4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWB4"
FT                   /protein_id="ACQ78572.1"
FT                   /translation="MTTTSHTRPTGPQAAARTSPAARRRRRRRGEIGPAIVRVVVIVGA
FT                   VLFAAGPVVYAFGLSLQPLAAVAANPLDVFPSFSELDFSAYSRALLDESDGGFGLGRFM
FT                   RNSLVLASLTTLATLAVCVLGAYATARLEFRGRGAIGAIFLGVYVLPGIALAVPLYVLF
FT                   SRIGLRGTLVGLVLIYMASTVPLAIYMLRNYFDGVPRSVEEAAAIDGAGRMQIIGRVVL
FT                   PMTLPGIAATGLYIFMIAWNEYLYALLFLVEDRERWTVSLGVAQLATFDVPVTVLMAGS
FT                   IAITLPVVIGFFASQRLLISGLTAGAEKG"
FT   gene            332031..333071
FT                   /locus_tag="Bcav_0309"
FT   CDS_pept        332031..333071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0309"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: Bacterial regulatory proteins, lacI family;
FT                   Periplasmic binding proteins and sugar binding domain of
FT                   the LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78573"
FT                   /db_xref="GOA:C5BWB5"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWB5"
FT                   /protein_id="ACQ78573.1"
FT                   /translation="MAVTIYEIARRAGVGVSTVSRYLNSSGYVGADAARRIAAVVEETG
FT                   YVSSRAASSLTTKRSGAIGFVTSSLLNPFAAELAHAMAAEAASEGFSVLSAVTDGDDDR
FT                   LVHVLRDLRSHRVDGVIVTPPETPAVREELARTVASGVPVTTIGMAIPDAAHDEVSTDT
FT                   YGGALDAVRHLLEQGHRAIAVVAGPDPERVAASRFRAYRDALDAAGLAVRAELVPATAL
FT                   DREGGAEAAARLFALDAPPTAVFAANDLAALGVLQAAHEAGLRVPDDLSVVGFDDIAMA
FT                   SHATPPLTTVRQPKTAMGVRAVRLLLDRIAEPEREPRSERLECELVVRASVAPPRRGRE
FT                   GAATDL"
FT   gene            333104..334435
FT                   /locus_tag="Bcav_0310"
FT   CDS_pept        333104..334435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0310"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: Bacterial extracellular solute-binding
FT                   protein; TIGRFAM: Tat (twin-arginine translocation) pathway
FT                   signal sequence"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78574"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWB6"
FT                   /protein_id="ACQ78574.1"
FT                   /translation="MPDQRRSLPPMSRRSFLGGAAAAGALTLGACGSPRSARDLTFLIN
FT                   HTNQEAQLFDEQIGVFLDGDPEHRITLQNIASGPQFYTRLRTVSVTNDLPDVWYARTLD
FT                   TAFNVSNSWQLPLDEFIRDDPDAAVDDIWAAQVRQMSVDDVQYSMPYDLSCYCIYYNRT
FT                   AFEEKGIDRPDDESWTWDELFEIAEAFTESSGGRQTRWGFYFSLGTWFFDGVFRSNGGG
FT                   LFEDDGRTVVIASEENIATLDTFYAMMDSGVAAQPQTLGAAVDPFISGLVAMAVNGSWA
FT                   TAQTRDQIGDRFAWDVLKLPKGTTGRREVATAGGAWGISRDSANPELAWEFIRFLSDTE
FT                   RLNLFISEPLRGIPGRISAAEDEEAMNASAGLPPESFRILRQMLVEDAYEVTWPPFWAE
FT                   FETIWNNRATALNGGARPRDVLTQIDSDVRAASARFFGSEGGDR"
FT   gene            334432..335397
FT                   /locus_tag="Bcav_0311"
FT   CDS_pept        334432..335397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0311"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78575"
FT                   /db_xref="GOA:C5BWB7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWB7"
FT                   /protein_id="ACQ78575.1"
FT                   /translation="MSTSAPARASSDASAVEQRTGATGNRPSAHARREARTGWLWVQSW
FT                   LVGFLLFTLFPLAFSLYLAFTEWNGRGAPRWIGLQNFSTLAVDPLFWQSVKVTAVFSVL
FT                   YLPLSLVIGFGMAMLMNQRLRGVRVFRTIYYLPSVLSGVAVAVLWQFVFNRDYGLANWL
FT                   LSLVGVGPVNWLQDSSWVIPALVIMQLWGVGSSIIIYLGGLQGIPTELYEVASMDGAGF
FT                   WRTLTSVTLPMMSPVIFFQVVLGIISTLQIFTQAYIMTGGGPNYGSYFLSLNIFNQAFT
FT                   NLRLGYSSAIAWVLFLMILAITLVIFRTSKYWVHDPNRRD"
FT   gene            335399..336295
FT                   /locus_tag="Bcav_0312"
FT   CDS_pept        335399..336295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0312"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78576"
FT                   /db_xref="GOA:C5BWB8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWB8"
FT                   /protein_id="ACQ78576.1"
FT                   /translation="MVVLGSRGAAPVVRHPLGDPHSRSRVGRRRSAVSYLILLLGCLAF
FT                   LFPLAWLVSTSLKTQDQILVFPIQWIPDPVAWENYAEIFRVAPFGRYLLNTVILTAFGV
FT                   LGSIIGASIAGYAFARLRFRGRDTLFLVMLATMMVPSWATLIPSYVLFARIGWLDTFLP
FT                   IIVPAFFAAPFNAFLLRQFFMSVPLELEEAARIDGAGTFRTFRTIALPLAKPALIIVGL
FT                   FSFLLYWNDYLGPLVYLQSERNYPLALGIANFVGLQNQDYALAMTGAAIAIAPCVLLFF
FT                   FAQRWFVQGVVITGVKG"
FT   gene            336292..338214
FT                   /locus_tag="Bcav_0313"
FT   CDS_pept        336292..338214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0313"
FT                   /product="ADP-ribosylation/Crystallin J1"
FT                   /note="PFAM: ADP-ribosylglycohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78577"
FT                   /db_xref="InterPro:IPR005502"
FT                   /db_xref="InterPro:IPR036705"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWB9"
FT                   /protein_id="ACQ78577.1"
FT                   /translation="MTMHVDVRSETFRDKVLGCWIGKNCGGTLGTPLEEGWGRDEPFDV
FT                   WWYPELQSGGLPNDDLEMQLVWLAALRDVGPELRAADLATYWLDHIGYNFDEYGLSKTN
FT                   LRLGLRPPVSGAFNNWFVDCMGCPIRSEVWACVTPGHPRIAARYAYEDAICDHAGGESV
FT                   YGELFNAALESAAFVVEDRDLLLDIATSYVPQDSATRRAIDAARAAHAEGVDWVTARRR
FT                   VIDAAPSKVAQYSPINLGFQVIGWLYGKDFGEAMCITVNCGYDTDSSGGTIGSWLGVRA
FT                   GLSNLPEKWTEPFGMGLSTNESWGGVRHLSDGARGIPGDVPELTDEIVRQAERVLLHHG
FT                   VRLRDGAFDVDVADLYADDAVRELWSRPVTSVSGGTASHAISVDYGPTPVVRPGEDVVY
FT                   DVAVTSHLSDPVRAVVSAVVPGGWRAPEPVELVLDPHATSATKLALPGPARAAIARTNP
FT                   VLVSVQVDHMPVVPPVPAPLVGAQAWRVLTGDAGVVDGPADLPDRSAAGPAWREIAVDG
FT                   NELPLESLRGAGDVVLQTFLQAFAQQQVRLAVDASVAVTVWADGEQVIDLPGGRMIRPS
FT                   YGSTGDVGATLDLAEGFHEVVVRFRFDGAAEGASPALAHVLLFSADRLKHGDVTLGRTT
FT                   FPWDD"
FT   gene            complement(338269..339114)
FT                   /locus_tag="Bcav_0314"
FT   CDS_pept        complement(338269..339114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0314"
FT                   /product="fumarylacetoacetate (FAA) hydrolase"
FT                   /note="PFAM: Fumarylacetoacetate (FAA) hydrolase family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78578"
FT                   /db_xref="GOA:C5BWC0"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWC0"
FT                   /protein_id="ACQ78578.1"
FT                   /translation="MTTIARELHGGEARWVVTGEEGTSRECPPLAELLALPLTAARAAV
FT                   EQAAASGAPVPDDGVTLAPVDRQEVWAAGVTYERSRDGRAEESAHALMYDLVYEAPRPE
FT                   LFLKSTPERVVGPGDAVGIRADSGWDVPEPELGLVLSSSGEIFGYVVGNDMSSRSIEGE
FT                   NPLYLPQAKVYTAACALGPVIVPVWDAGEGPFDISLRIERDGGAAFEGTTSTAQLHRTL
FT                   PDLASWLFRALDFPYGAVLLTGTGLVPEAGFTLAAGDVVEIAIDGVGRLTNPVAVVGTA
FT                   "
FT   gene            339203..339709
FT                   /locus_tag="Bcav_0315"
FT   CDS_pept        339203..339709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0315"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: Bacterial regulatory helix-turn-helix
FT                   proteins, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78579"
FT                   /db_xref="GOA:C5BWC1"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWC1"
FT                   /protein_id="ACQ78579.1"
FT                   /translation="MARGEAVSEVLVRDEAVTALRRARDLADSRYADEIDVDTLAASAG
FT                   YSRYHFSRLFRRVYGETPGQYLSRRRVERAQQILSSTNLTVTEVCHLVGFTSLGSFSSR
FT                   FRALVGVGPQEYQRRKVAEGVPPIPGCFLLLAAGLPTADRTTADRTTADRITARVEKQT
FT                   GQGAP"
FT   gene            339768..340226
FT                   /locus_tag="Bcav_0316"
FT   CDS_pept        339768..340226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0316"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/Bleomycin resistance
FT                   protein/Dioxygenase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78580"
FT                   /db_xref="GOA:C5BWC2"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWC2"
FT                   /protein_id="ACQ78580.1"
FT                   /translation="MITGLGVASVFVTDYDEAKAFFVQKLGFTERHDLVLDNGYRWLTV
FT                   GPSASPELQLSVTVPGPPVHDDETARMLRTLLAKGVLSGGAWNTDDCRATFELYTSRGV
FT                   EFLQEPQERPYGVEAVFRDPFGNWYSLNETNRAAFDAAAMKDAFPELA"
FT   gene            complement(340236..342521)
FT                   /locus_tag="Bcav_0317"
FT   CDS_pept        complement(340236..342521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0317"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: Glucose inhibited division protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78581"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR039650"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWC3"
FT                   /protein_id="ACQ78581.1"
FT                   /translation="MTSAATSSPSTSPVVTTEEVNSDLTVVGGGLAGVCAAIGAARQGA
FT                   RVALVQNRPVLGGNSSSEVRVWVCGATAHGVQHFARETGIMGELFVENQFTNPSGNPYY
FT                   WDLVVLEAVRAEPNITLYLNTDVRSVDASGPDDDRTISSVTGWQMGSERVLRFVSPAFV
FT                   DATGDGLVGHLAGAWYRTGRESRETYGESWAPEGPDRSTLGSTILFYSKDAGEPVKFVP
FT                   PSFAVDIAETSIPDLRPIRIEANGCAYWWIEWGGELDVVADNERIRDELQGAVYGIWDY
FT                   IKNSGKFDADNLTLEWIGAVPGKREYRRFVGDHTLTQSDVLEQEPFDDRVAFGGWSIDL
FT                   HPPGGMYASESGSRHWHPDGNYHVPLRSLYSANTRNMWLAGRNISASHVAFGTTRVMAT
FT                   CAVIGEAAGVAAALAVADGVAPRELATERFERVRRALVRADASVLGVLHDDPADLALAA
FT                   DVTASSTLLTLAAETPTATWELADHLGFVVPVDPELDGIWLLVDAAVATTLEVEVHDPD
FT                   LPQNYVPRELAASASVEVSAGEKQWVRVPVQWRPTSPRNAFVVVRANPDVVVHTSDEVL
FT                   PGVLTFTHREPSPQEEFTEQWRAWKQVLQRGSVCLRLDAATSAYAPSKAVGGYARPWGG
FT                   PQMWVSQPVEHDGEPWLALTWSSPAVVGEVAVVLDDDLDEDLINLHHHRTPFDVLPTLV
FT                   RDYRIEARAGDGAPWVVLADVTDNRARHRRHVLPSPVSATELRMVVTATNGASAARVVS
FT                   LRAWAAEG"
FT   gene            complement(342518..343525)
FT                   /locus_tag="Bcav_0318"
FT   CDS_pept        complement(342518..343525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0318"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="PFAM: SIS domain; Helix-turn-helix domain, rpiR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78582"
FT                   /db_xref="GOA:C5BWC4"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWC4"
FT                   /protein_id="ACQ78582.1"
FT                   /translation="MPARRPGQDGDDAGSSSTAVSAAAARSPRVVAHADDASPLQALRD
FT                   ALPSLTGALARAAAHIVDAPAEASRGSITRLATASGVSPATLTRLAGLLGYDGFPAMRA
FT                   AIATEHGREVQGGWQRDIGTAIAPDDPADQVLGVLVAHSSRAARNAMGALDLAGATRAA
FT                   DWIAAAERIHLYGEWGDSVSLHELYLRLLRIGRPVWFHEGKQATRVAASLLRPGDVAIA
FT                   LSRAGHDAVGEAFCALAQENGAHTVVITGDPEGPLADVADLVLFTGTREGTAWTDYFAG
FT                   RASDTLTAALLWVLVAQRVPDALGVEFAVPHSHPRSAGTADRPHPTTSSTKDLS"
FT   gene            complement(343543..344982)
FT                   /locus_tag="Bcav_0319"
FT   CDS_pept        complement(343543..344982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0319"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78583"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWC5"
FT                   /protein_id="ACQ78583.1"
FT                   /translation="MTTTDQRPTTTTAVATRTDTSPTQVSGVFPHLAQIGDFGPPRSEL
FT                   GIGSLMPYNGVLYVQNYNSHKAASGGGVSLRRVHPDLTMEVVPETLGVDGTYTNRFIHW
FT                   ATGNLVIGPHVISPDHEIRTVPELAPHRLCGTARHLTKPDTHVYVLTMEGEVFSLDVTT
FT                   LDVELAWDLNDELGTEGEWKVHYKDCYSSFGRLVVCSNEYAEEEWRGERARGRLAEFDG
FT                   ETWRILERKPFTAIGGRHEFGGTIFASGWDAASAILEVFTEGDGEWRRYRLPKASHCFD
FT                   HKWQTEWPRIREVEHERLLLDHHGMFYELSPWAYGNRIWGVRPISTHLWVLGDFCSWRG
FT                   MFVAGADNASPSHGLNPTTAEPQSGMFFGKTDDLWSFGKPTGWGGPWWDEDVSAGAPSD
FT                   PYLMTGFDNKCLHVQNHGEHAMRVHIEIDARGDGTFGRIGTLDVAAGELSTHVFPPGFS
FT                   AHWVRLVSDDDGRASAQLFYT"
FT   gene            complement(344993..345895)
FT                   /locus_tag="Bcav_0320"
FT   CDS_pept        complement(344993..345895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0320"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78584"
FT                   /db_xref="GOA:C5BWC6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWC6"
FT                   /protein_id="ACQ78584.1"
FT                   /translation="MTDATLSPAAAPAVVGTARTGRSAKQRRARRTRWIWAAALWILAI
FT                   AFLAPFAWMLSTSLKTNADAFTIPMEWIPDPLRWDSFVAVLTGPTSIVPAFANSVIVAT
FT                   ARVLGEVLTATMAGYAFARLHFRGRDKIFLAYLATSIIPAQLLLVPRFIYFQQMGLYDT
FT                   LWALILPGMFTVLGTFLMRQFFVAQPSAFAEAARIDGANEWQIFWRLYLPMATPVMSAL
FT                   GILAFVWSWNDYETPLVLISSPEAFTLPLSLTNFTDEQGSLAPNLSMAASVVSIIPVLI
FT                   VFLLLQKRFVHAMTHTGIK"
FT   gene            complement(345888..346838)
FT                   /locus_tag="Bcav_0321"
FT   CDS_pept        complement(345888..346838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0321"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78585"
FT                   /db_xref="GOA:C5BWC7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWC7"
FT                   /protein_id="ACQ78585.1"
FT                   /translation="MATLTAPTSAPAQAPSSGSRTSRGTGPRARVGWLFIAPNLIGVAL
FT                   FTFIPLVSVIVLAFTDWNLVSGLGGIEFIGVDNFVNVLRDPVFWGSVGRTIVYAGVSVP
FT                   LTVLLGMALAIALNRDIPGRGALRAVFFLPYIVSTVAVGMTWLMLMNPSAGLVNQVLHG
FT                   LGIENAPAWFASSRWALPALIVIAIWSGVGYAAVIYLSALQDAPSDLYEAAEMDGAGAW
FT                   LRFRTITWPALMPTTVFLLVTLFIGTSQGFGLVALLTAGGPGDATTVMSFYMYQTGFQF
FT                   YRFGYAAAIGLVTFVGVLALTLAMWRAQRGKALHD"
FT   gene            complement(346838..348175)
FT                   /locus_tag="Bcav_0322"
FT   CDS_pept        complement(346838..348175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0322"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: Bacterial extracellular solute-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78586"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWC8"
FT                   /protein_id="ACQ78586.1"
FT                   /translation="MSRVPPRPSRRAPSLTRRAVLAGALGAGTAGALAACSGGGGGTTP
FT                   QNTLNVWGGVPPESGPGALVDAFHEAHPEYTVNYTRFVNDDRGNLKLDTALQGGVDIDV
FT                   YFTYATGNLALRAGSGMTLDLTDRVEADPELAEFLDTEAPKGFWQDDRLTALATTREPN
FT                   MILVNLARLEAAGIELPQAWTLDEFVAAAAELTGDGTYGAYMLPDTARVSLGPNYWYTD
FT                   DGGSNFADPAFGEHMALSRDLIDDGVLYPWTEILARQLEAYQQNAFVAEDFALWMTAPF
FT                   SLRFLADAENYPHDFKVAAAPIPTTDVGAWNTGVFGNHIMVNPRSSKQDLAWEFVRFWI
FT                   LSGSEFMAPGGKIPTLQNVGTEDMLGSLLGPDAADWFDVDSFRRVLFDDDPELFVDTNL
FT                   TAFPEIDLAVRQQRDLCWIGERAPVDAVDAIDRQAGAAITRYGRSS"
FT   gene            complement(348390..348953)
FT                   /locus_tag="Bcav_0323"
FT   CDS_pept        complement(348390..348953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0323"
FT                   /product="protein of unknown function DUF1470"
FT                   /note="PFAM: Protein of unknown function (DUF1470)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78587"
FT                   /db_xref="InterPro:IPR010852"
FT                   /db_xref="InterPro:IPR021005"
FT                   /db_xref="InterPro:IPR023286"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWC9"
FT                   /protein_id="ACQ78587.1"
FT                   /translation="MYFDSHVADLLRASTELVNLMTCRDAGGRPAEVPTGAQLRRDLGV
FT                   ALARGGQPVHVSRDAELILRRFADDARPIFEAVADEDYDEAARRTNALLTWCRPAPRLD
FT                   NAGDGWHMHFHGPTDELGDGWAAGCAAALTMAIGSRHAGRLGVCEAPRCDRVYVDSSKN
FT                   GTRRFCGVTCQNRVKNAQHRARNE"
FT   gene            349008..350198
FT                   /locus_tag="Bcav_0324"
FT   CDS_pept        349008..350198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0324"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: Major Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78588"
FT                   /db_xref="GOA:C5BWD0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWD0"
FT                   /protein_id="ACQ78588.1"
FT                   /translation="MNSLGWLQLLASLPRAVKVLLVARFVNRIGAFSMPFLAVLLVQEV
FT                   EASTVLAGTVMAAFGVATIPSRLLGGVLAQRVATRHAVAVGLLGTAAAQGLIASASSVA
FT                   MALVGAVLLGLFFEIYEPASQALIADTTPDALLPRTYGLFGATLACAGLAAGTIAALVG
FT                   QIGLRWLFVVDAATATACAALVIGLMPRSTRSTAPSATRTRSAWGDRRLWSLMLTGTAF
FT                   ATVYLTVPMAMPLALIDAGHHPSVAGWLEALSALVVIAAQPLLSGRPAAARRMVVGYAA
FT                   IAAGLATAAAAPTLAGYAAATLVMSVGDALLLGYSLTLVARIAPAGSTAAYFAAYGLTW
FT                   GVALILGPPAMGYLIGIGPPTFWSACAIVMVCTGAATAVIVRRLARATTRGRGGVG"
FT   gene            complement(350195..350407)
FT                   /locus_tag="Bcav_0325"
FT   CDS_pept        complement(350195..350407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0325"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78589"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWD1"
FT                   /protein_id="ACQ78589.1"
FT                   /translation="MSAAPGSPGSASDAEDPSAPSPSTLRVPVLDGAASPFTLVGADAG
FT                   AGQCVDGVCVIPDGVPTTAPTDRPS"
FT   gene            complement(350404..351117)
FT                   /locus_tag="Bcav_0326"
FT   CDS_pept        complement(350404..351117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0326"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA-like thioredoxin domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78590"
FT                   /db_xref="GOA:C5BWD2"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWD2"
FT                   /protein_id="ACQ78590.1"
FT                   /translation="MPGVSAIKVDIWSDIACPWCYIGLRRFQAAVDVDDVDVDVEFHSF
FT                   DLAPDTPVDFDGSEVDFLAGHKGMPVAQVEQMLEQMTLLAATEGLTYDFDAVRHTKTLA
FT                   AHELLHHAKAHGTQLELKERLFAAYFTEGRHIGHTEELLALAADVGLDPEAARAALEDG
FT                   RYRDEVQADIAQARAYGITGVPFFVVDGRYGVAGAQESAVFRQVLAQAAADRASAERPA
FT                   PAPAPDEAATAVASA"
FT   gene            351183..352190
FT                   /locus_tag="Bcav_0327"
FT   CDS_pept        351183..352190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0327"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: Phosphotransferase enzyme family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78591"
FT                   /db_xref="GOA:C5BWD3"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWD3"
FT                   /protein_id="ACQ78591.1"
FT                   /translation="MLPDDLPDLSPWGLREPTTVTRPADGINNAVWLLDEEYVVRRYST
FT                   LDAEHVAAEHRLLAALDERADLPFAVPAPIRTSDGATFVVAGGRPVAVFAYRAGAPAPP
FT                   DPASMELAGEALGLLDAALAELPAELAPRVGPASMAGLHPAVDDLDELGAELERRLPGD
FT                   DGVAWFRAAWAPADEAYASLRRTLPTQILHADLSPSNVLIHQSRVSAILDFDHACLGLR
FT                   VEDPVAAMHMAAVFGTAGPEETLRAFRRGYVRTGEILPAEDAAVPVLLRRRGVGAVVWQ
FT                   SGLWRSGLGTFDDVRARLADGPAFEERLTAGAAVTARAPRSAARLRATGGVRRG"
FT   gene            352208..352705
FT                   /locus_tag="Bcav_0328"
FT   CDS_pept        352208..352705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0328"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78592"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWD4"
FT                   /protein_id="ACQ78592.1"
FT                   /translation="MVRPMQAWFRIVSVMALAVAAFATAGCGPGGTPFDEAEAGDCLGD
FT                   TGDTDTDDLRVTDCAEADARWTVLGQVEGAGADACADLPDTDVIISAADDSTSTCVRFR
FT                   AAEGDCVWTDLSGYANCEEDSGYQLAAIVEAAADDTGCPEDTAQSRIYSDGVVYCWVQH
FT                   SV"
FT   gene            352726..353853
FT                   /locus_tag="Bcav_0329"
FT   CDS_pept        352726..353853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0329"
FT                   /product="aromatic amino acid beta-eliminating
FT                   lyase/threonine aldolase"
FT                   /note="PFAM: Beta-eliminating lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78593"
FT                   /db_xref="GOA:C5BWD5"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWD5"
FT                   /protein_id="ACQ78593.1"
FT                   /translation="MRRRRPPPYTPPPYAVAVPVAPVSFASDNYAPAHPEVLAALTEAN
FT                   SGHAVSYGEDPWTERLADVVRRHFGEHALAYPVLTGTGANVVALASVLPRWGGVLVSRH
FT                   AHLHTDEAGAPEQVAGIKLLPVAAPDGRIAPSDVERAAVDLADVHRAQPLAVSLTQATE
FT                   LGTVYEPEALRAIADAAHARGMRVHVDGARLANAAAHLGVGLRELTTDAGVDVVSFGGT
FT                   KNGLLLGEMVVVCAPDAVAGLENLRKQAMQLASKMRYVSAQLVALLDGDLWLRSARHAN
FT                   EMAALLRTTLDDAVASGRAPGLAFTQPTQANSLFATLPPGVADRLRARFRFYDWDAARR
FT                   EVRWMCAWDTTPGDVEGFAAAVVAELGAAGSAAST"
FT   gene            354119..356173
FT                   /locus_tag="Bcav_0330"
FT   CDS_pept        354119..356173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0330"
FT                   /product="hypothetical protein"
FT                   /note="TIGRFAM: glutamate--cysteine
FT                   ligase/gamma-glutamylcysteine synthetase, Streptococcus
FT                   agalactiae type; Tat (twin-arginine translocation) pathway
FT                   signal sequence"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78594"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR025832"
FT                   /db_xref="InterPro:IPR032626"
FT                   /db_xref="InterPro:IPR038410"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWD6"
FT                   /protein_id="ACQ78594.1"
FT                   /translation="MVSRRAFLGTTGLAATGAVAASWFSPTAAPAAAGSGGLSWDRRRL
FT                   LPRFATARRLQVGDIQHLTGDEQLLLGTLQGAVNRHRPELYFHYDDADKPWLSSIDVPQ
FT                   TVHEDPLELVAAYADRVAGAIVYDPEVRDSINVATTLAGLRGAVVASPELAAAYELPVV
FT                   DDLRGRFTGQDKVDIYRWQLDELWPQCEHRLLTGLPPTRVVDVEGVTWREVAREAEQIR
FT                   DESNRDHYTVDVSAELGGEAVYVKFSDGFGNDGWGASVASVSVLADGVEIAAFVPGSPE
FT                   EEQVLVEGGNSSLGGDGNRFADGGNFFVYRLAPPEGTTTLEVTVDMWNQYVVSATDTAP
FT                   TRVEPFPHFRDYVVATQAMVVWLDPNGEPGELLSEIFALSEPTTPYLGWFSNDVAGEWG
FT                   GVDLAATQSVEVLPADFFANGTVLGGVPARISSRRRRAPRTELTDTVYVTMTVGEGDNL
FT                   QYCQRHMRTLWDNPDRGAAPTNWTISPVLADAAPAIFRYYQETATENDLLVCGPSGAGY
FT                   TYGGSWPQEDFDAYTDVTGRYLRETGLDLVYAYNNRDDDGWIPMPEWVIDSYRRNTQLG
FT                   GIMQSWDGGGVIAAGDLPVIGHFNAPGQAVEFKQGLDDYIAQWDGTRPLFVSAGIFAWG
FT                   WNPTDIAELHQLLAADDRYQVLLGHAFFDLLRRAPNPGPPPPPRPSGQG"
FT   gene            complement(356225..356926)
FT                   /locus_tag="Bcav_0331"
FT   CDS_pept        complement(356225..356926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0331"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78595"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWD7"
FT                   /protein_id="ACQ78595.1"
FT                   /translation="MSDDAPIDIMPMLAKGKHRSPRKGACFMELASYLAGEAWSDHPAC
FT                   THRLLASMARLVNDLTNDAARPRLAPLIPSVIGLTSADLRWDAGIALRAATTALPIAAA
FT                   ERQNTLAVGIIAAERALAVLDGHPVDELTPRGRAALARAPRAAAWAVDFCAGAPVRPER
FT                   FGDRAAAAIISSSVQGIAEAAVPDSDDRLYDLLDETIAECRRWADLEERARQELTPDMW
FT                   AAVCKPAVLAG"
FT   gene            357057..357590
FT                   /locus_tag="Bcav_0332"
FT   CDS_pept        357057..357590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0332"
FT                   /product="protein of unknown function DUF664"
FT                   /note="PFAM: Protein of unknown function (DUF664)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78596"
FT                   /db_xref="InterPro:IPR007061"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWD8"
FT                   /protein_id="ACQ78596.1"
FT                   /translation="MTSPPRLDPPQHGPEAEILLGFLDFHRRTLQLKTDGLDAEQLNRT
FT                   LAPSSMTLGGLLKHLAYVEDNWFSVVLLGNDDAEPWRDVDWGADRDWEWHSAALDDPEE
FT                   LRALHAAAVEASERIVAGVLADDGLDRLSVRRSRSTDEPFSLRWILVHMIEEYCRHNGH
FT                   ADLIRESIDGAVGE"
FT   gene            complement(357598..358257)
FT                   /locus_tag="Bcav_0333"
FT   CDS_pept        complement(357598..358257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0333"
FT                   /product="Protein-L-isoaspartate(D-aspartate)O-methyltrans
FT                   ferase"
FT                   /EC_number="2.1.1.77"
FT                   /note="PFAM: Protein-L-isoaspartate(D-aspartate)
FT                   O-methyltransferase (PCMT); TIGRFAM:
FT                   protein-L-isoaspartate(D-aspartate) O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78597"
FT                   /db_xref="GOA:C5BWD9"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWD9"
FT                   /protein_id="ACQ78597.1"
FT                   /translation="MAAAADRTAERERRVDDAFAAVRRAPFLPRQLRHRAGDDAPLPIG
FT                   HGATCSQPRTVRDMLLLLDPRPGHRVLDVGSGSGWTTALLAHLVAPDGAVVGVDLEEEL
FT                   VATSRAALAHAGLLDDETSAHEPATRTTPDPASGVAVVVHVAPPHTLGWPAAAPYDRIL
FT                   VSAQAAREVPDALLDQLAPTGVMVIPVRGELVVVDQDEGGRRLSAHGAYRFVPLRQ"
FT   gene            358290..358982
FT                   /locus_tag="Bcav_0334"
FT   CDS_pept        358290..358982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0334"
FT                   /product="conserved hypothetical protein"
FT                   /note="TIGRFAM: conserved hypothetical protein TIGR03086;
FT                   uncharacterized Actinobacterial protein TIGR03083"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78598"
FT                   /db_xref="GOA:C5BWE0"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR017520"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWE0"
FT                   /protein_id="ACQ78598.1"
FT                   /translation="MPGAGEDGARAGRSSNAGREAVGGGLYDRRMSTPSDLRPLHRTAV
FT                   TISVDIVSRVRADDLDRPTPCGDWTLRDLLAHMTVQHLGFAAAARGHGGDPGLWDANPD
FT                   EPDPVGAYATAAADVLDAFAADDVLTAELELPEFAPVTRYPGAQAIGFHFIDYVAHGWD
FT                   VAATLGVPYEIPDDVAAAVLPLALQVPNGAGRGAPGAAFAAAIESGDGSSDLDRFLLWL
FT                   GRDPAWRP"
FT   gene            complement(359041..359703)
FT                   /locus_tag="Bcav_0335"
FT   CDS_pept        complement(359041..359703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0335"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: Response regulator receiver domain; Bacterial
FT                   regulatory proteins, luxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78599"
FT                   /db_xref="GOA:C5BWE1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWE1"
FT                   /protein_id="ACQ78599.1"
FT                   /translation="MSTPIRVLLADDHAAIRAGLRLMLEQAGDVEVVGEAADGAAAVTN
FT                   VRALRPDVVLMDVRMPGTDGIAATETIVGEGLADVVVLTTFDLDEYVFAALRAGAAGFL
FT                   LKTTDAPALLDAVRRVAAGEGALAPEVTRRVLDAVARGPAPGGSDDPAVPHGLAELTDR
FT                   ERDVLACLGRGLSNAGIARELVITEATAKTHVSRVLAKLGCSSRVQAALLAREAGVV"
FT   gene            359766..360416
FT                   /locus_tag="Bcav_0336"
FT   CDS_pept        359766..360416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0336"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78600"
FT                   /db_xref="GOA:C5BWE2"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWE2"
FT                   /protein_id="ACQ78600.1"
FT                   /translation="MSDDVPAPETRSGRPEWWSLAAAIILSAATVASAWSGYEASRWAG
FT                   ESVRWNRSATVARFDATAQLAAADSQRITDVEVFGTWLTAEVAGDDALADAVRERFRPE
FT                   FVPAFDAWFATTDDGLPPGSPFERDEYVLAAQEQADGFVAEAERNALRADDASGLSTDY
FT                   VLVAVLYASVLFLAGIASKLRNERVAHLMVALAALVFVGAAIAMLSLPITFGS"
FT   gene            complement(360400..361626)
FT                   /locus_tag="Bcav_0337"
FT   CDS_pept        complement(360400..361626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0337"
FT                   /product="histidine kinase"
FT                   /note="PFAM: Histidine kinase; Histidine kinase-, DNA
FT                   gyrase B-, and HSP90-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78601"
FT                   /db_xref="GOA:C5BWE3"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWE3"
FT                   /protein_id="ACQ78601.1"
FT                   /translation="MVWLRRAWRDLGEDAGPTTAVWLFGLGALTIALGLVDVWGPGRGV
FT                   APAWHLVPLAVGCAAMTVRRRRPGFTLGVATVVFIADAILGGSFAVTLVLFDAIYAAER
FT                   FGGTRLRRSVHLAAGVIVVGIVLASVRGGNELRDVLALGLQTGGLLGLPIWWASSVRQA
FT                   AELAAAAEERARLEIERAESLERLAAAERTSAVEAERTRMARDLHDAVAGEVSAVVIHA
FT                   EAALAAPPDHERDRAALTAVRAGGLAALAEMRTLIEILRARESDDDPDEQRTTPPRLTQ
FT                   DLPALLGGAVAVRVTGEASLQEHGLPRAVDQTAYRIVQECLTNVAKHGASPQAELSLTV
FT                   DAATLEIDVSNRARPGVPTATGGHGVIGMNERATPLGGTVTAGIADDGGTWVVRARLPL
FT                   PPADVRSRT"
FT   gene            361777..362853
FT                   /locus_tag="Bcav_0338"
FT   CDS_pept        361777..362853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0338"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: GlcNAc-PI de-N-acetylase; Response regulator
FT                   receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78602"
FT                   /db_xref="GOA:C5BWE4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWE4"
FT                   /protein_id="ACQ78602.1"
FT                   /translation="MTQDRPRALVLEDDADAAEFTRIALERFGGMDVAVVGTAGDALRL
FT                   LREQHFDILVSDIELPGRSGLEILPEVRMIDPTLPVMVITAHGSVSHAVEALRKSADEF
FT                   LVKPVTAMQIVERATELVRSGRERDAAGREAVLAIGAHPDDVEIGVGATLAAHAAAGDR
FT                   LTILTLSPGAVGGEVTLRHAEALEAAAVVGARLVHLAFPDTRLDPADGLITAIEEVVAD
FT                   VRPDRVYTHTSHDRHQDHRAVHEAVQVAARQVPSLWCYQSPSSTVQFQPNRFVDVDGFV
FT                   ETKLRMLAAYASQAHRDYMDPGLVQATARYWSRFSPALAVEPLETVRASESLAAAAQAV
FT                   RPALGDVEVEHLRGVDES"
FT   gene            362850..364589
FT                   /locus_tag="Bcav_0339"
FT   CDS_pept        362850..364589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0339"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="PFAM: Histidine kinase-, DNA gyrase B-, and
FT                   HSP90-like ATPase; His Kinase A (phosphoacceptor) domain;
FT                   TIGRFAM: PAS domain S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78603"
FT                   /db_xref="GOA:C5BWE5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWE5"
FT                   /protein_id="ACQ78603.1"
FT                   /translation="MNSAATRTAESVRLPAIISRWFEPTAVGLRQVPLTVSYALVLASI
FT                   TVTHEVGHTVLLVVGALIVLAVQLIGSLGRWTQWSPWQYALPLAQMVALVLLELGAGVE
FT                   RSYFLSLVFIPVASLALQPGLLGTVLAIAGATAVITLGVTTNPDIEGTPPAIRVFVVGI
FT                   VAAFVAIGTHGATDALRRQADDLTSARDELTARAKQLVSSRDLLRSVMAAATEQAVVAT
FT                   DADGTVVAVSTGAERMFERPQDELLGTCVADLFPPGAADPGGPAPARPWARVAALVAAA
FT                   TADGATSAERTLTRRDGSARALEVVVTRRPPLSDELPAPAPGYLFVATDVTARHEAERL
FT                   QDEFIGLVSHELRTPLSSILGYVELLQLGGALSGEDETYVDVIDRNARRLLRMVDDLLT
FT                   SVQLTAGTFTFLPEQVDVVGVVRELVTDIEPTARRAEVQVVVAGDDAVPLRSDPGRLGQ
FT                   VVGNVLGNAVKFSARGATVTVKVTGLLGADGRRRARIVVTDTGSGIAPDDLARITERFY
FT                   RSSDARRRRVRGVGIGLSVVQAIVDAHGGTITIRSQPGEGTVVEIDLPDLTGRPAPAAS
FT                   PAE"
FT   gene            complement(364621..365757)
FT                   /locus_tag="Bcav_0340"
FT   CDS_pept        complement(364621..365757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0340"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78604"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWE6"
FT                   /protein_id="ACQ78604.1"
FT                   /translation="MVALVGVGVVLARPWVDEDALPSFRPAAPPEEVRSISLDFDVVVD
FT                   DETDWDAVAARLDEVDATTVHLNAGRIEFTAFDWPAYPQYAAEPGTDHLAVAARALHES
FT                   QDGVARQINLIIDAYTPELIKEDPSLAGIDANGVRSTHVASATQLMRGEVGERIADYAA
FT                   ALGERYDPNAIELTELNLDRFTFGEEDFDLFREMTQEADWPRNEDGTIDTGSPLIGTWR
FT                   SDVVAGLLSRVRAALDEVREGRGEQIELSADVRVDWTDPAAGRPDSGHDYSTLLEVADR
FT                   LVVWVYIGPVQRSPDDVESLTAALAEAGYDMSRLTMSVGLWKGRADDPTSIEPGELAGA
FT                   VRRAATNGITSVNVTPYSMMSAEHWAALAAVWNPPGTS"
FT   gene            complement(365763..367049)
FT                   /locus_tag="Bcav_0341"
FT   CDS_pept        complement(365763..367049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0341"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: Glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78605"
FT                   /db_xref="GOA:C5BWE7"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWE7"
FT                   /protein_id="ACQ78605.1"
FT                   /translation="MAILTSVALVFGITLLVVGVLRLLLTPFALVFEARYGRAPRGPHD
FT                   VGPMFPEPPHVSVVVPAYNEAVVIVHCVRSILRSDHPHLEVVCVDDGSTDDTFALMEGL
FT                   AAEHPSVRAIRQANAGKGAALNTGIAAAHGEVLLLVDADGLFRPDTVTELLRGFRDERV
FT                   GAVCGNDRPVNLDRVQTKLLALISHVGTGLMRRALDVVHALPIVSGNVGAFRRDVLERT
FT                   GPFRTDTLGEDLELTWRIYERGYRVTFAPRALVHAESPSTLRGLWRQRVRWARGLLQTT
FT                   DLHRRTIGNPRYGFFGPYLAYNTLAQLVLPFVQVLAVVVLAVLVLTDGTSWLPSGLWPW
FT                   VLFLGIPLSLALLLLAIALDRAPGDLRFLWTVPLWPLYSAMMTFVTIDAVRLELGGAEQ
FT                   RWNKLDRSGTVSVKGLVDDDDDASPPSSS"
FT   gene            complement(367057..367965)
FT                   /locus_tag="Bcav_0342"
FT   CDS_pept        complement(367057..367965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0342"
FT                   /product="protein of unknown function DUF201"
FT                   /note="PFAM: ATP-grasp domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78606"
FT                   /db_xref="GOA:C5BWE8"
FT                   /db_xref="InterPro:IPR003806"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWE8"
FT                   /protein_id="ACQ78606.1"
FT                   /translation="MQSDSSSDPVRTVLITGIGGPAGRSLGAQLARRRVDGARLRLVGV
FT                   DMAPVTDSAFDVIERVPAAADPDYDAHTLDLVRRHRPELVVPTVSEELPQLSVLATAAG
FT                   GPIVVSPPGPTAVAADKLLTMWALERAGVPVPRFAPASAFGSAGEALDWAGGPVVVKPR
FT                   VARGGRGVRVVEHADDDWSATDGSWIVQTFAPGVEYSPQLYRAPGDGGTVVVLLEKTGR
FT                   KEGRVGNATTVTRVPDGEAIDAADVAAHAAAALGLVGPLDMDVRRDADGIPVLLEVNAR
FT                   FGAVSAHAPELLDAVLGTWGT"
FT   gene            complement(368022..368513)
FT                   /locus_tag="Bcav_0343"
FT   CDS_pept        complement(368022..368513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0343"
FT                   /product="Activator of Hsp90 ATPase 1 family protein"
FT                   /note="PFAM: Activator of Hsp90 ATPase homolog 1-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78607"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWE9"
FT                   /protein_id="ACQ78607.1"
FT                   /translation="MSITGTVTTSRSGRDLTLHRTFRAPIDDVWAAVTESERLDRWIGR
FT                   YDGAASAGATVRFTMTAEDGDPEGDIRILACDAPRHLAVEMVDEHGTWNIELGLVESGG
FT                   VTTLTFVQHLTPEVDVSSVGPGWEFYLDALVAAETGGETPSFDSYFPAMQEPYRRAAGV
FT                   "
FT   gene            complement(368510..368866)
FT                   /locus_tag="Bcav_0344"
FT   CDS_pept        complement(368510..368866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0344"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: Bacterial regulatory protein, arsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78608"
FT                   /db_xref="GOA:C5BWF0"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWF0"
FT                   /protein_id="ACQ78608.1"
FT                   /translation="MDVDVLAALDDPVRREILRLLRDGDLAAGSIAARFPVSRPAISRH
FT                   LRVLREAGLVRARPEGRRQVYRLDPAPLAELERWLAELRSGPWPARLDALETEVYRTRR
FT                   ERRTTQPDTEEHTA"
FT   gene            369136..370113
FT                   /locus_tag="Bcav_0345"
FT   CDS_pept        369136..370113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0345"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78609"
FT                   /db_xref="GOA:C5BWF1"
FT                   /db_xref="InterPro:IPR021315"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWF1"
FT                   /protein_id="ACQ78609.1"
FT                   /translation="MTPELLGQLAVLALIDSTSFGTLLIPIWLMLAPGRLRAGRVLVFL
FT                   GTVGTFYFVLGLALLAGATALYGRLGGWLESPTAGYLQLALGVGLFVASFYIGRKKKGD
FT                   DAADPTAKPGRLSRWRARAMGADAAVVGGAGAVSGSGAAPNATAGSGGAAGSTAGSPGA
FT                   MSSTTGSGGAAGAYAAPASTVPTGAYAAPAPTGALTTDRRAARSSLLALMGLALGAALI
FT                   ESASMIPYLTAIGLMTGADLQTPTAVGVLALYCAVMLLPALVILGARILAAGLVRRPLE
FT                   KLEGWMTRSAAETTAWIVGILGFLIARDALMRTGILEQFGVVVS"
FT   gene            complement(370239..371576)
FT                   /locus_tag="Bcav_0346"
FT   CDS_pept        complement(370239..371576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0346"
FT                   /product="Glutamate dehydrogenase (NADP(+))"
FT                   /EC_number="1.4.1.4"
FT                   /note="PFAM: Glu/Leu/Phe/Val dehydrogenase, dimerisation
FT                   domain; Glutamate/Leucine/Phenylalanine/Valine
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78610"
FT                   /db_xref="GOA:C5BWF2"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWF2"
FT                   /protein_id="ACQ78610.1"
FT                   /translation="MDAGLKQIFDDVLRRNPGEAEFHQAVREVFDSLGPVLAKHPRYVD
FT                   AGVLERLCEPERQIIFRVPWVDDAGAVHINRGFRVEFNSALGPFKGGLRFHPSVYLGTV
FT                   KFLGFEQVFKNSLTGMPLGGAKGGSDFDPRGRTDAEVMRFCQSFMTELYRHIGEYTDVP
FT                   AGDIGVGGREIGYLFGQYKRITNRYESGVLTGKGISWGGSLVRTEATGYGTVLFAERML
FT                   ATRGRSFDGARVAVSGSGNVAVHAITKAQSLGAQVVAFSDSSGFVVDPSGVDVELLRRI
FT                   KEVDRGRVADYADARPDARFVSDGRIWDVPVDVALPCATQNELTGADAARLVANGVVAV
FT                   AEGANMPTTPDAVAAFAAAGVLFAPGKAANAGGVATSALEMQQNASRDAWTFDYTEERL
FT                   AAIMAAIHDRCLDTAEEYGAPGSYVLGANIAGFTKVADAMIALGVV"
FT   gene            complement(372129..374012)
FT                   /locus_tag="Bcav_0347"
FT   CDS_pept        complement(372129..374012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0347"
FT                   /product="HNH endonuclease"
FT                   /note="PFAM: HNH endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78611"
FT                   /db_xref="GOA:C5BWF3"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR003870"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWF3"
FT                   /protein_id="ACQ78611.1"
FT                   /translation="MTATLKTQMRSVTAAVGAGSGGWREDEALDVAAVIEDFARAVRHL
FT                   QLVAAHAVADVHDRGRDPGAGATRLGDADDGHPLSFGKRAHLGLVDGDGGAMTNGSLRS
FT                   NGGLTSSGRTTRDDTAATEDTSDGGLMERGSAATSAGQGAAAPQAAAGATAGRRGRAAR
FT                   NRSPYRSAADALRVRLRLSGYEARRRVATARDVLPGVAISGAELPAAFPRVGALIADGE
FT                   GDRDAVGHILRGLHQVDEAIRRRRSIGVTVANHDEDGGGGEEGVDGDGGATASERARAE
FT                   AVEQLTGAEEILVTAAREVDADSVRRLAERIVHLVDQDGPEPMVPDLAAAGVWEMGRRH
FT                   GLHHLRVLVDDVGRELLDTVFATATNPRTFEDTTCENARTDTDTGSTAADEPQSGTAGT
FT                   GTRPGGDSPNAAAGSDAGMTATAATTAAPPERRSVARLRLDALLAACGAALRVRALPKT
FT                   GGLPTQVMVTVSLDELRSGLGSAHLPYTGPIRARDVRQLACDADIIPIVLGTRGQVLDV
FT                   GRAHRLFPPHQRRALIARDGGCAYPGCHIPAPWCEGHHVVEWWRGGGTSINDGVLLCAY
FT                   HHHLIHAGRSRVTTASGVPQFHEPNSSPSRGAGRRPVRNTYHRPPLPPRRQ"
FT   gene            374576..375046
FT                   /locus_tag="Bcav_0348"
FT   CDS_pept        374576..375046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0348"
FT                   /product="GCN5-related protein N-acetyltransferase"
FT                   /note="PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78612"
FT                   /db_xref="GOA:C5BWF4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWF4"
FT                   /protein_id="ACQ78612.1"
FT                   /translation="MSHLRLHEVTDQNLRALTDFQLKPGQERFVAPVVLSIAEAYVTPT
FT                   AWPRAILEQDKIVGFVMANFDPDNEIEAFRCGIWRLNIAAHAQGRGVGRFAVEEVASEA
FT                   RKRGQDRMTVLWAEGEGGPESFYLRCGFEPTGERIFDQTLGVRTTAASAPRT"
FT   gene            complement(375371..376417)
FT                   /locus_tag="Bcav_0349"
FT   CDS_pept        complement(375371..376417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0349"
FT                   /product="putative AfsR-like transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78613"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWF5"
FT                   /protein_id="ACQ78613.1"
FT                   /translation="MRDAPTIGTDERTAAVSAAAAASSTADVVDAVERTLERAAAVVPA
FT                   AATRARLALAALLDGVARSTWPEIAGRFSRLTTSGAPVELAWTGRDASLRWTAEVAPPE
FT                   TPTAQRLTLAGTWAGVDTQSLAQAQHGRPLRYGAWLAGRHAEDGRDGAKVYAEVPDGAR
FT                   LPDPAAHPVFRSWGLTWRMAGVADDGTTEWYARAERAEEVDLLAFERSTLGSDGLLRAR
FT                   VRELLRSEALPRPCGLSVAFAPGPGGSPSPGESPSPGESPSPGGRTVPVAITWFAPAGA
FT                   VFADDDDAVRRLSATTDDAAARALLAALLGAERATTTTAAARRRIVPIGVGVGFDGSSW
FT                   AQAGLLPS"
FT   gene            complement(376414..379404)
FT                   /locus_tag="Bcav_0350"
FT   CDS_pept        complement(376414..379404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78614"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWF6"
FT                   /protein_id="ACQ78614.1"
FT                   /translation="MLSLSQPITVDDMTVYRDHADPNRFWYLPPHVAIGETADGSRPAF
FT                   QFMAFKPAEAGTGLEGGGFVMFESVLTLAPNAESRIRARVASEPGVTATPILAQPPFDG
FT                   GTVQCIALDLQGSGGTEAPDGGPGTFRAVESILGATVPSMDHRNVAAFSLKLTQAGATI
FT                   VREAMTDGMAPIGVVYTMNYLAMRPALDVEITADFERIFNHFSASIEAQYKFVKAGIDA
FT                   AFESLVQEGAITIKVVNFTGEADEVEQEKWALEFFKNDLLAKWFEPTLVPGQLATSGAS
FT                   ATIPTPPATPPATPPATPPAGGTPPAGGTPPAGGTPPAGGTPPAGGTTAPVLQRATLTT
FT                   TASSPNPLPAGLAVTHQPSATGTSETVTVTGAGAKVTVDGKAVTPGAGGAVVIDVAAAS
FT                   SHPITVEWPGTATEQVFGLFFDFDKPARNGWAVQPPSTEFRSYVSNSTTDPRYQDASGT
FT                   LRIEGDGAWTGPERGADRLRAWILALPGTKSVRLSAHASHEHSPAVSDDTQRTRYNQQL
FT                   SERRLAVAHAVVTSAGGTIAAEAARGDTPASTRPGTHSPMGGDPDNRVVHVTAQVPGAA
FT                   RTWSGTIARAASTGGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGGG
FT                   AKPLELPTAVAFKLKFVRQEERKKLTVKYQRAEAVRRVFAPQGFLGLLIKDLAGDDVLF
FT                   KEIDLDDPFFREMTITASTATDFAPIGLSRAHIAIDYGDPAVPADHKHHELTFTPQDAA
FT                   PKTATFFLNSTRDLDYDATIRFDFAPQAGWEADAAHYEVVEADTVKRDLVLNPFEHVEF
FT                   REIRFEPGVVDWETVASLDIRLEAHGYADPEPRGLLTLTKDSGPQTFRIRGALPGPDGR
FT                   GVTFTVTQNLTDGTSETAPPAEAVDDVVVVHDLLESALEVVFVPQFDAAAVATVFIDLE
FT                   YRDDANSYVREVRREIPGTQVEPVRIRIALRDGDLRTYRHRFTFSGPGLFDQRAFVEST
FT                   EILVPIR"
FT   gene            complement(379433..381712)
FT                   /locus_tag="Bcav_0351"
FT   CDS_pept        complement(379433..381712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0351"
FT                   /product="hypothetical protein"
FT                   /note="TIGRFAM: glutamate--cysteine
FT                   ligase/gamma-glutamylcysteine synthetase, Streptococcus
FT                   agalactiae type"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78615"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWF7"
FT                   /protein_id="ACQ78615.1"
FT                   /translation="MLLLDSRSQVIDDISVFPDHADPLQWYYLPTAPHITTVRDEGSGT
FT                   DVPSVLLFAYTGVEGSGGFLNLDCNLGVATDRLDGIAREIQRTAGLDDVPRVVPVPLVG
FT                   GTVRMQMLDGESDRPTEVIEGHPRFVLSIDNDTAPALYGVNQAAFSVHLDKAGFTAVEA
FT                   CLDGAILPIVVAYSLEFLGLRPAYNVTLSIDWDRVQKHLDETFGASVMFFSTEISTAVD
FT                   ELVESRAIVFSADTFVPEGEEHEGILERRDLAVAQVRQMITDAFFTPSIPPWTPEKTPD
FT                   WERALNVIGGLAAKGASAAAGGPATTAATFSYKKTDYTRIDRKKLDVNFSERVTIQRTI
FT                   HPQGHLGQLLSLIAASGLPRETFVKRIPLDDPWFERRRLTATYQPGLAVDEIASINVRA
FT                   TYGGLTKNAFLTPGAWSTEFDWANQLDPAGALVTGVDVTYDVLLKNADTTERPGQLTSP
FT                   VETVHENAIPITPEVDLFTFKPIPLRAENVPWTTYSSVEVELRYTDEANAISQRDTVRL
FT                   TADALESTWMMFQLDRSRRAFDVRLVYRALDHRDVELDWRTVDEEGVTVRDPFPSKRVL
FT                   EVVPPVVWTELAAAFVDLRYVDADAGLVLEDSFTFQQGAAPQKFSVDLRDPTKRDVFYT
FT                   VTFQYADGRTVTLPESVTAERRIVLAPEMKGRRAVRVHRPRDFLDRKMRKVTVELRFED
FT                   LLAGLSFADTVILDAATAEAAFEYDYVDAARDSYEYRSTFLFENGLSRVVEWQPASALD
FT                   LVVTTP"
FT   gene            complement(381742..383925)
FT                   /locus_tag="Bcav_0352"
FT   CDS_pept        complement(381742..383925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0352"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78616"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWF8"
FT                   /protein_id="ACQ78616.1"
FT                   /translation="MLEVDDIRLVDGYTVHGDDTSDSTFYIFPNGPAFARTPDGGLQLR
FT                   FIEYEQLRLEGEDTFGGFVVFSADLAIPAETEAAIKAKLQEEVTRKYAGREAPQVTLAP
FT                   INWAKGSVTLLLEDGGALVEKKHGAAIPSLYNTNVACFALELTDIGTAVFKNTLSTGAN
FT                   SAITVIYNLEYFGRLPKMHAWGEWHAEKFYSFFQSVDYEENTWSEDSYTEVVESSRYNS
FT                   EVQTIGGDFVDNPNLTAEENAKIQSEIRTAIQSMLAEQVERNLLTAAAEVDPNVKSLYD
FT                   EQDFENIQRTISSTQIANVRVDLTESKATLISKHPQGQLPSITTLKDAEGNALKWEDYY
FT                   TKISADEFFKDKRVNVRVNAPFENLPIHTVAVSMTYPFGPQPKTDSETFTSADDVWEFE
FT                   SLVHDGKRDVTYTYTVNYENSAFSFTSEEFTESGDEVVINVDDLGVLSVDIAADGIDFA
FT                   RVPRTSVELRYDGATPVVKTLNLTAEAPNAQVREVIKEARTTPVTYKVTYSLDDGRDVT
FT                   GTPGTIDVGQTTLSVRDPFGAPRTITFRALGDLANEIASVTIDATYTDPGNDYTQKKTA
FT                   VLSADMPFLEWAFPVFDDTAGSVTYSGFISRKDGTTEPFGPTTTTDSIIAVGEIVADKL
FT                   DVTIMTNLVDWTKVKVVLVALAYLDETNAVRERKDFTFDAPAATPPVWTIPLKDPAKTD
FT                   FTSTITFFLMDGTRKVVGPTTETGTTIFPELPA"
FT   gene            complement(383937..384674)
FT                   /locus_tag="Bcav_0353"
FT   CDS_pept        complement(383937..384674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0353"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78617"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWF9"
FT                   /protein_id="ACQ78617.1"
FT                   /translation="MTGWAAGARPPGVPGAPVPQLTAHGLHARRVGPTEWTYRPDAVGV
FT                   ARDARGRPSVTLIAAGDDAFLNLTTLLPADDDAVAALAKELARREGVPPAELTLRPARL
FT                   DVAPAELLVGDGDGGWICLARRVTSGVPPYSAAFAVPLSPARVAAVRAALDGTSGQLAA
FT                   RYTLTEAPAPTREATTSSSSSFSSTTTTTTTTSSRGDASPEGGTTHERVATERHDTHVA
FT                   PPGPPSEPGPIVLLTDAAAWRTT"
FT   gene            complement(384671..386437)
FT                   /locus_tag="Bcav_0354"
FT   CDS_pept        complement(384671..386437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0354"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78618"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWG0"
FT                   /protein_id="ACQ78618.1"
FT                   /translation="MPADALPDWDAPFAVAGRTAFAAHERPGLAFAPPLRLEAAPEGDT
FT                   PAVTLDVVAQDRSPGLVTTGFLQLRLETRFDLPETRLALFGQDEAMRVEPLPAAGGLLR
FT                   LVAPDLAGTDELPDLPLDGAGVAGLTASVSLDGVAADLVVEALHRGIALVEARALVTVR
FT                   GAAARWPGVADVDVARLRAGLGGDPVRVRDLLEALVRAPAALGVVVSGAAAEDDAGRAR
FT                   LAAALADRVTAELGSGILDDDGEACVLLAAEAPDHMHWELDDVVVAPRHLALATDPWGP
FT                   LRAMTAEEVGARVVRRHVAPALDSGHRTLGIASVIRPPWAGAVALAADVTVPPRPPERP
FT                   ATVRETVVLDPAAPFTTLALRLAPGEPLAARVRTITYLDSPVPELPGPELDVTSETVVL
FT                   GPDAFGAAFLPVEIDDALRAQAVAVDVVHEAEVNGLMQRTRVTLDAGTPRATLVVAPDT
FT                   GSATLHAEARDAVGRVASTPPLESGPTRFDPFSFGGAGRHEVTIDVSPDGPFAGGSADG
FT                   VLRLELTPEAGGPVGAVALTADRPRAVWSYLALSPFTPGYRWRRAGESDFSEPLGPDTP
FT                   LRVPAPVPGGTP"
FT   gene            complement(386439..388760)
FT                   /locus_tag="Bcav_0355"
FT   CDS_pept        complement(386439..388760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0355"
FT                   /product="hypothetical protein"
FT                   /note="TIGRFAM: glutamate--cysteine
FT                   ligase/gamma-glutamylcysteine synthetase, Streptococcus
FT                   agalactiae type"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78619"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWG1"
FT                   /protein_id="ACQ78619.1"
FT                   /translation="MPTDFSFRAGALTALSPRLLGSRHVLLDPDRIVAPATFPRSASAH
FT                   PIAPDTLVLDTMLLSSPDGATSYYIPRYRLRSAGDRYDIHVEPGPTGRFVLRLVLDAFP
FT                   APELGDAARTAVVLPGTLTAWLTYGSPILAEVVASATSEVEGGLAVEFSLTLAERDAVL
FT                   WAFRSEQGARLTVTRAAPLAVPAGSAPVRLVPLEWVAEAAVPQLRMSILEPVEGPVVEP
FT                   VEVPVIERVEPDPIPVLEPDPDPIIETFGADVAGSARLVVGSRLTGLMAVAADEPTAGF
FT                   ALAARGRLVGLDRAVVRDHRTGPIVRDHRTPRIPRIPRIPVDVPEPSPTVPEPPVVVPP
FT                   AEQQYSSATPSLQCTVDLRFDPAVHPYVYPGTGSGGSAPSYERLLLEHDGRRHPYLREV
FT                   AVPHVFYHLPDAFRLARTTTAPLRPALAFRVDQGAEESEASVTLTCQITPVTELSRLAA
FT                   AAEALAANVPERDGVRPAVELRPLRASATLTLGLPEGTDDADAQGESVDVVNGFLFAES
FT                   FPFAEFQDVYAALAAVGDVSTVLRGTVSVATGLAAEDLIPVDLRFATTVGDVLASAVTV
FT                   DAEGTADVALRNASESPVRISSLTASVSRGTAVVAGEIAGLHLPVELAPDGEISCTVTP
FT                   SAQLGGEGDIEVGFDTSGVEALPDPAAILALTLDRRIAQSVNREVTVLTTAAKLAADTA
FT                   RPVETVIVELDGGPAPVVVDAATPSAKGKVPVPLVDVLLGRDGGGEFRYRQTLVTASGE
FT                   TVEDADWRTTDRSLLVVPVT"
FT   gene            complement(388772..393646)
FT                   /locus_tag="Bcav_0356"
FT   CDS_pept        complement(388772..393646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0356"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78620"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWG2"
FT                   /protein_id="ACQ78620.1"
FT                   /translation="MTTTRILTTALPVTLAAGAPAHLSVFVTHRLTPQAVGSTLADFPA
FT                   AADWVTTLAGLRVEILASHLADPLPATIVSDPDAAAWRAVFPPGLRVDGFPEPQVSAAE
FT                   WNSYPAHRLADHAVDLQLTSALAAPTARPGVMDSPPAAAVIDQLVQVHPAVRNLLALAE
FT                   QKSVRSRRLLERRLLEARASLGTLGSREGYPSETDERTPSAIEVLLDERGAVDEKKLNA
FT                   YLDGLLDDDLSSQPVLQLMADAHATRRYYDRPEEQTPYQREPTPGATTPRPEEPDPDFH
FT                   ARAAGLGSTPALLRRLGLVLDVTLSDADRAALEGASWIAARLVPADDDGEAPDVVSLAP
FT                   PRLRVIVGGDVVAAISSDAWVAGAVPLGEEEYVVLDLDPDASGLKLDQHLRNLPRSLAS
FT                   EVNGDEASAAPATLRATGFGIARTDRVAATRERVQAAEQLTSPDDGPGVSGPELIYDDV
FT                   VRGLRLEVWDDASEDWHSVHERLVDVTATGDDDVPVDVLTGTADTGFLQLSGLNRVPGN
FT                   DANPYYLHEVVAGWDGWSLAAPRPGKVIVHGPGGEEQVVDDPRDAHGDAAVSGVHIRST
FT                   VAPGTLPRLRYGTSYAFRLVGVDLAGNSVVRTPRPRRPDLAATRTHLDGLRASYARRDG
FT                   GGLVSVIRDDVLASLPRDADDDAAWLGGVTPGDDGGARRSRTGRRGRRGATGGASSARP
FT                   YTLPRAVRTGEPRIDAFVAQRVADAVRGADPASRAAGGAGGAAGLPPGVAPTVAGLHRS
FT                   VAAASRRIAEHAEVWRTRPQLGIDPEALAGLGDVLRRPGLPIPGRPLPRPRPVVTTPRP
FT                   YLRWEPVGAPALVARAPLTTGEQLSRLVVRTGLPPSSPDAAATSERHVVPPKTHQLEAE
FT                   TSSAFDAAIGSTDPAVQRAAYGWALVERGTLTDRFVPDPANPGAELEQPDIALHARPDA
FT                   DPDTAVTLADLEGAGRGTPLGEGQYVVHDVDELRLPYLPDVFAAGVALVFYDAGDPHLL
FT                   PDARVLQAVVIPFPGTWPTVEPLRLVLAGGGELGARLEGRAIHVSLPPGEQVRVAVSSS
FT                   LRTDDLEKLGLWRSHPVSGIDRSSAEPAVLAAADLLRQAAVSGWTWWLTPSVDVRLVHA
FT                   IPTPARPPELRVLRCGARTPGITVAPLVGLVDVHGASTDRLLVKARWTEQVDDVAIAAP
FT                   AEVARDDVVVNSPVGGAERLGVLSTVDWAPDPADDELGPLAAAGVQLHRAIHTFTDTHH
FT                   RRVTYTPTGTTRYREFFAAADVPADDDPALAGESVELVIPSTARPAAAHLAGAVPLLRW
FT                   ETTTEPDQPFALRRVRRSGVRIWLRRPWFSSGDGELLGVLLGTEKNPSGVVSAWGRDPV
FT                   LAGAQVPGMSRPPLLTGEQLLLAAYGSSPGGPDVARPLTVAPAVPLPGEDAGPAVTVCG
FT                   YVPVFHPGRGQWYVDVALDATSTLWPFVRLAVARYQPHSIARCELSAVDLVEWIQPLPT
FT                   RTATVSRPDADRVRLTLTGVIALLRGLERGDDDEREEPEESVSAIDALVRRTRTVRLTL
FT                   QARATGGTDLQWVDVASRRLPLVGIGDETNFLATWSGELALPAPDERPDGVPFDVALRT
FT                   PGASEHWRVLVEEHELLDADAPDSPNVRGATTRVTRLVYADTIAL"
FT   gene            complement(393664..397290)
FT                   /locus_tag="Bcav_0357"
FT   CDS_pept        complement(393664..397290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0357"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78621"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWG3"
FT                   /protein_id="ACQ78621.1"
FT                   /translation="MPPPRRTPRAPEARLLRARDLLDVRISAPGCTLTETADGPVLTAG
FT                   RDASLVLHLPPQHVTERTLPEPVGNPPPPFPKEPALVGHRAAAASRIVFALDDGASVPF
FT                   TIAGVLTAMRTLALRLAPDARRPAPVRPGRPLRGIDPAPGWERLLTPRGRLRRGVSPAD
FT                   LVRATGDAALEAARLARPAAHVLQRAQTLRSVQAARAAAGLAAGPVRLGDLLPRAPRPR
FT                   PIPRPSPRPRAPKEDETAIEAPYRVTLSPGEDGAFTHDAEPLVALEDPERAELWRTHLT
FT                   TRLTDDDGAFVGLDETAERPVRAIWSRDLDPIDRPATTDPHQIQPTSLAPADRRALVRQ
FT                   TTSRTMPKPATPIDARALALSTLGAWLDLAGDWASTDVFDPNDPIEDGVELLAQYRHQA
FT                   TMGRDWYVRVARPGFLFWPGHRCLWVTLSERKIAHLDDPVAALWQRTFIVIKQRERTYS
FT                   DADDPYRWIAIDPEVTPNLDPAPSPVDDPIVPSRAGEPFLFTLTGIDAGGRPSTLRAPL
FT                   VFVPDLALQKPNVQALAEAAYAPIGTIPAGGQQITFASSAVSGDTRFEVNTLRFTGTID
FT                   VDARTSRPSLVTTNAVVPAMRHLAPQAPGVDLAYAQPYLDAAAAAPAGDPDRGFGAGNP
FT                   GQVFLSVTGAPPAVDFSGGSDRSGGFLAPSLAVRGLSRSLGAVGDDGTAPAGLSQGEFD
FT                   PGTFLAGAMPKLFGLFDLVELLEKLGLGGAPEFVTETLDAVSTLVSEASRLRAAAADAG
FT                   PRLAAEVAGAAHDGARAGVEAARAQLEAVLNPLLVDLDALVDAVENLSAATITDVTDAL
FT                   ASIVGRLGPLDDALKAPQIPAALRAALQRPVGALAALGADVALVTKALSDFLDGLLSPD
FT                   GAVVARLEWKPKIRSWPTTGSPVFRADDPQGLRLAVEVRGSATSPPSVDVVAELTTFAL
FT                   QLLPNAELMAMTFRRVGFRASSGAKPEIDVVFGGMEFLGPLSFVETLRQLIPFDGFADP
FT                   PFVDVSPEGVTAGFDLALPNVSVGVFSLENLSLGADARVPFLGDAVTVGFHFCRKDSPF
FT                   RLTVMCIGGGGWLELRASPKGLVVLELGLEATACLSIDLGVASGSVSIAVGVYLRLEGE
FT                   KGLLTAYFRIRGEVDVLGLISASITLELSLTYHFETGKLIGRASLVVEVEVLFFSASVE
FT                   ITCERKLAGSKGDPTLADVMPPDPVTGENADWSRYCAAFAAV"
FT   gene            397544..398410
FT                   /locus_tag="Bcav_0358"
FT   CDS_pept        397544..398410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0358"
FT                   /product="Activator of Hsp90 ATPase 1 family protein"
FT                   /note="PFAM: Activator of Hsp90 ATPase homolog 1-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78622"
FT                   /db_xref="GOA:C5BWG4"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWG4"
FT                   /protein_id="ACQ78622.1"
FT                   /translation="MATDREFDGTIRALSDAHRRALLDALRERDGQTVSELERVLPDLG
FT                   RHAVLKHLRVLEGAAVVTTQKVGRTRIVRLNPTPIVELATRWLDDYAALAGLTLHRLRR
FT                   HLETDHTDQTDQTDQTDQTGPPVPGTHDHQGVTMPTTDTRTLVASVVIEATPDRVWRAL
FT                   TDPDETRRWYFGGIVRSDWRVGSAVEWVDADGASLIAGEITALEPGRRLAHTFRATWSP
FT                   ETAADPASDYEWLLEPLGDGLTRVTVTHTNVPPGTPTAEQVDGGASLVISALKTFVETG
FT                   RTMPGMG"
FT   gene            complement(398432..399124)
FT                   /locus_tag="Bcav_0359"
FT   CDS_pept        complement(398432..399124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0359"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78623"
FT                   /db_xref="GOA:C5BWG5"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWG5"
FT                   /protein_id="ACQ78623.1"
FT                   /translation="MTASGAVEEYLAQVSAQLPRGRRARDVCDELRDGLTEAIEICPSL
FT                   VPQDAAALLVREFGTPQEVGSALAAEIRLRLARRNSAYVLGVLLASWAGWLVFDSTVGV
FT                   PETSVPTGWAGAVFLAGIDVLRAAAIVAQVGAALGIVATSFPMRRLAPTTVPTWLTRLT
FT                   LTALSIFGLAVLVALASMAPGHHLLGALVAVPVCAMTVTAVALSRRAARHLAVGANGFV
FT                   ADGHARTA"
FT   gene            complement(399121..399444)
FT                   /locus_tag="Bcav_0360"
FT   CDS_pept        complement(399121..399444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0360"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /note="PFAM: Transcriptional regulator PadR-like family;
FT                   TIGRFAM: transcriptional regulator, Acidobacterial,
FT                   PadR-family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78624"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWG6"
FT                   /protein_id="ACQ78624.1"
FT                   /translation="MNAEMLKGHLDLLLLAVLEPGPRHGYGVVEALRARSDRALDLPSG
FT                   TVYPALHRLERTGLISGEWTIHNGRRRRVYALTAAGEARLVARRSDWRGFADVVERVIS
FT                   VPS"
FT   gene            399494..400426
FT                   /locus_tag="Bcav_0361"
FT   CDS_pept        399494..400426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0361"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78625"
FT                   /db_xref="GOA:C5BWG7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWG7"
FT                   /protein_id="ACQ78625.1"
FT                   /translation="MLLIVETEDDVGLTTDGLTKRYGDRIAVDDLTMEVPARRVTGFVG
FT                   PNGAGKTTTIRMLLGLVRPTAGSAQILGHPLAEPAAYLRRVGSLVDGPAFYPHLTGRDN
FT                   LRVLGRLAGRTSRIERVLDVTGLSRRAGDPVAAYSLGMRQRLAIAAALLPSPDLVILDE
FT                   PANGLDPSGIREIRRLLRDLADDGTTVLVSSHQLAELEQVCDHVVLLHEGRLRFQGALT
FT                   DLLLRHHARVLARPEDPAQLDALARIAGDDGWQLQVDQGVLAGDSPRRSPAELNRLAHA
FT                   HGITLAELSSRPPTLEEIFFVLTQGGAER"
FT   gene            400423..401208
FT                   /locus_tag="Bcav_0362"
FT   CDS_pept        400423..401208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0362"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78626"
FT                   /db_xref="GOA:C5BWG8"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWG8"
FT                   /protein_id="ACQ78626.1"
FT                   /translation="MSAAFGSEVVKLRQRTYWFALAAMLAFMAIAMVISVGDPGEVASD
FT                   RGPAGLVLARQDLEAADGLARSLGNAVTFVGVVALAIVALNVGGEYGHGTIRNLLVRQP
FT                   NRARLLLGKSAALLTFSAAAAVLVALVGIGVAQILARDLDTAAWWSAQGRAASAAGVLA
FT                   FAVATCGWAALGILFGFVLRSAPAAIGVGIGYALPVEILFGTMFPVAARWLPAQTFQAL
FT                   ARGGTPDVDVALAAAGSVAWAVVAVLVALVVFRRRDVEA"
FT   gene            401400..402107
FT                   /locus_tag="Bcav_0363"
FT   CDS_pept        401400..402107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0363"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: Bacterial regulatory proteins, luxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78627"
FT                   /db_xref="GOA:C5BWG9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWG9"
FT                   /protein_id="ACQ78627.1"
FT                   /translation="MHICVIGVSPLVRHGLALQLRARGIAVHAELASAHELDVRARFDA
FT                   ALVVASAQELPALPAALSGLLDGGTAVLVLTDSPGGWVTTAGRAGSALRSVRPVGRAPR
FT                   LARAVARRGRLDVMALDDALDTDVLLGWLSSATARGEGPRRVASAVVVGRPTPFPPPGP
FT                   RVRRALTAAESAVLALVGQGYSNAGIASALSLSPKTVECYVSAVFGKLGLFAEDRERNR
FT                   RVAAALEWLQSTG"
FT   gene            402307..407040
FT                   /locus_tag="Bcav_0364"
FT   CDS_pept        402307..407040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0364"
FT                   /product="5'-Nucleotidase domain protein"
FT                   /note="PFAM: Endonuclease/Exonuclease/phosphatase family;
FT                   5'-nucleotidase, C-terminal domain; Calcineurin-like
FT                   phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78628"
FT                   /db_xref="GOA:C5BWH0"
FT                   /db_xref="InterPro:IPR001322"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036415"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWH0"
FT                   /protein_id="ACQ78628.1"
FT                   /translation="MGSAVRTRVTGGIGALALAVVGIGAAPLAAQAAVSPDAPVVVAEV
FT                   YGGGGNSGAVYSHDFIELANTSDAVVDLAGWSVQYASAAGTNWSGVIPLAGSIEPGARY
FT                   LVQAGTNNAGVGQPLPAPDATGSANLSATNGNIALVSAGGALQCDAAACAADAAVVDLV
FT                   GFGTGAAFAGTGPAPSPSNSTSIARDADLTNTAANAADFTVGAPTPDAAGGGDPDPDPV
FT                   TATIAEIQGDGAASPLVGSTVVTRGVVTAAYPTGGFDGYVIQTPGTGGVLDLATHTTSQ
FT                   AVFVYSAATVGQVAIGDHVEVTGVVSEFFGLTEITVGADGLSVLSEPADDVAPAQLAGW
FT                   PADGAQRESLESMLYLPEGAFTVSDTYNTNRWGEVTLAAGEEPLRQPTDVARPGSPEAA
FT                   AVVADNAAREVRLDDGATTDFLEPANSGLTPPYISLTDPVRVGAAATFGAAVVVDFRND
FT                   VWKLNPVAHVTPADPGAYPATFANTRTDAPDAAAIGDTGDDAVRLASFNVLNYFTTLGT
FT                   DGATCVPYTDRAGDGVTVEEGCDQRGAWDAEDFQRQQDKIVAAINGLDADVVGLMEIEN
FT                   SAALGETADEALGALVAALNAAAGADVWAFVPSSAELPPVELQDVITNAIIYRPGAVTP
FT                   VGEPRALGTQSAEGQPFANAREPIGQVFAPAGGGEDVFVVVNHFKSKGSPGPLPGDEDS
FT                   GDGQGASNASRVAQATALRDWVGQVAAADDAVALLGDFNSYGQEDPLHVLYDAGYTDVE
FT                   AHFDVDGSSYSFGRQSGSLDHVLLNAPALARATGADIWEINSGEAVALEYSRHNYHGTL
FT                   FYDATAYRSSDHDPVLVGLAAGDSEPTGPVDLTLLNINDFHGRIDGNTVAFAGTVEEQR
FT                   AAAEAAGGSAVFLSAGDNIGASLFASSVQQDQPTIDVLNALELAASAVGNHEFDAGYAD
FT                   LVDRVIAGGSNAQWGYLGANVYEAGTTTPALDEYRLVESGGVTVGVIGAVTEETPTLVR
FT                   PGGISTLEFGNPVEAVNRVAAQLTDGDEANGEADVIVAEYHEGAGAGTPDGSTLEEEVA
FT                   AGGAFAQIVNETSPLVDAIFTGHTHKQYAWDAPIPGSTETRPIVQTGSYGEFIGQVVLT
FT                   YDATTDDVTAYTAENVARTATPADQLIATYPRVSEVNDIVTAALAYAEEIGEQPVGSVA
FT                   ADITTAFSGGSYVNGVYVGPGPEPTSGRDDRASESSLGGLVANALLDTLADADLGGAEI
FT                   GVVNPGGMRAELLYAPDGVVTYAEANAVLPFVNNLWTTTLTGEQVKLMLEQQWQRTDEG
FT                   EVPSRPYLQLGLSSNVTYTFDASRPEGDRITSITVNGAPLDPAAPYRIGTFSFLAEGGD
FT                   NFHVFADGADTRDSGLIDRDAWIAYLEAHPGLEPDFARQAVSVPELPETEAGAEVAFDV
FT                   TGLNLTSLGSPENTALTASFDGAELGEFAVADGAASVALTVPADATAGAHTLTLVAAPS
FT                   GTTVTVPITVSEAAPPTVGSETSLWLSQTTYRSGSWLPIIAFSHVELDDGRFPRGRVEI
FT                   REGDQVVASARVVLGVAITTLPRHLTPGTHTYTAHFVPSDPEAVSGSVSDPVTVRVR"
FT   gene            complement(407220..407750)
FT                   /locus_tag="Bcav_0365"
FT   CDS_pept        complement(407220..407750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0365"
FT                   /product="carbohydrate kinase, thermoresistant glucokinase
FT                   family"
FT                   /EC_number="2.7.1.12"
FT                   /note="PFAM: Shikimate kinase; TIGRFAM: carbohydrate
FT                   kinase, thermoresistant glucokinase family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78629"
FT                   /db_xref="GOA:C5BWH1"
FT                   /db_xref="InterPro:IPR006001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWH1"
FT                   /protein_id="ACQ78629.1"
FT                   /translation="MPAPIPPDLQHVVVMGVAGSGKTTVAQGLAAGLGWTYAEADDFHP
FT                   PANVAKMAAGTPLTDDDRAPWLQAIRDWMTEQHEAGRRTIVTCSALRRPYRDVLRQARG
FT                   AVVFVHLRGSAATIAERMERRTDHFMPPSLLPSQFATLEPLADDEAGVVIDVDDTAAEI
FT                   VARIERDLALAAR"
FT   gene            407912..408235
FT                   /locus_tag="Bcav_0366"
FT   CDS_pept        407912..408235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0366"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78630"
FT                   /db_xref="InterPro:IPR025637"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWH2"
FT                   /protein_id="ACQ78630.1"
FT                   /translation="MKIRTMGAALTAAAAAVVLAACSASANLTVSPDTVADLAEDALEE
FT                   QVGERPEIDCGDEQIDLLNDVEVACELTDPASGNTYDATVTVSDVDGTDFRVNVQVADS
FT                   PQG"
FT   gene            complement(408299..410038)
FT                   /locus_tag="Bcav_0367"
FT   CDS_pept        complement(408299..410038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0367"
FT                   /product="thiamine pyrophosphate protein TPP binding domain
FT                   protein"
FT                   /note="PFAM: Thiamine pyrophosphate enzyme, C-terminal TPP
FT                   binding domain; Thiamine pyrophosphate enzyme, N-terminal
FT                   TPP binding domain; Thiamine pyrophosphate enzyme, central
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78631"
FT                   /db_xref="GOA:C5BWH3"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWH3"
FT                   /protein_id="ACQ78631.1"
FT                   /translation="MARTVAEQLVENIVAAGVTRVYGIVGDSLNPIVDAIRRTKGIDWV
FT                   HVRHEEVAAFAAAGEAEVTGALAVCAGSCGPGNLHLINGLYDANRSRVPVLAIASHIPS
FT                   NQIGTGFFQETHPDRLFIECSVYSEMISSGTQAPRVISSAIHHALAGPGVAVLTIPGDV
FT                   AEEEVPTSATPIVCRPVPPSVVPDQADVQTLADAINRAQKVTFFVGAGARGAHDEIIAL
FT                   ADAAAAPVGHSLRGKEVIQYDNPFDVGMSGLLGYGSCFEAMHDADLLVLIGTDFPYDQF
FT                   LPDDVPTAQIDINPANLGRRTRLDYAVVGDARETAAALLPLVTRKKKRAFLDKMLAKQD
FT                   KLMSSVVGAYTRKVERTTPIHPEYAAVQLDEVAGPDAVFTVDTGMTNVWAARYITPNGR
FT                   RRVIGSFIHGSMANAMPHAIGAAFADPTRQVIAMAGDGGLSMLLGDLITIRTYHLPVKV
FT                   VVFNNSTLGMVKLEMLVEGLPAWATDSPPVDYAAVATALGIPAVRVEHPKDLRKALTGA
FT                   LHRRGPALVDMVTDPNALSIPPSITAKQVKGFATAMTKEVLGGGLGEVMAMARSNLRNI
FT                   PRP"
FT   gene            complement(410326..410697)
FT                   /locus_tag="Bcav_0368"
FT   CDS_pept        complement(410326..410697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0368"
FT                   /product="thioredoxin"
FT                   /note="PFAM: Thioredoxin; TIGRFAM: thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78632"
FT                   /db_xref="GOA:C5BWH4"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWH4"
FT                   /protein_id="ACQ78632.1"
FT                   /translation="MATRELTGETFESAVTDNDIVLVDFWATWCPPCKQFAPTYESASE
FT                   QHTDIVFGKVDTDAEQDLSMQFGIRSIPTLMAFREQVLVFSQPGALPPAALEQVITAVK
FT                   ELDMDDVRAKIAEQETAQA"
FT   gene            complement(410825..411847)
FT                   /locus_tag="Bcav_0369"
FT   CDS_pept        complement(410825..411847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0369"
FT                   /product="ATPase BadF/BadG/BcrA/BcrD type"
FT                   /note="PFAM: BadF/BadG/BcrA/BcrD ATPase family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78633"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWH5"
FT                   /protein_id="ACQ78633.1"
FT                   /translation="MRLLLGVDVGGTSVSALAVMALPGAPATISVGRGPGANINSGGGA
FT                   RDVRASLHTAVAEAVRPLALDDAARQGVSAVVGASGAAAAGRDRIVAVVSDVWTELGLP
FT                   TDAGSLDVSTDLEIAFAAGSGDDADGVLLLAGTGAVAARVRSGHVVRRRDGMGWLLGDV
FT                   GSGLWLALEAVRASAAELDARGPRTALTPIVLHALGIDAGPDTGADPRQALVAAAYAGP
FT                   VAALGRLAPLVSQAADDGDAVAGAIVARAVAALVSDAVAMAAGDQDDVPCVVLAGSVLT
FT                   SVGPVSRGVRAGLGHRLPRVAVRAATAPVLGALHLAERRADVSLDPLDVERAAATVALP
FT                   "
FT   gene            complement(411855..412778)
FT                   /locus_tag="Bcav_0370"
FT   CDS_pept        complement(411855..412778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0370"
FT                   /product="glucokinase regulatory-like protein"
FT                   /note="PFAM: SIS domain; TIGRFAM: N-acetylmuramic acid
FT                   6-phosphate etherase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78634"
FT                   /db_xref="GOA:C5BWH6"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005486"
FT                   /db_xref="InterPro:IPR005488"
FT                   /db_xref="InterPro:IPR040190"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWH6"
FT                   /protein_id="ACQ78634.1"
FT                   /translation="MDEATTNGVVDLSGLATEAIDPRYGHLDELSTTDIVLAMNEAEQS
FT                   VPAAVRAVAPAIAGAIDAIAERMSRGGRLFYVGAGTPGRLGVLDASECPPTFHTDPELV
FT                   QAIIAGGPSAVFRSVEGAEDRADDGAAAIAERGVTADDSVVGITASGRTPYVLGAVEEA
FT                   GRRGALTVGLCCNPHAALSSLVAHPLEVVVGPEVLAGSTRLKAGSAQKQVLNAISTTVM
FT                   VRLGKTYGNLMVDVTASNAKLRARALRLVQRITGADQADAAAALAAADHRVPQASVMLA
FT                   RGVDAAEADRLVTAAGGRLADILHRA"
FT   gene            complement(413128..414372)
FT                   /locus_tag="Bcav_0371"
FT   CDS_pept        complement(413128..414372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0371"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: Major Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78635"
FT                   /db_xref="GOA:C5BWH7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWH7"
FT                   /protein_id="ACQ78635.1"
FT                   /translation="MMRTVPNPYAQILRKPGALQFSSAGVLARFPMSMVGIGIVLMISE
FT                   LYDSYGLAGQVSAVYVVAQALCSPQLARLVDRHGQARVMRPALAVSMIGLVGLILAATS
FT                   HAGAPLLFALAIVTGATIGSLGSLVRTRWNAVVTNPRELHTAYSLESALDEFVFVIGPV
FT                   LATILATSVSPSAGLVVAIVAALVGGYWFLSLRKTEPAPSPPDAGTPRTSVLRDGAIVS
FT                   ICIVFVCIGAIFGATDVSVVAFAEEEGQKGLAGVILGICASGSLISGLLYGARHWRSSL
FT                   WRRFAIGVVALALGVSLFFLVTSLWVLAAVMFVVGFSIAPTLVNGNALVQQIVPPARLT
FT                   EGLTWIGTSLGVGVSFGSSIAGPIIDANGARAGFLVVVASAALALAAMGTALASRRRRD
FT                   AVVPTIPDPAADPAS"
FT   gene            414645..415829
FT                   /locus_tag="Bcav_0372"
FT   CDS_pept        414645..415829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0372"
FT                   /product="bifunctional protein (secreted sugar binding
FT                   protein/sugar hydrolase)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78636"
FT                   /db_xref="GOA:C5BWH8"
FT                   /db_xref="InterPro:IPR036278"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWH8"
FT                   /protein_id="ACQ78636.1"
FT                   /translation="MRRALRSIVLFALASLMLVTTASWSSAAPSEPPPPGGAENGTRLM
FT                   EGPAFYPRTIRLAHAGADDGAIIASVVTFADGLGHGAIFRSDDDGRSFQRIGTVTDPAT
FT                   ADGLCCATLFELPQQVGELPAGTLLWSASVGQQAPDRRMTLPVWASTDQGRTWSKVSTI
FT                   ATQPNTGGLWEPEFAVARDGSLVVYVSDESQQPTHSQTLVQATSPDGVHWSELENIVAA
FT                   RDPDLRPGMPLVRQLPNTTYLMSYEICGPGQECSQRTRRSLDGVHWGPETWLGVRVRTA
FT                   DGAHFRHAPTISWYDDGTRNGRLLAVGQMLYGADGTVQPGNGRTIFTSDLLPELPWGTG
FT                   PAPLAIAEPWNNFCPNYSSSLLAMPERDELLELASGYDDVGECTTYFAVGDLPD"
FT   gene            complement(415944..417623)
FT                   /locus_tag="Bcav_0373"
FT   CDS_pept        complement(415944..417623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0373"
FT                   /product="phosphoglucomutase, alpha-D-glucose
FT                   phosphate-specific"
FT                   /note="PFAM: Phosphoglucomutase/phosphomannomutase,
FT                   C-terminal domain; Phosphoglucomutase/phosphomannomutase,
FT                   alpha/beta/alpha domain I;
FT                   Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha
FT                   domain II; Phosphoglucomutase/phosphomannomutase,
FT                   alpha/beta/alpha domain III; TIGRFAM: phosphoglucomutase,
FT                   alpha-D-glucose phosphate-specific"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78637"
FT                   /db_xref="GOA:C5BWH9"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR005852"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWH9"
FT                   /protein_id="ACQ78637.1"
FT                   /translation="MHPRAGQPAQPEDLIDVAQVVGAYYDRVPDPDDPAQQVVFGTSGH
FT                   RGSSLDGAFTETHIAAITAAIVEYRRSQGTDGPLYIGRDTHALSEPAWRTALEVLAAAE
FT                   VDVRIDARGSWTPTPAVSHSILRHNGAGSLAGVRTQGPELADGIVVTPSHNPPRDGGFK
FT                   YNPPDGGPAGSEATSWIARRANELVRSGLAAIARVPFERAVAAPTTARHDYLLTYVDDL
FT                   DAVVDLDRIREAGVRIGADPLGGASVEYWAAIAERHRLDLTVVNPEVDPRWAFMTLDWD
FT                   GKIRMDCSSPSAMASLVRTMTPDAGGKVPYDVATGNDADADRHGIVTPDGGLMNPNHYL
FT                   AVAIDYLFRSREGWPAAAGVGKTLVSSALIDRVARALSRRLVEVPVGFKWFVPGLLDGA
FT                   VAFGGEESAGASFLRTDGSVWTTDKDGILLALLAAEITAATGASPSAYHARLAEQHGES
FT                   WYARVDAPATREQKARLGALAPEDVTATELAGEPIAERLVTAPGNGAPIGGLKVTTASA
FT                   WFAARPSGTEDVYKIYAESFAGPEHLAQVQDAAREVVDAALA"
FT   gene            417705..418604
FT                   /locus_tag="Bcav_0374"
FT   CDS_pept        417705..418604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0374"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78638"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWI0"
FT                   /protein_id="ACQ78638.1"
FT                   /translation="MAKKNRRQKQRASEQAAAAASSPAKPRRAVPEFVARPFEGLTGEA
FT                   DWVAMREIVPAATAKVRTTAEYGSRDVVVATLLPMLWPALHREDGTVLVATQTTSSSGD
FT                   ASRDVAAALLQALEAEPGTAIPPGELPEPGPRLQDVLEDGPFAVELSETFDFWLSPQDE
FT                   HDHEIEESLENANDAIVPTVAVEGVDAAYWCRMNGREFLRWVVPQEEDRMLDALARLHA
FT                   DRAAGLDDDARLVGAFRTCGVLVPVWELARGTEADELTAPLQAFAGRLEAALADEEPLT
FT                   PEQRRARAGLVSRQVNLR"
FT   gene            418676..419689
FT                   /locus_tag="Bcav_0375"
FT   CDS_pept        418676..419689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0375"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: Glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78639"
FT                   /db_xref="GOA:C5BWI1"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWI1"
FT                   /protein_id="ACQ78639.1"
FT                   /translation="MSQPTAPGRGPLRVVRRRRGRPDEVSQLEVQGPAEDQRVAVVIPA
FT                   KDESQRIAATVRAARAIPHVDLVLVVDDGSEDDTQHVARAAGAVVVRHSHNRGKASAME
FT                   TGAAVVAMRDVEGGPPRLLLFIDADLGETAVNTAPLVPPVLAGRADLSVAVLPRQPGAG
FT                   GRGIVTGLARRAIQRASGWSPKQPLSGQRCLTREAFEAATPLARGWGVETGMTLDLLAQ
FT                   GFRIVEVPCDLRHRPSGNDLAGQMHRAAQYRDIAYAIGMRRMRTFGRRPPASEVRPALP
FT                   GSTPDPVDAGDVEGTTAPGGSGARPADGPDRASGDASGQTPSDAPGDVRKDQAEES"
FT   gene            complement(419671..421980)
FT                   /locus_tag="Bcav_0376"
FT   CDS_pept        complement(419671..421980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0376"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78640"
FT                   /db_xref="GOA:C5BWI2"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWI2"
FT                   /protein_id="ACQ78640.1"
FT                   /translation="MTVLAASLTVFASASPARAETAGQPGEQVVLVGVGGLSWSDVSPE
FT                   TPALWDLAQRASLGSAVVRSIRTATCPADGWLAVSSGARAADESGRCRTLAEPVAGAVP
FT                   GWPDYVAAAEETGYGARLGTLGNAVSEAEVPATSIGPGAAIALADSDGAVQGTSLRRAP
FT                   TPVGLEAQVTAALTTSALVVVDAGTVRDLSNASLPNPPAPTAPTTPEEARTAQVDVVER
FT                   RIAAVLAAVQEQAPDATVILASLADSGSAPGLRLLAATGPGLTDGSTPFGESLLVTTST
FT                   RQTGYVQTTDLLPGLVSALDLGEFVPTGTLVGSPMRATDGPASAEGRLDAVLDQDVHAQ
FT                   AVRPIVAPFYLFLVVGNIALYAAVAIGLKRPAAFRIREFLDRRLSVLRGKGLRRGLAAQ
FT                   RRRVLLSLRIVSLAIGALPVASFLANLLPWWRVDPPALGLAVAIIVWDAAIVAVALLRP
FT                   WRDWVLGPLAVVAGITAAVLALDVLTGARLQISAVMGVPTLVAGRFYGFNNTAFALFTV
FT                   STILVVVAVTNPLVRAGRRLLAAAVVAGIGIVATVLDGAPGIGADFGGPPALVPAFTIL
FT                   ALMAAGVRLTWKRIAVVLGGAAAVTVLFAFVDWLRPADDRTHLGRFIDTVLDGGLWDVV
FT                   FRKLEANLRILANNRPLTLLAIAGVALVVFVLARPVKIAILSPGGGKFDWLSAGAPISQ
FT                   MGQASPMLRPGLVAMAVAMGIGFVVNDSGIAIPAIGISVAVPLLLAACASWMLTLSPPA
FT                   VPVDAPLLVEPQDSSA"
FT   gene            422133..423140
FT                   /locus_tag="Bcav_0377"
FT   CDS_pept        422133..423140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0377"
FT                   /product="Prephenate dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /note="PFAM: ACT domain; Prephenate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78641"
FT                   /db_xref="GOA:C5BWI3"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWI3"
FT                   /protein_id="ACQ78641.1"
FT                   /translation="MQDAAAGSIAGSGRPRYAYLGPPGTFTEAALHQVASPDTADFLPR
FT                   GDVVAAVDAVRTGDADFAVVPIENSVEGGVSATLDTLAAGGGLVVVGEALVPISFVLAA
FT                   LPGTRLSDVRRISTHPHAWAQCRRSVAALTPGAVHVPATSTAAAAARLAEVAAERAGVH
FT                   EAAEALGFDAVLVAPHSARSYGLEVLAADVGDNPSAVTRFVVVGRPGRIPPRTGADKTT
FT                   LMVQLPDNEAGALLTMLEQFATRGVNLSRIESRPIGDELGRYAFSIDAEGHLEDERVAA
FT                   TLMGLHRVCPLVLFLGSYPRADGARTQVHRGTSDAEFAAARGWVEGLRGDGAPA"
FT   gene            complement(423268..424392)
FT                   /locus_tag="Bcav_0378"
FT   CDS_pept        complement(423268..424392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0378"
FT                   /product="diacylglycerol kinase catalytic region"
FT                   /note="PFAM: Diacylglycerol kinase catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78642"
FT                   /db_xref="GOA:C5BWI4"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWI4"
FT                   /protein_id="ACQ78642.1"
FT                   /translation="MAWEQIVALAAIVLALAAIVVGVLALRRLRAAGDAPGPAPRAENP
FT                   RADIGPAAFVINPVKVDDPARIEHAARTISAELGMPEPLLYRTTVEDPGVGQARAALDA
FT                   GASVVVAAGGDGTVRAVATALAGTGTPMGLLPSGTGNLLARNLDLPVDGADALIRTALA
FT                   GRDVPVDLGWLTPVRLRTPDEEDDDADAPDVLTDREEHLFLVMAGIGFDAAMVAGADDD
FT                   LKARMGWMAYFLAGVRHLHGRKIRLEMRIGDAEPRQLKLRSLLFANCGRLPGGIVLLPD
FT                   AEIDDGLLDVAAIDTRGGLIGWASLFGKVVLQGVGVRGQLAASPGRIDFFRGADIEVRM
FT                   DQAEQVQVDGDLLGEAIGVRTRVQPGGLRVRVRG"
FT   gene            424443..425714
FT                   /locus_tag="Bcav_0379"
FT   CDS_pept        424443..425714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0379"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="PFAM: Seryl-tRNA synthetase N-terminal domain; tRNA
FT                   synthetase class II core domain (G, H, P, S and T);
FT                   TIGRFAM: seryl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78643"
FT                   /db_xref="GOA:C5BWI5"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BWI5"
FT                   /protein_id="ACQ78643.1"
FT                   /translation="MIDLKALRENPDVGRASQRSRGEDPELVDRLLDADARHRALLTSF
FT                   EQQRAEQKELSRAVGKAAPQDRPAVLAHAKSRAEQVKSAEADADRARAELDALLSRMPN
FT                   IVADGVPPGGEDDYVVLRHEGTPRDFAAEGFTPRDHLELGERLRAIDTERGAKVSGARF
FT                   FYLTGLGARLELALLNAAIDKALTAGFTPVITPTLVKPEIMAGTGFLGAHAEEVYRIEK
FT                   DDLYLVGTSEVALAGYHANEIVDLSDGPLRYAGWSACYRREAGSHGKDTRGIIRVHQFH
FT                   KVEMFSYARLEDAAVEHERLLAWEEELLRLVELPYRVIDTAAGDLGSSAARKFDCEAWL
FT                   PTQERYLELTSTSNCTSFQARRLGTRERLEDGSTRPVATLNGTLATTRWIVTILENHQN
FT                   PDGSVRVPAGLQPYLGGLTELRAS"
FT   gene            425711..426598
FT                   /locus_tag="Bcav_0380"
FT   CDS_pept        425711..426598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0380"
FT                   /product="HAD-superfamily hydrolase, subfamily IIB"
FT                   /note="PFAM: haloacid dehalogenase-like hydrolase; TIGRFAM:
FT                   HAD-superfamily hydrolase, subfamily IIB; Cof subfamily of
FT                   IIB subfamily of haloacid dehalogenase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78644"
FT                   /db_xref="GOA:C5BWI6"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWI6"
FT                   /protein_id="ACQ78644.1"
FT                   /translation="MSAELSGKSADADDAAGRPVFDAAMVTWPAGPDALVALDIDGTLL
FT                   GHDGSMSVGVRDAVAALREAGTHLVLSTGRSVPAVLPVAEELGLDRGWAVCSNGAVTIT
FT                   LDPESEKGYEFADLVTFDAGPAVRTLLAEQPGVIVAVEDLGRGFKVSAPFPMGELGGEV
FT                   EVVDLEEMLAEPATRVTLRAPQLMPADFADLVDRVGLHGVAYAVGWTAWLDLTPDGVSK
FT                   ASALEQVRGWAGVAPERTLAAGDGNNDREMLRWAGLGVAMGGADADTVLAADARTGPVE
FT                   DDGVVPVLRALLRA"
FT   gene            426665..428344
FT                   /locus_tag="Bcav_0381"
FT   CDS_pept        426665..428344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0381"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: Tetratricopeptide repeat; Tetratricopeptide
FT                   repeat; Tetratricopeptide repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78645"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWI7"
FT                   /protein_id="ACQ78645.1"
FT                   /translation="MPTTPYPFDLGTHTRRTSTSSPEAAQWFDRGLVWSYAFHHEEAVR
FT                   CFERALRADPRFALAHWGIAYAIGPNYNLAFDLYPPEDLPGMLARAAAELARARELADG
FT                   APEVERALIEALSTRFPTDPAADFAAYNRAYATAMARAAALHPDDLDVIALHADALLNV
FT                   TPWKLWSVATGEPAEGASTLEAKALLEDALARPGAMTHPGLLHLYVHLMEMSPTPELAL
FT                   PAADALRHLVPDAGHLLHMPTHIDVLVGDYESVIAGNTAAIEADERWVAASAASGDEAP
FT                   FYALYRAHDRHFRIYGAMFAGRFEIARATAEDLEESVARELVRDPGMADFVEGFAGMRL
FT                   HVLVRFGRWDELTAHPLPADPDLYCVTTALTHYARGVAFAALGRVAEAEGERASFVAAS
FT                   ARVPESRYLFNNTCRDILAVASAMLDGEIAYRRGHIEEAFAHLRRAVDLDDTLPYDEPW
FT                   GWMQPARHALGALLLEQGRVDEAAAVYAADLGLDATLGRACRHPRNVWSLHGYHECLSR
FT                   MAGTDPDPDRVQAATDAGRQLALATARTDVPIEASCFCRTGT"
FT   gene            complement(428369..429631)
FT                   /locus_tag="Bcav_0382"
FT   CDS_pept        complement(428369..429631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0382"
FT                   /product="putative RNA polymerase, sigma-24 subunit, ECF
FT                   subfamily"
FT                   /note="PFAM: Sigma-70 region 2; Sigma-70, region 4;
FT                   TIGRFAM: RNA polymerase sigma factor, sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78646"
FT                   /db_xref="GOA:C5BWI8"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWI8"
FT                   /protein_id="ACQ78646.1"
FT                   /translation="MSVPVRRGAGSAAPAALEDVWRREAPHVLAALLRRYSDLERCQDA
FT                   LQDAAEDALAWETDGVPDNPRGWLVRVASRRLIDALRSDGARRAREEADHERDARSAVV
FT                   PAADETPSTDADDTLQLLLLCCHPSLSRSSQVALCLRSVGGLGVDDIAAAYLVPVRTMT
FT                   QRLTRARATLREAGARFAMPSADELPDRVAAVLDACHLMFTAGYTRASGEALLDEALTA
FT                   EAIRLVRQVVAALPDHDEAAGALALMLLTNARAGARTDGAGDLVPLAEQDRRRWARAPI
FT                   AEGVALLERVLPRGPVGRYQLTAAIAAVHDEAATWEDTDWPQICELYAMLTHVAPSPVV
FT                   TLNRAVAVAMVDGPGAGLAMLEDLRADAAMRDHHRLHAVRAHLLEEAGDLDGARESYAR
FT                   AAQLTRSVPEQRYLNRRLAAL"
FT   gene            complement(429662..430051)
FT                   /locus_tag="Bcav_0383"
FT   CDS_pept        complement(429662..430051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0383"
FT                   /product="YCII-related protein"
FT                   /note="PFAM: YCII-related protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78647"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWI9"
FT                   /protein_id="ACQ78647.1"
FT                   /translation="MKYVILIHSNPQPWGHPTSDFLPAHQALPAAERERLNAAFESVMT
FT                   ELQERGELIGGEALGDAASARLYRWADGSPLVSDGPYSEAKEHLAGFFLIDVESQERAE
FT                   EVTASFAGPGETVELRPAMGPGGDE"
FT   gene            complement(430160..430729)
FT                   /locus_tag="Bcav_0384"
FT   CDS_pept        complement(430160..430729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0384"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: Protein of unknown function (DUF2587)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78648"
FT                   /db_xref="GOA:C5BWJ0"
FT                   /db_xref="InterPro:IPR019695"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWJ0"
FT                   /protein_id="ACQ78648.1"
FT                   /translation="MTEQSEDQTGTRADQPEVVVVEPEAIGADTPEEKGPTDPTSLVEE
FT                   PAKVMRIGTMLKQLLEEVKAAPLDDAARERLAEVHERSLHELEDGLSPELIAELHRITL
FT                   PFTDASTPSDAELRVAQAQLVGWLEGLFHGIQTALVAQQMQAQSQLTQMRRALPPGVMP
FT                   VPGHGAGGQVPVARADDGDRAPGQYL"
FT   gene            complement(430737..434333)
FT                   /locus_tag="Bcav_0385"
FT   CDS_pept        complement(430737..434333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0385"
FT                   /product="adenylate/guanylate cyclase"
FT                   /note="PFAM: Adenylate and Guanylate cyclase catalytic
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78649"
FT                   /db_xref="GOA:C5BWJ1"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWJ1"
FT                   /protein_id="ACQ78649.1"
FT                   /translation="MIAGRSGTRRRSRLYRWLMAGQVPGADDVAQLRRAMEALEAQRDT
FT                   LGDQVVDVALGPLRERLDALSARTAGEQRRLVTVVFADLVDFTTLSGSLDAEDVRGIVA
FT                   AYFGRWQSAITRHGGVVEKFIGDAVMAVFGLYASEEDDAQRAVRAALEMRASLRDLTAA
FT                   AGLPQGVRLHMRVGIDTGDVVVSTLGERAGHEFVAVGQTVNRASRIQAAAPVDGVLISA
FT                   GTHRHVRGLFSFEERPGLVLKGIEDPVDAYLVRNERPARFHIESDGSADTPTVGREREL
FT                   AMLRETLDDVVEERAWRLVTIVGDAGVGKSRLAFELDRWLSERPEPAWWFRGRATRSDL
FT                   HRPNALLRTVLFARIGVTETDPPATVEQAIGTAFATPFGSRAAAAARTVSTWLGLRDPE
FT                   PGTDPRGLRQQATTLLAELMARISEVAPVVVLLEDVHWADDESLDWLESADEQLRSARV
FT                   YVVATARPALFDRRPLWGEGRAHHVRLDLAPLGRRASRTLLDELTHHAGTLPDVVVDTV
FT                   LGAADGNPFYLEELAAWLHETGVVVRRDAEWRVDLSRWEPLVVPATLRGVLQARIDALG
FT                   PLDRDVAQRAAVVGRVFWDTAVAAVAGEDPADVGTVLDRLRAVGIVQERATSSFDGTRE
FT                   FLFAHSLLRDVAYDGVLRSRRTVDHRQAAAWLADLTERTGRGDEYAAVVADHLERGADE
FT                   GAAGWYLRAARRAGSVWALQDAENLLAGALRTAPADPALRFDAHAERLLVRERRGDVDG
FT                   QHADLEAMAASAADLPADEARQLRLALARSVWAFERSSYDDASAHAAQAADLARHLGAD
FT                   AELAAAQLAFAKARQWAFDLDGARAALTDALRTARAHGLTDVEAEALRYRSMTEVAEDD
FT                   YAAALASVEAAYALNSQRGDEEAQAVTLHQSSNVLYHLGRYSEALSALIQALPLFRRTG
FT                   YRYREAVTLTNAAAIALFTGQLADAGRWVTESLEIIRRLDDQEALATALGVHGQVEALL
FT                   GRTASAHELFTEALTIAKEVGDHQLEVDLAALLALLMVEAGVPESAREWAGVALASMSD
FT                   AHTAKDRAEALLRVHYVYRELGEVSRASALARDLAAVVADVPDDVRARASYELELAAAQ
FT                   IALGRSSDHVELLSRLDLEALRGCVRPEAVLATALDAGDGAALPDVAELALALLDDRTS
FT                   AIGDPDLAREYLATSGREALRQRASRARAERS"
FT   gene            434425..435447
FT                   /locus_tag="Bcav_0386"
FT   CDS_pept        434425..435447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0386"
FT                   /product="putative transcriptional regulator, Crp/Fnr
FT                   family"
FT                   /note="PFAM: Cyclic nucleotide-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78650"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWJ2"
FT                   /protein_id="ACQ78650.1"
FT                   /translation="MRVQATATAVSWIPSESVTGALRAGFDLRLSHYDSPPPARLSSPD
FT                   EVRRLRDADGFRFANVLGVWADVDDDGVHDVGISPSSGLAMGATTTRLAGLAIRFAAVS
FT                   LPVLRHEPEVLGSGVRVVQTVGGRTGVPLPRPVPHPPFVQWSAPTVWTTLAVTLRPDGT
FT                   SDVELLGASAFPRHWVYGPDGTLVAKSGLTDPDGWLKHSFGERTPWSSSDSSVLVAEAE
FT                   SALERELSALIMRGGAEPEIRRVGAGAAVMRQGEPGDELFLVLDGVLDVAVDSTIVAEV
FT                   GPGAVIGERALLEGGRRTATVRARTPARLAVAGADAVDLDRLRELAAGHQREIGATPVA
FT                   "
FT   gene            435559..436107
FT                   /locus_tag="Bcav_0387"
FT   CDS_pept        435559..436107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0387"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78651"
FT                   /db_xref="GOA:C5BWJ3"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWJ3"
FT                   /protein_id="ACQ78651.1"
FT                   /translation="MVTGSTTMTTARATMHARSLPLALTSVTLIALLFCEMAYPHSPYP
FT                   QGLVPGVAYLVTFLIVRAIRPREPMGVRVPYGVLALVLLALGIMPLVGMFAGAPFLLGL
FT                   GLVTLGIRDRDAWLWVPGIALMVLSPLMAFWTIENHLGLNSESVLGALVVAFAGLGGSA
FT                   WRREREILTAPVWPVGSAI"
FT   gene            436582..437856
FT                   /locus_tag="Bcav_0388"
FT   CDS_pept        436582..437856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0388"
FT                   /product="N-acylglucosamine 2-epimerase"
FT                   /note="PFAM: N-acylglucosamine 2-epimerase (GlcNAc
FT                   2-epimerase)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78652"
FT                   /db_xref="GOA:C5BWJ4"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWJ4"
FT                   /protein_id="ACQ78652.1"
FT                   /translation="MRAAIDAPLSWIGRPAHARWLEAHTDDLLAFASGAGTPHGFGYLD
FT                   ADGGLRPGKDTELWITCRMIHSFSLGVLLGRPGCAPLVDHGLEALRTSFADDANGGWYS
FT                   AVGPDGPTQPIKEAYAHAFVLLATSSAMLAGRPGAAALLGQAQAVHTEKFWREDEGMAV
FT                   ESWNEDFTECEAYRGVNANMHTVEAYLAVADATGESLWRDRAVRILRRVLGYAKDYEWR
FT                   IPEHFSPSWEPLPDYNTDDRAHPFRPYGATVGHWFEWARLALHAHAALLAQAGEGDVGS
FT                   VTDDVQWLLDGAVALFGAGVSEGWDVDGAPGFVYTVDFAGVPIVRDRMHWVVTEALGAA
FT                   AALYAATGDDDYAAWYATWWDYAHEFLLDATGSWIHELDPSNAPADSVWPGKPDIYHAI
FT                   QATLIPRLPLNPALASSLKAGLLDA"
FT   gene            438039..439988
FT                   /locus_tag="Bcav_0389"
FT   CDS_pept        438039..439988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0389"
FT                   /product="penicillin-binding protein transpeptidase"
FT                   /note="PFAM: Penicillin binding protein transpeptidase
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78653"
FT                   /db_xref="GOA:C5BWJ5"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR002137"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWJ5"
FT                   /protein_id="ACQ78653.1"
FT                   /translation="MTVRDLRAAGGAVVALLVLTGTLTACSPGRPGPGDSAEALASALA
FT                   GGDESDVGAVTWTGSTPDKVTTHLTDTFAALDGVERTVQVAELEEPGDDDGDGDPDTAA
FT                   AELAWEWDFGDGGESWTYATTAQLAWDEETETWTAAWSPELLVPGLTPTELLSLTRTSG
FT                   ERGEVVDANGGAIVMDRGVLRIGIDKTMVDAADAPASGLALAELLEFDDPQAFADRVAA
FT                   AGERAWVEAIIVRVSEPGVDLDAVAAIDGARAIDDTRPLAPTSTFARPILGRAGPATAE
FT                   IVEESDGAVVADEITGLSGLQRQYDEVLRGVPGYLVEAVREDGRPRTLFERDPARGSDL
FT                   ALTLDAPTQILAEEVLAGVGPASALVAIRPSDGAVLAAASGPGSAGENTAMLGQFAPGS
FT                   TFKVVTALALLRSGVGVTEPTLPCTPTVTVDGREFDNFPGYPEAGLGDVPLRTVIAQSC
FT                   NTALIASRDSAPPDALADAAAALGLGVEPSLAYPAWLGSVPTDVDAGGTEHAASMIGQG
FT                   RVLASPLAMATVAASVVRGAAVTPVLVADADQEPAPEAETPLTDEEATALRELMRAVVT
FT                   EGSGSLLADVPGEPVSAKSGTAQYGDADPPHTHAWMIATQGDLAVAVFVERGDYGSATS
FT                   GPIVEAFLRGLAAL"
FT   gene            440088..441482
FT                   /locus_tag="Bcav_0390"
FT   CDS_pept        440088..441482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0390"
FT                   /product="sulfatase"
FT                   /note="PFAM: Sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78654"
FT                   /db_xref="GOA:C5BWJ6"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWJ6"
FT                   /protein_id="ACQ78654.1"
FT                   /translation="MRRPNVVLILSDDHGYADRGALGLDPAVRTPALDRLAADGVTCTD
FT                   AYVTAPICSPSRAAIISGAYQQRWGARWFDSSRFGDERTSLAERFAELGYATGYLGKVH
FT                   YGPEDVGDRACPPHHGFAETYYGLAGRQQGRLNYLRHSDDAVAEYGPEASWRMAVQPML
FT                   SGDDPEDLEGFLTAELGRRSRTFVDDHAAEPFFLMLAFNAVHNFCWQLPPDELRRRGLP
FT                   ARDDWHDADAQGYADWYDGAITPNLEHGREYYLAQLELMDAEIAALLDTLEERGLADDT
FT                   IVVYLTDNGGSTCNYGSNAPLAGTKYTLWEGGIRVPFLVRWPGGGWAGGRTTTALVSSL
FT                   DLVPTLVAAAGGAVDDVDGVDLADVLSGAGDRAHDALHWDCGFQWAVREGDLKLRYVDG
FT                   ASETAAGIRAVEHADPGDGLTLVDLAADVAERRDLAGDRPDDVARLLARHEVWRRDVGW
FT                   ADPVPR"
FT   gene            complement(441489..442352)
FT                   /locus_tag="Bcav_0391"
FT   CDS_pept        complement(441489..442352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0391"
FT                   /product="Aminoglycoside N(3')-acetyltransferase"
FT                   /EC_number="2.3.1.81"
FT                   /note="PFAM: Aminoglycoside 3-N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78655"
FT                   /db_xref="GOA:C5BWJ7"
FT                   /db_xref="InterPro:IPR003679"
FT                   /db_xref="InterPro:IPR028345"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWJ7"
FT                   /protein_id="ACQ78655.1"
FT                   /translation="MTTPAPPSSSTDLHGRSLQTRSSLAQDLAALGVRPGETLLVHSSL
FT                   SSLGWVCGGAPAVVDALLDALGPDGTLAVPTHSMDNTDPAGWQAPPVPEDWWPLIRAEM
FT                   PGYDPRTSPTRGMGRIPDAVRAVPGAVRSAHPQSSFTALGARAAEVTEPHPLECNLGDD
FT                   SPLGHLERLGARVLLLGVGYDACTTFHLAEYRVPRPRLAPSSCAVLRADGTREWVTYTD
FT                   VELDDEGFPELGAAFEAAAHDDDGAASGAGGGGVVVGRVGDATARLFPLAAAAAFATAW
FT                   LTEHRA"
FT   gene            442593..443636
FT                   /locus_tag="Bcav_0392"
FT   CDS_pept        442593..443636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0392"
FT                   /product="daunorubicin resistance ABC transporter ATPase
FT                   subunit"
FT                   /note="PFAM: ABC transporter; TIGRFAM: daunorubicin
FT                   resistance ABC transporter ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78656"
FT                   /db_xref="GOA:C5BWJ8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005894"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWJ8"
FT                   /protein_id="ACQ78656.1"
FT                   /translation="MTTPLLSRARSSRADGSAVAVRTEGLVKTFGTNRAVDHVDLEVHR
FT                   GEIFGVLGPNGAGKTTTLRMLATLLGIDEGRAEIFGVDVKQRPHVVRQLIGVTGQYASV
FT                   DENLTATENLYLFGRLQGISGPKSRATAQDLLDRFGLEEAANRPLSQFSGGMRRRLDLA
FT                   ASLITRPPLIFLDEPTTGLDPRTRGQMWTTIRELVESGCTVLLTTQYLDEADQLAGRIA
FT                   VIDRGRKVAEGTPDELKSQVGSSTLQVVLSDPAEIATAGDVVSRAMSAEPVLSPESGRI
FT                   HVPMSSADEAADVLIALRTAGVSVASLNVSKPSLDEVFLALTGHDTGEGDDGASTDTTT
FT                   EPQENVR"
FT   gene            443633..444457
FT                   /locus_tag="Bcav_0393"
FT   CDS_pept        443633..444457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0393"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; TIGRFAM: ABC
FT                   transporter efflux protein, DrrB family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78657"
FT                   /db_xref="GOA:C5BWJ9"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWJ9"
FT                   /protein_id="ACQ78657.1"
FT                   /translation="MSTLALTQVAADPVAATTSHVSLRQAVAQTMSMAWRAAKTMRRNP
FT                   EQFFDVTIQPLLFTAMFAYIFGGAISGDVASYLPLMIPGILAQTALTACMATGVQLRED
FT                   MDKGVFDRFKSLPIARIAPLAGPMVADLLRYLIAAVLTFATGILMGYRPGGGVVGVAAA
FT                   IMLVVISGWSLAWVFTWVGTIARSARSVQGISMMIMFPLTFLSNAFVPIETLPSWLQGF
FT                   VRVNPVSLVVTATRDLANTGDVTTAVGWALVGCAVVVAVFAPLAVRSYQRKM"
FT   gene            complement(444461..447610)
FT                   /locus_tag="Bcav_0394"
FT   CDS_pept        complement(444461..447610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0394"
FT                   /product="transcriptional regulator, winged helix family"
FT                   /note="PFAM: Transcriptional regulatory protein, C
FT                   terminal; Bacterial transcriptional activator domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78658"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWK0"
FT                   /protein_id="ACQ78658.1"
FT                   /translation="MLRLLDDVSWDGAPVVGARPRAFLAALALAAPGAVADDRLVDAVW
FT                   GDDAPAHPAKALQVVAARARTATSPGAVVRTPHGYRLGLAETDVDTLRLAGLTGLAERS
FT                   LAGGDATGARDAAREALALAGEPEPAPGALGELRAAAAAQKERAAVVLGTALAAGGDHD
FT                   AALPLLERAAARRPGDEGVLAALLRSEAAVRGPSAALERYDAHRTRLADRLGTDPGPEL
FT                   QRLHRELIAADRPVRTGVRFDPTDLIGRDDDVRRLRAMVATSRVTSIVGPGGLGKTRLA
FT                   QVLARRAEEPAVHVVELVGVSDPQDVLGEVGTALGVRDSVTGRRALTPEQRADIRSRIA
FT                   QQLDGVPTLLVLDNCEHVVDTVADLVAFLVATNRDLTVLTTSRAPLGIAAERVYALAQL
FT                   GDADAAELFRRRAVAARPDVALDQREVAAVVRRLDGLPLAVELAAAKVRVMSVADIDRR
FT                   LGDRFALLRGGDRSAPDRHRTLLAVIDWSWNLLGEPERQALRRLSVFHDGFVLDAAEAV
FT                   VRTAGPGVLDAVASLVEQSLLSVHDAGGSVRYRMLETVREFGRLRLAEAGEAADAERAQ
FT                   REWAVAYCVAACADLHGPRQIAAIDRLWDEEANLADIARRATTLPDAECVVVVMAALAD
FT                   LWRLSGNFARIVAPLNRAVLTVIRDHPLPDALLDPARDVVGAILMTEGIFGGEAIAEAR
FT                   EVLTRLGADSADPRVAAETTFVLAVTAEDVVGPQAFLSLTASPDPRVAALGWQWSCHWK
FT                   ENDGDIHGAIDAAERALALARPEEGPAVTANLHAGLAGMHLQIGDSDAGERYALLALEP
FT                   LTALRAVDDTHQLRALLAVVAMRRGDLAQAERILDQVERADAPEFGFGGHVVTASGRAE
FT                   LVLAEGHLAEGLRRYRDAHAAAGAFRFPGVAGVPGFEPWTLFSSASCLTAHARYLPADT
FT                   PPSDAGAVFAAALAATVLAKARTYVGEGAGFLDYPVAGTVLFALAWWHGRHGADADVVA
FT                   RLLLLADGFGYNRALPTMSLEAAVAMRDDVTRRFADLRPAYVGRFGPQLREEAAALLTQ
FT                   L"
FT   gene            complement(447743..448618)
FT                   /locus_tag="Bcav_0395"
FT   CDS_pept        complement(447743..448618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0395"
FT                   /product="Luciferase-like monooxygenase"
FT                   /note="PFAM: Luciferase-like monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78659"
FT                   /db_xref="GOA:C5BWK1"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWK1"
FT                   /protein_id="ACQ78659.1"
FT                   /translation="MKTDLVLSPFGAEGHQMIAAAEAADADGWDGVWTYDHFSALVATG
FT                   IGPRGWSRDPFVALGAIAARTQRLRLGVLVANIANRHPAQLASALNTLQALAPGRVVCG
FT                   IGAGAGPGTQFAAEANAIGRTTLPVTARRALLVEYVAALRSIWRDEDADGVTIRTHGLT
FT                   GVVDGAAQPPIVIGAGTDATIRLAAEHADGVNLVGGAGPRLAEQVALARTHAAAPGSER
FT                   DSDSESQRAQEDRGRGFEVSVHAPFEVDHPGGGDLAPLLAAGVDRRTLWVTAPYPVDAI
FT                   RRVGAWLTAD"
FT   gene            complement(448657..449613)
FT                   /locus_tag="Bcav_0396"
FT   CDS_pept        complement(448657..449613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0396"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="PFAM: Sigma-70, region 4; Sigma-70 region 2;
FT                   TIGRFAM: RNA polymerase sigma factor, sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78660"
FT                   /db_xref="GOA:C5BWK2"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWK2"
FT                   /protein_id="ACQ78660.1"
FT                   /translation="MSVGTAELADAFEAERPRLLRVAYRLTGSVADAEDAVQEAWLRLD
FT                   RAESAAIRDLPAWLTTVVSRICLDRLTSAAARRETYVGNWLPEPVVTAFPTPGHASAAP
FT                   DPLDAVVADADARYAALVILEALPPNQRVAFVLHDGFGVPFADVADVLGTSPANARQLA
FT                   ARARAGVADPPPASDAETRLRAVEQLAAALSAGDLDAIVAVLHPDVVARGDSGGTTATA
FT                   LHAVRGSDKVARFFLGLLDKYGTHVITTARPVLVNGELGFLLAGSPGDATHDPIPPRVM
FT                   ALGVRDGRIAELYDLANPAKLRHVRLPDGTRPVPEAD"
FT   gene            complement(449610..450593)
FT                   /locus_tag="Bcav_0397"
FT   CDS_pept        complement(449610..450593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0397"
FT                   /product="NAD(P)H quinone oxidoreductase, PIG3 family"
FT                   /note="PFAM: Alcohol dehydrogenase GroES-like domain;
FT                   Zinc-binding dehydrogenase; TIGRFAM: putative NAD(P)H
FT                   quinone oxidoreductase, PIG3 family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78661"
FT                   /db_xref="GOA:C5BWK3"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014189"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWK3"
FT                   /protein_id="ACQ78661.1"
FT                   /translation="MTIDDGRLVPTDVPRPEPRPGQVLLDVVAAGVNRPDLLQVAGGYP
FT                   PPPGAPVWPGLEVSGHVAAVGDGVTSLRTGDAVVALLDGGGYAEQAVVAAGQVLPAPDG
FT                   VSLVDAAGLPETVCTVWSMMVRAARLRAGETVLVHGGSGGIGTTAILVAKALGARVITT
FT                   AGGPDRTARCRDLGADVAIDHRPGDVVERVEDASDGRGVDVILDLLGGGALADNVRLLA
FT                   TDGRLAVIGTQAGSRGELDVWQLMKRRASVHAATLRARPPAEKAAIVADVGTHVWPMVA
FT                   AGLVRPVVDRVLPLREAAQAHALLDAGAIFGKVLLATGSGSAGGAA"
FT   gene            450665..451090
FT                   /locus_tag="Bcav_0398"
FT   CDS_pept        450665..451090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0398"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78662"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWK4"
FT                   /protein_id="ACQ78662.1"
FT                   /translation="MRAFVDGSTFAVDAADGPDAAPWRAWRATFEGELEGRLCTSAGAL
FT                   ARMRSGLRSSPPATKRAGEDAVVGVEVLGVSDQALATAAHAASVVDPFRAIDVGIAVTH
FT                   PDVRVMVSYDPLLCRVSAVYGLDVVTPGRASGWWDAA"
FT   gene            451147..451237
FT                   /locus_tag="Bcav_R0004"
FT   tRNA            451147..451237
FT                   /locus_tag="Bcav_R0004"
FT                   /product="tRNA-Ser"
FT   gene            complement(451328..452230)
FT                   /locus_tag="Bcav_0399"
FT   CDS_pept        complement(451328..452230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0399"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="PFAM: Sigma-70, region 4; Sigma-70 region 2;
FT                   TIGRFAM: RNA polymerase sigma factor, sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78663"
FT                   /db_xref="GOA:C5BWK5"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWK5"
FT                   /protein_id="ACQ78663.1"
FT                   /translation="MDRTERLARRFEEDRPHLRAVAYRLLGSAAEADDAVQEAWLRLSR
FT                   SDTSDVANLTGWLTTVVGRISLDMLRSRTSRREAPLEAERSDAVDHAAPDPEAAAVQAD
FT                   AVGTALLVVLDQLAPAERLAFVLHDLFGVPFEDIGPIVGRSTTASRQLASRARRRVRGA
FT                   GDDAGAEPDPARQRQVVEAFLAASREGDFAGLLALLDPDVVLTADRAAVAAATVNAAKG
FT                   APELAPEVRGAGAVAEAFAGRAAYATTALVDGAWGAVWASDGAARAVFAFTVERGRIVG
FT                   IDLVLNQTTVREMDVQLVP"
FT   gene            452315..452656
FT                   /locus_tag="Bcav_0400"
FT   CDS_pept        452315..452656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0400"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/Bleomycin resistance
FT                   protein/Dioxygenase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78664"
FT                   /db_xref="GOA:C5BWK6"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWK6"
FT                   /protein_id="ACQ78664.1"
FT                   /translation="MSQVFKVITYPVRDLSAAKAFYTTLLGTEPYADSEYYVGYRLGDQ
FT                   EIGLDPNGHATGLTGPIGYHPVDDLEAAVEAATAAGATLVKPIAEVGPGRRIAAVADAD
FT                   GNVTGLMHG"
FT   gene            452884..454206
FT                   /locus_tag="Bcav_0401"
FT   CDS_pept        452884..454206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0401"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: Major Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78665"
FT                   /db_xref="GOA:C5BWK7"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWK7"
FT                   /protein_id="ACQ78665.1"
FT                   /translation="MTTTTPRNAHASGAAPSASTAADQHDPTAGSSPTSDDGGPSLLRQ
FT                   PRAVWAVAFAAVVAFMGIGLVDPILPAIASDLDATHAQVMLLFTSYMAVTGVAMLVTGW
FT                   VSSRIGAKKTLLAGLAIIVVFAALAGASDSIGAIVGLRAGWGLGNALFIATALATIVGA
FT                   ASGGVASAIILYEAALGVGIATGPLLGGLLGSVSWRGPFFGTAVLMAIAFVAITVLLPR
FT                   SAPPERRTSLADPFRALRFPALRALAVTAFFYNMGFFALLAYTPLVLDMSAGSLGLIFF
FT                   GWGVCLAVTSVLVAPCLHRRFGRIGVILAMFVGLGVVLAVMALTTTAPAALIVCVILAG
FT                   AFLGVVNTLLTEAVMVAAPVERAVASAAYSFVRFFGGALAPFLAGFLAEVSVGLPFWMG
FT                   AAAVVVAFVVLLTQRRTLGHADRDDEPEIAEAEALTVAEAS"
FT   gene            454321..455115
FT                   /locus_tag="Bcav_0402"
FT   CDS_pept        454321..455115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0402"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78666"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWK8"
FT                   /protein_id="ACQ78666.1"
FT                   /translation="MMWIGGAPGAGKSTIARALAHEHDLPLHPIDRWTYDHVQRLGPRD
FT                   WPPPDPEEPDAAAEVFVESSRERLALVRADVRARDLGEVPAVVEGPQLFPDDASGLRDG
FT                   WAVWLVPDAEQTRSARERRLAAVEDPGGRARLAGYLARDAVLARRVREGAVVAGRPVVE
FT                   VGADPDWVAVRRAAEAALAPALGAASRLEPGARLAEQRRFENRAAARQIRLWVETERLD
FT                   ARPEFPFACECGRSRCAATWPATVGAYEATASDGPVVTAEHR"
FT   gene            455267..456295
FT                   /locus_tag="Bcav_0403"
FT   CDS_pept        455267..456295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0403"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD dependent epimerase/dehydratase family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78667"
FT                   /db_xref="GOA:C5BWK9"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWK9"
FT                   /protein_id="ACQ78667.1"
FT                   /translation="MARVAAMAALRVLFIGGNGTISAASSRLAIERGHDLTLLNRGVSA
FT                   ASDTPDARPPIEGARSLVGDAGDPDSIRAAVAGQEWDVVVNFRSFSPEQAAADVEIFDG
FT                   VVGQYVYISSASAYAKPVEHLPITESTPLKNPFWQYSRNKIASEEVLVRAWRERDFPAT
FT                   IVRPSHTYDERSIPIPGRWTAIDRLRRGAPVPVVGDGTSLWTLTHTRDFAVAFVGLLGD
FT                   RRAVGDTFHITSDESLTWAQITRILARAAGADEPELIPIPGRAIGTELQDELDGLVGDK
FT                   VHSVVFDNSKVKALVPEYTATTRYWQGAAEVLAWYDADERRRVVDPDVDAALDRLITRF
FT                   GS"
FT   gene            complement(456327..456983)
FT                   /locus_tag="Bcav_0404"
FT   CDS_pept        complement(456327..456983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0404"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: Response regulator receiver domain; Bacterial
FT                   regulatory proteins, luxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78668"
FT                   /db_xref="GOA:C5BWL0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWL0"
FT                   /protein_id="ACQ78668.1"
FT                   /translation="MSIRVVVADDQDLVRAGLVMILGAQPDLEVVGEAEDGLAALELAT
FT                   RLRPDVLLVDIRMPGLDGVEVTRRLAGPGVTDPMAVVVITTFDLDEYVLGALRAGARGF
FT                   LLKDAGPELLVRAIHAAAEGDALIAPNVTRRLLATFADQAPAVPVQPIDPLTGREEEVL
FT                   ALVARGRTNAEIATELFVGLSTVKTHVASLMTKLGARNRVEIAMWAYDTRRVRAD"
FT   gene            complement(456980..458119)
FT                   /locus_tag="Bcav_0405"
FT   CDS_pept        complement(456980..458119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0405"
FT                   /product="histidine kinase"
FT                   /note="PFAM: Histidine kinase-, DNA gyrase B-, and
FT                   HSP90-like ATPase; Histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78669"
FT                   /db_xref="GOA:C5BWL1"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWL1"
FT                   /protein_id="ACQ78669.1"
FT                   /translation="MVTVRRSIWHEPRPADVPPVGRLDWLLVGVFAAAALVEGLVRPGL
FT                   AWRPLVMVLALALIPALLWRRRRPLVAALVGWGVAGLLSVLQLTADAGELGLYAMMAVL
FT                   ILLYSLVRWGSGREMVVGTAFVTVVVALGMYATSAGWVDVFGGIVLLLLFVALAAVFRY
FT                   RADLLHRQQREIRNQERVALARELHDTVAHHVSAIAVQAQAGGVVAGAQPEKAAEVLAA
FT                   IESEASQTLAEMRSMVRVLREEEAVAYSPPLGVADLPALARADTTPTVEVSLDSSLTRL
FT                   ARPVDAALYRLAQESLTNAVRHARSATRVGIVVRQEGDAVRLRVSDDGQTEPGPAPEPG
FT                   FGLLGMAERVLLLGGSLSAGPGPDGGWVVEAVLPVEVLT"
FT   gene            458282..458770
FT                   /locus_tag="Bcav_0406"
FT   CDS_pept        458282..458770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0406"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78670"
FT                   /db_xref="GOA:C5BWL2"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWL2"
FT                   /protein_id="ACQ78670.1"
FT                   /translation="MRTRQPTITLDDQPIPVRAKLAAAWTSLMFLYAYVDILNFFTPGV
FT                   VDDILAGRVFEFALSQTFSTTALALMAIPILMVVLSMTLPARVNRITNLVVASLYVPVT
FT                   AFNAVGESWLYFYGLGIALELILLALILRYAWTWPRTASSATMVTSPDRDTVRAPQQA"
FT   gene            complement(458977..459068)
FT                   /locus_tag="Bcav_R0005"
FT   tRNA            complement(458977..459068)
FT                   /locus_tag="Bcav_R0005"
FT                   /product="tRNA-Ser"
FT   gene            complement(459194..459853)
FT                   /locus_tag="Bcav_0407"
FT   CDS_pept        complement(459194..459853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0407"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78671"
FT                   /db_xref="GOA:C5BWZ6"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWZ6"
FT                   /protein_id="ACQ78671.1"
FT                   /translation="MNIDAVIELIRNVEREIAAARQRVVDGIDLSSPTDIVGGMLIAEA
FT                   LDYLDTLVRQVIDWLEEISIAFGNPADIDRAANGWASGVGGPVSELRTLVESSDLLRGG
FT                   NWTGEAAEAYGRLIPIQLDAIGDVIDPIALEIYDALSDAWLGVSVFQMGLVATLVALIA
FT                   GIATSFTIAPLIAAVATAAVALTTAVITLQWELRNAAGTLGTLDAGVRDSWPQFAR"
FT   gene            complement(459864..460172)
FT                   /locus_tag="Bcav_0408"
FT   CDS_pept        complement(459864..460172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0408"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78672"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWZ7"
FT                   /protein_id="ACQ78672.1"
FT                   /translation="MTYEVAMEALAEEAVLWYEVANGLRSAANSVNGLGVVERAFTFLG
FT                   DGFDQQYEQVRTRIHDLLVDGANTVQGASEELRYVHATYASTDEAAKARLDGQWNWE"
FT   gene            complement(460184..460936)
FT                   /locus_tag="Bcav_0409"
FT   CDS_pept        complement(460184..460936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0409"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78673"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWZ8"
FT                   /protein_id="ACQ78673.1"
FT                   /translation="MSIELDRIAEIRESLDRVQQVAEAVDAEGTLAEATDDTGSVSVQL
FT                   GHDGAIVSLVVDADWPDHYRPEELGQVVRDTIRAAEVARLRTALTMTGERLRDAPPTTR
FT                   PMPPTSDSLPGRLREILAERPAGAVDAQAVASRLNGVVDEALHALGESRELLEARRRAR
FT                   YDGHREGGVVATADAQGQLLEVAYDGDWLRGQSALAISLATTDAIVAARAEASAAAARS
FT                   SHDATPLERLARELQDPMAVADRLGLLG"
FT   gene            complement(461087..462598)
FT                   /locus_tag="Bcav_0410"
FT   CDS_pept        complement(461087..462598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0410"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain"
FT                   /note="PFAM: Bacterial regulatory proteins, gntR family;
FT                   Aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78674"
FT                   /db_xref="GOA:C5BWZ9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5BWZ9"
FT                   /protein_id="ACQ78674.1"
FT                   /translation="MTSDARHRRELDLLTIGTERDDPDDRARSWSEDLRTVVRRGEGVS
FT                   AGLAEAIRSAARSGALRAGVRMPSSRALAEDLGVSRNTVTEAYTQLVAEGWLATRQGSG
FT                   TWLADRAGDGPDVAPIDIGSRLEEIASFRYSFEPGSPDVSAFPREAWAAAARRALLAAP
FT                   SRSLGYIDSRGDPGLRHTLAEYLGRVRGVVCHPEQVVVCSGFTQALAVLSRVIASRRGV
FT                   LALEEQRHWHHTVVVHTAGVRTLTLPLDEDGADVARLPSTSATAVLLTPAHQYPSGARL
FT                   STARRRAVIEWARTSGGLIVEDDYDGEFPDPRGRHRALQGLEPGHVAYCGTVSKTLAPG
FT                   IRLGWVVAPPVWVGEIVRTKRNLDQQAGVLTQLTLDDLITSGEYDRHVRRSRLAYRRRR
FT                   EALASTVRMAAPWADIQGGIGGLHVVLTWSDRPGMPTVEAVQDSCARLGVSPPPALTRF
FT                   GPVPAGRAGVVIGFATPAEHEFRGALAALASALRAAAAEAGPAEV"
FT   gene            complement(462707..463618)
FT                   /locus_tag="Bcav_0411"
FT   CDS_pept        complement(462707..463618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0411"
FT                   /product="helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78675"
FT                   /db_xref="GOA:C5BX00"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR041413"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX00"
FT                   /protein_id="ACQ78675.1"
FT                   /translation="MDHRAEVREFLMTRRARVDPERVGLQRGDDRRVPGLRRGEAAALA
FT                   GVSVEYYARIERGGLGSASPAVLDGIARALLMDDAEREHLYRLADRAGAAGGGSPRQER
FT                   GTTGWRPSPTLQWFLDSVGTAAALVGNGRTDLLAWNPLGRALMDELIATSTTVRPNFAR
FT                   FIFLQPVARRFYPDWDTAAAMNVAQLRTEAGRVPHDKELHDLIGELSTRSDHFRRLWGR
FT                   HDVWHHESGTKRYHHPIVGELTLHYDGLDVVGNPGVQLTVLTAEPGSPDYEALQVLGAW
FT                   STPEPGTPHSRSLTPRATEAEA"
FT   gene            463822..464166
FT                   /locus_tag="Bcav_0412"
FT   CDS_pept        463822..464166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0412"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78676"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="InterPro:IPR041183"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX01"
FT                   /protein_id="ACQ78676.1"
FT                   /translation="MEDDAVAAQLTEQLPSDHILSFDSRMGTAQVAALPQPLDVRGDAM
FT                   RSYRAGDVVYWSTEQALVIFLTDGFAVPDDGVLTRIGAVVDGMDQLVGCERDCRVHFGA
FT                   TSSSLGRGGG"
FT   gene            complement(464355..464699)
FT                   /locus_tag="Bcav_0413"
FT   CDS_pept        complement(464355..464699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0413"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78677"
FT                   /db_xref="GOA:C5BX02"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX02"
FT                   /protein_id="ACQ78677.1"
FT                   /translation="MAVPKIGQGAAAAGELEAESLMFFVCASVFGAQAIAIGWFCNRVN
FT                   DRFGYWLNLVVLGLIDAAFVAVMVVPGHVDIAAGLSGPLIWVVAAATSTVAIRTGHPSP
FT                   APRSPEPAQT"
FT   gene            464919..465188
FT                   /pseudo
FT                   /locus_tag="Bcav_0414"
FT   gene            465532..466518
FT                   /locus_tag="Bcav_0415"
FT   CDS_pept        465532..466518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0415"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78678"
FT                   /db_xref="GOA:C5BX03"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX03"
FT                   /protein_id="ACQ78678.1"
FT                   /translation="MRVVAFVLTVVGLTVLTGLAGLGMVVQADRTDPLWLSVSGAGVAL
FT                   AFSGPVVLGSLAAWWQLRGSSDSGRYYRLWRNVATAGTVLGAALVVVAGLAMGVPIWLL
FT                   LVIAVVALGLLIVAVPVGDRVRRSADAKGRVTDAFAPDTSDDTRRVIRRTALTFAITLV
FT                   VVAAAWIPLTVMTGEEPNDLRLAMALSGFPFIAASLACSLSALRLNRRVREVTGQDFGR
FT                   LRAIARVVLKGKDDELDELGQIAAARYAALAPATLGTQLGSVALLYVGLALNITSQALG
FT                   GVIPSTIPLVMLAVLAIALAVVIPLQLRNIRRARNYAAEHRDLLSNR"
FT   gene            466730..467101
FT                   /locus_tag="Bcav_0416"
FT   CDS_pept        466730..467101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0416"
FT                   /product="DoxX family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78679"
FT                   /db_xref="GOA:C5BX04"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX04"
FT                   /protein_id="ACQ78679.1"
FT                   /translation="MNLALWITAGLLALAFLGSGAVKLVKSRDDVVAAYAWAEDFSKGQ
FT                   IRLIGAAEVLGAVGLVLPPALGTMTVLTPVAAAGLALLMVGAVIVHLRRGETSKIGYPL
FT                   VLFVLAAALCVLRAGPYAF"
FT   gene            467133..468638
FT                   /locus_tag="Bcav_0417"
FT   CDS_pept        467133..468638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0417"
FT                   /product="monooxygenase FAD-binding"
FT                   /note="PFAM: FAD binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78680"
FT                   /db_xref="GOA:C5BX05"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX05"
FT                   /protein_id="ACQ78680.1"
FT                   /translation="MDHENLHDTTALVVGGGPTGLTAALVLAANGIACRVIERRTAPSS
FT                   SSRALGLQARSMELLAGLGVAEEVERVAYRLSGASVMRGDDELVRLPWIPPDSRYPYTY
FT                   VLPQVGLEHLLRTRLGELGVEVERGAELQRLTQDDAGVVAHLADGRRLTAGWLVGADGA
FT                   RSRVREELGIAFPGTATGETYYLADVVLRLATPIEDSAMWLGPEGPFMLMRLPGGEGLW
FT                   RIFVDVTDAARAADLPEPSAEILGDLLDERGPGGAGIERLDWTSVFHTRVCLADAYRRG
FT                   RVFIAGDAAHVFPPFGGQGMNLGIQDAVNLAWRLATVARGGPQNLLDDYETERRPIAAA
FT                   TIRDVEARRRMYALRHPVARALRDLLLRMGGRSERAARSGARKNSQLDSGYSTGGPFAP
FT                   RPRVGDRAPDGALGTGTVHERFGPDHLTLLRFRAGASPEPLTRDGAVLTVSVDDGTDPG
FT                   GTLRARYGMRGDGFVLVRPDGHIAARGARPTQARLAIEALQPQ"
FT   gene            complement(468672..469670)
FT                   /locus_tag="Bcav_0418"
FT   CDS_pept        complement(468672..469670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0418"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="PFAM: Sigma-70 region 2; Sigma-70, region 4;
FT                   TIGRFAM: RNA polymerase sigma factor, sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78681"
FT                   /db_xref="GOA:C5BX06"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX06"
FT                   /protein_id="ACQ78681.1"
FT                   /translation="MTTENGPDQGRREPNHSTVMGERRHLLNLAYRLLGTLAEAEDVVQ
FT                   ETYARWYAQSPQERDAIRSPGAWLTTVAGRICLDVLGSARARRERYVGEWVPEPLPAAG
FT                   QWSSVGRPAGLGDPADRITLDESVTMAFLVTLEAMSPAERVALILHDVFGYSFPEVANI
FT                   VGRTPAACRQLASSARRRARAYESPETSTIRHAETVRAFKRAWVAQDIEALLELLDPDA
FT                   TAIADGGGLAHAALDPIEGADQVAHHYVSIAERTPANVTIVECLVNGQPGLSVQREGAI
FT                   VTVLAFDITGDRIQHIWAVLNPAKLQRWNDDADRRPTAGSVPPSTPRASDR"
FT   gene            complement(469829..470179)
FT                   /locus_tag="Bcav_0419"
FT   CDS_pept        complement(469829..470179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0419"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78682"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX07"
FT                   /protein_id="ACQ78682.1"
FT                   /translation="MATYTVNPGGLKHARRLIDARQYVLDSDWGEVQPRADDENAYLER
FT                   HSWEEYAAWHLGLTEGASDETKARYAFVCGDFRRVHRTALIACVYRASEWRHKEIELAA
FT                   HDLLQHLDRVSG"
FT   gene            470385..471338
FT                   /locus_tag="Bcav_0420"
FT   CDS_pept        470385..471338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0420"
FT                   /product="NLPA lipoprotein"
FT                   /note="PFAM: NLPA lipoprotein; TIGRFAM: lipoprotein, YaeC
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78683"
FT                   /db_xref="GOA:C5BX08"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX08"
FT                   /protein_id="ACQ78683.1"
FT                   /translation="MSQDSTSHDDIAGHLARTRKRRRIGFVAGGVVVLAAAITIPLVLR
FT                   NSSSPAEGAAGEDELIPLTIADTAQSDFQDAIVDVGRENGLDIEFINFDDPYLPNTALV
FT                   EGEVDANSFQHVAWLSQFNSENDTEITPVFSTVISAWGLFSDRYSSADDIPDGARIAVP
FT                   DDPANFSRALFILQTAGVLEVDEDAGVFPTEEDITANPRGVELVRIAHESVQTAYGDPT
FT                   IDAVVVATDDFDPALGITSDDALTLEDSAASTSSPYVIVVATTPERVDDPAWPLLEQTY
FT                   RDERVVAALEEEKRGEATIVEMPVEDLREALAELTE"
FT   gene            471347..472372
FT                   /locus_tag="Bcav_0421"
FT   CDS_pept        471347..472372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0421"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter; NIL domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78684"
FT                   /db_xref="GOA:C5BX09"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX09"
FT                   /protein_id="ACQ78684.1"
FT                   /translation="MTERIRLTGVSKRYASAGRGPGALALHDIDLSIAAGEIYGLIGRS
FT                   GAGKSTLLRTINGLETPTSGQVLVDGVDVHALAPRELRELRHGIGMVFQQFNLWGSRTV
FT                   YGNIATPLKVAGWKDDAIAARVGELIDFVGLGGKAFARPRHLSGGQKQRVGIARAIASR
FT                   PSILLADEATSALDPQTTVEIVELLRSVNRELGITIVVVTHEMDVVKRIADRVAILSEG
FT                   AVVESGEIHQVLAHPRHPVTAGLVGSYARTSLSDADRAELHERFDGRRIAVAADDAVVD
FT                   GPLLTRLARTHGVDFAIVQGGVARVKGRPYGQLSLALYGDDGALDRFTAELATQAEVTS
FT                   W"
FT   gene            472369..473037
FT                   /locus_tag="Bcav_0422"
FT   CDS_pept        472369..473037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0422"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78685"
FT                   /db_xref="GOA:C5BX10"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX10"
FT                   /protein_id="ACQ78685.1"
FT                   /translation="MTFAGIDLDVVVPKVADALYETLLMVTASFVLATVIGLVLGIFLF
FT                   ATRSGQLLQSSVAHTVLNIVVNTLRPIPFIILLIALTPVTRSLIGTSIGPAAAILPLTI
FT                   AASVGIARVAESNLVAVDPGVVEAAKAIGARPLHILFGFVVREAFGPLLLSLTFIFVAL
FT                   IDATAVAGAVGGGGLGNLALTYGYQRFDYGVMILIIVVLIGLVQLVQLLGNRVARRFID
FT                   "
FT   gene            473037..474035
FT                   /locus_tag="Bcav_0423"
FT   CDS_pept        473037..474035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0423"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78686"
FT                   /db_xref="GOA:C5BX11"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX11"
FT                   /protein_id="ACQ78686.1"
FT                   /translation="MPASRTGRSVLVIGGGVLGSAVAASVAVRGHDVTLVTDEPGLATR
FT                   VGLASFAWVNTAGSLPDDYRELRSDARAVHADLSANGDAWFAQTGSEVGTERTAEDGWV
FT                   DVARFVAAQRARVVARGGSVRTGVRVRDLRRTSRGLTATAVPLGGAEGQDVAELRPDRV
FT                   VVAAGTGTAELLRGLGPVSRRVGTATGPRGFLARVRLAEPLPVDGVVVRDDLQLRPDGP
FT                   GRLAVQSLRLEEALRAGGESATPATVWPHLRADLERALGTDVPEQALLRVDEAARPVST
FT                   DGLPVVGPVEADVHVVLTHSGVTLAPLLAELVARDLDGDADAGARLRPYRP"
FT   gene            474053..475282
FT                   /locus_tag="Bcav_0424"
FT   CDS_pept        474053..475282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0424"
FT                   /product="putative transcriptional regulator, GntR family"
FT                   /note="PFAM: Aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78687"
FT                   /db_xref="GOA:C5BX12"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX12"
FT                   /protein_id="ACQ78687.1"
FT                   /translation="MTDPHADRLAGASTLLATLPERRGFGDATLIRPVPGSIDLGGGNP
FT                   SVDLLPTELYRDATHAVVTDPAFGTALRYSAAQGLPALRAAVAARERVDPERIVVTNGG
FT                   AHGLALAVLGTLDRGDTIVVDDPVYPLFLRVLDLVGGVNVVAAPVTADGIDVDAVERLL
FT                   RDGLRPKALFTVPTFQNPAGGTLSTEASAALVDLAERFGFTIIADDPYREVAFPGVVVP
FT                   DRPRFRDTDRVVGVNTFSKTLGPGLRLGWLTVPESLRPAYTKLRNRLDGQTSGVLQSVV
FT                   ARMLADPRYDAAVARAGAGYEPRARALAAALRDELAGHVEVRDPDGGFFVWARLDVGAE
FT                   DSARLFDVAQDAGVVYQRGEWFAAGQERFTGFVRLSFSEGDPETLREGVARLATAWRTV
FT                   RTPSVARQER"
FT   gene            complement(475302..476231)
FT                   /locus_tag="Bcav_0425"
FT   CDS_pept        complement(475302..476231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0425"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: Aldo/keto reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78688"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX13"
FT                   /protein_id="ACQ78688.1"
FT                   /translation="MATSTTDTLTTPDAAAGTWRLGDLTVNRLGFGAMRLAGMPWDPAP
FT                   RRRGDSIAVLRRAVELGVNHIDTAAFYLLPTRSINELISTALQPYSDELVITTKVGASR
FT                   SRDGEFEPYARPDQLRGQVEENIRQLGLDHLDVVNLRWGSGLVQEAGSVAEHVGALADL
FT                   RDAGLIRHIGVSNVLPEQLTEALEVTPVVCVQNRYGLTERADDGLLAQCGELGIAFVPF
FT                   FSVGAAIPGAAPGGGVPDDTGRSEVAAVAAAHGATPAQVRLAWTLHRGPHVLAIPGTGS
FT                   VAHLEENVAAGALRLSDDELALLDGIRS"
FT   gene            476328..476987
FT                   /locus_tag="Bcav_0426"
FT   CDS_pept        476328..476987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0426"
FT                   /product="response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78689"
FT                   /db_xref="GOA:C5BX14"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX14"
FT                   /protein_id="ACQ78689.1"
FT                   /translation="MQTGEAVTIVQGEAELLARTTHLFATATDVACAANDLVTWAGAHG
FT                   SAEFTAALRAQSENDVRIRKVYRPNVLLDPVSARGLAKARDRHGAQIRITTEEINETII
FT                   LDRRLVILAGDLSAGRRSYSVITQREAVQGVTSLFEAAWRSATDLAVFDARIAEIRELA
FT                   PRVLDLLGQGVKDETAARMLGLGVRTYRRRVAELMDALGAESRFQAGVRARELGLV"
FT   gene            477078..477632
FT                   /locus_tag="Bcav_0427"
FT   CDS_pept        477078..477632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0427"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78690"
FT                   /db_xref="GOA:C5BX15"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX15"
FT                   /protein_id="ACQ78690.1"
FT                   /translation="MTLLTAVVGNPRQGSRTHALTATVVDQLARAVDADEIETVDLAAL
FT                   GAALIDPAGEGPRAARELAAASDLLVVATPVYKATYTGLLKLFLDGYGSNGLDGVTAVG
FT                   VVVSAAPGHLLSTDIHLRSLLVELGAVVPTRSLGVVEAQLEGAASLVAEWTSAHADTLR
FT                   RLTGPASGARQVAELATGGRA"
FT   gene            complement(477629..477973)
FT                   /locus_tag="Bcav_0428"
FT   CDS_pept        complement(477629..477973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0428"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78691"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX16"
FT                   /protein_id="ACQ78691.1"
FT                   /translation="MWASRPQARHSSNIDARSAVGFVIFETPVSVEGRTRAVYAEATAA
FT                   EASEADRARCLGVVDRRSRAEGLGGWTTERVTAPADLRLYRAVVSRLFVLHPDRDLRRE
FT                   VDVDAVIAAG"
FT   gene            478224..478847
FT                   /locus_tag="Bcav_0429"
FT   CDS_pept        478224..478847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0429"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: Bacterial regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78692"
FT                   /db_xref="GOA:C5BX17"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX17"
FT                   /protein_id="ACQ78692.1"
FT                   /translation="MARDAGGQTVKRADARRNIEAILDAAASRLSRDPEATIAQIAQEA
FT                   GVGRITLYGHFASRAELVDAVVARTIAEGDAALDEVDLTGDAREALVRLIGSSWLLIVQ
FT                   IGALMTVAAATLPPERMLELHAGPVSRVESLIDRGRAEGAFRTDVPSSWLAGTLHRLMH
FT                   GASVEIDAGRLAPHDAAATIAATALAAFTAPGETVPSVDQASQW"
FT   gene            478844..479425
FT                   /locus_tag="Bcav_0430"
FT   CDS_pept        478844..479425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78693"
FT                   /db_xref="GOA:C5BX18"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX18"
FT                   /protein_id="ACQ78693.1"
FT                   /translation="MTVAQGAGRRRTAWLGRRWPTAAGIVMAASLAAAFWVGFADLRDL
FT                   AQILTAAGLVYLGAGALRRRAAAWPLFAMTFVLIGIGFAVPGFDPTLWMSGIAVALLVY
FT                   GLARGALRPPWGMPLQAGVMVLIVALVVVAAWVGQPWAGVLVGVGLLAHAGWDVYHHRT
FT                   RRVVASSMAEFCCVLDTLVGVALIVTSLVA"
FT   gene            complement(479434..480198)
FT                   /locus_tag="Bcav_0431"
FT   CDS_pept        complement(479434..480198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0431"
FT                   /product="protein of unknown function DUF125 transmembrane"
FT                   /note="PFAM: Integral membrane protein DUF125"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78694"
FT                   /db_xref="GOA:C5BX19"
FT                   /db_xref="InterPro:IPR008217"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX19"
FT                   /protein_id="ACQ78694.1"
FT                   /translation="MTTLHADHDLLSPTSASSSEARSESGEPLAQGLAARLNWLRAGVL
FT                   GANDGIVSVAAVVVGVAGATSSTPAIVVAGAAALVGGALSMALGEYVSVSSARDSQHAV
FT                   IARARRNATDPERGLADVAAAYERRGVSAATARQVAAELVAHDADAAHLEAAGIDEDDV
FT                   VSPWHAAGASALAFVLGALLPFLTVLLVPAPVRIVATVGAVLVALAVLGAAGARLGRAP
FT                   MGRPTARVVLGGALALAVTYGIGSLLGVTGVV"
FT   gene            complement(480353..481840)
FT                   /locus_tag="Bcav_0432"
FT   CDS_pept        complement(480353..481840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0432"
FT                   /product="hypothetical protein"
FT                   /note="TIGRFAM: Tat (twin-arginine translocation) pathway
FT                   signal sequence"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78695"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR024535"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX20"
FT                   /protein_id="ACQ78695.1"
FT                   /translation="MNQERETAQAARITRRGLLRTAGIGTGAIVATTLGTAPATATPGA
FT                   GWENVKDHGAVGNGTADDLAAIRAAIDAVDAQGGGIVFFPSGRYRLGDALRIGDGSDAA
FT                   VSTRHHRVTLQGSGRGGSPSLNFVQNDGATELVYDGPVDPDAAALSLEGPLHSLAVSNM
FT                   VVNANAKAGYGVRVNHVTDSIFTNVMTRAATVSGWILTSRNGFPPGCVYGCGNNVLLHC
FT                   WSYDAEPAAHGLVMTSGVTESVTLTGNPDAANNDVIGGVYFYGGSAGTAGFFLHGADNN
FT                   TVYGAQAIPSGGAQGGSSVYFQPWSGDPRFPLENVFTNIGMSQDVGGTSGTFGNIFTTF
FT                   QEGDGAALPDLPYITAMSHRGVQSAYGKRVLRTRDLQLAALATSTTVTTPDYSGVPGLS
FT                   VALTGVASGSARVRTTFTGVIEKAQGGTGDLCLAVDGVPIEHTRQRAAAGAGQVNASAA
FT                   VVVEADSETPELSVVARSSNGHPLTVHAGSLTVEELY"
FT   gene            complement(481855..482571)
FT                   /locus_tag="Bcav_0433"
FT   CDS_pept        complement(481855..482571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0433"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: UTRA domain; Bacterial regulatory proteins,
FT                   gntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78696"
FT                   /db_xref="GOA:C5BX21"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX21"
FT                   /protein_id="ACQ78696.1"
FT                   /translation="MTTTQAEDGKAERVRRHLEQLIDTSLQPHDRLPPERLLAAQLDVS
FT                   RMTVRQALDSLEAEKRVYRVQGSGNYVAERVIEKTIRLTSFTEDMRERGMTPGARLVTS
FT                   GTEHAGPEVGARLGLSPADAVVRINRIRLADGEPVCLEAVHISEKRVPGLLEEDLSGSL
FT                   YDLLTTRYDIAVSTAQQRIGATVVDQADAKLLEVAPFSPALVIERLTLDQHRRPLEYTR
FT                   SLYRADRYSFLIDIER"
FT   gene            482822..484156
FT                   /locus_tag="Bcav_0434"
FT   CDS_pept        482822..484156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0434"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: Bacterial extracellular solute-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78697"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX22"
FT                   /protein_id="ACQ78697.1"
FT                   /translation="MKRTRRRVVAALALVSATSLVASACSSGSEGGEGGEEEATLRIFV
FT                   HANPPTDAGFEAINAMFEEQHPGVTVELTTAQGADFFTVRNTRLTAENVDITEGSSSGG
FT                   TRLLPDWVQDQTESDWVVGLQAGTWVDLTDQPFLDNFSPEIMEAYEYEGRSYAVPTGTS
FT                   LVGGVYYNTALFEEHGLELPTTWDELLHVIDVFEAAGVAPFIMGGKDVWPAGAPMYGLV
FT                   QSLFPDSAALDQGLWEGDVQLTDPEVVTLMERLATIYAHTYPQWEGIDYSSVPARFAAG
FT                   DAAMMPDGGWSIPAIQEADPDFEFGYFPLPGSDNAADNDTIAGKLEFSLSIPTSSDNQE
FT                   LAMEWLALYSDPEVYSDFIVASGFGTAQPDVELGPVLQGVQQYLPEGGFTPSWDQVFHG
FT                   NRYAGPLAANPFAFDNVAPVGTYTDMAELTARMNDDWQVGLDSLP"
FT   gene            484252..485091
FT                   /locus_tag="Bcav_0435"
FT   CDS_pept        484252..485091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0435"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78698"
FT                   /db_xref="GOA:C5BX23"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX23"
FT                   /protein_id="ACQ78698.1"
FT                   /translation="MAPGLLLFALFGLIPAVAVIGMSFTNISGMPNVPWEWTGLDNYRR
FT                   FFSAGAAAANMSVIVRTIVFAFSVTVILNALALFIAIILNRRLPGAAIARSIVFMPVAF
FT                   GVTVVGLVWSLMLNPTGGPAASLWEIFGARSAFLGDPRLAFPLIILVQIWAAIGTTMMI
FT                   YHAGLQAVPDDLYEAATVDGANAAQRVRHVTIPMVAPSITANMIISIVGSLQTYQIIYV
FT                   LTGDRPTTSVLAMQIFSLGFGSSEQGYAAAVSMVQFVLVAVVALVFLAYLRRRETQL"
FT   gene            485088..485966
FT                   /locus_tag="Bcav_0436"
FT   CDS_pept        485088..485966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0436"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78699"
FT                   /db_xref="GOA:C5BX24"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX24"
FT                   /protein_id="ACQ78699.1"
FT                   /translation="MTTLELSRTPVQAAPRKREARTSKRLSTLLVYVAMLLIAVVYLFP
FT                   LFFLLNTALKAPGEFNRDPMGIVDAPALENFSAAWRQGDFGSLVANSVVYAMVSATVST
FT                   VLSVFIAFPVARNYVRWSRFFRVLFVISLFLPNALVAQFQLVLQLGLYDTRLGYMLLMT
FT                   AGLGLGPLLVMGYLRSLPRELDEAAALDGCGYLRYVLTFVFPLCRPVVITVFLLQVIGV
FT                   WNDIIGATIYLASPELRTISLGLFSFYGQYGNNQWELLSAATLIVAGPLILLFLLAQRF
FT                   FVSGAIGGALK"
FT   gene            485963..486697
FT                   /locus_tag="Bcav_0437"
FT   CDS_pept        485963..486697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0437"
FT                   /product="N-acylglucosamine-6-phosphate 2-epimerase"
FT                   /EC_number="5.1.3.9"
FT                   /note="PFAM: Putative N-acetylmannosamine-6-phosphate
FT                   epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78700"
FT                   /db_xref="GOA:C5BX25"
FT                   /db_xref="InterPro:IPR007260"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX25"
FT                   /protein_id="ACQ78700.1"
FT                   /translation="MTTPSLERLRGGLVVSCQARQGEPLDAPDHIVALARSAVLGGAVG
FT                   VRIDGSENISAVRRATDVPIIGIKKVADRERPRITPTEADVIEVLDAGADIVAVDASMQ
FT                   YRTDVAALHRIVRRIRAHGTATVMADISTRSEAERAWEAGVDVVGTTLYGHTPQTSATV
FT                   GPGLELVAELVPLGMRVIVEGRVTEPAEVEAAFTLGAWSVVVGGAITSPIDLTRRFAAV
FT                   TPRRSGDHEPAEAGRGTSGGPG"
FT   gene            486694..487644
FT                   /locus_tag="Bcav_0438"
FT   CDS_pept        486694..487644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0438"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78701"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX26"
FT                   /protein_id="ACQ78701.1"
FT                   /translation="MTGTNDGAPVVAVDVGGTKIRSALVCGRDQVGEAGWRATPREGGA
FT                   PVLQAVRAEVEALVASSAVRPRGVGLACAGTVDRDRGVVVAAGSTLADWSGTRLRRALE
FT                   PGLGLPVVVDNDCNAFASGVAADDGGSLLAVMVGTGLGAGLVIDGELHRGRRFTAGEIA
FT                   HMAAGESVGPWCGCGLPGHLEGIASGSGIDRYHAHLTGQGAVGVGVVAQRYRHGDPTAA
FT                   QVVTAAGAALGGALAGLAVALDLDRVVVGGGVIDAVPEVGEIVANRFDHALPPTLQRDV
FT                   RLEVSPDSATAVLRGIARQVADTTARRPGPEGHAR"
FT   gene            487641..488687
FT                   /locus_tag="Bcav_0439"
FT   CDS_pept        487641..488687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0439"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78702"
FT                   /db_xref="InterPro:IPR032287"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX27"
FT                   /protein_id="ACQ78702.1"
FT                   /translation="MTTPPAPSPSAQPWFTTRGIVLTWDDVTSYDWPALAARAGLTTVS
FT                   VHTSADGWASPAAHELRARCAELGLAIEEQQHALDRLLPRALFDTAPGMFRAGADGVRT
FT                   PDANCCASSPDALDVIAEHAVTELERSATTTDRFYFWADDGGGWCHCPRCSELSPSDQS
FT                   LLISNHVMRALRRVRPAAQLSHLAYQSTMAAPVATVPEKGVFLEFAPFFRTWEVPLSRT
FT                   EANGPGWDPSVPDRSSPRAGRRDMLRVSHAEYLDRLDENLTVFPAATAQVLEYWLDVSL
FT                   FSDWTMPAVELPWSDGVLEADLDTYGSRGIRHVTTFGAYMNGEYFASVGGVEPVERYGR
FT                   ALAAWRPR"
FT   gene            488786..489130
FT                   /locus_tag="Bcav_0440"
FT   CDS_pept        488786..489130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0440"
FT                   /product="protein of unknown function DUF488"
FT                   /note="PFAM: Protein of unknown function, DUF488"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78703"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX28"
FT                   /protein_id="ACQ78703.1"
FT                   /translation="MTIATKRVYDDAAHGDGYRVLVDRLWPRGVSKERAHVDVWLRDVG
FT                   PSDELRRWFHHEARLFEEFADRYRAELATNPAVETLRGIVRSHDVVTLVYSARDAEHNQ
FT                   AVVLRDYLSD"
FT   gene            complement(489134..490450)
FT                   /locus_tag="Bcav_0441"
FT   CDS_pept        complement(489134..490450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0441"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78704"
FT                   /db_xref="GOA:C5BX29"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX29"
FT                   /protein_id="ACQ78704.1"
FT                   /translation="MRQTVSLWWMLRRRSAGRSDPQGLTAVLATIAFAVTTAVVLVVLG
FT                   GVLAFQERAVGADEFSDAAVYPILAYVAAGLLVIPIVTLGAAAARLAMARRDARLAALR
FT                   LAGATTSQVGLLTLLEAASQAVVGAVLGVVGYLALIPLVAQLRFQNRTFELAELWVGPG
FT                   YVALAVLAVVVLALGSAALSLRRVAITPLGVAARVTPKGLSWLRVVPVVVAGGAWIALL
FT                   NSPYAGIGILLAVLLVGFAILNVVGPFVVWLIGRVTTARARSAATLIAGRRILDSPKTA
FT                   WRTVGGVSLATFIAGMASVMSVLTGADADVVTRDMATGGFLTLGIAGLLAAVSAGVMQS
FT                   GRIIDQRAEYRTLALTGAGLGVMRSAQLREIVIPLLVGMGVAAGFSLMFLVPMLGFSAV
FT                   TDPSVVLQFAVSVLAAFALVIAGVLASRRVLRTVLTQEA"
FT   gene            complement(490447..491364)
FT                   /locus_tag="Bcav_0442"
FT   CDS_pept        complement(490447..491364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0442"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78705"
FT                   /db_xref="GOA:C5BX30"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX30"
FT                   /protein_id="ACQ78705.1"
FT                   /translation="MTDASPLVARRLAKTYGDAQNPTVALDGVDLTISPGQSVAIMGPS
FT                   GSGKTTLLHCLAGILAPSGGTVTWRGAELGGLSDAQRTALRRDDFGFVFQSGQLLPELP
FT                   AEENAALPLLLAGSERPHAVSRARQWLGYLGLAGMEQRRPGELSGGQAQRVAIARALVG
FT                   NPGVVFADEPTGALDRTTGYEVMHALTTATRASGAALVVVTHDPEVARWCSRTISMRDG
FT                   RIIGEAVQEAAGGQAAAAPVAPSAQPMVAPTQQPAPPAQPAQTAPQAPAAQPAPPAQPA
FT                   PPAPPAPPAQPVAPAGTTPWGGAR"
FT   gene            491738..491810
FT                   /locus_tag="Bcav_R0006"
FT   tRNA            491738..491810
FT                   /locus_tag="Bcav_R0006"
FT                   /product="tRNA-Arg"
FT   gene            complement(491915..492997)
FT                   /locus_tag="Bcav_0443"
FT   CDS_pept        complement(491915..492997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0443"
FT                   /product="protein of unknown function DUF87"
FT                   /note="PFAM: Domain of unknown function DUF87"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78706"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR008571"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX31"
FT                   /protein_id="ACQ78706.1"
FT                   /translation="MLQLPVGTHAGSAEPFSLDGARFNRHTFWCGQSGSGKTYALGVVL
FT                   ERLLLDTGLPMLVLDPNSDFVSFGQPAPSAPEDVAQQIRERDVRVFRPRGEGGEPLLVR
FT                   FVAMDLASRAAVLRLDPIADAEEFNAMRRLQDDSGPQDADALEAALRQSSEPGARPLLL
FT                   RVQNLGTLGWDVWARGRVSVESVIEERPAATVLDLGGFDEPEESTTAALAVLDRLWALR
FT                   AERKPLLIVIDEAHNLCPPDPLTPVRRAITERIIQIAAEGRKYGLWLLLSTQRPSKIHP
FT                   QVLSQCDNLCLMKLNGPLDLAHLGEFFGAVPPDLLQRAPSFRQGQALFAGGFAATPTIA
FT                   QLAERFTLEGGSDVTVPLRG"
FT   gene            complement(493106..495922)
FT                   /locus_tag="Bcav_0444"
FT   CDS_pept        complement(493106..495922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0444"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: Bacterial regulatory proteins, luxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78707"
FT                   /db_xref="GOA:C5BX32"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX32"
FT                   /protein_id="ACQ78707.1"
FT                   /translation="MPTLPAEAVTPREHDVLVGVAQHLTNAQIARDLHLSVRTVETHVS
FT                   ALLRKLGVASRRDLAATAAGLTARPDGSARPADHDGPRRVPGPHRHSLRSAGTPSGVIG
FT                   LPAPRTSFVGRRAEVDAATRLAQESRLTTIVGPGGAGKTRLAIAATTAVAPAFPSGGAY
FT                   VDLVPTRPGHVDEAVATALGVTEGPGQTLRQALAAALRGRVLLVLDNAEHLVDDVTGLV
FT                   EDLLDACPGLSIVATSRERLAVAGETVLLLGPLHVADEAVVLFTERARDGDPAFAAEPA
FT                   DVEDLCRRLDCSPLAIELAAARVASLGVAGLRAGLADQLRVVAASRGGHERHRSLRAVI
FT                   EWSHRLLAADERYVLARTSLFAGSFTLSSAAALCPDLAPGTVADVVGRLGDKSLVHRAE
FT                   DAARWTLLASVRQFAREQLDASDDAGRTVGLYRTWAASTAADLRRRMASGADWWDALEL
FT                   VQDDLRACARLEDPSVPTRDGGGRALPGGGGGGATRHALVRDLARLTTARGCVGEARGH
FT                   FLAAARLAPSGAAAARDLADAASCAHLLTHAKDAYDLLLEAAQVAGADGGVRADALAGA
FT                   VVVARRFLGSGFERPVERPVLEGMFAEADRIAAGDDDGASRRVAPVAVARAWLSGDGAQ
FT                   LVDAGAAAHAVAQVRETGDVVLLSAALDASSTAWAASGRPDESHRLAGERLDLVALMDR
FT                   SDPGALVEIVDAHRGASAYAIATGAVAEALEIGERAAAETSLAAYHRRSLDWLVVAAAL
FT                   AGDHARAVDLAERSWSAFLDAGRPRTSTFGVPMLAGSLAAGLAGDSGGADRWRERAREG
FT                   TGLADFHASPNLAPWDAFVRARLALHTGELDGVLASVGAEFSPGRFDGYAAAVAAEIAV
FT                   VAGSPNVEDRLETAARHAGRNRWVAASLQRSRARLTGDTDALHDAAELFGNLGAAFERE
FT                   RTLALVGT"
FT   gene            496103..496474
FT                   /locus_tag="Bcav_0445"
FT   CDS_pept        496103..496474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0445"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: AraC-like ligand binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78708"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX33"
FT                   /protein_id="ACQ78708.1"
FT                   /translation="MLIVAKEADLRIGTGRTVRFEGEGYGSGISYFHVENEPGQGPDAH
FT                   VHPYSETWVVLAGTAHMRTADGETLAHAGDVVVVGPDTAHAFRAAGTETLRMMCIHASP
FT                   RIQQEFLADDESERLAVAF"
FT   gene            496541..497119
FT                   /locus_tag="Bcav_0446"
FT   CDS_pept        496541..497119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0446"
FT                   /product="bifunctional deaminase-reductase domain protein"
FT                   /note="PFAM: RibD C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78709"
FT                   /db_xref="GOA:C5BX34"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX34"
FT                   /protein_id="ACQ78709.1"
FT                   /translation="MSTRKIVVGQFVSLDGVVESPQTWHFPYLNDEMGAALGQLYAEAD
FT                   TLLLGRATYEEFAAVWPHQTGAMADAINGVRKVVVSTTLVDPDWQNTTVVAHDVLREVA
FT                   RLKESPGRDIAVTGSITLTQALLAAGLVDELRLLVHPIVLGAGRRLFADGGAFADGEAP
FT                   GRGATRVPLALASSTTFATGVLDLTYRPA"
FT   gene            497168..497509
FT                   /locus_tag="Bcav_0447"
FT   CDS_pept        497168..497509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0447"
FT                   /product="Domain of unknown function DUF1801"
FT                   /note="PFAM: Domain of unknown function (DU1801)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78710"
FT                   /db_xref="InterPro:IPR014922"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX35"
FT                   /protein_id="ACQ78710.1"
FT                   /translation="MTTIDELVAGLDDERRETATRLCTLLDSALPEASARVYHGHPVWL
FT                   DEARPVAGFKPFPRYVTFMIWNAEPIDDTSGTLVPGARMSTVKYAAAEEIDEALVRDWL
FT                   ARSAGVRGA"
FT   gene            complement(497734..499320)
FT                   /locus_tag="Bcav_0448"
FT   CDS_pept        complement(497734..499320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0448"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: Major Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78711"
FT                   /db_xref="GOA:C5BX36"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX36"
FT                   /protein_id="ACQ78711.1"
FT                   /translation="MTTTQPTSRRDVPARAGAREWTALGVLALPALLVSIDVFVLLLAL
FT                   PSLSSDLGATATQQLWILDVYGFMLAGFMLTAGTLGDRIGRRRLLLIGGAAFGVASIVA
FT                   ALSTGPLMLIVARGALGIAGATLAPSTLALISNLFRDPAQRAQAIGVWLVCFMGGAALG
FT                   PVVGGIVLEHFWWGAAFLLGVPVMVLLLILGPLLLPEYRDATAGRIDLASVALSLAAIL
FT                   PFVFGVKELARAGWAPLPALGLTAGIAFGVAFARRQLRLTDPVLDLRLFRNHRFSAGVG
FT                   GMLLIASTGVTMYLVTQYLQLVRGMGPLEAGIATLPGVVASITGFLVSPLLARRVRPGV
FT                   LIASGMAVAASGVVVLTQAGVGGPLTFAVLGYALFQLGCGPMVTLGTDLVVGSAPPEKA
FT                   GSAAAASESSGELGYGLGIAVVGSVAAAVYASRLSASTTASLSAADEAAARGSLAGAVE
FT                   VARTLGDDALLDAAREAFLAGMRAGLVGVVGVMVGVAVIGLGALRHVPSLRQGHSSGAS
FT                   APQPAPAGEDS"
FT   gene            499525..500985
FT                   /locus_tag="Bcav_0449"
FT   CDS_pept        499525..500985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0449"
FT                   /product="protein of unknown function DUF1222"
FT                   /note="PFAM: Protein of unknown function (DUF1222)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78712"
FT                   /db_xref="GOA:C5BX37"
FT                   /db_xref="InterPro:IPR009613"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX37"
FT                   /protein_id="ACQ78712.1"
FT                   /translation="MEWFAAGDYTIAREILQRGVAAVFVLAFVAVLRQFPALLGSGGLL
FT                   PVPRYLARLERVTRRSRVLTLFWWRYSDALLRTVGWVGLLLALSLVVGLPQAGPWWVPL
FT                   VAFLLLYVLYLSIVEVGQTFYAFGWETLLLEAGFIVAFLGSDDVAPPVLVLLAARWLVF
FT                   RVEFGAGLIKMRGDPAWRDLTALYYHHETQPMPGPLSWHAHHAPRWWHRVEVAGNHVTQ
FT                   LGIVWLLFAPQPVASIAAGVIVLTQAWLVVTGNFAWLNALTMVLAASAISDSSWRWLLP
FT                   FLPEPADDGVASGANIGFGVVVAAFFVLTVVLSYWPVRNLLSQRQLMNASFNRFRLGNT
FT                   YGAFGSITRRRREVVVAGTLAAEPTEDDWREYGFRGKPGEVRRRPPQVAPYHLRLDWLM
FT                   WFLALGGRDEAWFVAFLRRLLEADPATLRLLRHDPFDGVAPRFVRARVYRYRYTTRAER
FT                   RVSGDTWVRVSAGVLVPPVALGDLPPTP"
FT   gene            complement(501038..501919)
FT                   /locus_tag="Bcav_0450"
FT   CDS_pept        complement(501038..501919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0450"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78713"
FT                   /db_xref="GOA:C5BX38"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX38"
FT                   /protein_id="ACQ78713.1"
FT                   /translation="MLEPLLAVGGLGVRFDAVEAVRGATFDVGHGEFVAVIGPSGCGKS
FT                   TVLRALAGLLPAGARFDGAIDVPHEGGRPDVAWLPQRDALLPWRRAWANALVGARIAGV
FT                   PDAETRAAELFDRFGLAGFERAWPHELSGGMRQRLALLRTVLAGRRVLLLDEPFGALDA
FT                   LTRRSMNDWLAGLHLAGHADDGGASGVGRLAVGPGSSRLGAATADGAAAAGAVVLVTHD
FT                   VDEALRLADRVLVMSARPGRIVREVAVPGSAVSRDDAHPELRTELLAALDHDSDPSGRF
FT                   RPSGAPESTARV"
FT   gene            complement(501912..502961)
FT                   /locus_tag="Bcav_0451"
FT   CDS_pept        complement(501912..502961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0451"
FT                   /product="NMT1/THI5 like domain protein"
FT                   /note="PFAM: NMT1/THI5 like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78714"
FT                   /db_xref="GOA:C5BX39"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR027939"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX39"
FT                   /protein_id="ACQ78714.1"
FT                   /translation="MTLTHPGRAHRVARRSRAVPAAVVALALCATLAACGGIGGGASAD
FT                   GEAQRLRLVLDWTPNTNHSGIYLAAERGWYTDAGLDVEIVEPGETSGLQLVAAGQAEVA
FT                   LSVAESLVPAREQGADVVSIAAVIPENTSSLISLTADGITRPADLAGRRYGTYGSALEA
FT                   ALIERLVACDGGDPAAVEMTPLASDDFRIGLTQDQFDVGWVFEGWDTIRLRDVDGLDVT
FT                   TIPFADHTDCIPNWYTPLVATSQELVDSDPELLRAFLEATARGYEAATADPEAAADALL
FT                   AAAPALDAELVRLSAAYLAPRYSSTPEQWGAQDSATWDAFVEFLVSEGLAAPGTDPDAL
FT                   WTDELLPDA"
FT   gene            complement(502976..503734)
FT                   /locus_tag="Bcav_0452"
FT   CDS_pept        complement(502976..503734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0452"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78715"
FT                   /db_xref="GOA:C5BX40"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX40"
FT                   /protein_id="ACQ78715.1"
FT                   /translation="MRRTRRVLLPSLVLAALVAVWELAVRAAELPPFVLPAPTAVLAAG
FT                   VRLHDELGAHLATTLTEAGLGLAAGAFAGAGIAVVVALVPVIGDAVLPLVVLTQTVPTV
FT                   VLAPLLILWAGFGIGGKVVLVALTTFFPVMVATSSAMARADAELADMVRGLGGGRRDEL
FT                   ALVRLPAALPGALAGLRIAATYAIGAAVVAEYLAGASGIGVFIQHSRKAYAVDQILVGV
FT                   LLVGLVTGALVLAVDALSRRLVPWQRPDLS"
FT   gene            complement(503731..504024)
FT                   /locus_tag="Bcav_0453"
FT   CDS_pept        complement(503731..504024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0453"
FT                   /product="protein of unknown function DUF77"
FT                   /note="PFAM: Domain of unknown function DUF77; TIGRFAM:
FT                   conserved hypothetical protein TIGR00106"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78716"
FT                   /db_xref="InterPro:IPR002767"
FT                   /db_xref="InterPro:IPR029756"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX41"
FT                   /protein_id="ACQ78716.1"
FT                   /translation="MLVEIHVSPRPSGTPEQKYAHVDAAIAVIAASGLTYEVHALGTVI
FT                   EGPPDRIWSLVRDVHEATFAAGADSTMTTIRLAQGKDDAGPTIADLVTKFRA"
FT   gene            complement(504289..505167)
FT                   /locus_tag="Bcav_0454"
FT   CDS_pept        complement(504289..505167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0454"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78717"
FT                   /db_xref="InterPro:IPR025184"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX42"
FT                   /protein_id="ACQ78717.1"
FT                   /translation="MTSAALTPHPPDRAQSWATADPDIRSYVSAAVGLFTDELGDGVAG
FT                   VVLHGSLAAGCFYRAKADLDLLVVVADPIEPTSRARLSRGLAQLAGTRPILGDLEVSAI
FT                   TAAAAATFRHPSPYELHYSAAWRDAVLEGRVDVAAQQVDGDLAGHVVVSRARGVALLGP
FT                   PPVELFGAVPLEAFRDSVGADLAWTLSDDHLLESPYYGVLNVARTLRADAVGIERAVAE
FT                   GTSKEEGALWALANLPEPRRGVVAQALACYRSGRPVSEAERPTDGHDWDPAALRAFRDD
FT                   ARDALAGWVSP"
FT   gene            complement(505263..505778)
FT                   /locus_tag="Bcav_0455"
FT   CDS_pept        complement(505263..505778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0455"
FT                   /product="LPXTG-motif cell wall anchor domain protein"
FT                   /note="PFAM: Gram positive anchor; TIGRFAM: LPXTG-motif
FT                   cell wall anchor domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78718"
FT                   /db_xref="GOA:C5BX43"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX43"
FT                   /protein_id="ACQ78718.1"
FT                   /translation="MLLNVLSPICDGDAPYLVYDVDVENTEGSTATITFVNPSGGNVVY
FT                   TDLPLSGTILWPGAAVDGSGAPTDWPGWAFVGGEWVEDSSDAWLRNPITVTIEVNPTAS
FT                   ATVSYPPATPSCSANPPGREDPPPPSSGEARLPNTGTETLTYAGIAGGLVVLGGLTVAA
FT                   VRRRAHQG"
FT   gene            complement(506170..507984)
FT                   /locus_tag="Bcav_0456"
FT   CDS_pept        complement(506170..507984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0456"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78719"
FT                   /db_xref="GOA:C5BX44"
FT                   /db_xref="InterPro:IPR025101"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX44"
FT                   /protein_id="ACQ78719.1"
FT                   /translation="MREDDTREQDVLDDLLTDDDAARPARGRRTGRRIVGWSIAALLVA
FT                   VVAAAALLALDALRARDALAEAVPLVQAAEQQLEADPTADVDLAHLQDLTTTARTSTDG
FT                   PLWWLAARLPGLGADVHAVSVSADAVDVVTHDVLPPLLAARDGVDLAALRPVDGRVDLA
FT                   PIQAAAPLVREASDALAGVVADVAALDPAELRGAVAGPVESLQAGLATLDEQLTSARAV
FT                   TTVLPPLLGADGEQRYLVLFLTNSELRSAGGIPGALAVLTADDGRVALTDQVSTADVGP
FT                   FDDPVPGLAPEDAEIFGDRPARYIQDTTMLPDFPSAASLAATMWEASGRGAVDGVISVD
FT                   PVALSYVLTSTGPVDVPGGRIDADGAVDLLLSGAYAMFPEPAQQDEFFAGVSAAVFGSA
FT                   LGGAVDPSLLATAVERAAQEHRINVWSRDADLQADLVGLGVGGSLAAEPAASGVFLNDG
FT                   TGAKLDYYLDVETTSVAACAADADAVTLTRTVTLTSSVPADVAQLPWYVLGSAGAGSLE
FT                   PGVLRTNVAIYSPAGGSIDSIARDGVVIGGDVHDDGAGRQVTVVTVELAPGESTTLTVT
FT                   TSGAAGAGGTWMTPTARHGGDAAVATCG"
FT   gene            complement(508359..510959)
FT                   /locus_tag="Bcav_0457"
FT   CDS_pept        complement(508359..510959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0457"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78720"
FT                   /db_xref="GOA:C5BX45"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX45"
FT                   /protein_id="ACQ78720.1"
FT                   /translation="MRRVAWREVREHLGRFGLSVLAVLLGVAFVTGTFSLRAMLSATFS
FT                   SIVQSTIQGDAYLRGPAVADSDDAGGFDPADGPPEGGSSGAMFGGGGRALVPLTLADDA
FT                   AAIDGVAQAVPDVSGPLVLVGADGEAVINGQAPSIGVALADDDPGVTIVEGRAPRAADE
FT                   VALETGALAASGLAVGDATQVVLGDSVREVTVVGEASLGTPAAGATLTFLDLDTATAAY
FT                   APEGLVGSVAIYAEDGVALDDLLAALEPLATDDVEVASGDELREEANAQVQSILGFLGT
FT                   FLLVFAGISLFVGAFIVANAFAMSVRQRQRDFALLRALGASPGQVFGVVLVQAAVVGLV
FT                   GSAVGAVAGYGLVHVVRAGLRSVFGLTLSGEIPLSAATIAACVVAGTLVSVVAAAIPAR
FT                   RAALTAPVEAMRDDVVVTERSLLLRAIVGTVLLVLGAAGVVAAVRDADAALPGGRGLWL
FT                   GVGAGAALLGTIAIAPVIARACARVLALPFLPIKPLGALARGNVTRNPRRTASTASALL
FT                   IGMALVAACAVIAASAQASTRSIVTTEVAADLMVRSATGVVPADAVAAVEGVPGVGTAD
FT                   AVRFGEGRTEGPEGGSETATLGGIDAEGVQRAFTLDVRSGSLDALADGEVAVQQRVAVE
FT                   QGWAVGDSIELTGDGGARLTTSIGAVIDSQVVAVDVLLADEQFDEIMRQPQVAAVLVDA
FT                   APGTSVADLGDALDTALEPFVVVSALDADELTSLLGDMVDQALAILYALLALSVIIAVL
FT                   GIVNTLALSVVERTREIGLLRAVGLGRLQLGATITIESILIAVFGTFVGVAVGVALAAA
FT                   LPSVYADQGLSVLAVPWDRIGLILALAVVVGLVAAVGPAVRASRLPVLEAISTE"
FT   gene            complement(510959..511825)
FT                   /locus_tag="Bcav_0458"
FT   CDS_pept        complement(510959..511825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0458"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78721"
FT                   /db_xref="GOA:C5BX46"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX46"
FT                   /protein_id="ACQ78721.1"
FT                   /translation="MPRHASPSPETTGTHPTESPGAVVDPTGAPAAAGDALHSPGPVGD
FT                   AIVTARDLVKVYGAGSTAVHALRGVDVDFARGALTAIMGPSGSGKSTLMHCLAGLDTAT
FT                   SGTVTVDGQRVSDMSQRQLTALRRTHIGFVFQAYNLVPTLTAAENITLPMDIARAGVDR
FT                   ERFDAVVDAVDLRDRLDHRPSELSGGQQQRVAVARALVARPAVVFADEPTGNLDSRSAG
FT                   DLLEYLRRSVDDLGQTMVMVTHDPRSAAFADRVLFLADGRIVGELEQPTQTGILDALGE
FT                   LTPETER"
FT   gene            511950..512732
FT                   /locus_tag="Bcav_0459"
FT   CDS_pept        511950..512732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0459"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78722"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX47"
FT                   /protein_id="ACQ78722.1"
FT                   /translation="MEGTPEPPDDAAHAPAPESAAGPAPEPQQRRSRDRGKEGGRRRGA
FT                   ARAASARYSQSARSVLRPLPARVVLITAIAGIAAVGATGGFAPVELVDVPEVEPGTVME
FT                   LGPYTARVESFFVTDQVATSALESQEGAEAWLGVRAHIENTWTEPRVVSDSSFTPLLDG
FT                   EEVAPDGRPTDMLVRDGSTYVTLQPNLPEDVLMLWPIPDADAIGDEVTVRMDSLVYVDS
FT                   ELLGAWDWLRPQPVALVTLERDDDLPPQVIDPPEEEDT"
FT   gene            512729..513310
FT                   /locus_tag="Bcav_0460"
FT   CDS_pept        512729..513310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78723"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX48"
FT                   /protein_id="ACQ78723.1"
FT                   /translation="MSRRRWARRGVVVLLAVLVTFTGWLHNQRSTHPPAQPRAATGAVG
FT                   EDVTAYPLVVHVTGARAARLLTYEEFDGPMELDSGGAWVGVTLSYAGIDTPVLPSGFEL
FT                   RDAQGRTFSESDRVDVMTRTAQPDEFFRTEIVFEVPTGALDGDLLLRALPSGEVDIPMW
FT                   IAEIPLGRVEVDDAAPLEPVEGEFLPVGER"
FT   gene            513307..513858
FT                   /locus_tag="Bcav_0461"
FT   CDS_pept        513307..513858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0461"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78724"
FT                   /db_xref="GOA:C5BX49"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX49"
FT                   /protein_id="ACQ78724.1"
FT                   /translation="MSVDLAYGRNRGPGRTVALVVTALLAVGAMVVTVGWSDARRWWDA
FT                   QPRTAVVPDDDGVATIGDVAFRLSSFERLASIDTGFEIWQAPAGTQLWRVETEVVAQGE
FT                   EASACDLELLTADGRVFTRSDQAPAADVASWSFYCGYDEEDGPTQIVDFLLPADAEPVQ
FT                   VRIYSQFDTLPRYWAFDVDA"
FT   gene            complement(513831..515657)
FT                   /locus_tag="Bcav_0462"
FT   CDS_pept        complement(513831..515657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0462"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78725"
FT                   /db_xref="GOA:C5BX50"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX50"
FT                   /protein_id="ACQ78725.1"
FT                   /translation="MLARARGASRAAGRRRVGSLSRVSVPPPVPPPPGQPHERDVPTPP
FT                   RGTPRPGAPGHPQPAGRPVAGPPPPAGSPVPGPPPPAGSPVPGPPPPAGVPVPLPPPPG
FT                   VTASGPGVPGHGAPPPQTPRPTPEEDAPASPGSPPPAGAADQAPVPEGAGQILRDGLDV
FT                   LRDAGRLLARHWAPLVALAALAVIGRHLVLNLAVLTAPVNNVLGLLVFSLVPLVWLIAV
FT                   VGMLLVLRRPDRGSTDDDGARRRVRRTTGLVLASLGSVMVPFLLVYEYTGSLSDDRGRY
FT                   FLTSLQTQMGNAFDENLELDPTFDATADIPDPTSLVVLGTIAAALLVRFVGGRILRSRD
FT                   PEDDGGGWTWLRLVIGYSEVVWMVLGAVAIVEVTRNAQGWWRERSAAVELAAWWEGVVA
FT                   DLPHLGAFADAAFAVAAAAVGGAIVGVGVPLAWLTIGTIVYGVRAERVVDDPTALARGR
FT                   LGRLTARVTDRVGAERIRRAWASMLHPESRFGGLTGGLGLVLAAGWLPALLFCAAFLLA
FT                   QQADYVIWWLAGVALPTAVRTDWIALYPAIAAVAVVVSQVLSIALLASAADALLRRFGA
FT                   RSALRLPERMPSAAPTAAEAPAPHYASTSNAQ"
FT   gene            515896..516900
FT                   /locus_tag="Bcav_0463"
FT   CDS_pept        515896..516900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0463"
FT                   /product="Helix-turn-helix type 11 domain protein"
FT                   /note="PFAM: HTH domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78726"
FT                   /db_xref="GOA:C5BX51"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR028349"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX51"
FT                   /protein_id="ACQ78726.1"
FT                   /translation="MARMTDTPGRLLRLLSLLQARRDWPGATLAERLAVTPRTVRRDVD
FT                   RLRELGYPVVATKGPHGGYRLAAGQQMPPLLLDDEQAVALTIALVTAAPSVAGLDDAGQ
FT                   RALATVRQVMPARLRSRVDSLADVSVLRPEEPHGGVEPVSPDVLVALGDAVRAQEVLRF
FT                   DYAGGSGEQLTDADGATFRPPRRVEPHHVATWSGRWYLVAWDLDRRAWRTFRADRITPR
FT                   TPTGPHFTRRTLPAPDVATFLGRRLTAREWPCRGEAVVHLDAATLAPWMGDVGSVEDLG
FT                   PGRCRVLVGSWSWAGLAAWFGRLEVGFEVLGPDELRDACGRLAERYAAASRSV"
FT   gene            complement(516926..518776)
FT                   /locus_tag="Bcav_0464"
FT   CDS_pept        complement(516926..518776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0464"
FT                   /product="Gamma-glutamyltransferase"
FT                   /EC_number="2.3.2.2"
FT                   /note="PFAM: Gamma-glutamyltranspeptidase; TIGRFAM:
FT                   gamma-glutamyltranspeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78727"
FT                   /db_xref="GOA:C5BX52"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX52"
FT                   /protein_id="ACQ78727.1"
FT                   /translation="MAGVAPAPTFTTRPELLGTTGMVASTHWLASASGMAVLERGGNAF
FT                   DAAVAAGLVLHVVEPHLNGVGGDMPLIAHDASASRTFVLCGQGSAPAGATIEAYRDLGL
FT                   DLVPGTSHLAAVVPGAFGAWMHLLGRYGTLPLREVAQYAIGYARDGFPLVPQAATTIEA
FT                   VADVFAEHWTASAEIYLGRGPGRRGAPAPRSRFANPLLAETLERLVAEGEAAGAGAAAQ
FT                   AEGARRAFYSGFVAEAVDAFVRTPAWDGVGGEDARHAGFLTADDLDAWRPSEEEPVTTA
FT                   FGGLEIAKPGMWSQGPVLLAQLAMLERAGVADLAPGSPELVHLAVEVAKLAFADREAFY
FT                   GDSLDADAPDAVVSAPALLDPAYLAERVALLGETAADGLRPGSPGGRTPRLAEHVVRAM
FT                   ADGGAWPDGLTTPRVGEGEPTVARGDTCHLDVVDRWGNVVSATPSGGWLQSSPAVPGLG
FT                   FALPTRAQMFWLEPGLPASLRPGRRPRTTLSPGMALRDGRPAFAFGTPGGDQQDQWPVP
FT                   FLVQHLLHGANLQAAIDAPSWHSTHVPSSFAPREAEPMGVRAEPRLGAAVLDDLRGRGH
FT                   VVTEAGPWALGRISAAGMREDGMLVAAANPRGMQGYAVGR"
FT   gene            518938..519543
FT                   /locus_tag="Bcav_0465"
FT   CDS_pept        518938..519543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0465"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78728"
FT                   /db_xref="GOA:C5BX53"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX53"
FT                   /protein_id="ACQ78728.1"
FT                   /translation="MRAPRMQGYAWSMQTIPALRAALPRADEPPRGGAASPAGDLSLVD
FT                   PAEAARLAACGDLVDALRRMIRIYRAGSAHRERPHGLATGQVMVLTAVDRWAPARMSEL
FT                   ASRMHLDASVVSRQVAALEGLGLLEREPDPDDGRAWRVRLSAEGVASLADVRADQARIL
FT                   AEALPGWDAERLRHITTDLQDMARDVAAALDTHQEATA"
FT   gene            519540..521267
FT                   /locus_tag="Bcav_0466"
FT   CDS_pept        519540..521267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0466"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="PFAM: Major Facilitator Superfamily; TIGRFAM: drug
FT                   resistance transporter, EmrB/QacA subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78729"
FT                   /db_xref="GOA:C5BX54"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX54"
FT                   /protein_id="ACQ78729.1"
FT                   /translation="MTATTASTAPTTDTDSDAEHKQILRVLVGLLLALFVAMLSGTIVA
FT                   NALPVIIAELDGTQQQYTWVVTATLLASTAVTPLFGKLADLYDKKKLLLIGIGIFAVGS
FT                   LLSGLSTSAGMLIGFRVIQGVGLGALQALVQITIATIISPRQRGRYAGYMGAVMAFATV
FT                   SGPLLGGLIVDVSWLGWRWCYWSAIPLALIAMVVLARRLHVPPPSRTEVKVDWLGATLI
FT                   SAAVTLLLLWVSFAGPTHSYDWISWQTAVMVPGALALFGLFIWVESRVAEPIVPLWILR
FT                   ERTTTLAIVASIAVGVGMFGASVFLGQYFQIARGYSPTEAGLLTIPMMLGLLVSSTVSG
FT                   RFVTQIGRWKPFVVWGLVTFTAGMGLLGSIQYGTSLWLIGVFMLVAGIGLGASMQNLVL
FT                   AVQNTVPLSDMGAATSSITFFRSLGGAMGVQVLGAVFASHVSSLTATRLTDAGIPVAPG
FT                   GDGGGSLDLSELPDAVADIIRSAYGDSIGLLFLIGAGLALVGLVAALFMRGTHLRDTVD
FT                   LKAAVAEAAEEDVAVETAAATALGAAVAVDETADQTADETADAVDDADGVTAGARSTT"
FT   gene            complement(521239..522210)
FT                   /locus_tag="Bcav_0467"
FT   CDS_pept        complement(521239..522210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0467"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78730"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX55"
FT                   /protein_id="ACQ78730.1"
FT                   /translation="MSTELDERPDVLGSEWVARTLPLAPDEADPEGELVATLVRKAGPP
FT                   SSSTAVLYVHGFTDYFFQDHHARAWAGHGIDFYALDLRRYGRSLRAHHAAGDVRDLRAY
FT                   DEEISAAISVLRAERGHERVILLGHSTGGLILSLYAHAHPRAADALVLNSPWFDLNEAA
FT                   LRRMIATPLAESISRLDPTRRVGKLGGAYGRSLHTSTGGSWEYDLAWKPIEGFPVRAGW
FT                   LRAIRRAQARVARGLDVRIPVLVCSSTRSGGVAGRPATPEELASTDTVLDVQHMWRGAQ
FT                   GLGDDVTIVAVPGGLHDLTLSAPRARADFERAVFTWLSARLP"
FT   gene            522426..522728
FT                   /locus_tag="Bcav_0468"
FT   CDS_pept        522426..522728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0468"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78731"
FT                   /db_xref="InterPro:IPR011437"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX56"
FT                   /protein_id="ACQ78731.1"
FT                   /translation="MTATLEMPHVAECTVLGCDYNHDGCRAFAVTISSAHAGSTASCAT
FT                   FIDIGARGGLDRVVAQVGACQRTDCVFNESLECRAEAVRIGPGGGTAHCLTYTHG"
FT   gene            522927..524591
FT                   /locus_tag="Bcav_0469"
FT   CDS_pept        522927..524591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0469"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: Bacterial extracellular solute-binding
FT                   proteins, family 5 Middle; TIGRFAM: Tat (twin-arginine
FT                   translocation) pathway signal sequence"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78732"
FT                   /db_xref="GOA:C5BX57"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX57"
FT                   /protein_id="ACQ78732.1"
FT                   /translation="MPRSTTRSVVPSALNRRGFLLGTASVAGAGVLTACAGGGGEPGSS
FT                   GSTASGEPTTGGTLTVAFPADPENLDPHQRPQLYPRTITRQIADSLTDQDPETGEVIPW
FT                   LASSWEISDDVRTFTFTLRDDVTFSDGTPLTADVVTANWERILEIGPLAYVAAGLLRDY
FT                   SSSEVIDSHTVSITFANPNAQFLQATASQSLAVLAPATLALTPEEVAAGDVIGSGPYIL
FT                   ESYTPGEDVVLTVREDYAWGSPLYANRGRGYVDRIEFSIIPEPTTMAGAVASGQIDFAY
FT                   LLDVSVLSTVESSDAELIGTDMPAIAIPIVPLVYRPIFADERTRRALSLATDREAIVDS
FT                   VFEGRYQPASAVLTKANPGWVDLSDQLAYDVDGAIALLEEAGWTTVGDDGLRSNDAGEP
FT                   LRFEIQYTSAGTSSELMLQLLQQQWRAVGADFVLTPVSTPSEANLHEYPFDITTWSQTR
FT                   ADADVLRTVYSSFFENQSFLFDNADPELDGLLTELQTTVDAAARLEVSGEAQRLIVERG
FT                   YSIPLYDLTQFSAASSATSGAHADIEGKPVLVDIWKP"
FT   gene            524598..525563
FT                   /locus_tag="Bcav_0470"
FT   CDS_pept        524598..525563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0470"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78733"
FT                   /db_xref="GOA:C5BX58"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX58"
FT                   /protein_id="ACQ78733.1"
FT                   /translation="MRWYILRRLGQAALVLWGAMTLSFAIVHLVPGDPVRIMLGVGDGA
FT                   EGGSAATTEQIEQVRSELGLDRPVLVQYVAFLARAVTLDFGTSYSTQRPVTEVIAGATP
FT                   PTLQLAALSIALSLVLGLVFALAGALLPTRWIRSLFQSVTVLGIAVPSFWVAILLLQVF
FT                   SFSLGWFPAFGNDSFAALVLPAFTLALLTAGTLAQVLGRGIVESLAQPYADTARAKGAS
FT                   QARVVVRHALRNGSLPVFTIVGMMVGGILSGATIVETIYGRNGLGTVIVDAITARDFPL
FT                   IQALVIFSGGVFVIVTLLVDLGYRYIDPRVTSPAASEVLV"
FT   gene            525560..526438
FT                   /locus_tag="Bcav_0471"
FT   CDS_pept        525560..526438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0471"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78734"
FT                   /db_xref="GOA:C5BX59"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX59"
FT                   /protein_id="ACQ78734.1"
FT                   /translation="MTTSALTVATADPSGRLGTRRLPLGRALREPGLVLAVAYLGLVLL
FT                   AALAPNVLTTWDPVTDVDPAASLSAPSAEHWFGTDALGRDVYSRVVHGANLSITAGLLA
FT                   VSISLVVGVLAGVVSGYVGRWADSTIMRVMDVMIAIPGLLLSLAFVSILGFGVVNVAIA
FT                   VGIAGIPGFARLARAETLRLRNLAYVDAARCSGSGSARIIVRHIVPGAGTAVVVLAALE
FT                   IGGAVLAVSALSFLGFGAVPPTPEWGSMVNEGRSHIASAWWLTTFPGAAIAATVLACNR
FT                   ISRAVRVAGRS"
FT   gene            526435..528072
FT                   /locus_tag="Bcav_0472"
FT   CDS_pept        526435..528072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0472"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter; Oligopeptide/dipeptide
FT                   transporter, C-terminal region; TIGRFAM: phosphonate C-P
FT                   lyase system protein PhnK"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78735"
FT                   /db_xref="GOA:C5BX60"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX60"
FT                   /protein_id="ACQ78735.1"
FT                   /translation="MSAADGVVATSSSAPLLRVAGLSVTYRGRRGVHQAVRGVSLDVAR
FT                   GEVVALVGESGSGKTTIGRTILGLLPASAERYGAVELDGADLLRLPDRRRRRVLGARIA
FT                   TIPQDPLAALNPVQRIGPQVAEVLAIHGLASGDAARARALEALRLAGLDDAEARYRQYP
FT                   HELSGGQRQRVLIAIAIVAGPELIVADEPTSALDVTVQRRILDHLEHLVRETGTSLLLI
FT                   THDLGVAGDRADRVVVLSDGEVVEQGATGAVLERPEQPYTRALLEATPDRRPPATPPPS
FT                   AGSSDSPALEVRGLGRTFHVTGRPPVTAADDVSFTIPRGGALGLVGESGSGKTTTARIV
FT                   LGLLRPDAGEVLVDGRVQDSPAEIRRARRFVQPVFQDPYSSLSPHQSIASSIAEPLRAL
FT                   GGGNRAERRARVAELLDRVHLPASVGRRRPTELSGGQLQRVAIARALAIHPRLVVCDEP
FT                   VSSLDVSVQARVLDVLAELREQDGLALLFISHDLAVVRAVCEDVAIMRAGRIVEQGRTL
FT                   DVFASPASPYTAELLAAIPGRRTAAAVA"
FT   gene            528230..530719
FT                   /locus_tag="Bcav_0473"
FT   CDS_pept        528230..530719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0473"
FT                   /product="glycoside hydrolase family 43"
FT                   /note="PFAM: Glycosyl hydrolases family 43"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78736"
FT                   /db_xref="GOA:C5BX61"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX61"
FT                   /protein_id="ACQ78736.1"
FT                   /translation="MSPATPRTRRLAVVGLATASLITTLVAAPAAADPPDPAIDTGDPA
FT                   AVAAASVTPSPPPEPATITNPVSSPFADSYADPAVLRGRDGWFYAYATSDPLVSGGEFG
FT                   LMHMARTRDFADWEYLGTVFDDATRPAWAAPGSFFWAPDVRYVNGEYRLYYTVTDSLAK
FT                   PGADPGIGMATAPTPAGPWTDIGRPVLESQVLAEAGATAFDLRDYDGAVNSPRELRSPE
FT                   LAATESARAAVPAYQGLIDPSVLADTDGSLYLYVGGFAGGPHVTRLDDTGTTAIGELQQ
FT                   IAVSDRYEGSYVVQHDGAYYLMVSAAGCCSSVASGYSVFAGRSDSPFGPFVDAAGVPLN
FT                   QSRAGGTQVIAANGNRWVGVGHHAVVTDTTGQDWMVYHGIDRNDGWLNEPGGINKRPML
FT                   VDRLDWIDGWPVVNAGAGPSDGPEPGPVTGSALGITTDDPASGRAFRALTGSFASVPDD
FT                   DGDAGQVAALRPGRRVPAVAVARELLRGENRVEADVRLAGADAEACVRVDGLRRGVEVC
FT                   VDGAARELVVDARPGGRDVTAAVPERIDLEGWHTLVVTLEGDAVAAELQESRLGDPIAR
FT                   AVADVRRGGGVEGLLSLTARGAGADLDNLSVARLAEGPTTRVPDPEVGDVTYTQTFDGS
FT                   LDDVLADGWTLLGEHPGLTTADGALSWPLTSGDIAGANGAGPVLVRDAPAGDWVLETDL
FT                   ELDLGTDTVRNFQQAGLLVMADENFFVRLSSVAIGHSRTVEFFTEREHQGVLLLGGHLD
FT                   GPPATEITLRILRTENAAGEQLYRSAFSIDDGVTWRWGMTWTLPAGTDVRIGLQAGGGA
FT                   TPATTAAFEEVRIRDAA"
FT   gene            complement(530751..531629)
FT                   /locus_tag="Bcav_0474"
FT   CDS_pept        complement(530751..531629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0474"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/Bleomycin resistance
FT                   protein/Dioxygenase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78737"
FT                   /db_xref="GOA:C5BX62"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX62"
FT                   /protein_id="ACQ78737.1"
FT                   /translation="MAADTRMGAVTLHVGDMTAMRTYYTRALGLDVIAENSTGSRVTLG
FT                   RGAAPIVVLVHAPDLPRPRRGEAGLFHTAILFDDAASLAGALARLAQHAPHTFTGSADH
FT                   LVSEAFYATDPEGNGVELYVDRPRSAWRWTGSHVVMDTLPLDPNAYLQAHATPSALEDT
FT                   PGEDDAVVGHVHLQVGDVPTARAFYVDVLGFDETAALGHSALFFSAGGYHHHMAANTWA
FT                   SMGAGPRAQSLRLAQIEIDVPSADDVAALADRLRVAGIAHELDGGGGPGATALLRVADP
FT                   WRNELHLTSAR"
FT   gene            531697..532722
FT                   /locus_tag="Bcav_0475"
FT   CDS_pept        531697..532722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0475"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78738"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX63"
FT                   /protein_id="ACQ78738.1"
FT                   /translation="MPRAFAPGQTATVWIHDVETRERHRAWVSRDVLPEAPNWTPDGAH
FT                   LVLNGGGRLLVIDAERAVAPESVTPSPVDAAGLPPVNNDHVLAPDGRTVFASAEDGHLY
FT                   AVPLAGGSARRVSSSRGPTFTHYLHGVSSDGATLSYVGLERRADGVRTNLFTMPAAGGP
FT                   SVQLTDDDFPDDGAELGPGEDGTEWLWFSSERPLPGAPRRAPGHAQLFRMRPDGTGLEQ
FT                   LTHDERVNWFPHPSPGGTRVAYVSFPPGTLGHPADVADVRIRLLPLSGRAPSGADGELG
FT                   SIREGMAPESTPVRPPGGVDDDGVGRPRDLARVFGGQGAMNVPSWAPDSRRLAYVDYSP
FT                   V"
FT   gene            533006..534022
FT                   /locus_tag="Bcav_0476"
FT   CDS_pept        533006..534022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0476"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: Oxidoreductase family, C-terminal alpha/beta
FT                   domain; Oxidoreductase family, NAD-binding Rossmann fold"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78739"
FT                   /db_xref="GOA:C5BX64"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX64"
FT                   /protein_id="ACQ78739.1"
FT                   /translation="MTTHLETDRPLRWGILGPGRIAEKVAADFTHVRDGVLVAVGSRSQ
FT                   ERATAFASRFADVAPGPIRPHGSYADLLADDGVDAVYIATPHSEHARNAVDTLRAGKAT
FT                   LVEKAFTATYAGAERVVATARETGVFAMEAMWTRFQPAIVRMRELIADGAIGEVRGVQA
FT                   DLGTRREFDPDDRTFNLALGGGTLLDLGVYVVSFAQMVLGDPVGVTARGSLLPSGADAE
FT                   AGLLLDYGDGRVATLQTSFVTPSPGNARVYGTAGWIDVPPRFHHPHEIVLHRQGRDAVT
FT                   ERAMPDGAGYALELDEVARCVRAGRPESAVMPLADSLAVQRVLQDAADQMGVAFVDS"
FT   gene            complement(534059..534619)
FT                   /locus_tag="Bcav_0477"
FT   CDS_pept        complement(534059..534619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0477"
FT                   /product="protein of unknown function DUF664"
FT                   /note="PFAM: Protein of unknown function (DUF664)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78740"
FT                   /db_xref="InterPro:IPR007061"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX65"
FT                   /protein_id="ACQ78740.1"
FT                   /translation="MGERPERWTRGTVYTDMWVDPADDPRNTDGVSPDGELATLQDYTA
FT                   SYRFTLTMKCEDLDAEQLARRSVPPSTMSLLGLLRHLAATERDWRNGMGDADPLPQLHG
FT                   GTDADFDGAVADPAVVDAAYADLAREQAATDAALARHPDLGERLGEEQIAVREIWVHRI
FT                   EEYARHCGHADLLRECIDGRVGQ"
FT   gene            534776..535045
FT                   /locus_tag="Bcav_0478"
FT   CDS_pept        534776..535045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0478"
FT                   /product="Domain of unknown function DUF1876"
FT                   /note="PFAM: Domain of unknown function (DUF1876)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78741"
FT                   /db_xref="InterPro:IPR015057"
FT                   /db_xref="InterPro:IPR038070"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX66"
FT                   /protein_id="ACQ78741.1"
FT                   /translation="MDATKHWSIAVEIDEHDDTTRAQARLETAAGREVRGLGHAQRNPL
FT                   DASVPEIGDELAVARALRNLADHLLHTTEKDIEGATGEPAHLYR"
FT   gene            complement(535102..535614)
FT                   /locus_tag="Bcav_0479"
FT   CDS_pept        complement(535102..535614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0479"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78742"
FT                   /db_xref="GOA:C5BX67"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX67"
FT                   /protein_id="ACQ78742.1"
FT                   /translation="MGHGSHTLDGLDARPAASGTNKGMARMGRRGMWFTVSAAAVLALA
FT                   GCSGGGGGNVDRTDPVAVSQAFVDAVAAQDSGAACAQMADEDGPIADGDAQACEDQVDG
FT                   FISEFTEEELEIFGDVEVADAAVNEGGSTAYVQDESYSADTPEDARMPLILNLVDDEWW
FT                   VDIDVLN"
FT   gene            535733..536848
FT                   /locus_tag="Bcav_0480"
FT   CDS_pept        535733..536848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0480"
FT                   /product="ATP dependent DNA ligase"
FT                   /note="PFAM: ATP dependent DNA ligase C terminal region;
FT                   ATP dependent DNA ligase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78743"
FT                   /db_xref="GOA:C5BX68"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX68"
FT                   /protein_id="ACQ78743.1"
FT                   /translation="MALPLTSPIDPMLAKSVRGVPDADAVPGGYAYEPKWDGFRTIVFA
FT                   DDGDVELQSRNGKPMTRYFPEIVDAVKAELPARCVVDGEVVLSRGGRLDFELLGQRIHP
FT                   AASRVKMLAEHAPAALVVFDLLALGDDDLTQRPFAERAAALDELGLDGPSVHVTPRTRD
FT                   ADVAREWFTTYEGAGLDGVVAKPLDGAYEPGKRAMLKIKHERTADVALAGYRLHKTSTD
FT                   ERPLIGSLLLGLFDDGGDLRFVGVSASFPAARRAELYDELQELRVGEGDEHPWGNWQQP
FT                   EGSRRPGAVSRWNAGKDLSFTALRVERVLEVGYDHMEGDRFRHTAQFKRWRPDREPTSC
FT                   TYAQLDEAVGYDLAELLPGAPTAAPGFTGAL"
FT   gene            complement(536870..537673)
FT                   /locus_tag="Bcav_0481"
FT   CDS_pept        complement(536870..537673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0481"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78744"
FT                   /db_xref="GOA:C5BX69"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX69"
FT                   /protein_id="ACQ78744.1"
FT                   /translation="MTTTTVPAGPRSRRGGMPGLGRLVRTEAKLFVRSPGDVFFALIFP
FT                   TVLLVAVGFVIPGMRETIVEPGSPYDGLQVIATYAPVALAAAAATASLMSFPVVIATYR
FT                   AQGVLRRLSTTPMRPQGVLLAQVTIAIVVIAVAAALAIAAGFLAFDLPVIDNPLMLAVG
FT                   VALSALACLAIGMLVAAIVPTISLANAVASLLYFPLLFLGGMWLPLPLMPDGLARVASF
FT                   SPLGAGVEVMSAAWIGAPVPGAQVLVLLAYPVVLLPIAAKVFRWS"
FT   gene            complement(537670..538638)
FT                   /locus_tag="Bcav_0482"
FT   CDS_pept        complement(537670..538638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0482"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78745"
FT                   /db_xref="GOA:C5BX70"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX70"
FT                   /protein_id="ACQ78745.1"
FT                   /translation="MARHHADDGVPPVVEVRHLRKSYGEKVAVQDVSFAVAPGEIFGIL
FT                   GPNGAGKTTTVEAIAGLRHADSGDVRVLGIDTQAEPDRIRTALGMQLQESALPERITVR
FT                   EAIDLYGSFYPDPMPTEQLIDMLDLRDRAGARYAALSGGQKQRLSIALALVGRPQVAIL
FT                   DELTTGLDPAARRATWDLIETVRDSGVTILLVTHFMDEAERLCDRLVVIDGGRIVAEGS
FT                   PAELVSGDGELRTIHVRLAEAPSAAVLEALRAAPDVATVTGDGLDLEIRGGRRVLPSAV
FT                   AALDAAGIVPESLRTGARSLEDVFVGLISHDDTPAQEGAHP"
FT   gene            complement(538665..539375)
FT                   /locus_tag="Bcav_0483"
FT   CDS_pept        complement(538665..539375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0483"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78746"
FT                   /db_xref="GOA:C5BX71"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX71"
FT                   /protein_id="ACQ78746.1"
FT                   /translation="MARQVVLGSLRGTLPTYISFWVVMVIVLVVLTIVQARTGALEEPV
FT                   FAFIGSGRWFLFVMGIIVPVAMLATHVVGGGGTRRSVVRGLWALAIASGIAFGLLALVM
FT                   TIVQNALWAANDWPDVSLTGRSYVVTQPWRLALSETVCNAVYYVAGAAVGTGYYRWGGW
FT                   RGTAALPLAAVPAVVAEVTLQGSSYGEPLARALGMAAFSVPVAVAGSILATALAAGLLH
FT                   LIVRDIRIRALTSS"
FT   gene            complement(539473..540255)
FT                   /locus_tag="Bcav_0484"
FT   CDS_pept        complement(539473..540255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0484"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78747"
FT                   /db_xref="GOA:C5BX72"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX72"
FT                   /protein_id="ACQ78747.1"
FT                   /translation="MSTITASERAAAARRREAFMTRQVALGCLRSTWVVFAGFWVVMVI
FT                   VLAVLTVVQARTNALDEPVFAFLGSSRFFLFVMGIILPLALLAPHVVGSGGTRRSIVRG
FT                   HYALALASGVTFGLLAVLLTLAETRIRTMNDWPLVTISSSGLADSSEPWLMWFAESAYN
FT                   VLYYLVGCTVGTAYYRWGGWRGTAALPLALIPAAVAELALQNEWYGEWYGQSIAAALGI
FT                   GTPSAPVAVLGSLLAIALAGWLLHVVVRDIPIRGFTPS"
FT   gene            complement(540252..541136)
FT                   /locus_tag="Bcav_0485"
FT   CDS_pept        complement(540252..541136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0485"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78748"
FT                   /db_xref="GOA:C5BX73"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX73"
FT                   /protein_id="ACQ78748.1"
FT                   /translation="MTPAPFGAELRDVVVRYGDEQALDGADVAFRPGIITGLIGRNGAG
FT                   KTTLLSLLASLRRPTSGTVRVDGVDPFEDPLVMAGVHLVRESGDVIGDEPVRRTLRYYA
FT                   ATRPNWSTDLAAELLDVFAIVTKKSPNSLSRGQRSALGAVLGLASRAPLTIFDEVYLSM
FT                   DAPSRYAFYDAVLADYAEHPRTIIISSHLIEEVERLFEDVVIIDRGRVLVADSADAIRA
FT                   RGTGLTGPADAVEAIAREHTVLARQRLGGVVRVTLDVALDDDARRAVRAAGVEVDSVGL
FT                   QDLFVHLTRKETP"
FT   gene            complement(541133..541501)
FT                   /locus_tag="Bcav_0486"
FT   CDS_pept        complement(541133..541501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0486"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: Bacterial regulatory proteins, gntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78749"
FT                   /db_xref="GOA:C5BX74"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX74"
FT                   /protein_id="ACQ78749.1"
FT                   /translation="MFDGPEPIYVQIADMVRAQILAGSLGEEEQVMSTTQFSTTFRINP
FT                   ATVAKAYAQLVDEGLIYKRRGLGMFVTVGAREKLLAAHRAAFFGEVLDPALTQADLLGI
FT                   SRDAVVAHILGTSTTEKP"
FT   gene            complement(541485..542303)
FT                   /locus_tag="Bcav_0487"
FT   CDS_pept        complement(541485..542303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0487"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78750"
FT                   /db_xref="GOA:C5BX75"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX75"
FT                   /protein_id="ACQ78750.1"
FT                   /translation="MTTTARASRALPQATRSGLVLGGIAFAAAGSPVWGEPELGSPTSV
FT                   AQVAVAVIGGALLLVGVVGLGRSRPATSGRLGRWGTGLVVAGLAAHLLGSALGGLAPTL
FT                   PAGAADVVAVAAIPAWALAHLAYVGTTLIGVATWRSGALPRPVSALLVACAPLVLAGVP
FT                   ASLALEPAVGSGVSAVIAWIATEGQLGLGWLLVGVTGRRPGADDAGAGSALEHSHSGSL
FT                   GKRRSARALPAPNGSGRASQRRRLAPRPLPWFTTYVMNPRTRSGPYVRRP"
FT   gene            542384..543142
FT                   /locus_tag="Bcav_0488"
FT   CDS_pept        542384..543142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0488"
FT                   /product="protein of unknown function DUF328"
FT                   /note="PFAM: Protein of unknown function (DUF328)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78751"
FT                   /db_xref="InterPro:IPR005583"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX76"
FT                   /protein_id="ACQ78751.1"
FT                   /translation="MLLVLPPSETQARPSAGSGDPLDLADLSFPGLTDARERVLRGMVA
FT                   TSTRPDALRRLGAPAGAVADVLANVDVEDAPTRPAVELFHGALYAGLDAASWDPTTARR
FT                   AGRRIVILSSLFGALRAHDAVPAFRLPVCALLDGLDVGLERYWRAELGPVLDEAAGREL
FT                   LVDVRSSSYTSLWKPGPDVAERWVLVRVPGSPYEAKRTRGLLVRHLCGLPQGPLEPEEL
FT                   VPAVAEAFTTALAPPERPGRPWVLDVRLAG"
FT   gene            543305..543787
FT                   /locus_tag="Bcav_0489"
FT   CDS_pept        543305..543787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0489"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78752"
FT                   /db_xref="GOA:C5BX77"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX77"
FT                   /protein_id="ACQ78752.1"
FT                   /translation="MSDLIVNLQDFTESLPPLLRWVGVMLAGLIPYVEAEGAALIGTVA
FT                   GIHPAVAIPAAVLGNAIALAVVVGITSAVRTGVTRNRTSDANPKRERMRRVFDRWGVPG
FT                   VSLLGPVLLPSHVTAAAMVGFGAPRGKVLAWGVVAVAAWAVVIGLVAYLGIRATLG"
FT   gene            complement(544193..545395)
FT                   /locus_tag="Bcav_0490"
FT   CDS_pept        complement(544193..545395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0490"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: Major Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78753"
FT                   /db_xref="GOA:C5BX78"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX78"
FT                   /protein_id="ACQ78753.1"
FT                   /translation="MTTPSTTPSRLPYHALIWLAVAAFSTGIDGYVLAGLLPAIAGDLQ
FT                   VSDSWAGQLVSVFALTSALAGPILGAATGGWERRRTIAASLAVFVAGNLAVALAPNYPA
FT                   ALGGRVLSALGASLLNAVITSYVIHLAPEQHRGRALSFVLGGWMAATALGVPVGLLLGQ
FT                   SSWRFPLVMVAVVGAVALVGIALRLPRLTLPATTLRERLRPLGRPQLVGGLLVTTGILC
FT                   ASYTCFTYAVLILGPTHPESWMIIAIMFGYGLASLLGNAFTGRLADRFTPARVLTVILV
FT                   GLLLNSVLGAVSFAVTSLSVTAVLGLVWFFVAGVGNGGAAVPQQARLAAMAPESATMVM
FT                   ALNASAISLGSALGGGLGGLTLAGGLEPPGLLVVAAVVLAATLALHLAVATLTARRRRL
FT                   A"
FT   gene            complement(545512..546597)
FT                   /locus_tag="Bcav_0491"
FT   CDS_pept        complement(545512..546597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0491"
FT                   /product="DNA primase small subunit"
FT                   /note="PFAM: Eukaryotic and archaeal DNA primase small
FT                   subunit; TIGRFAM: DNA polymerase LigD, polymerase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78754"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX79"
FT                   /protein_id="ACQ78754.1"
FT                   /translation="MARAQTPPVELDVAGRTVKVSSPDKVLFAGVGDGVTKLDVVRYFI
FT                   SVGEGILAALKERPTTLERWPQGYADGMKLTTRQGAKGDGFYSKRVPQYAPDWVEPVEI
FT                   TFPSGRTAEEVCPSELAVVAWAAQQGTLTFHPWPVRRPEVDSPDQLRIDLDPQPGTDYV
FT                   DSARLAPLVREVAAEAGLTAVPKTSGGRGVHVFAPIEPRWSFVEARRAVIALGREVERR
FT                   APEQVTTNWWKEERGERVFIDFNQMARDRTIASAYSIRANVRATVSAPLRWDEVDQVQP
FT                   DDFTVLTMPDRFAEVGDLFAGANGDADHPAGSLDVLLEWAARDERDHGLGDLPYPPEYP
FT                   KMPGEPKRVQPSRDRDRPRDD"
FT   gene            546715..547392
FT                   /locus_tag="Bcav_0492"
FT   CDS_pept        546715..547392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0492"
FT                   /product="protein of unknown function DUF541"
FT                   /note="PFAM: Protein of unknown function (DUF541)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78755"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX80"
FT                   /protein_id="ACQ78755.1"
FT                   /translation="MPTIAVSGSTVQHHPAERGTVRLAITFTGDRRDHVFRAAEKLHGS
FT                   VVAQAKEHVAAGAATWWGSDRVVAWSYDEWVKPKPHQDGVKVRRFRASAAVRVKFADFA
FT                   ALGAWVSDVGVLEGIQVQGIEWALTEKRRDAVVAQVRTAAAQDAVTRAQAYADALGLGP
FT                   VRLLAVYEDGLRPHVSAGAPGPVAFGARAMAADAGGGAFELRPDDIDVHAELTADFEAG
FT                   TSA"
FT   gene            547396..548073
FT                   /locus_tag="Bcav_0493"
FT   CDS_pept        547396..548073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0493"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78756"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX81"
FT                   /protein_id="ACQ78756.1"
FT                   /translation="MRVAVYVDPSAGMAHDGWASATTFDLAAWGVVGQGPDDGAALADL
FT                   SRRLTDAGVVVDPAVVERLEPAPTGTERLFGPELLPATPEQRVATQAVLDDVRPRTLAL
FT                   LDSLGEAELDREDPERDLPAWAAWRTLRAMFWHIADCETRYYLACLGIPAPPRLQDLRA
FT                   ELVASAAAVREAVATMPADLVVDVGAEGRWSTVKVLRRLAWHERDELVAMTALAARARG
FT                   ATA"
FT   gene            548168..548509
FT                   /locus_tag="Bcav_0494"
FT   CDS_pept        548168..548509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0494"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /note="PFAM: Transcriptional regulator PadR-like family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78757"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX82"
FT                   /protein_id="ACQ78757.1"
FT                   /translation="MSMDDTSAGHLQELRRGTVVLASLVCLREAGYGYALLDQLDGLGI
FT                   SVDASTLYPLLRRLEKQGLLVSEWNTDEARPRKFYRTSPAGEALTAALVADWRRLNDSI
FT                   ESLLKENPS"
FT   gene            548506..549486
FT                   /locus_tag="Bcav_0495"
FT   CDS_pept        548506..549486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0495"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78758"
FT                   /db_xref="GOA:C5BX83"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX83"
FT                   /protein_id="ACQ78758.1"
FT                   /translation="MSRQSLTDRYVYAALRTVPEEQRAELDPELRELVADRIEAQDADE
FT                   AGDAERAALLELGDPARLAASYIDRPLQLIGPQHYLQWWRLLKLLWAIVPACVAAAVAL
FT                   GLAISGESVGSIIGQTISVVIQVIVHIGFWTTLVFAVLDRTVKEPLVEWTPDYLPEIPT
FT                   AGGVSGPSRLSRGDVVGGTVTQLLLVGALLWGTFGSPWPWTSVDPLLQSDLWPIWVLYF
FT                   AVVGVGQIALLVATFRRGFTWPLAAVKVALNVAFAVPAVWLTASGRLLNPDVVALAGDS
FT                   ATDVDTVLTAIIVITVIVIAAWDSIDGAIKASKQARLARRERVAA"
FT   gene            549502..549816
FT                   /locus_tag="Bcav_0496"
FT   CDS_pept        549502..549816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0496"
FT                   /product="acylphosphatase"
FT                   /note="PFAM: Acylphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78759"
FT                   /db_xref="GOA:C5BX84"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="InterPro:IPR020456"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX84"
FT                   /protein_id="ACQ78759.1"
FT                   /translation="MRDADAAGAPAGAGRSRVRRRAVVTGIVQGVGFRYSAQHVAESHG
FT                   VDGWVTNRGDGAVEAVLEGSPDAVEAVLAWLREGPPGAWVRDVVVTSEPPAGERGFEIR
FT                   "
FT   gene            549865..550536
FT                   /locus_tag="Bcav_0497"
FT   CDS_pept        549865..550536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0497"
FT                   /product="Pyridoxal 5'-phosphate synthase"
FT                   /EC_number="1.4.3.5"
FT                   /note="PFAM: Pyridoxine 5'-phosphate oxidase C-terminal
FT                   dimerisation region; Pyridoxamine 5'-phosphate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78760"
FT                   /db_xref="GOA:C5BX85"
FT                   /db_xref="InterPro:IPR000659"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX85"
FT                   /protein_id="ACQ78760.1"
FT                   /translation="MTSWRERLRALPTIPAEVEDLDVATLPGDPVDLFTAWLTEAIDAG
FT                   VPAPHAMTIATSGLHGEVSARALILKDVGPHGWAFATRRDSLKGAQIADNPRAALVFLW
FT                   PALGHQVRVVGPVRDLGDDAAAADFAARSPYSRASALAGHQGDELADVATHRRAYADAL
FT                   ARAQADPDLTLAAWRVYAVVPREVEFWHSSAAGQVRVVYSRPVDDDAAPGGAWRRTFRW
FT                   P"
FT   gene            550764..551603
FT                   /locus_tag="Bcav_0498"
FT   CDS_pept        550764..551603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0498"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: CAAX amino terminal protease family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78761"
FT                   /db_xref="GOA:C5BX86"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX86"
FT                   /protein_id="ACQ78761.1"
FT                   /translation="MSSPVEPSTARWRATPSVPVAAVVFVVYCVIVIGLMKAAGVGYEH
FT                   FFDSAQAALRAVVLPLAAGAVWLTAFLVWARWDHVFRDARRLPTSWFLWILPGLMALVA
FT                   VLHLLGLDWNRFTPGHVLAVLLASLLVGYTEETLFRGIVLRALRQGARSEGMAILWTTL
FT                   WFGGFHLTNLLLNEPGAVLQVVFAALTGTALYLARRGTGTIIAAMALHALWDNSTFLAG
FT                   VHTSDSGPALAANALTTVVYPLAAVTLVVLVVRDRRRPAREAITAEPGQVTEADSRS"
FT   gene            complement(551677..553074)
FT                   /locus_tag="Bcav_0499"
FT   CDS_pept        complement(551677..553074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0499"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: Major Facilitator Superfamily; TIGRFAM: drug
FT                   resistance transporter, EmrB/QacA subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78762"
FT                   /db_xref="GOA:C5BX87"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX87"
FT                   /protein_id="ACQ78762.1"
FT                   /translation="MSPRQRRALVVAILAAFVPFLDGAVVNVALPAIETELGGGLVTQQ
FT                   WVVDAYLITLGAFILLAGSLADVYGRIRIMTIGLVLFGATSVLCALAPTAEVLIVARAL
FT                   QGAAGALLVPSSLALIVQEFRGQAQAAAIGTWTAWTSGAFIAGPLIGGVLVDAASWRWV
FT                   FGINVLPVAVTLILMAALRGGDAVEAGRRIDVLGAALAAVGLGGTVVALIEQARLGWTH
FT                   PVVWVSLVVGVLSLVGFVVWERRSPDPMLPLALFRARNFAWGNLATFAVYGALGVGSFL
FT                   LTLFVQQVGNYTATQAGLALLPPTVLLLLLSGWFGRLAGRFGPRLFMTAGPLVAGVGYL
FT                   LMLGTTAEATYLTQLLPGIVVFGLGLAMTVSPLTAAILGAVEPERAGIGSAVNNAVARV
FT                   AGLLTVAGAGIVIGSTLDVAAFHRSLVATAVLFGLGGLISWVGIRTPAPAPPPPTEPAP
FT                   GADSSSA"
FT   gene            complement(553233..553892)
FT                   /locus_tag="Bcav_0500"
FT   CDS_pept        complement(553233..553892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0500"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78763"
FT                   /db_xref="InterPro:IPR025164"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX88"
FT                   /protein_id="ACQ78763.1"
FT                   /translation="MYTFDTPTTVTAVIDVPAGRVQVIAADRADTTVDVRAANAAKGRD
FT                   VKAEERTTVELSDGVLRIATPTKNELFGPSGAVEVTVQVPAGSRVEAKGPAELRGVGRL
FT                   GDVTIESSYGTVKLDEAANLRVTAIAGDVTVGRLTGPAEISTTKGDIRIDEATRGSVEL
FT                   RTQAGDVTVGAASGVSATLDAGTSYGRIENALQNTGSVELEIRATTSYGNISARSN"
FT   gene            554131..554892
FT                   /locus_tag="Bcav_0501"
FT   CDS_pept        554131..554892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0501"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78764"
FT                   /db_xref="GOA:C5BX89"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX89"
FT                   /protein_id="ACQ78764.1"
FT                   /translation="MPGGRLTQQERRQIALGLADDLAYAEIARRLERPTSTITREVMRN
FT                   GGPTAYRADLAHRATERRAHRRREPAVRASRDVRTDGRDAAAVRAYEESFTALLMQSGL
FT                   PRMAAGVLTCLYTADAGSLTAAELAERLQVSPGSISKAITYLENQGLVMRERGEGRRER
FT                   YVADTDVWYQSMVASARSNAQLAETARAGVAVLGRGTPAAVRLENMSRFVDFVGESIAR
FT                   AAEQAREILSTTSQAPPGPGGGSASSGEPGA"
FT   gene            complement(554998..558045)
FT                   /locus_tag="Bcav_0502"
FT   CDS_pept        complement(554998..558045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0502"
FT                   /product="type I site-specific deoxyribonuclease, HsdR
FT                   family"
FT                   /EC_number="3.1.21.3"
FT                   /note="PFAM: Type III restriction enzyme, res subunit; Type
FT                   I restriction enzyme R protein N terminus (HSDR_N);
FT                   TIGRFAM: type I site-specific deoxyribonuclease, HsdR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78765"
FT                   /db_xref="GOA:C5BX90"
FT                   /db_xref="InterPro:IPR004473"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022625"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040980"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX90"
FT                   /protein_id="ACQ78765.1"
FT                   /translation="MTDTASKFEPIAMSSDSTVVAEFTADPAEATRYQSEAELEAELVR
FT                   LLREQAYEYLPITSESDLVANLRRQLEALNHITFTDAEWKRFFAERIAGERDGIVEKTV
FT                   RIQEDHVQLLKRDDGTSKNITLLDKTHIHNNRLQMINQYEVPGAPSSDGAGRPRRANRY
FT                   DVTILVNGLPLVHVELKRRGVDLREAFNQINRYQRDSFWSGSGLFEYVQLFVISNGTLT
FT                   KYYSNTTRSQHLSEQGKAKRGRKTSNSFEFTSWWADATNRPIMDLVGFTRTFFAKHSLL
FT                   NVLTKYCVQTADRMLLVMRPYQIAATEQILTRIETSSNQKRFGTLSAGGYVWHTTGSGK
FT                   TLTSFKTAQLASKLGGVDKVLFVVDRKDLDYQTMREYDRFEKGAANSNTSTAVLKRQLE
FT                   DPSKRIIITTIQKLSTFIAKNAGHAIYGGHVVTIFDECHRSQFGDMHTAITKAFKRYHL
FT                   FGFTGTPIFAVNAGTGGNPTLRTTAQAFGDKLHTYTIVDAITDRNVLPFRIDYVNTVKV
FT                   GAVIDKQVSAIDTERALLDPARVRQVTQYVLDHFDQKTKRNQTYALKDRRVVGFNALFA
FT                   TASIDAAKVYYNMFSLLQEDLPDAKKLKVGLIYSYAANEAEDETAAGLLGEEEFETHDL
FT                   DASSRDFLEDAIQDYNDMFGTSFDTSADKFQNYYKDLSLRLKDREIDLVIVVNMFLTGF
FT                   DATTMNTLWVDKDLRAHGLVQAYSRTNRILNSVKTYGNIVSFRDLEQETNDAIALFGNK
FT                   DAAGIVLLKPYGEYFDEYADKVTELRERFPLGTPIVGEQAQKDFIAVFGALLRLRNILL
FT                   SFDNFAGNQILSDRDLQDYQSIYLDLYQSFRRADTAERETINDDVVFEIELIKQVEINV
FT                   DYILMLVEKYRAAKGDGDDREIRATIDRAIDSSPSLRNKKDLIEEFVDRLSVDEDVAAE
FT                   WRAYVATKRDAELEQIIADENLKPDQTRAFIDTAFRDGQVRVTGTAVTALLPPVSRFAK
FT                   GSNHGAKKQTVIERLTAFFERFFDLQ"
FT   gene            complement(558042..558875)
FT                   /locus_tag="Bcav_0503"
FT   CDS_pept        complement(558042..558875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0503"
FT                   /product="hypothetical protein"
FT                   /note="PFAM: GIY-YIG catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78766"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR040843"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX91"
FT                   /protein_id="ACQ78766.1"
FT                   /translation="MSQVIPVNVQIPSASTAPVVADFVSHALRVAYAARRDVDRLTPEE
FT                   WGVPGIYVLLTDDGTHQLYVGQAVDLRRRLLHHPSRPKLAWSRVVAIKRDTSHGFNSAE
FT                   IGYLEGRVAAELAAIPGVAVIEGKRDQDTTLPPHMLLSLDELLASVLAALRLAGVDTHK
FT                   EADELERTSPRGTRRKSPIAKRGTVADLLAAGLLRAGAEVHLSQGGRAASGTVTTSGEI
FT                   IVAGVAYASPSTAAQQALGLRSSNGWTTWRVGDLRGPTLDALRDRLAEVDGESVL"
FT   gene            complement(558875..560101)
FT                   /locus_tag="Bcav_0504"
FT   CDS_pept        complement(558875..560101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0504"
FT                   /product="restriction modification system DNA specificity
FT                   domain protein"
FT                   /note="PFAM: Type I restriction modification DNA
FT                   specificity domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78767"
FT                   /db_xref="GOA:C5BX92"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX92"
FT                   /protein_id="ACQ78767.1"
FT                   /translation="MSRIDDLIRRYAPDGVEYIELAELFSTRNGYTPPKSDASAWADGT
FT                   VPWFRMEDIREKGRVLDDSIQHIATTAVKGGRLFPANSIIVATSATIGEHALISVPHLS
FT                   NQRFTSLALKPKYQDRFEIKFIFYYCFVLDEWCKNNTTVSSFASVDMVGLKKFKFPAPP
FT                   LEVQRDIVRILDAFTELEAELEAELEARKQQYAHYRDALLSFGGSEAVSWATLSELCTI
FT                   QSGGTPKSDNAVYYGGDIPWCAISDITSASKYIRRTQRTITPEGLANSSAKVFDAGTLL
FT                   LSIYASLGEVTITSIPMATNQAILGLVPRDGSGILVDYLYYTMLSSKDRLLAQRQVGSQ
FT                   NNLNKAIVADFRVPVPAMPDQERIVALLDKFDALVNDLSSGLPAEIEARRQQYAHYRDR
FT                   LLSFEELTV"
FT   gene            complement(560098..561672)
FT                   /locus_tag="Bcav_0505"
FT   CDS_pept        complement(560098..561672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0505"
FT                   /product="type I restriction-modification system, M
FT                   subunit"
FT                   /note="PFAM: N-6 DNA Methylase; TIGRFAM: type I restriction
FT                   system adenine methylase (hsdM)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78768"
FT                   /db_xref="GOA:C5BX93"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR004546"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX93"
FT                   /protein_id="ACQ78768.1"
FT                   /translation="MNRETQRAELHKTIWRIANDLRGSVDGWDFKAYVLGFLFYRYISE
FT                   DLTAYLNAGERDAGSTDFEYVTAPNSVVADHEVVAGIVAEKGFFIRPSELFANVRARAA
FT                   RDPNLNETLERVFRTIESSAVGTEAEDDLKGLFDDVDVNSNKLGPTVAKRNEKLVRLLD
FT                   AIGDLNLGNGTFSENKIDAFGDAYEYLMQMYASAAGKSGGEYYTPQEVSELLARITVVG
FT                   KTSVNKVYDPACGSGSLLLKFRKVLGKGGVRQGYFGQEINLTTYNLCRINMFLHDVGFE
FT                   HFDIAHGDTLIDPMHWDDEPFEAIVSNPPYSIKWAGDANPLLINDPRFAPAGVLAPKSK
FT                   ADLAFTMHMLSWLAVNGTAAIVEFPGVLYRGGAEQKIRKYLIDNNFVDAVIQLPPDLFF
FT                   GTAIATCIIVLKKSKADNGVLFIDASAQFVRGGNKNKLTEANQQRILDAFTTRDDVVHV
FT                   AKLVDNEAISENGYNISVSSWVEAEDTREVVDITELNARIAGIVERQAALRTQIDAIVA
FT                   DLEGAGA"
FT   gene            561881..563134
FT                   /locus_tag="Bcav_0506"
FT   CDS_pept        561881..563134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0506"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78769"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX94"
FT                   /protein_id="ACQ78769.1"
FT                   /translation="MTDYRPRVVDAELARRMRVMGAVLIDGPKAVGKTQTTTRVAKTVL
FT                   RLDVDRVARAALETVPEQLFEYPTPILFDEWQETPDLWNLVRRAVDDHRRKGLYLLTGS
FT                   ATPRDDTRMHSGAGRIGRLRMRPMSLFESGHSDGSVGVAALLDGERVTGTTNTLTVPQL
FT                   LERIVVGGWPEITDWDWTDARDWLTDYLRNLAEVDVPRLGPRRNPGNIARLLASLARAV
FT                   GTPLNRSALEVEVGGATGPIASETLNNYLDALERLMVLEPLPAWRPHMRSRTRLRTTPV
FT                   HHFVDPSIGTAALGVGPADLLADLNAAGFHFESMALRDLRIYSQPLGATLSSWRDTQAN
FT                   KEIDAILELPNGTWAAFEFKLGEGATDAAAESLKAFASKVDTRKHGEPAALVVINGGRF
FT                   TVRRDDGVTVVPLSVLGP"
FT   gene            complement(563327..564721)
FT                   /locus_tag="Bcav_0507"
FT   CDS_pept        complement(563327..564721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0507"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /EC_number="1.8.1.4"
FT                   /note="PFAM: Pyridine nucleotide-disulphide oxidoreductase,
FT                   dimerisation domain; Pyridine nucleotide-disulphide
FT                   oxidoreductase; TIGRFAM: dihydrolipoamide dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78770"
FT                   /db_xref="GOA:C5BX95"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX95"
FT                   /protein_id="ACQ78770.1"
FT                   /translation="MATHYDVVVLGAGPGGYVAAIRAAQLGKSVAVVEKKYWGGVCLNV
FT                   GCIPSKALLKNADLAHTLNREKAKYGIEGDATMAYGPTHARSRQVSAGIVKGVHFLMKK
FT                   NKITEIDGWGTLTGPKAMDVALNDGATEQLTYDDLILATGSVTRMLPGVEVSENVVTYE
FT                   EQILDADLPGSIIIAGSGAIGVEFAYVMANFGVDVTIVEFLDRMVPLEDPDVSKELAKH
FT                   YKKLGVKVLTGTKVESVEDTGSGVKVTVSANGEQQVLEADRLLSAIGFAPRTAGFGLEA
FT                   VGVKLTDRGAVEIDDYMRTNVPGIYAIGDVTAKLMLAHVAEAQGIVAAETIAGAETMPI
FT                   DYRFIPRATYCHPQIGSMGLTEQQAKDAGHEIKVAQFPFSANGKAQGLGDGIGFVKIVA
FT                   DAEHNEILGAHMIGPDVTELLPAINTAQTWDLTADEMSRVVFAHPTLGEAVKEAFHGIT
FT                   GHMINL"
FT   gene            complement(564944..566407)
FT                   /locus_tag="Bcav_0508"
FT   CDS_pept        complement(564944..566407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0508"
FT                   /product="Cysteine desulfurase"
FT                   /EC_number="2.8.1.7"
FT                   /note="PFAM: Aminotransferase class-V"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78771"
FT                   /db_xref="GOA:C5BX96"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX96"
FT                   /protein_id="ACQ78771.1"
FT                   /translation="MSTSPLAPIVGLDSRVPIVTPDTSAGAGAAPRTVRYANLDYAASA
FT                   PALAAVAEAVTRALPLYASVHRGAGYLSQVSTALYEASRTAIGTFVGARTDDVVVITRN
FT                   TTDALNLLAGCVPEGGTVLVLDLEHHANLLPWQRSAGGADVLALRPTVAETLRTLTSAL
FT                   ATRNYTLLAVTGASNVTGEALPIDDVVELAHAAGVRVVVDGAQLLPHRAFSLASSGADY
FT                   VTLSGHKLYAPYGAGALVGRRDWLDAGRPYLAGGGAVTNVTASSTTWEPAPQRHEGGSP
FT                   NVIGALALGVAARELTAIGDDALRAHDAELRTRLVAGLEELDGVRTVALWSDSAEAVGE
FT                   PVGVVTFALPGHDPGLVAAYLSAEHGVGVRDGRFCAHPLLSRLDLDAGALRASIGLGTT
FT                   ADDVDRLLAGVRAYLDEGPGAEYVVVNGRWQPAADQRVLPEAVSLLAALGADATAPAVL
FT                   ATAAAGVGCGPAPEPATHAATHALASTPA"
FT   gene            566678..567874
FT                   /locus_tag="Bcav_0509"
FT   CDS_pept        566678..567874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0509"
FT                   /product="PT repeat family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78772"
FT                   /db_xref="GOA:C5BX97"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX97"
FT                   /protein_id="ACQ78772.1"
FT                   /translation="MTGTGHEPARPARVVRRWLLRGAIVVGGAGLGVLVAASAAQAEPV
FT                   ASEAPALSAGADGPAAATGLLEGIVDDVVAPVVEDAVAPVVEQVVDDVVAPVIDAIAPA
FT                   GVAPEPAAPEPVTPVPQPLPPVVDDAPRAPEPTDPAAPAAPASPGERPGRDTPTADLGG
FT                   AAARAVESLAPATAPVLDALDPVTEPVVDVLARALRPTLVEVGGSLGPVLGEVLGPLAP
FT                   VLGDVVVPIVHALPPVTGGALDPILRPVLPVLEPVLPGVVPAASDPPSRESSAPPGAPP
FT                   GPAARGDATAASVPIARPGVGTSGTTAPPGVLLPPLAAAAQQVSSASGDDGAPVRGPGD
FT                   EQVPAATTGAPASSSGGARDLAVVAALATVTFLLLGVARLRDTTLPSAPAFEVLVSPA"
FT   gene            567954..569342
FT                   /locus_tag="Bcav_0510"
FT   CDS_pept        567954..569342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0510"
FT                   /product="hypothetical protein"
FT                   /note="TIGRFAM: LPXTG-motif cell wall anchor domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78773"
FT                   /db_xref="GOA:C5BX98"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX98"
FT                   /protein_id="ACQ78773.1"
FT                   /translation="MHVFVKRALRIALCTGGLVVAGAGAASAAESGLLESIGVDAPIDV
FT                   SVGVSDVAVGVLGDAAAEPADEPLQVVPVMPEVVAGPQAVEAAPTADSAPVAELVDDVV
FT                   GVVADDVAVDVPVDVSVDVSDVAVGVLGDAGASSETPAAEPAASVAVDSAPTGAESEDS
FT                   TSLLGDVAVNAPIDVSVDVGCVAAGVVGDAAAACEEPAAAPGPAEPAAPAEPAAGPDEV
FT                   SVDAPVTVPVDVSGIAVGVLGDASAERAEAEANGPAPAPAPEEPAAPGAGSGVLDDVLG
FT                   PVDVDAPVTAPIELGCLGAGVAGDASVTCAAPATATPAPAEPADPGTREGGVSAGLPVT
FT                   VPVGVGCLGVGVLGDVSSQCTTTAAVDPGDPGDPGDPGDPGDPGTPGDPGTPGGSDDAD
FT                   QVGPSVPGGRSVVVARGPAPREASGELAESGASDAAGLAGPAALGLVLLGAGLVIGARR
FT                   RSEA"
FT   gene            569712..569951
FT                   /locus_tag="Bcav_0511"
FT   CDS_pept        569712..569951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0511"
FT                   /product="domain of unknown function DUF1737"
FT                   /note="PFAM: Domain of unknown function (DUF1737)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78774"
FT                   /db_xref="InterPro:IPR013619"
FT                   /db_xref="UniProtKB/TrEMBL:C5BX99"
FT                   /protein_id="ACQ78774.1"
FT                   /translation="MTERTTDAPPPPSGDQSARRRYRLLTGPDDGSFCDRVSAALDEGY
FT                   VLHGSPAATFDGAQVIVAQAVVLPAAPSAQVRPA"
FT   gene            569948..570406
FT                   /locus_tag="Bcav_0512"
FT   CDS_pept        569948..570406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0512"
FT                   /product="Rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78775"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXA0"
FT                   /protein_id="ACQ78775.1"
FT                   /translation="MSAAATPSGTTPQPGYAGDVTPERAWEILSEDDGAVLVDVRTRPE
FT                   WAYVGVPDTSDLGRDVVLAEWVSYPTGAPNPAFVDELRAAGLEPGDERPIVFLCRSGQR
FT                   SIGAALAATAAGFGPAFNILDGFEGGLDPQGHRGARGWRAVGLPWRQS"
FT   gene            570423..571655
FT                   /locus_tag="Bcav_0513"
FT   CDS_pept        570423..571655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0513"
FT                   /product="O-succinylhomoserine sulfhydrylase"
FT                   /EC_number="2.5.1.48"
FT                   /note="PFAM: Cys/Met metabolism PLP-dependent enzyme;
FT                   TIGRFAM: O-succinylhomoserine sulfhydrylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78776"
FT                   /db_xref="GOA:C5BXA1"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006234"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXA1"
FT                   /protein_id="ACQ78776.1"
FT                   /translation="MSDPRPRSPLPEGLRPDTLAVRGGQERTNFDETSEALFLTQGYVY
FT                   ERAADAEAAFAGELERFVYSRYGNPTVSTFEERLRLLDGAEACYATATGMSAVFTTLAA
FT                   LVKSGSRIVAGRALFGSSLVIFDEILAKWGVRTDYVDAHELDQWEAALATPADVVFFET
FT                   PSNPMQDLVDVRAVSDLAHAAGAVVVLDNVFATPVLQRPLDFGADVVVYSATKHIDGQG
FT                   RVLGGAILGPSDFIDGPVQQLIRNTGPSLSPFNAWVLLKGLETLSLRVRHATASALTIA
FT                   RWLEEQPAVADVRYPFLDSHPQVELAKAQQSGGGTVVTLTLDAGAEPEAAKARTFAFLD
FT                   ALRVIDISNNLGDAKSLVTHPATTTHRKLGLEGRAAVGIGEATVRLSVGLEDPLDLQED
FT                   LEQAFAAAARA"
FT   gene            complement(571680..572102)
FT                   /locus_tag="Bcav_0514"
FT   CDS_pept        complement(571680..572102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0514"
FT                   /product="protein of unknown function DUF307"
FT                   /note="PFAM: Domain of unknown function (DUF307)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78777"
FT                   /db_xref="GOA:C5BXA2"
FT                   /db_xref="InterPro:IPR005185"
FT                   /db_xref="InterPro:IPR031308"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXA2"
FT                   /protein_id="ACQ78777.1"
FT                   /translation="MRSVLNVILNIIWLLFAGIPMALGYAVAGLICFVLIITIPWGIAS
FT                   FRIANYVLWPFGRTVIDKPTAGLGSAIGNVIWIIVAGIWLTIGHLVSALALFVTIIGIP
FT                   LAIAELKIIPVTLTPLGKQIVPSDRPFATYGGVTQV"
FT   gene            complement(572186..572821)
FT                   /locus_tag="Bcav_0515"
FT   CDS_pept        complement(572186..572821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0515"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /note="PFAM: Phosphoribosyl transferase domain; TIGRFAM:
FT                   uracil phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78778"
FT                   /db_xref="GOA:C5BXA3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BXA3"
FT                   /protein_id="ACQ78778.1"
FT                   /translation="MRVHVADHPLVAHKLTVLRDERTDSPTFRRLTEELVTLLAYEATR
FT                   DIAVEPREITTPVTTTVGVHLRSPRPMVVPILRAGLGMLEGMTRLLPTAEVGFLGLQRD
FT                   EETLEAITYANRLPDDLSGRQCFVLDPMLATGGTLVASIEYLFLRGARHVTAICLLAAP
FT                   EGLRTVEDAVGDRADVTIVTAAVDERLNERGYIVPGLGDAGDRLYGVV"
FT   gene            complement(572868..573602)
FT                   /locus_tag="Bcav_0516"
FT   CDS_pept        complement(572868..573602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0516"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78779"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXA4"
FT                   /protein_id="ACQ78779.1"
FT                   /translation="MSLVLVTGSTRGLGLATARRLAEAGHHVILTGRGAADVEAAVSAL
FT                   RAEGVVVEGHPLDVTDQASVASLVAWVQERHGELDVLVNNAGILPEATATDAVDFASVD
FT                   LFRTTFETNVFGLVAVTEALLPLLRASGAARIVNVSSTVGSLAAQTDPASPWYEMLVPA
FT                   YQTSKSAVNALTIQLAKKLAGTDIVVTAVCPGWVQTDLAPGNWEQAPLTADEAAVVVAA
FT                   AAVAPDGTPSGRFVDAAGTVAW"
FT   gene            complement(573777..574712)
FT                   /locus_tag="Bcav_0517"
FT   CDS_pept        complement(573777..574712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0517"
FT                   /product="GCN5-related protein N-acetyltransferase"
FT                   /note="PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78780"
FT                   /db_xref="GOA:C5BXA5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXA5"
FT                   /protein_id="ACQ78780.1"
FT                   /translation="MDLFSPASRDDAISLILTHRPQPDTPGQRLLFEQPSLGRVFDNGQ
FT                   RAPERVWAVRGSDPGAHGLVAGRLLGDLALVDMIALPADDDAAALLAHAATSWARSAEE
FT                   AVVSFESAAVTDTLDDPAVTRVVETFGAVGWQVRVTRRHYQLGAEVAAPHSAAVPLSMN
FT                   LEQARPGDEQRLTDLLTRVLPGSLDVSDRELVAQHGLAAAAAQQVDDLLEDDPVECIRI
FT                   ATIAGADVGLISWRLMPRGRGYVLTVGVAVEHRGRGLAGELVAAATRDLVAAGAHTLIA
FT                   DTDDENVGMIRGFARAGWQPTEARIDLTLV"
FT   gene            574931..575407
FT                   /locus_tag="Bcav_0518"
FT   CDS_pept        574931..575407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0518"
FT                   /product="CMP/dCMP deaminase zinc-binding"
FT                   /note="PFAM: Cytidine and deoxycytidylate deaminase
FT                   zinc-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78781"
FT                   /db_xref="GOA:C5BXA6"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXA6"
FT                   /protein_id="ACQ78781.1"
FT                   /translation="MDHEEAIGLALELARGALETDDVPVGAVVLGPDGEVIGRGANRRE
FT                   ADDDPTAHAEMIAIREAAAALGQWRLEGCTLAVTLEPCTMCAGATVLARLPRLVFGAYD
FT                   PKAGAAGSVTDVVRDPRLNHRVEVTGGVREAECGEELRAFFRARRRPTAADPPS"
FT   gene            575404..576396
FT                   /locus_tag="Bcav_0519"
FT   CDS_pept        575404..576396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0519"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="PFAM: Sigma-70, region 4; Sigma-70 region 2;
FT                   TIGRFAM: RNA polymerase sigma-70 factor, TIGR02960 family;
FT                   RNA polymerase sigma factor, sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78782"
FT                   /db_xref="GOA:C5BXA7"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014305"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXA7"
FT                   /protein_id="ACQ78782.1"
FT                   /translation="MTASVPAVSTTAPTVADVDALRGRLTGYCYRMLGSAADTDDAVQE
FT                   TVIRAVGNLERFDPGRAALSTWVHAIATRVCLDMLRGARRRALATDLGPAASGGDIGAP
FT                   LPAEAFVEPMPDSRLLEAQDPGDAVVARETVRLAFVAALQRLPPRQRAVLVLRDVLAFS
FT                   AREVADALGVSVAAANSALQRARATLEAHRPDPVDLAEPDDAGQRDLLRRYVAAFEAHD
FT                   VAGLTALLREDATTSMPPFAWWLRGGALIASLVAGNDECAHDRLLVTRVNGGLGFGQYR
FT                   PDDAGRLRPFALVGVEVVGGRIARTVTFLGAADRFGEFGLPLEWSTPDR"
FT   gene            576455..577051
FT                   /locus_tag="Bcav_0520"
FT   CDS_pept        576455..577051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0520"
FT                   /product="conserved hypothetical protein"
FT                   /note="TIGRFAM: uncharacterized Actinobacterial protein
FT                   TIGR03083"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78783"
FT                   /db_xref="GOA:C5BXA8"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXA8"
FT                   /protein_id="ACQ78783.1"
FT                   /translation="MADTGRIIAETRAERARLVGILEGLAPAQWAAPSLCDGWRVREVV
FT                   AHITMPYRIGGLGYLAGLARAGFRFHVYADRAARADTARMDDAALLASLRDNIDHPWRP
FT                   PGGGALGALSHDVIHGLDITEPLGLPGPPAERVALVLAESKAKQYAYFGVDLDGVRLEA
FT                   TDADVAIGDGRTVRMPVRDVLLVVTGRSPMPAPAG"
FT   gene            577213..577788
FT                   /locus_tag="Bcav_0521"
FT   CDS_pept        577213..577788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0521"
FT                   /product="putative transcriptional regulator"
FT                   /note="PFAM: Bacterial regulatory protein, arsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78784"
FT                   /db_xref="GOA:C5BXA9"
FT                   /db_xref="InterPro:IPR000488"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXA9"
FT                   /protein_id="ACQ78784.1"
FT                   /translation="MPFEHEPTSTSSLASLRALSHPLRLRIVELLDDVGPLTATEVAAQ
FT                   LADTPSNCSFHLRVLAREGLVEEAPGGRGRARPWRLVRRDVDVRTDDLDDDGRAQLRAV
FT                   VVALAERFRTHALAWLDRRGEFSPAWREAATSRHLLLRLAPEELQDINERVTELLAPYV
FT                   ERDDDAVPADARSVALTIATLPVLPPRA"
FT   gene            577808..579640
FT                   /locus_tag="Bcav_0522"
FT   CDS_pept        577808..579640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0522"
FT                   /product="peptidase S9 prolyl oligopeptidase active site
FT                   domain protein"
FT                   /note="PFAM: Prolyl oligopeptidase family; WD40-like Beta
FT                   Propeller Repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78785"
FT                   /db_xref="GOA:C5BXB0"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR023302"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXB0"
FT                   /protein_id="ACQ78785.1"
FT                   /translation="MHTFDDFVPRRRFQDAVALSPDGTLVAYSAHDDGAYSLLVRPVAG
FT                   GEPRRLARFDDRSVRAVAWSPSGDRLAFSADRDGDEQTQIFVVGADGGDPVRLTDRDDR
FT                   QYGLAEQPFTPDGATLVYSGNDRDESASDVLVHDLATSQVRRIEMAPGITAPVDVSPDG
FT                   RLLTVLVLHSNSDSDVAVVDLAGGADAVRTVASHEGAVRHLPGPWLADSSGFWLRTDRD
FT                   AEFLALATCTLDGDVEVVHAPDADVELVTTAHGRTAWVVNEPGGFVPFVRDEPSAESSA
FT                   EPRRVDLPAGVLDVAELAPDGVTLVGLWGSGVRPRELVAIDLDAARLQYLTDSRPPAIL
FT                   EGAPAAPVAITYPTHDGRDVPAWLYRPSSAMGDGPFPVLLSVHGGPEAQERAEYNYSGL
FT                   YQYLLSRGIGVLAPNVRGSTGYGASYQKLIQRDWGGGELGDLEHAVRYLRTLEWVDGDA
FT                   IAVFGGSFGGFAALSCLSRLPELFAAGVSVVGPSNLVTVGRSVPATWRPLIRAWLGDPD
FT                   DDHDFLMSRSPITYADQIVAPLFVVQGAKDPRVVQAESDQIVDALRARDVVVRYDVYED
FT                   EGHGFTKRENEIQALGDVADFLVEHLRPAVVTSR"
FT   gene            complement(579627..580745)
FT                   /locus_tag="Bcav_0523"
FT   CDS_pept        complement(579627..580745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0523"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: Conserved hypothetical protein 698; TIGRFAM:
FT                   conserved hypothetical integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78786"
FT                   /db_xref="GOA:C5BXB1"
FT                   /db_xref="InterPro:IPR018383"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXB1"
FT                   /protein_id="ACQ78786.1"
FT                   /translation="MPEPTIAATPAPAPGRGNAVVRDEAHEPSGARGRRLPWLAGLALA
FT                   VAIAAPATLVGRAFPLLGAPVCAILLGAVVAAALRGRAAATLKPGLAVASRPVLQLGVI
FT                   LLGAQLSLAEVARVGADAVPVMLVTLAVCLLAAWALGRAMRVESDLRTLIGVGTAICGA
FT                   SAIAAVTGVLRPASEKVAYALSTVFVFNIAAALAFPPLGHALGLDAHTFGVLAGTAVND
FT                   MSSVVAAATAFGPDAAHDAVVVKLTRTLMIVPICAVLGVVVARRGRRGATAGGTDAGDG
FT                   GTGRRALLRAVPWFLLGFLALAGANSAGLVPTSASAALTTAAGFLVTVALAAIGLSTDL
FT                   AGLRRAGARPLLLGGALSLIVTGTSLAMLTWR"
FT   gene            580817..581731
FT                   /locus_tag="Bcav_0524"
FT   CDS_pept        580817..581731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0524"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate binding domain; Bacterial
FT                   regulatory helix-turn-helix protein, lysR family; TIGRFAM:
FT                   ModE molybdate transport repressor domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78787"
FT                   /db_xref="GOA:C5BXB2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXB2"
FT                   /protein_id="ACQ78787.1"
FT                   /translation="MEEARGGRGRGATLDELRLLVDVADQGSISAAARAQLISQPSASA
FT                   RMRTLERRLGLELVDRRTRGAELTEHGRVVTDWARAVVAAADTLVTGAEALAARRDEHL
FT                   RLAASQTVAEYLVPGWLAELRRRDGEHATRLRVANSRDVVAALRARDVDLGFVEGPSVP
FT                   ADLRSREVATDRLVLVVAPDHPLARRRRPLTREDLAALPLASREDGSGTRDTVRRALGR
FT                   DMAPPAVELDSNAAVKVVVVSGGFAAVMSELAVAAELRDGRLVEAPLEGVDLRRSLRAV
FT                   WRRDAGLSRAAEAMIAVAGGRRR"
FT   gene            complement(581845..582207)
FT                   /locus_tag="Bcav_0525"
FT   CDS_pept        complement(581845..582207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0525"
FT                   /product="Camphor resistance CrcB protein"
FT                   /note="PFAM: CrcB-like protein; TIGRFAM: crcB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78788"
FT                   /db_xref="GOA:C5BXB3"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXB3"
FT                   /protein_id="ACQ78788.1"
FT                   /translation="MTLVLIALAGGVGAAARFVVDGVVRSRAALPWLGTTVVNVSGSFL
FT                   IGLLAGFAVAHAVPATWHAVVATGFLGGYTTFSTAAVEGVVLLRAGERRRAAVYVLGVA
FT                   VVSALVCSGGFALGSL"
FT   gene            complement(582204..582635)
FT                   /locus_tag="Bcav_0526"
FT   CDS_pept        complement(582204..582635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0526"
FT                   /product="Camphor resistance CrcB protein"
FT                   /note="PFAM: CrcB-like protein; TIGRFAM: crcB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78789"
FT                   /db_xref="GOA:C5BXB4"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXB4"
FT                   /protein_id="ACQ78789.1"
FT                   /translation="MTGPEQRSVHRDPALVGLVALGGGIGTALRAWLEDVVPRLTWSGA
FT                   ELPLTTFGINVVGAFALGVLLETLALRGADTGRRRRLRVFAGSGVLGGFTTYSAFMLEA
FT                   DTLVRGGHTWLGVAYVAASLVLGLLAAWGGIAAAGRGRS"
FT   gene            complement(582720..583643)
FT                   /locus_tag="Bcav_0527"
FT   CDS_pept        complement(582720..583643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0527"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78790"
FT                   /db_xref="InterPro:IPR025159"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXB5"
FT                   /protein_id="ACQ78790.1"
FT                   /translation="MRAAARRQLGLVTTAQCVAAGMSRKAVRTRADRRAWVRVTTGVYD
FT                   VDPARTRELDPGGLRRRAAVLGLLAYGPDAVAVGTAALALHGLWGLPVRIRPQVALADG
FT                   DSRRSRDGILVRRFAVPVVERTRDGHAVAPLDVALAQAVPELDRDHAVAVLDSAVNLGL
FT                   LTAQDLEHVRSLVRGRRGAERVAGWWSLVDGRSESTYETFARLECRDAGLPPDDLQVRL
FT                   RRPDGGEARGDLGWRIDEDHWLLAEIEGKSVHGAPGADRRDRRRQNGITLTGGATFLRY
FT                   DPGDVRTGLVPAEVRLALDAHRRHAA"
FT   gene            complement(583864..584748)
FT                   /locus_tag="Bcav_0528"
FT   CDS_pept        complement(583864..584748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0528"
FT                   /product="Silent information regulator protein Sir2"
FT                   /note="PFAM: Sir2 family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78791"
FT                   /db_xref="GOA:C5BXB6"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026587"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXB6"
FT                   /protein_id="ACQ78791.1"
FT                   /translation="MRTTTWQAEPITREPATEEDLDAVVELLAGRRLAVLTGAGISTDS
FT                   GIPDYRGPDSPPRNPMTYQQFVGDPAFRRHYWARNHVGWHHMTATEPNAGHRALAALEQ
FT                   RGAVAGVVTQNVDLLHEAAGSRRVVDLHGHYNEVVCLQCGTTVTRTELDARLTALNPGW
FT                   LERVEEVGDVEIAPDADAVIAATEDFVIAACEVCGGVLKPNIVYFGENVPRERVARAFE
FT                   IVDDGDALLVAGSSLAVMSGLRFVRHAAREGKPVVVVNRGVTRGDALATVLLHAGTTET
FT                   LVELDRRLPDVES"
FT   gene            584826..584912
FT                   /locus_tag="Bcav_R0007"
FT   tRNA            584826..584912
FT                   /locus_tag="Bcav_R0007"
FT                   /product="tRNA-Ser"
FT   gene            complement(584987..585670)
FT                   /locus_tag="Bcav_0529"
FT   CDS_pept        complement(584987..585670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0529"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78792"
FT                   /db_xref="InterPro:IPR014825"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXB7"
FT                   /protein_id="ACQ78792.1"
FT                   /translation="MAEMTQTEPEVAELMAELAALEDPKAREVNERHGDDHGVNLGRLR
FT                   AIAKRLKTQPDLARELWATDDTAAQLLSILISRPRAFGRDELDTMLREARAPKVHDWLV
FT                   NYVVKKNPHAEELRVAWSADPDPVVASAGWALTSERVTKSPDGLDLAGLLDVVEEEMKD
FT                   APDRLQWAMNTCLAQIGISHPEQRARAVDIGERLEVLKDYPTSPGCTSPFAPTWIAEIV
FT                   RRQES"
FT   gene            complement(585687..586922)
FT                   /locus_tag="Bcav_0530"
FT   CDS_pept        complement(585687..586922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0530"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78793"
FT                   /db_xref="GOA:C5BXB8"
FT                   /db_xref="InterPro:IPR018584"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXB8"
FT                   /protein_id="ACQ78793.1"
FT                   /translation="MRRAGRSAALFWAAFLAVHALLAVAGAGAFGRPAFFDVDLYRQWI
FT                   EAGLQAGVWPVLDTPWVYPVGALLPLLPLAAVASSPTGAVVVWCVLVTALDGVASVVLR
FT                   RHLPAGVGAAWWWLAFVLALGPVGMGRLDAVVAALMVPAFAVATTRPALASALLTLVAW
FT                   IKATPGVAFLALVAAVRERGRAIVAAAAGVSVLVVGTALALGAGGRVLDFVLEQGSRGL
FT                   QVEAVAATPYVLARLVSPAVTIVFDPLVTYEVHGPGADGVALALDVALPVAVAVVTWLV
FT                   WRSRRGLTSAGALAWGAFALLLVAVVVNKVLSPQYVAWLAPPVAVALGRAAGRVRWRRV
FT                   AAWTLVAAFLTQLVYPIGYPDLLAGSAVWAWVLAARNAVLVGLLVVALRVLVAAGRRRR
FT                   REAESGRTLRSA"
FT   gene            complement(586928..587554)
FT                   /locus_tag="Bcav_0531"
FT   CDS_pept        complement(586928..587554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0531"
FT                   /product="GCN5-related protein N-acetyltransferase"
FT                   /note="PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78794"
FT                   /db_xref="GOA:C5BXB9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXB9"
FT                   /protein_id="ACQ78794.1"
FT                   /translation="MTPDVHIRHAAPADRDALYHVCLLTGNSGKDGRELYADPEILGHR
FT                   FAGPYLALEPDFAFVAEDSEGVAGYVLGAPDSAAFEARLERDWWPDLRERYPDPGDVDS
FT                   DVRPRDPVIAHSFHHPPATDPGLLERYPAHLHIDLLPRLQGKGAGRGLMTTLLDALRAA
FT                   GIPGVHLGVGAANTNAIGYYEHMGFHTVFESVNGRTMAMDLRTTG"
FT   gene            complement(587551..588039)
FT                   /locus_tag="Bcav_0532"
FT   CDS_pept        complement(587551..588039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0532"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78795"
FT                   /db_xref="GOA:C5BXC0"
FT                   /db_xref="InterPro:IPR025241"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXC0"
FT                   /protein_id="ACQ78795.1"
FT                   /translation="MSERDPNPYLPGGASLPPSYGAQPPGPAGPPPPVGPPTAYGPPPP
FT                   SYGQPPAPAYGPPAYGQQAAPSPYLAYGPPGQAVPYPGGGTTNGFATASLVCSILLCFG
FT                   PLGGTAAVIFGHVALSQIKRTQQAGRGMAIAGLVIGYLQLAFMALTLLAYLTLGDSRS"
FT   gene            complement(588036..588698)
FT                   /locus_tag="Bcav_0533"
FT   CDS_pept        complement(588036..588698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0533"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78796"
FT                   /db_xref="GOA:C5BXC1"
FT                   /db_xref="InterPro:IPR027381"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXC1"
FT                   /protein_id="ACQ78796.1"
FT                   /translation="MWKAAGRTLLVGYGDAVTSAPTDEAARRRAARRRHLQQRQTVIFG
FT                   GLLAVLGVVALAAAGVFTGILPSPIDPPFSTPEPTDTALPPPCPAADALPVAFSEVTVN
FT                   VYNGTTRAGLAGSTAEQLAALGVLINSELNNPGGHYEGVTDIQVGAAGVTAGYTIAALF
FT                   PEATITLETNRTDAAVNVVLGDGFEAMSDPAEAALDPETPIAAPAGCEPVPTPEPSS"
FT   gene            complement(588742..589038)
FT                   /locus_tag="Bcav_0534"
FT   CDS_pept        complement(588742..589038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0534"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78797"
FT                   /db_xref="InterPro:IPR014447"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXC2"
FT                   /protein_id="ACQ78797.1"
FT                   /translation="MIFKAVGEGRPYPDHGRTTPRDWSEIPPRQVRLDELITTKLELDL
FT                   RSLLSEDSTFYGDLFAHVVEWKGELYLEDGLHRALRAALQQRTLLHARVLELS"
FT   gene            589186..591039
FT                   /locus_tag="Bcav_0535"
FT   CDS_pept        589186..591039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0535"
FT                   /product="Siderophore-interacting protein"
FT                   /note="PFAM: Siderophore-interacting protein;
FT                   O-methyltransferase; Siderophore-interacting FAD-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78798"
FT                   /db_xref="GOA:C5BXC3"
FT                   /db_xref="InterPro:IPR001077"
FT                   /db_xref="InterPro:IPR007037"
FT                   /db_xref="InterPro:IPR013113"
FT                   /db_xref="InterPro:IPR016461"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="InterPro:IPR039374"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXC3"
FT                   /protein_id="ACQ78798.1"
FT                   /translation="MPKRLRETRVFPIVLRRLEVLAVADVTPGMRRVTVGGRQLRAFRS
FT                   ESGIDLPELRSDGFDDHLKLFFAEPGADPVLPVQNPGNIDWPRDPRPIAKDYTPRRYDV
FT                   EAGELDLDFVRHGTGYASTWAERAQVGDAIYTAGPKVSELHPADADWYLIFGDETALPA
FT                   IGRWLEEMPSDARGQVFVEVAEPEHEQDLRHPPGVELTWLHRHGAAPGSTDLLELAVRG
FT                   AEFWPGDVYAWGAGEADSLKPIRRFLRDERDVPRERLDVTGYWRRTELAVAEDGSTALG
FT                   VADMVNPVHERLHELTDLVGPYALRVAVTLRIPDHVARGRTSVEALAAATGTHPRALAA
FT                   LVRYLVSEDVLGTDDDGALRLGALGGDLVDDEHEVTELDLGGAQAHLDLAIAGLAATLR
FT                   SGASSYASTFGRSLAEHAEEDEAFRRELFDAVTERARWARASFENAFGWGEAGRVVVVG
FT                   PTASTVAEGVLAATTTTRVSVVDLPSRLPLVREALEEHGLTDRFDAVARSPLAPLGDLG
FT                   ADVVVLAPQLLETLPDEDARLVLAQLRDVDAGVVVLDRLAEDDPDGLSFDVGEDLVSWC
FT                   VHGSARRTRAELAELVSASGLTTVEERGIGWGITLLRLAPA"
FT   gene            complement(591097..592692)
FT                   /locus_tag="Bcav_0536"
FT   CDS_pept        complement(591097..592692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0536"
FT                   /product="anibiotic ABC transporter efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78799"
FT                   /db_xref="GOA:C5BXC4"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXC4"
FT                   /protein_id="ACQ78799.1"
FT                   /translation="MSALTGTGTLVRLALRRERIRIPVWSLALGLTVLGSVPALEESFP
FT                   TAEARQARAELVQNPAAIVMAGPGFGLDDYTLGAMVANELSLTLVVAAAIMSIFMVVRH
FT                   TRAEEESGRAELVRAAVVGRSAAAVAALVTTAIANALVALLIWGGLVAGGLDAGDGLLL
FT                   SVAVGLTGVAFGGVALVAAQVTEHARAASGMAMAVLGAAFLVRGIGDVLVEHGGLLSWF
FT                   SPIAWAQQTRPYAGARWWPLLLTAALVAGTLLAAHALAARRDFAAGLVAQRPGRAQARP
FT                   ALASPLALATRLTLPSFVAWTVAVAVSGAAFGALVNSVQDAMEDSPLMEQLLGGESRVT
FT                   ESFFALFLPYLVLAAVAYALSVVQRLRSEETEGRAEVVLARPVSRWTWFGTTLGVSAVG
FT                   GVLVLAVGAFAMGATGAAVTGDGSWTGRVTGGALAYVPALVLVVALGALLFGTWPKLFG
FT                   LAWALVGWMTVVLVLGTLLDLPEWTTWISPVNQTPAVPMEALEALPLVIMGAGALVLGA
FT                   LGMAGFRRRDVPTV"
FT   gene            complement(592689..593609)
FT                   /locus_tag="Bcav_0537"
FT   CDS_pept        complement(592689..593609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0537"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78800"
FT                   /db_xref="GOA:C5BXC5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXC5"
FT                   /protein_id="ACQ78800.1"
FT                   /translation="MTSTSDAVGIRDLVKTFGPVRALDGLDLTVRTGEVAGFLGPNGAG
FT                   KSTTIRVLLGLLRADAGSATLLGGDPWRDAVDLHRRIAYVPGDVALWPNLSGGEAIDYL
FT                   SRLRGGVDATRRARLLERFELDPTKKTRTYSKGNRQKVALVAALASDAELFVLDEPTSG
FT                   LDPLMETVFRECITEIKAEGRSVLLSSHILAEVEKLCDTVTIIRAGRTVETGTLDEMRH
FT                   LTRSTVSAVLDDGAAASASIGSLPGVHDLVTEDGRVTFDVDNDHLGEVMTSLTHRGLRS
FT                   LTCAPPSLEELFLRHYGDELEETSR"
FT   gene            complement(593593..594357)
FT                   /locus_tag="Bcav_0538"
FT   CDS_pept        complement(593593..594357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0538"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: Bacterial regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78801"
FT                   /db_xref="GOA:C5BXC6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041484"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXC6"
FT                   /protein_id="ACQ78801.1"
FT                   /translation="MLNMRSTRQPGGGTTAAPPSDLTARARIRDGAIRLFGEHGFGVGL
FT                   RAIAQEAGVSVGLVAHHFGSKDGLREACDAHVLSALNEARRAADVSGPSGAMITQLAAV
FT                   AEFAPLVAYVFRSVQAGGQLARDFVEHAAADAAAFLERSAASGLVRPSRDEVARARALT
FT                   SQSIGSLALELALDPPGPGESMSEAIERYVERYTAPLLELYTDGLFTDSSMLDAYLEYE
FT                   RAHPPPTPSSGSPKTPETPRPRPRKATHDQHQ"
FT   gene            594455..594829
FT                   /locus_tag="Bcav_0539"
FT   CDS_pept        594455..594829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0539"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: Bacterial regulatory protein, arsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78802"
FT                   /db_xref="GOA:C5BXC7"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXC7"
FT                   /protein_id="ACQ78802.1"
FT                   /translation="MLNSATNTLDRVEVMGRLGRAMSDPTRARLLERLLDGPTYPAELA
FT                   ADLALTRSNVSNHLACLRGCGLVLTVPDGRRTRYEIADPHLAAALGELMRVVLDVRDGR
FT                   ECANPLCDVPGCTACETGTA"
FT   gene            594826..596865
FT                   /locus_tag="Bcav_0540"
FT   CDS_pept        594826..596865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0540"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="PFAM: haloacid dehalogenase-like hydrolase; E1-E2
FT                   ATPase; TIGRFAM: heavy metal translocating P-type ATPase;
FT                   heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase;
FT                   ATPase, P-type (transporting), HAD superfamily, subfamily
FT                   IC"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78803"
FT                   /db_xref="GOA:C5BXC8"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXC8"
FT                   /protein_id="ACQ78803.1"
FT                   /translation="MSRECCGDDEIDARELQLRALADGSSGALSGGADDDDAAASEEEF
FT                   VPFWRDRVLLLPAASGVLLGVGYVLEWTGSDAPALVAQGASLLAGAWTFVPGAVRRLAR
FT                   GRLGVGLLMTIAAVGAVALGHVGEAAALAFLFSIAEALEDRAMDRAKHGLRALLALMPA
FT                   TARISRMAGEIEIPAAQVRELDLLVVRPGERIATDGVVTTGRSSLDTSAVTGESIPVEV
FT                   APGDAVLAGAVNGTGALLVEATADGRDNSLTTIVRLVEEAQARKGERARLADRIARPLV
FT                   PAVLVLAALVAVWGLIVGDPALWTQRALVVLVAASPCALAIAVPVTVISAIGAASRFGM
FT                   VVRSGAAFEELGAVRAVAIDKTGTLTRNRPAVVEVSTRAGVTEHQALTLAAALEARSTH
FT                   PLAAAILAAAPSPPLAHDVAELPGRGLQGDVDGVRVQVGTTRWLDPGDLADDAARLEGE
FT                   GMTVVAVVSDGVPAAVIGIRDELRPEAPDAVARLRADGITVTMVTGDNERTARALAAEA
FT                   GIEDVRAAQLPQDKERAVRESSSRVPTAMIGDGVNDAPALAAADVGIAMGVGGSAAAIE
FT                   SADVAFTGADLRLVPQGLAHARRGRRIMTGNIALALAIIVVLFPLALFGVLPLAGVVLV
FT                   HEVAEVVVILNGVRAARTAGALAPLAPVAGRGERLPTGAAQRVR"
FT   gene            complement(596850..597407)
FT                   /locus_tag="Bcav_0541"
FT   CDS_pept        complement(596850..597407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0541"
FT                   /product="bifunctional deaminase-reductase domain protein"
FT                   /note="PFAM: RibD C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78804"
FT                   /db_xref="GOA:C5BXR0"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXR0"
FT                   /protein_id="ACQ78804.1"
FT                   /translation="MAKLIYSMITSLDGYAEAAEGDLGRGAEDEEVHTFIGDTFRHVGT
FT                   YLYGRRMYETMVFWETAHTDPDAPPHIVQYARDWQAAEKVVYSTTLESPSSAKTRIERT
FT                   FDPDAVRKLKASSDHDLSVDGPNLAAQAIAAGLVDEYHLFMTTSVVGGGKRFFPDGVRL
FT                   DLDLVQERSFDSGLIYAHYRTR"
FT   gene            597512..598144
FT                   /locus_tag="Bcav_0542"
FT   CDS_pept        597512..598144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0542"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: Bacterial regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78805"
FT                   /db_xref="GOA:C5BXR1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039536"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXR1"
FT                   /protein_id="ACQ78805.1"
FT                   /translation="MPRELSTYHRGVAAANRAAILDAAMALFLASGYDRTSLASVAESA
FT                   GVSKATLFKQFPTKAELFEATVLAAGGTPGGELVDPPPGDFHGGLVTLGLAYAELLTRP
FT                   GMEDLIRVVIAEAPRFPELREQTFDFGTLPVLAALGRYLRAEHAAGTADVDDPDAASAQ
FT                   FLGMISTVVFWPRLVHGNWSLSDEETLRVVDDAARTMAARYGVAVGS"
FT   gene            complement(598220..598307)
FT                   /locus_tag="Bcav_R0008"
FT   tRNA            complement(598220..598307)
FT                   /locus_tag="Bcav_R0008"
FT                   /product="tRNA-Ser"
FT   gene            complement(598438..599721)
FT                   /locus_tag="Bcav_0543"
FT   CDS_pept        complement(598438..599721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0543"
FT                   /product="amidohydrolase"
FT                   /EC_number="3.5.1.32"
FT                   /note="PFAM: Peptidase family M20/M25/M40; TIGRFAM:
FT                   amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78806"
FT                   /db_xref="GOA:C5BXR2"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXR2"
FT                   /protein_id="ACQ78806.1"
FT                   /translation="MTDAPTRIDALTDGLDGRLADLRSLYEDLHAHPELSMQEHRTAGV
FT                   VAERLRAQGYEVTEGVGGTGVVGVLANGAGPRVLLRADMDGLPLREDTGLPFASTVTAI
FT                   GADGVEVPVMHGCGHDVHVTALLGATAQLAENRGAWSGTVLAVFQPAEETGEGAQAMIE
FT                   DDLFARFGTPDVCLGQHVSSLPAGHAMLRPGPMMATADAVHIRLFGRGGHGSTPELTVD
FT                   PVVMGASLVMRLQTIASREISSQDPVVVTVGSLVAGMKENIIPDDAVLKISVRTFDPTI
FT                   RDQVMAAIERMARAEAAASGAPREPEFTYLHSLPLNANDVDGEARTRAALALGLGTGHV
FT                   HEMPRPVSGSEDFGRFGAAAGCPSVFWFVGGYDPALFADILAGRASIMSLPEGVAYNHS
FT                   PHFAPSAPGTLDGAVRAMLAAASEWLGS"
FT   gene            complement(599814..600530)
FT                   /locus_tag="Bcav_0544"
FT   CDS_pept        complement(599814..600530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0544"
FT                   /product="glycoside hydrolase family 16"
FT                   /note="PFAM: Glycosyl hydrolases family 16"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78807"
FT                   /db_xref="GOA:C5BXR3"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXR3"
FT                   /protein_id="ACQ78807.1"
FT                   /translation="MTTLLWSDDFADDGAPDPARWSHAVGGHGWGNDELQFYTSDRARN
FT                   ARVSGGRLVIEAHAEDWQDRRFTSARLVSRAAWLHARVEVTARLPIGRGTWPAIWMLPS
FT                   TPGERRWPDDGEIDVMEHVGHDPGVVHASIHTAAYNHVDGTQRTATTAVPDAQEAFHTY
FT                   AVDWDAESITWSVDGEASFTYAREAAAERDTWPFDTPFHLILNLAVGGGWGGAQGVDDA
FT                   AFPARFEIDSVRVLGR"
FT   gene            complement(600856..601653)
FT                   /locus_tag="Bcav_0545"
FT   CDS_pept        complement(600856..601653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0545"
FT                   /product="protein of unknown function DUF990"
FT                   /note="PFAM: Protein of unknown function (DUF990)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78808"
FT                   /db_xref="GOA:C5BXR4"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXR4"
FT                   /protein_id="ACQ78808.1"
FT                   /translation="MRTLRRHARFTAAAFVQALGRDAQFRAQAWTTIVVGLIEVAVGLV
FT                   PALLVFQHTDEVNGWDVGLVIAVTGMAQVAMALLGAFVVPNQAKMTDYVRRGELDGVLI
FT                   RPVSTQWYAAVRWMQPSELWSGLAGLLLVAVGLAEAGARPSAADVALAALWFAVGLVAV
FT                   ALVWTNLGYLAFWLESVDSVTDLMATLLSAGRYPVAFFPAAVRTILLVVIPIGLATTLP
FT                   VTALDGGSDPRFAVAGVGCVLAGALLTRWHFVVALRRYASASS"
FT   gene            complement(601655..602461)
FT                   /locus_tag="Bcav_0546"
FT   CDS_pept        complement(601655..602461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0546"
FT                   /product="protein of unknown function DUF990"
FT                   /note="PFAM: Protein of unknown function (DUF990)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78809"
FT                   /db_xref="GOA:C5BXR5"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXR5"
FT                   /protein_id="ACQ78809.1"
FT                   /translation="MRQLHLFGRLFALNVGVTFQYRGEFLIMQIGNLIVPITSLLVWQA
FT                   ALASGAPLPVDGEFLVAYFLLVSVVGMLTASWTAFYLAASIRDGALNRWLIRPASTHLD
FT                   AVANNVGEKVVKLVIIVPLIAALALLLGDRIALPSDAGRWLLFAVAVVLAAGMRLALDI
FT                   MIGSLAFWFEDVQGFIRALAVITPVLSGAVVPLALMPPGIAAVTAVQPFRFMLSYPMEV
FT                   LLADPAGGPGGLTAGFALQVGWLAVFVAGAAGVWRLGLRSYAAAGA"
FT   gene            complement(602458..603459)
FT                   /locus_tag="Bcav_0547"
FT   CDS_pept        complement(602458..603459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0547"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78810"
FT                   /db_xref="GOA:C5BXR6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXR6"
FT                   /protein_id="ACQ78810.1"
FT                   /translation="MPQPVISTRALRKEYRYHRQQPGLLAAVRGLVHRTRETRVAVESL
FT                   DLTIHEGEFVGLLGRNGAGKTTTLKMLSGLLRPTSGTVSVLGHEPARRRYDFLRRIAVV
FT                   LGQKSMLWWDVSTSDSLRLHQAMYDLPRTRLDATVDELADLLQLRDLLDIPVRKLSLGE
FT                   RMKCELLVALVHEPDVLFLDEPTIGLDVVSKAAVREFLAALNATRGTTIILTSHDMDDV
FT                   AELCRRVILVDHGRLQYDGDLPDLVRTIRPHKRVMLTFAASAHVPALLPPGVRLVDADD
FT                   SPTGSRLDLEVEREAAQRLLAAAPGWGEVVDIEVRDADIDDVMRAVLAGEGA"
FT   gene            603777..606302
FT                   /locus_tag="Bcav_0548"
FT   CDS_pept        603777..606302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0548"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /EC_number="2.7.7.7"
FT                   /note="PFAM: ATPase family associated with various cellular
FT                   activities (AAA); TIGRFAM: DNA polymerase III, subunits
FT                   gamma and tau"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78811"
FT                   /db_xref="GOA:C5BXR7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXR7"
FT                   /protein_id="ACQ78811.1"
FT                   /translation="MTTALYRRYRPDTFADVIGQEHVTGPLMAALRSDRATHAYLFSGP
FT                   RGCGKTTSARILARCLNCAQGPTDTPCGTCDSCVELARGGPGSLDVVEIDAASHNGVDD
FT                   ARDLRERAVFAPARDRYKIFILDEAHMVTAQGFNALLKLVEEPPPHVKFVFATTEPDRV
FT                   IGTIRSRTHHYPFRLVPPQVLGDYLAQVSEAEGVAVAPGVLPLVVRAGGGSVRDSMSVL
FT                   DQLMAGADSDGLDYDRAIALLGFTHATLLDDVVDAFAAGDGATVFRVIDNVIESGHDPR
FT                   RFVEDLLERLRDLIVLAAAGDQAVAVLRAIPEDQVERMRGQAQHLGAARLSRAADLVNA
FT                   GLTEMTGATSPRLQLELLCARILLPATPAAATGVEPRSAGTSGPASGSAPSGGAGSAAG
FT                   AAPSRRETPAQPVPRTERPPAPERGAPSRAAAEPPAASAARGERERGSAARAADEAGPE
FT                   SAGSVASGSAEAEPGAARRGAPATDAPARRQQPDARPGGGDDVEGRGAGAGPEAEEAPG
FT                   SAEPPRSEVSDEEAPRSGEPAAGQSRSEVSDEEAPRSEVPAEGPPHPQEAAAGRTPSEA
FT                   PAAGPVSAAPQPDPSPLTGTDAATVRRRWPEVLETLSGIRRVTWTLVAQNAQVASISAG
FT                   VLELAFATEGLAVTFRNGTHAEALERALHETLGLDVRVRATIGDAAPTSPPAGGTSGGA
FT                   GAPDAPGSAGAGDPAARAAADWAAPVARLDPPEPPAGGSAPAPADPGSTPAPGAASQAR
FT                   ASGTSDARPTQARAPRTTDARPTQARTTAEAPPAVVGPDDPWPSDEDDDPGEPGAGSGL
FT                   VGAPLVARLLGGTVIDEVADGPGGPRPGP"
FT   gene            606312..606911
FT                   /locus_tag="Bcav_0549"
FT   CDS_pept        606312..606911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0549"
FT                   /product="recombination protein RecR"
FT                   /note="PFAM: Toprim domain; RecR protein; TIGRFAM:
FT                   recombination protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78812"
FT                   /db_xref="GOA:C5BXR8"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXR8"
FT                   /protein_id="ACQ78812.1"
FT                   /translation="MYEGAVQDLITELGRLPGVGPKSAQRIAFHVLAADPDDVGRLAHA
FT                   LTEVKARVRFCETCGNVSEEAQCRICLDPRRNAAILCVVEEPKDVVAIERTREFRGRYH
FT                   VLGGAINPIDGVGPDDLRIRELMTRLADGQVTEVIIATDPNVEGEATATYLARMLAGMG
FT                   ITVSRLASGLPVGGDLEYADEITLGRAFEGRRRIDV"
FT   gene            606904..607512
FT                   /locus_tag="Bcav_0550"
FT   CDS_pept        606904..607512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0550"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78813"
FT                   /db_xref="InterPro:IPR032025"
FT                   /db_xref="InterPro:IPR038312"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXR9"
FT                   /protein_id="ACQ78813.1"
FT                   /translation="MSDTPEHQDPAEAPAHELDADLTDLAGATAGEVRRYLTTITEVAA
FT                   GANPDAAIPLLLLAVSDLLAAGSRLGAIVDVVPAQRFEPDDGPDVDLEPLRRGLENLLE
FT                   GIDEYTEVSDPLVTAEVAVVSLSGDLVTVAQAAVQGLQHFEAGHTSEALWWWQYSYLSS
FT                   WGERAAAALRALLSVLGHLRLDVPDDVAAEAEFEALHQP"
FT   gene            complement(607551..608642)
FT                   /locus_tag="Bcav_0551"
FT   CDS_pept        complement(607551..608642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0551"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78814"
FT                   /db_xref="GOA:C5BXS0"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXS0"
FT                   /protein_id="ACQ78814.1"
FT                   /translation="MTTQFDVPVAVPDGDDVPRGLTWWGVRTVAQLELRQRVRSTRWKI
FT                   ALLVWVIVVGGVTALVSGAVSYFGGTQMPREDVGATVFGLVLFFVLFLGLLVAPTLSAT
FT                   SVNGDRAAGTLATLQVTTLSAADLAVGKLVAAWLAALAFLAASLPFLAWGLALGGTAVV
FT                   VAIGTVVLLALILAVVCAVGLAFSALTARTSGSAVLTYLTVAGLSVGTLIAFGLSAPLV
FT                   TRTDEVRVYDVAADYDWEGDEPPECEWRTQELPVTHLERTAWLLTLNPFVIVADLTPPD
FT                   LTGSNPMAAISAGIRYAHAGPATEIDQCPASWSGAPEPLPSSGPVWPWGLGVYLLLGAG
FT                   ALAVTIRRLRVPARTLARGTRIA"
FT   gene            complement(608639..609601)
FT                   /locus_tag="Bcav_0552"
FT   CDS_pept        complement(608639..609601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0552"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78815"
FT                   /db_xref="GOA:C5BXS1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXS1"
FT                   /protein_id="ACQ78815.1"
FT                   /translation="MTVTDVRQHGDGAALFADHVARRFGSVRAVADASIRVHPGQVTAL
FT                   VGPNGSGKTTLLLMLAGLLAPDAGVVRVAGLDPAHDGARARRLLGWMPDVFGTWDSLTA
FT                   REVLTTVAAAYRISAPEAASRADELLAVVHLTEYADVPAHVLSRGQKQRLGLARALVHR
FT                   PRALLLDEPASGLDPRSRVDLRHLVRELAAAGTAVLISSHVLAELDELVDDAVFLDRGV
FT                   TSSTNVAPTQGTTRWRLRTLDGAALAAWAASVGLPLAVDADARPPVDGGADAIVTLPDE
FT                   RAAAALLRDAVAAGVPVSSLAPAGGALEQAYLSLEAERR"
FT   gene            609761..610546
FT                   /locus_tag="Bcav_0553"
FT   CDS_pept        609761..610546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0553"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: Domain of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78816"
FT                   /db_xref="GOA:C5BXS2"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXS2"
FT                   /protein_id="ACQ78816.1"
FT                   /translation="MPPDIDLLTILLLVLAGLAAGWVDAVVGGGGLIQLPALLLVPGIT
FT                   PIEALATNKLGSIMGTSTSSITYYRRVQPDLTTAAPMALAALAGASGGALLASQIPGEL
FT                   FTPIILVVLVGVFVFTLARPRLGAHTQLRWEGNRHRWTAAGLGVAIGLYDGLLGPGTGT
FT                   FLVIALVSVLGYAFLPASAIAKIVNFATNFGALVVFVPHGVVLWGLGLCVGAANLVGAY
FT                   IGARMAVAKGSAFVRVAFVVVVGVLIVRLGWDVVADWLS"
FT   gene            complement(610685..611575)
FT                   /locus_tag="Bcav_0554"
FT   CDS_pept        complement(610685..611575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0554"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78817"
FT                   /db_xref="GOA:C5BXS3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXS3"
FT                   /protein_id="ACQ78817.1"
FT                   /translation="MSALTTPRLGDPTQERVDRHARQRNLVARLVTQVCLWIGVLMSIF
FT                   PFYWLITMSTNTTAEIFGFPPKLTFGTNFAENMRNLLASVDLFQALLNTILVAGALAVL
FT                   VMFFDSLAAFTFAKYSFPGKNVLFTLLIATFLVPGSLSLVPSFVLMSWFGWIGGLQALI
FT                   IPGAANAFGIFLLRQFATNSIPDELLESARIDGAGFFRCYRSIGVPMLRGGLAFLGIFT
FT                   FIGAWNDYIWPLVVLIDPQRQTLQVALQTLNSIYLTDYGMVMAGALISVLPLIGVFIIG
FT                   QRHFIANIAAGALKG"
FT   gene            complement(611572..612558)
FT                   /locus_tag="Bcav_0555"
FT   CDS_pept        complement(611572..612558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0555"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78818"
FT                   /db_xref="GOA:C5BXS4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXS4"
FT                   /protein_id="ACQ78818.1"
FT                   /translation="MAALDESVRLTPGRTASRATDQPRPRQGSPLRRFWPQYLAVSPFY
FT                   LLFLVFGLFPIGYSVFLSFQDWDGIGPMRFVGLAQYQFLLSDPRFWNAVGNTFVIWLIS
FT                   TIPMLFLALVLAFLLHQNIRFKGFLRVAYFLPNVTSMVAMAIVFGSIFSDSFGIVNSAL
FT                   AGLGIDQVPWLSSNWGIKVTIAVMVIWRFTGYNAIIYLAGLQAIPTDLYDAAKVDGANG
FT                   WRIFRSVTVPMLRPVILFTVITSTIGGLSLFTEPQVLLGDTGGVGEAGMTIVLYQYNQA
FT                   FTKFDFGYGSAIAWALFVIAAVFAIINWRLIRERDGIRGGRKKGASA"
FT   gene            complement(612558..613850)
FT                   /locus_tag="Bcav_0556"
FT   CDS_pept        complement(612558..613850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0556"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: Bacterial extracellular solute-binding
FT                   protein; TIGRFAM: Tat (twin-arginine translocation) pathway
FT                   signal sequence"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78819"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXS5"
FT                   /protein_id="ACQ78819.1"
FT                   /translation="MQMGTLDRRQFLGGLGVMTGAALTASLTGCGSSTSISSDPDELVL
FT                   WYWNRSVSPTLLGQAAEGIPGSTKRLRADVIGGGYDNKFRTSLAGGAYIPDVAAINSNC
FT                   SLYFPSEDKFFDLNELGAADHSAGYFDWKWDLGTSPTGRQLFFPLDTGPTGFYYRADVF
FT                   DEAGLPSDPDDVSAAVADWDAWIELGTELRATADVALMNTAGMVFGQFLNASPERYFDR
FT                   DNRPLYSEDGSAVREAWEVAIRASEAGITAKLPVPTEQNSAWSSGRTVGHIEAVWWAQI
FT                   LGDTAPDTAGSWRIAHQPGPPGNSGGSFFCIPSTCKDPEAAFAFVTWLNTPENQAATFN
FT                   EVQLFPSSPEAFTAGEMVSDTGFFGEQDPLEFFAAVAPDVPPTFVSTYEPQAAAFATEL
FT                   TNVEASGKDPEQAWADAVTEADRNLAKRGVI"
FT   gene            614241..616238
FT                   /locus_tag="Bcav_0557"
FT   CDS_pept        614241..616238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0557"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: Aldo/keto reductase family; Oxidoreductase
FT                   family, C-terminal alpha/beta domain; Oxidoreductase
FT                   family, NAD-binding Rossmann fold"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78820"
FT                   /db_xref="GOA:C5BXS6"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXS6"
FT                   /protein_id="ACQ78820.1"
FT                   /translation="MSAPFRWAILGPGSIAARFASQLPHSEHGVLAAVASSDPDRALAF
FT                   AEQHGAGVTGDYATILGRDDVDAVYVSTVHTTHARLTIAALEAGKHVLCEKPLAPNHGS
FT                   VMAMVDAARGSGRVLLEAYMYRFHPLTRQILELVASGAVGELQHVDASFSFHAGRTTGR
FT                   LFDPALAGGGILDVGGYPVSYARAIAGAAAGRAFVEPTALSARGTIGETGVDEWTVADL
FT                   TFPDGVTASVRTGVRLADPTTVTIYGSRGSVTLTDPWTLGAGDGASATLRVVGAEPQQI
FT                   ETGPAFPYALEADAVALAAWSGAADVPEASLDDSLGTARVLQQWRDAIGLVYPFEDDDA
FT                   DVPTVSGRPLALPTPGTATIPHGTIDGVGDLSRLVMGCDNQPDLAHASALFDAFVEAGG
FT                   SAFDTAYIYGGGRHEVLLGRWMANRGVRDDVVVIAKGAHTPHCDPESIPRQLTESLDRL
FT                   GTDHADLYLMHRDNPAVPVGEFVDVLDAEVRAGRVRAFGGSNWTPERLDEANAYASAHG
FT                   KTGFAVVSNHFGLAEAYDVPWTGCEHATDAASRAWLTERQMPLLPWSSQARGFFAGRAH
FT                   PDDRSDAELVRCYYSPENFERLHRAGKLAAGRGVATTAVALAYVLAQPFPTFPLIGPRS
FT                   IAELRSSLEATRVALTPEEVAWLDLRTDSV"
FT   gene            616288..617268
FT                   /locus_tag="Bcav_0558"
FT   CDS_pept        616288..617268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0558"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: Bacterial regulatory proteins, lacI family;
FT                   Periplasmic binding proteins and sugar binding domain of
FT                   the LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78821"
FT                   /db_xref="GOA:C5BXS7"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXS7"
FT                   /protein_id="ACQ78821.1"
FT                   /translation="MTRGRRVTITDVAEAAGVSRQTVTRAMNGMAEISDATRSRVLEVA
FT                   RELRYRPSRFGRDLVKREQRTVGLVVHDLTNPYYPELASAVVGAAVARGWNVVLADTVH
FT                   SRDRVADLADLVRQVDVVVGYVGLNREEKAEVFAGLPVVEIDPGPGSAFGAVDLDERPA
FT                   MAELCTHLLDVGVRRPVALMTSAGAERGVLFRESMAAHGVDVRTVVTGQESIDAADAAV
FT                   ADVVASGEELDAILAFNDLLACGALKALRHARIEVPGRVRVVGFDGLSLGTVVSPELTT
FT                   LAIDMSEVADVAVELAVAMFDGELPYSGDDVRRSVTHRLVLRESA"
FT   gene            617364..618638
FT                   /locus_tag="Bcav_0559"
FT   CDS_pept        617364..618638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0559"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /note="PFAM: ACT domain; Amino acid kinase family; TIGRFAM:
FT                   aspartate kinase, monofunctional class; aspartate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78822"
FT                   /db_xref="GOA:C5BXS8"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXS8"
FT                   /protein_id="ACQ78822.1"
FT                   /translation="MALIVCKFGGSSVSDAASIQRVADRIVATKAGGNDVVAVVSAMGD
FT                   TTDELVDLAQEISPDPPSREMDILLTAGERISMALLAIAIDARGVNAQAFTGQQAGVIT
FT                   DTSHGNARIIDVSPSRIQRTLGAGNVAIVAGFQGVTAHTNDVTTLGRGGSDTTAVALAA
FT                   ALGASVCEIYTDVDGVFTADPRIVPTARRIDRMTSEEMLELAANGAKILHLRAVEYARR
FT                   YGVTLHVRSSFSDRTGTLVVPPDSTEEDTMEAPIISGVAHDPSQAKVTVVGIPDVPGMA
FT                   ARLFEVVAGAGVNVDMIVQNVSASATGLTDISFTLPASDVAAAHTALDQLRSEIAITDV
FT                   RYNDQIGKLSLIGAGMRSHPGVSAKLFGALRDAGVNIEMISTSEIRISVVTAAADLDVA
FT                   VRAVHTAFDLDAAEVEAVVYGGTGR"
FT   gene            618643..619710
FT                   /locus_tag="Bcav_0560"
FT   CDS_pept        618643..619710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0560"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /note="PFAM: Semialdehyde dehydrogenase, dimerisation
FT                   domain; Semialdehyde dehydrogenase, NAD binding domain;
FT                   TIGRFAM: aspartate-semialdehyde dehydrogenase
FT                   (peptidoglycan organisms)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78823"
FT                   /db_xref="GOA:C5BXS9"
FT                   /db_xref="InterPro:IPR000319"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXS9"
FT                   /protein_id="ACQ78823.1"
FT                   /translation="MGARDGLRVGVVGATGQVGGVMRRLLDERDFPVAEIRYFASSRSA
FT                   GSTLPWRGSDVVVEDAATADVGGLDIALFSAGAATSRAQAPRFAEAGAIVVDNSSAWRM
FT                   DPQVPLVVSEVNPEQVHHTPKGIIANPNCTTMAAMPVLKVLDTEAGLRRLIVSTYQAVS
FT                   GSGGAGVAELASQVRGALASDVPLEALAVDGSAVPMPDPVKYVRPIAFDVVPLAGSIVE
FT                   DGLGETDEEQKLRNESRKILGLPDLLVSGTCVRVPVFTGHSLSINAEFARPLSPETAIE
FT                   LLAGAPGVVLTDVPTPLQATGADPTFVGRVRTDPGVPDGRGLALFLSSDNLRKGAALNA
FT                   VQVAELVARRVLAHA"
FT   gene            complement(619822..620784)
FT                   /locus_tag="Bcav_0561"
FT   CDS_pept        complement(619822..620784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0561"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78824"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXT0"
FT                   /protein_id="ACQ78824.1"
FT                   /translation="MTMASVARVHPLTLLLERQSGVITRRQIAQCGRSPRVPRSRLESG
FT                   RWQLIHPGVYLTYSGPITWSSRAWAAVLACGRGAALSHRSAGYLGGLVASQPRQLDVTI
FT                   PHDRQVRPLAGVRLHRTRRRLAPTGDPPRLGRAVTAIDLADAATNEDDVIGFLCAAARR
FT                   GVPTSRLRQEVAGRARLRHRGLLHELVAEVAAGSESPLEHRFHRDVVRAHDLPASARQV
FT                   WAEIRGLRLRADAVFGEYATRAELDGALAHPGGTTDADVWRDNEVRVDRSHVTLRYRWS
FT                   HLAVRPCDCTVQLVGALRSGGWQGTARRCGPLCPVPNSR"
FT   gene            complement(620987..622162)
FT                   /locus_tag="Bcav_0562"
FT   CDS_pept        complement(620987..622162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0562"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: Aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78825"
FT                   /db_xref="GOA:C5BXT1"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXT1"
FT                   /protein_id="ACQ78825.1"
FT                   /translation="MVSPQDLDAITVDDLRARGGIKWSTYPDSIGAFVAEMDFGVAPGI
FT                   ARALHTAVDDAQFGYLPPSLVRTMSEAVSEWYARRHGWQISPERIHPLPDVIKALEVAM
FT                   EHFSGRGEKVIVTTPAYMPFLKIPELFGREIIRVPMLLDDDDGVWRLDLDGIGRAFADG
FT                   AGLLVLCNPYNPLGRVFGREELAALADVVTAHGGRVFSDEIHAPLVYPGAHHVPYASIS
FT                   EAAASHTVTATSASKAWNLPGLKCAQLLLSNAADAVEWEKFGFMASHGAANLGVIANTA
FT                   AFTSGEGWLEEIVTYLDGNRRLLGELLTEHLPDVGYSPPEGTYLAWLDCRELELGAAPG
FT                   DFFREHAGVAMVDGAACGEEGFVRLNFALPRPVLAQAIEQMGTAVAGRHAA"
FT   gene            622211..623491
FT                   /locus_tag="Bcav_0563"
FT   CDS_pept        622211..623491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0563"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: Major Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78826"
FT                   /db_xref="GOA:C5BXT2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXT2"
FT                   /protein_id="ACQ78826.1"
FT                   /translation="MPDPTELVADWREAPDVRAVQHRTRRVLVSAQVLGSVGMGASASV
FT                   GILLAEQVTQSETWAGVARTSTTLGAALVSLPLALLAARAGRRTALSAGWSVALLGAVL
FT                   LVLAAATSSTVLLVLGMLAFGAGSATGLQSRFAATDLEVPAHRARTLSIVVWAMTIGSV
FT                   LGPNLGAPGELVESWFGLPELSGAFVISAAGLTATVIILLVFLRPDPVAVAAAKAGPDA
FT                   VPAPKARGSLVLGLRAIVATAPARFAFVALVLAHTSMVLLMTMTPVHMHHHGGTVEIIG
FT                   LVISGHVLGMFAFSPLVGALADRIGRIATILIGQAVLLAAAVAAIGWSGGTGGVTVALF
FT                   LLGLGWSFVTIPAATVVSDAVAPAVRNVVQGTSDTAMNVVAAVAAGVSGPLLAVVGFAN
FT                   LAWGVVALVIPVAVLALPLRRGVDRAA"
FT   gene            complement(623501..624820)
FT                   /locus_tag="Bcav_0564"
FT   CDS_pept        complement(623501..624820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0564"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: Major Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78827"
FT                   /db_xref="GOA:C5BXT3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXT3"
FT                   /protein_id="ACQ78827.1"
FT                   /translation="MPEHEPSAPSADPSPHEGIDPEVRDAVVDKPTWRRDAAVFLSGQT
FT                   VSLFGSMLVQYAIMWHLTLVTKSGSVMALASLFGFLPQAVVSIFGGVWADRLDRKKLII
FT                   AADSAIAVTTLALALLMLSGRDELWLIYAALAIRSIGAGIQMPAVSALLPQIVPTEKLM
FT                   RVNGINGTIQSTMMLLAPAAAAAVYASASIEAVFFVDVATAVIGIALLASLRVPRLVRQ
FT                   LVDGAPVGYFDDLVGGVRYVVTHPFVRWLLVLFGVVFVLTVAPSYLTPLMVVRTFGEEV
FT                   WKLTVNELAFSIGMILGGALLATWGGLKNRITMIVGATFAFGGLSIALGLSTNMWVFFG
FT                   FMFLVGLAVPFFSTTSMTVLQETVEPERQGRVFGFVGIVMAVAMPLGMVIFGPLADVFS
FT                   VELLLVAAGILTFVVVTAAIAMPAGRRAMAAAHARSQSRA"
FT   gene            complement(624894..626738)
FT                   /locus_tag="Bcav_0565"
FT   CDS_pept        complement(624894..626738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0565"
FT                   /product="peptidase S9 prolyl oligopeptidase active site
FT                   domain protein"
FT                   /note="PFAM: Prolyl oligopeptidase family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78828"
FT                   /db_xref="GOA:C5BXT4"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXT4"
FT                   /protein_id="ACQ78828.1"
FT                   /translation="MQLPEAPQVPRGHPEWPAPAWEARFRAGYVSVPEWALAAPERAVV
FT                   VATHQGVRQVHSWDSTTRALIPTTDRPHGTVTATIDPRGEWIWWFDDDGGDEFGVWRRQ
FT                   PFASGPRRRTETPLPLTAAYSAGLLLGEDKTVVVGRSDDAYGTQIHQLVVGPAGAGDTA
FT                   PVLLYAHAQDASAAALSRDANLVAIEHSERGDNRHPAIRVVRADDGGRVTELDDGPGQG
FT                   LWAMDFAPVHGDPRLLVLHERAGRPKPLVWDVATGLQRPIEIGIDGEIADADWFPDGRA
FT                   LLVAVDHDARTRLYRYDLSDGTLTPVSPESGTVAGGTARPDGDVWFSWSSAATPRTILS
FT                   ARTDRAVLTPIGAPAPPSVPVEDVCLDGPGGRIHALLRRPAGGVEPLPVIVEVHGGPTW
FT                   HDSDSFAPDAAAWVDHGFAVLQVNYRGSTGYGSAWRDALEAKVGFTELEDVAAVHEHLV
FT                   TRGVLDPDRSVLAGASWGGYLVLLGLGTQPDRWSLGLAGVPVADYVAAYEDEMDGLKAF
FT                   DRSLFGGSPAEVPDAYRVSSPITYASAVRSPTLVLAGENDPRCPIRQIDNYVGALRGRS
FT                   EAPPVEVYRYDAGHGSYADTERIKQMRAQLEFVRTHLG"
FT   gene            complement(626743..627369)
FT                   /locus_tag="Bcav_0566"
FT   CDS_pept        complement(626743..627369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0566"
FT                   /product="copper resistance protein CopC"
FT                   /note="PFAM: Copper resistance protein CopC"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78829"
FT                   /db_xref="GOA:C5BXT5"
FT                   /db_xref="InterPro:IPR007348"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXT5"
FT                   /protein_id="ACQ78829.1"
FT                   /translation="MFRRLAATSLASTLLAVAVVATALPASAHNALVSQTPADGATLDA
FT                   APTEIVLEFNEPASDIGNEIQVVGADGVDVAHGAPTLDGTSVVQHLTTDLAGGAYTVNW
FT                   RVTSADGHPISGTSTFTLALPEATTEPTAEPTAEATPTEPEATASATDDAAAGADEPGI
FT                   DEGNPWRTPLLVVFGLAIIGTIVTLIVRLRRGGAGRMNGPTSGQD"
FT   gene            627585..629102
FT                   /locus_tag="Bcav_0567"
FT   CDS_pept        627585..629102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0567"
FT                   /product="2-methylcitrate dehydratase"
FT                   /EC_number="4.2.1.79"
FT                   /note="PFAM: MmgE/PrpD family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78830"
FT                   /db_xref="GOA:C5BXT6"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXT6"
FT                   /protein_id="ACQ78830.1"
FT                   /translation="MPTTHHVRVHRSEEHLPRSEQLAWAIAEVATDRVEVPRAVVDMVV
FT                   NRIIDNAAVAAASLLRAPVVAARAQALAHPYTPGATVFGRSPQLRVSPEWAAWANGVAV
FT                   RELDFHDTFLAADYSHPGDNIPPILAVAQHTGATGADLIRGIATGYEIQVDLVKAISLH
FT                   AHKIDHVAHLGPSAAAGIGTLLHLDASTIYQAVGQALHTTTATRQSRKGAISTWKAFAP
FT                   AFAGKVAVEAVDRAMRGQSSPTPIYEGEDGVIAWLLDGPEASYDVTLPARGEAKRAILE
FT                   TYTKEYSAEYQAQALIDLARRLHRRYPEVADPEQVERIVIHTSHHTHHVIGSGANDPQK
FT                   YDPTASRETLDHSIPYIVAVALQDGGWHHVDSYAPERAGRQDTVALWHKISTAEDPEWT
FT                   RRYHESDPAQKAFGGRMEIVLTDGRTLTEEIAVADAHPLGARPFEREQYVRKFRTLADG
FT                   VLEDVEAERFLDLVERLPDLGTGELSGLTIAARPGLLGTARTPKGLF"
FT   gene            629102..629998
FT                   /locus_tag="Bcav_0568"
FT   CDS_pept        629102..629998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0568"
FT                   /product="methylisocitrate lyase"
FT                   /EC_number="4.1.3.30"
FT                   /note="PFAM: Isocitrate lyase family; TIGRFAM:
FT                   methylisocitrate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78831"
FT                   /db_xref="GOA:C5BXT7"
FT                   /db_xref="InterPro:IPR012695"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXT7"
FT                   /protein_id="ACQ78831.1"
FT                   /translation="MLHATATAQEKRGALRSALADGDRLLRWPGAFNPLGARLIEDKGF
FT                   EGVYVSGAVLSADLGLPDIGLTTLTEVAGRAGQIARMTNLPTLVDADTGFGEPMNVART
FT                   VQVLEDAGLAGCHIEDQVNPKRCGHLDGKQVVPLADAVQRVRAAADARRDGDFLVMART
FT                   DVRAVEGFDAAIERARAFVDAGADAIFPEAMRSLAEFEAVANAVDVPVLANMTEFGKSE
FT                   LFTVSQLQDAGVRIVIYPVTLLRVAMGAVERGLDEITAAGTQAALVPDMQTRARLYELV
FT                   DYAGYNAFDAEIFTYRP"
FT   gene            complement(630048..631541)
FT                   /locus_tag="Bcav_0569"
FT   CDS_pept        complement(630048..631541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0569"
FT                   /product="sulfatase"
FT                   /note="PFAM: Sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78832"
FT                   /db_xref="GOA:C5BXT8"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXT8"
FT                   /protein_id="ACQ78832.1"
FT                   /translation="MTTTDTEERPSMSSRPNILVICTDQHRFDAVGTHPGSAAITPNLV
FT                   ALAERGAVFEQCYAPNTVCSPTRASMLTGEYPSSHGLWANGVTLPEGRSLVSRELADAG
FT                   YRTGLVGKFHLASAFEGRTEERLDDGFETFAWAHDPFHGAPENAYHRWLRERHPALWAE
FT                   AMGDVVTPDVENFAHENTRFDEMPAHASYSTWVTEEVGDFLRTEDDRPFFLLANYFAPH
FT                   HPFAAPQEYLDLYPPGSVPPPVGGPDELATKPTLQSEASRASYVGHGPSFADFTPEGID
FT                   EIRRTYHAMVSQIDDGVGRILRTLREQGLERDTLVVFVSDHGEMLGDHALLLKGPMMYD
FT                   PAVRVPLVVSWPDLVPAGHRVTDFVGVHDVAHTIRCAAGLEPYARDQGLDLVAVAREER
FT                   EARTYAWAEYRDSGYPYDPPAHTTMYRRHDSKVVVWHGDPDAGRPATGELYDLADDPDE
FT                   LVNRWDDPAYARRRLELCAAVSDLQMLHEHRHADRVAPW"
FT   gene            complement(631538..632377)
FT                   /locus_tag="Bcav_0570"
FT   CDS_pept        complement(631538..632377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0570"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78833"
FT                   /db_xref="GOA:C5BXT9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXT9"
FT                   /protein_id="ACQ78833.1"
FT                   /translation="MGMRRTTRSSLPARIAAYVFIALVLVVFTLPTLYAVLTSLQPPQV
FT                   SLNPVPQWVFTPTLDNFVALFDESSFLGPVLNSVQSSVGSAALALAISAPAAYALSRAG
FT                   VSSSGATGLWLLAARALPAIGLAVPAYAIFTRVGLSDTIVALLLVYLPFNVALATIMLK
FT                   VFIDGIPRELDEAAALDGAGPLRTMLQVVLPVARPGLASVTIMTFLFAWNNFLFPLVLT
FT                   GSQSATIPLVLQKFLGSYTLQWNQVMAGVVLLSLPLIVLGAIFGKYMVGGLAAGSVK"
FT   gene            complement(632368..633258)
FT                   /locus_tag="Bcav_0571"
FT   CDS_pept        complement(632368..633258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0571"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78834"
FT                   /db_xref="GOA:C5BXU0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXU0"
FT                   /protein_id="ACQ78834.1"
FT                   /translation="MSSFTAADGRLRGWQLGFTAPLFVVLALTTILPIVYALALALGAS
FT                   DDSLTPRAPFSGENFSDVFGGREIWSALWLAVVFLVGALALELALGVLTALVLDRFLPN
FT                   RNALRVLLLWPAVLPPIAVALVFKYILQGDIGMVSYYLGLVGIHQEWLTQPGSAMAVII
FT                   GIDVWQYTPFVILLTLAALKTVPEEVLEAAQLDGAGAVRSAWSLVLPIVRPAVIAIALL
FT                   RFIDAIQVFPTIYVLTRGGPGSSTQLLTYYNFQVFFGQLRFGEGAAIAVFVVVFTLVCV
FT                   TVFTRLQRRAERAWA"
FT   gene            complement(633255..634667)
FT                   /locus_tag="Bcav_0572"
FT   CDS_pept        complement(633255..634667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0572"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: Bacterial extracellular solute-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78835"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXU1"
FT                   /protein_id="ACQ78835.1"
FT                   /translation="MRNDPTGLARWGALGVAAALVLAGCGAGGGDAGGGGDDTGAELEA
FT                   SAEDFLAGRGEELGVGSISVLAQSSPQADAIQQISGQFTELTGITVDWTILDEQSTENR
FT                   AAVALGSGDGGYDVLQTPSGFIPTYVDRGWLEPIGPLVDDAESIVPGWDLAAFGEGTTS
FT                   LLSREDELYGVPMFIGTQMFYYRTDVFAEHGIDAVPTTYEELVDVVHQIHSDDVAGIAL
FT                   RTAPSPSQLLFVWSAWLYANGGSYYETFDDGTYSGSALDSPEAVESLTTYTDLVQNYAP
FT                   SGATNWSVDDVTRAFASGRVAIVQEGAVFGGTFNNPEASQVAGNIDSFTLPEGPAGSYV
FT                   PYNTHGWTIAANSDATDAAWLFTQWATLAQTLTAATQTDANFGAPPLAEVYESPEYEES
FT                   YGFGSFVPTVTGTIGIANDGGVSPFEDDPNYLPATPDWATVGQQIAEELSKAVTGQVEV
FT                   AEAIRAAAAYLE"
FT   gene            634840..635778
FT                   /locus_tag="Bcav_0573"
FT   CDS_pept        634840..635778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0573"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: Putative sugar-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78836"
FT                   /db_xref="GOA:C5BXU2"
FT                   /db_xref="InterPro:IPR007324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXU2"
FT                   /protein_id="ACQ78836.1"
FT                   /translation="MVDASGSHARERALMAHVARRYYHGGRSKSEIADELFLSRFKVAR
FT                   LLDAARRTGVVQITIDVPGDVNDNLSRELEEAYQLRRAVVIDDGAEDQLLARLGEAAVV
FT                   LLSEVVREGELVGITSARTMLAIHELPQVPLPLCTFVQITGELPRTDASNVISLIRILT
FT                   RRTGGSAQVFFAPMVASSEDAWRSYMAQPEVRAAFARFRELSVLITGVGAWAPGRSIIY
FT                   DHLPDVRDDATRAGAVAEALGIPIDAHGRTVHGPARRRIVAPDVETLMGTRERIAVVFD
FT                   PARADAVRVAARNGVINSIVTQRSNAEALLA"
FT   gene            635834..636970
FT                   /locus_tag="Bcav_0574"
FT   CDS_pept        635834..636970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0574"
FT                   /product="2-methylcitrate synthase/citrate synthase II"
FT                   /EC_number="2.3.3.1"
FT                   /note="PFAM: Citrate synthase; TIGRFAM: 2-methylcitrate
FT                   synthase/citrate synthase II"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78837"
FT                   /db_xref="GOA:C5BXU3"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR011278"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXU3"
FT                   /protein_id="ACQ78837.1"
FT                   /translation="MTDADPQAKEIHKGLAGVVVDTTSISKVDPDTNSLLYRGYPVQDL
FT                   AARVSFEEVAYLLWHGELPTPDELQAQNATERLQRDLDPDVRDAILALPTTAHPMDVVR
FT                   TAVSVLGATDPDAENLDPDALQAASLRLFAQLPAIVALDQRRRLDLPEVAPRADLGWCE
FT                   HLLYLTFGQVPDAVVVDAFSVSMTLYAEHSFNASTFTARVIASTLSDLYSAVTGAVGAL
FT                   KGPLHGGANEAVMRTFAEIGTADDAAGWLADRLAAKGKVMGFGHRVYKHGDSRVPTMRE
FT                   ALVRMVDHTGRTELMALYAALEDAMAERTGILPNLDYPAGPAYHLMGFETATFTPLFVA
FT                   SRVTGWTAHIMEQLASNALIRPLSEYVGPERREVPERP"
FT   gene            complement(636977..637462)
FT                   /locus_tag="Bcav_0575"
FT   CDS_pept        complement(636977..637462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0575"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78838"
FT                   /db_xref="GOA:C5BXU4"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXU4"
FT                   /protein_id="ACQ78838.1"
FT                   /translation="MPVPEYVARLRAAVGHELLWLPGVSAVVTDPADRVLLGRRTDNGL
FT                   WAIPGGILDPGEEPAVGLRREILEETGVLARTEALVLVDTTDVVHYASGDSAQYLNLTF
FT                   WCVATGGEAHVADDESTAVGWFARDALPEPLAASTSKRVAAYDRYRADPANGPDFVP"
FT   gene            637671..638744
FT                   /locus_tag="Bcav_0576"
FT   CDS_pept        637671..638744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0576"
FT                   /product="phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /EC_number="2.5.1.54"
FT                   /note="PFAM: DAHP synthetase I family; TIGRFAM:
FT                   phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78839"
FT                   /db_xref="GOA:C5BXU5"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXU5"
FT                   /protein_id="ACQ78839.1"
FT                   /translation="MTTVAAAPRTNDLRVRALELLPTPAAIRTEAPLDDDGAALVASSR
FT                   RGASDILRGADDRLLVVVGPCSIHDPEAALAYAARLAPLRERFADSLEVVMRVYFEKPR
FT                   TTLGWKGLINDPGLDGSHDVPRGLRLARRVLLDVVAAGLPAATEFLEPTTPQYVADAVS
FT                   WGAIGARTPESQVHRQLASGLSMPIGFKNATDGDVQAAIDGCVAAAAEHTFLGIDDDGR
FT                   ASAVATTGNPDGHVVLRGGRSGPNFDAASVAAALDLIGAAGLPRRLVVDASHGNSGKDH
FT                   VRQAGVVRELAQRIGAGERGIAGVMIESFLVPGRQEPAPTGLVFGQSVTDACVGWDETE
FT                   ELLAALAVASASRRLSA"
FT   gene            complement(638839..639915)
FT                   /locus_tag="Bcav_0577"
FT   CDS_pept        complement(638839..639915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0577"
FT                   /product="Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit"
FT                   /note="PFAM: Pyridoxal-phosphate dependent enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78840"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXU6"
FT                   /protein_id="ACQ78840.1"
FT                   /translation="MPAFTPADRAWCDEAIRRVEADAQRSADTHLHQVPLPADWGIDLY
FT                   LKDESVHPTGSLKHRLARSLFLYALVNGWLREGTTVIEATSGNTAVSEAYFARMLDLPF
FT                   VAVMPRRTSPAKIARIEAYGGRCHLVDTPSAIYAEAERLAAETGGRYLDQFTYAERATD
FT                   WRGNNNIAESIFGQLALERHPVPEWVVVAAGTGGTSSTIGRYLRYRRHPTRLAVVDPEN
FT                   SSFYPGWADDVPDYTTGMPSRIEGIGRPRMEPSFVPGVIDHMIPVPDAASVAAMRHLAA
FT                   YAGRRAGGSTGTCLWGAWTLIDAMRRDGRTGSVVTLLCDSGDLYSGTYYDDAWVAAQGL
FT                   DPAPYRARIERLLAGGEL"
FT   gene            640182..641405
FT                   /locus_tag="Bcav_0578"
FT   CDS_pept        640182..641405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0578"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: Major Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78841"
FT                   /db_xref="GOA:C5BXU7"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXU7"
FT                   /protein_id="ACQ78841.1"
FT                   /translation="MHPASETMPRATRTTRWWVVALLFFLGWLFIYADRTILNPVMSEI
FT                   GSEFGLDKAGLGLLNSVFFLVYALVQVPSGMLGDKYGRLKFIVFGFIVFGLFTGLTGIA
FT                   GAVGVLFLMRAMAGFGQGFYYGPQYSLSGEMIPERFRTVGSALINSGQAFGISIGLIAS
FT                   SYIAFDLDLGWRGPFYVFALPTIVVGLAMWVFIKEPARPTPSAGDEPKPTVLSLFKSKN
FT                   LVRTFVMVFCSIYGFFVMITWLPTYLNEVRGVALEDTGFVSSLAAWTSVPAALVFAYFS
FT                   DRIGRRKPLLLIVFPAAIASILLLVFAPSMPLVIVALVLYGLTGKLATDPLLIALCGVN
FT                   SPKAITATAFGLFNFIGMSASILAPYITGFLVEATGEWNVGFYLAIGLLVVAILAALGI
FT                   KENRKAVS"
FT   gene            641410..643098
FT                   /locus_tag="Bcav_0579"
FT   CDS_pept        641410..643098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0579"
FT                   /product="FdrA family protein"
FT                   /note="PFAM: Bacterial FdrA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78842"
FT                   /db_xref="GOA:C5BXU8"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXU8"
FT                   /protein_id="ACQ78842.1"
FT                   /translation="MLQTIIKPNTYQDSVSLMMLSTQLSGLDAVERVSIMMGTPANKEI
FT                   FRDTGFGSDELEGAGPSDLVIALEADGAGAADLISGRVAEFLKSQASAASATTYPRVRS
FT                   LDRALTALPDANLALVSIPGEQAAPEIDRLLDKDLHVFVFSDNLAVDDEVRLKHKARER
FT                   GLLMMGPDCGTGSLGGLPLAFTNIVTPGSIGIVGASGTGTQEVMVQIDRAGGGVSQAIG
FT                   LGGRDLSEKVGAVTCLQALRALDADPGTSVITLVSKPPAPSVRETVLDVCQELATPVVA
FT                   ILLGEQPAVEVDGNVHFAATLDEAARLAVSLAGTVTDEEAPAVELAPGQRTITGLFCGG
FT                   TLTSEAAILLSRGLGVPTDAEHADGYMLHHDGHTVIDLGDDAYTQGRPHPMIDPSLRAQ
FT                   MIRDAFDDRQLAVLLLDVVTGFGSHEDPAGAIVGAIEAGREAARADGREVVVVASVCGT
FT                   EKDPQPLSEQTRTLQEAGVVVLGSNAAATRYALGVVSRTGERRTPAEIPEPTRRLVSEA
FT                   PRVVNVGLASFADTLQERGGQVVQYTWSPLAGGNARLQRILAALS"
FT   gene            643151..644419
FT                   /locus_tag="Bcav_0580"
FT   CDS_pept        643151..644419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0580"
FT                   /product="protein of unknown function DUF1116"
FT                   /note="PFAM: Protein of unknown function (DUF1116)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78843"
FT                   /db_xref="InterPro:IPR009499"
FT                   /db_xref="InterPro:IPR024033"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXU9"
FT                   /protein_id="ACQ78843.1"
FT                   /translation="MNHAAAIDAANAKVVEKITTAQPVLVDVVRAGDVIPELTEGKVLL
FT                   HAGPPIAWDEMTGPMQGSCVGAALFEGWATTEDEARALLASEVRFVPCHHVGAVGPMGG
FT                   ITSAGMAVLVVEERGNGNRAYCTMNEGIGKVLRFGAYDAEVVERLHWMADDLGPAIAAA
FT                   VAGMEDGLPLLPLVARAITMGDEFHQRNIAASALLFTKLAGPIAAQDLEPARKERILTF
FT                   LADTDQFFLNVMMAACKAIMDSARTIQEGSVVTAMTRNGKNFGIRVAGLGDQWFEAPVN
FT                   TPEGLFFTGFSQDDANPDIGDSAITEAFGVGGMAMIAAPGVTRFVGAGGFGDALAVSND
FT                   MLEIVTGHNPGLPIPTWDFQGACVGIDVRKVVATGITPIINTGIAHKVAGKGQVGAGTV
FT                   RAPLACFEQALEALAATYGVEVD"
FT   gene            644425..645291
FT                   /locus_tag="Bcav_0581"
FT   CDS_pept        644425..645291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0581"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78844"
FT                   /db_xref="InterPro:IPR021530"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXV0"
FT                   /protein_id="ACQ78844.1"
FT                   /translation="MTARWIGATASEVLQAVRVLDVHSVFDTSVNLAAPTTREPALVHV
FT                   SLVRGVRLLECPFGIELETPEWTAWSRAVHSGRTRWHVDARTGALTADDAAVSLELGAA
FT                   WRGAWVDVVAPPRPDSLDLAPPTDDLIGASGLATVAPDVLRRRLRDAVAGLARGDAGAA
FT                   AWLVGRGPGLTPSGDDALVGAVGALHARRLPDRAADGVRALAELVATRGSALTTDVSCA
FT                   YLRDACRGRFAGPLRRALAARPGVVGSAAIRDLLAVGHTSGADTLLGIAAVRDALAPRP
FT                   SLVGAAS"
FT   gene            645288..646586
FT                   /locus_tag="Bcav_0582"
FT   CDS_pept        645288..646586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0582"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: Major Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78845"
FT                   /db_xref="GOA:C5BXV1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXV1"
FT                   /protein_id="ACQ78845.1"
FT                   /translation="MSAPEGGAVPATETSQTPPAAARRSDWRWLRYAFLFFLGWVMMYA
FT                   DRSILSPVQDTVREQFGVSNATIGLLSSVFFVVYVATQIPSGILGDRVGRIRLIFVGFV
FT                   IFGIATALTGVAGILHVFGMLVLMRAFAGFGEGLYYGPQYAKSGEETPLRFRALGAAII
FT                   NSGQGIGTAVGILAATFITYTLELEWGWTFVLFGGITLVVGLLIRTLIPDSRPSRPPGP
FT                   LRGELGRFGTLLRNRVLLGTFVMLFCGVYAFFVMVTWLPTFLAHEWGMEPEAAGQLSSV
FT                   AFWVAVPAGLLVGHLSDRIRARRPFVVVLVPLTILAILTMAFTGQHAVLVAAIAMYGAV
FT                   GKLALDPVLISVVADNITNEMRSTAYGLYNCIGMAAAIVAPYVTGALVDVTGSFQAAFL
FT                   LSSVLLAIGASVFLLTFRERATPVAPREESTAV"
FT   gene            646621..647553
FT                   /locus_tag="Bcav_0583"
FT   CDS_pept        646621..647553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0583"
FT                   /product="carbamate kinase"
FT                   /EC_number="2.7.2.2"
FT                   /note="PFAM: Amino acid kinase family; TIGRFAM: carbamate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78846"
FT                   /db_xref="GOA:C5BXV2"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR003964"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXV2"
FT                   /protein_id="ACQ78846.1"
FT                   /translation="MKIVAALGGNALSRRGEPITSQNLRKNVREAVEPLAGLALEHDLV
FT                   LTHGNGPQVGLLALQNLAYEEIAAYPLDILGAETQGMLGYVVGQELMNAVRLKKEMATI
FT                   LTTTAVAGDDPAFDNPTKFVGPVYSEERANELAAEHGWTIAQDGEWWRRVVPSPEPLHI
FT                   RQAATIRALSEMGLIVLCVGGGGVPVVADYEAGHLRGVEAVIDKDLASAVLAHDIEADL
FT                   LLLLTDADAVYLDWGTPEQRAIERATPEALAEFGFAAGSMGPKVDAARRFVADGHGEAV
FT                   IGSLSKLGEILAGTSGTRIVGSGDLRFYS"
FT   gene            647558..648253
FT                   /locus_tag="Bcav_0584"
FT   CDS_pept        647558..648253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0584"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: Bacterial regulatory proteins, gntR family;
FT                   FCD domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78847"
FT                   /db_xref="GOA:C5BXV3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXV3"
FT                   /protein_id="ACQ78847.1"
FT                   /translation="MSTVPSPAPSTAPRVVTARAALRDRIVSSLRQQIIDGDLRAGTRL
FT                   HERDLSERFGVSRVPVREAIITLSGEGLVDVQPGVGAFVTPLTRQNVREVFEIRAALEP
FT                   MAARLAALRCTADHLATLQALVAGARDAARVHDAAAGARANADFHEMLFRATGNDLLQT
FT                   MVPALDVMTRRLFPKNIVHHEAMMWQDHEAITRAIELGDAERAAELAAAHLENTRRHTF
FT                   EMFERDAEL"
FT   gene            648340..648906
FT                   /locus_tag="Bcav_0585"
FT   CDS_pept        648340..648906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0585"
FT                   /product="bifunctional deaminase-reductase domain protein"
FT                   /note="PFAM: RibD C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78848"
FT                   /db_xref="GOA:C5BXV4"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXV4"
FT                   /protein_id="ACQ78848.1"
FT                   /translation="MRDVILYMSMSLDGFVDSDREHPGMAVPEGAELKAWKLDRISRAG
FT                   AHLMGRVTYQQMSSAWPGSDDPYAAPMNDIPKVVFSTSLSDAEATWPETRVARGDLAAE
FT                   IAAIKAEAGPDVIVWGGGRLAGALVAADLIDEYRLLVQPLVLGRGQALFDQLPESRHLD
FT                   LVEATPFPSGVVLHVYRPQRTPAPR"
FT   gene            648929..649786
FT                   /locus_tag="Bcav_0586"
FT   CDS_pept        648929..649786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0586"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78849"
FT                   /db_xref="GOA:C5BXV5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXV5"
FT                   /protein_id="ACQ78849.1"
FT                   /translation="MTAATIEMEDGTRLRTWTSGSAASRRPPVVMLHGGPGLPDYLGPV
FT                   AHLVDDLCLVHRYDQRGTGGSPWHGEHSIEGSVRDLVALLDAWGHERVVLMGHSFGTDL
FT                   ASYVLLAHPERVAGMVHLAGPFLGSWREADQATQRARRTDDQQRRLDELGDIEARTDAE
FT                   EIEFLTLSWFTDHADRARAWGWAAAAAATLRPVNYVMNAALNADRKARPLESRVGELRA
FT                   AMPRGATSIGGAGDSRPADALRSFGPRIGCEVVIVADAGHHPWLEAPHEFRAALRAAVE
FT                   RQAR"
FT   gene            complement(649788..650375)
FT                   /locus_tag="Bcav_0587"
FT   CDS_pept        complement(649788..650375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0587"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78850"
FT                   /db_xref="GOA:C5BXV6"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXV6"
FT                   /protein_id="ACQ78850.1"
FT                   /translation="METATRDDAGRHEHLGVAGTLLARWPTLVGLAVLAWSAAGGPDAH
FT                   VTAMIIILAAMCYLAAAALGSRRSGWVVAGAATVAVVIAMATALDAIVVLLVAAAAFAV
FT                   YGLLRGRRIDRRELGIQAAGFVVFAAIALTAMSVGPVAAAYLAAAAAIGHGVWDIVHYR
FT                   RDKVVTRSLTEFCAVLDLGLGVLLLAVTWAAL"
FT   gene            complement(650470..651084)
FT                   /locus_tag="Bcav_0588"
FT   CDS_pept        complement(650470..651084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0588"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: Bacterial regulatory proteins, luxR family;
FT                   Response regulator receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78851"
FT                   /db_xref="GOA:C5BXV7"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXV7"
FT                   /protein_id="ACQ78851.1"
FT                   /translation="MTPPIRVLVADDEELIRDALVGLLEREADIDVVATAADGRRAIDA
FT                   ALAHRPDVAVVDLQMPVLDGLAVIAELGRALPACAGVILTGHGRPRVLHQALASGARGF
FT                   LAKGAPGTALADVVRRVHEGNRYVDPVLAADALTAPPSPLTPRETEVLAAAREDRPIRD
FT                   VAGQLFLSPGTVRNYLAAVTAKLAASSRADAYRTARENGWI"
FT   gene            complement(651081..652241)
FT                   /locus_tag="Bcav_0589"
FT   CDS_pept        complement(651081..652241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0589"
FT                   /product="histidine kinase"
FT                   /note="PFAM: Histidine kinase; Histidine kinase-, DNA
FT                   gyrase B-, and HSP90-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78852"
FT                   /db_xref="GOA:C5BXV8"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXV8"
FT                   /protein_id="ACQ78852.1"
FT                   /translation="MTRRSPRISPRLVVLGALLAYTMWALVLPWVLARPPGAASATAYA
FT                   VGLVAFGVALVLVLRSAVTPGQSARARTGYVAVLAAVSLALWPAAHAWAEPGSQPWAWL
FT                   AGFVIGVAPLAIAWPGALAVGTGLTAATALGAAVFDDSVLAATATALGCAGVVWLMCQV
FT                   LVWLLRVLWAEEAGREAEAALSVAQERLRVSRELHDVLGHRLGVIALKAELAADLAARD
FT                   PARARSENEEIRAIAVDTLAEARAAVQGDTVADLATQLTSAELVLSSAGIEAEFDVDGA
FT                   AEHLPDAESRLLAAVVREGVTNVLRHSDARAVSLDLTRAPSWVTLRIVNDGARSAPARD
FT                   GAGTGTGLAALAARCAAAGGRLVSGPVDGGRFELRAELAPQGAGSR"
FT   gene            complement(652378..653916)
FT                   /locus_tag="Bcav_0590"
FT   CDS_pept        complement(652378..653916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0590"
FT                   /product="Galactarate dehydratase"
FT                   /EC_number="4.2.1.42"
FT                   /note="PFAM: D-galactarate dehydratase / Altronate
FT                   hydrolase, C terminus; SAF domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78853"
FT                   /db_xref="GOA:C5BXV9"
FT                   /db_xref="InterPro:IPR007392"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXV9"
FT                   /protein_id="ACQ78853.1"
FT                   /translation="MTDPALATGVIRLDPEDDVVLAARDLAAGSEVALGDVRLTLLDDV
FT                   PSGHKVAVTDVPEGGQVRKYGQSIGRATRGIRAGDHVHTQNLGMVEEDRHHEFGSARVT
FT                   LPEPAGERPTFLGYRRSDRRVGTRNYIGIVTSVNCSATAARLIADQFRGPALDAFPGVD
FT                   GVVALVHQSGCGLVGESEGAQVLLRTLRGYAAHPNFGGILLLGLGCEMLQLDLVTADLE
FT                   LPDDVVVERMTIQGEGGTRATVTAGVEAVRRMLPVVGERRREPIDASELVLGLNCGGSD
FT                   GYSGITANPALGVASDLLVALGGRSVLAETPEVYGAEHLLTRRAVSEEVGTRLLDRIEW
FT                   WRRYTADGGGSLDNNPSPGNKAGGLTTILEKSLGAVAKGGRADLSHVYEYAERIDGRGF
FT                   SFMDTPGYDPVSVTGLVAGGATVVCFTTGRGSVFGCQPTPSIKIATNSALARSMPDDID
FT                   VNAGRILDGDATVAGVGQEIFDLILRVASGEKTVSEELGIGQDEFVPWQLGAVT"
FT   gene            654042..654821
FT                   /locus_tag="Bcav_0591"
FT   CDS_pept        654042..654821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0591"
FT                   /product="glucosamine/galactosamine-6-phosphate isomerase"
FT                   /note="PFAM: Glucosamine-6-phosphate
FT                   isomerases/6-phosphogluconolactonase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78854"
FT                   /db_xref="GOA:C5BXW0"
FT                   /db_xref="InterPro:IPR004547"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXW0"
FT                   /protein_id="ACQ78854.1"
FT                   /translation="MPNITAATVDELTVEVLADEAAMGARAASDAARAIREAVAERGEA
FT                   RVVIATGNSQYAFTDALVTQDVPWDRVTVFHMDEYVGIDDDHPASFQRWIRERIAERVN
FT                   PRRVEYIGGHGDPEQEAARYEAALREAPLDLVCMGIGENGHLAFNEPYEADFDDDRWAR
FT                   IIALTEASQRQQVGEGHFPDLASVPSSAISLTIPALLSARRVQVCAPEDRKAEAVRAAF
FT                   TQPVSSACPATILRRTPHAVLYLEPRSARLLGDVVSA"
FT   gene            654856..656034
FT                   /locus_tag="Bcav_0592"
FT   CDS_pept        654856..656034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0592"
FT                   /product="N-acetylglucosamine-6-phosphate deacetylase"
FT                   /EC_number="3.5.1.25"
FT                   /note="PFAM: Amidohydrolase family; TIGRFAM:
FT                   N-acetylglucosamine-6-phosphate deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78855"
FT                   /db_xref="GOA:C5BXW1"
FT                   /db_xref="InterPro:IPR003764"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXW1"
FT                   /protein_id="ACQ78855.1"
FT                   /translation="MPDLLLRGARLARGDGALSPGDIRVRGERLVAVGDRLPTAPGDVV
FT                   VDVTGRVLSPGLVDLHVHGAGGHAFEDPGAAERIARDLARVGVTSVQASLVSATTAELA
FT                   ERLAAFAPLVGPRPARAAVLGVHLEGPFLAAGQRGAHAASVLRSPTDADRSLLGEHAGV
FT                   VTMVTLAPEVDGVLDLVGPLAGAGTVVALGHSDATAAQVRAAQRAGATHVTHLWSGQSS
FT                   VRREGPWRVPGMLEAALAATGMTAEVIADGRHLPPELLEIARRCLGPDLVVVSDATAGA
FT                   GMPEGYRYRLGEIECVVADGVGMVDGAPSFGGSTTALPGMVRHLARDLGWPLGEVLRTV
FT                   TSAPARVLGREGDIGVLAPGARADLVLWDEDVRVERVWVGGSEVRARDTASG"
FT   gene            complement(656037..657023)
FT                   /locus_tag="Bcav_0593"
FT   CDS_pept        complement(656037..657023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0593"
FT                   /product="transcriptional regulator, LacI family"
FT                   /EC_number="5.1.1.1"
FT                   /note="PFAM: Bacterial regulatory proteins, lacI family;
FT                   Periplasmic binding proteins and sugar binding domain of
FT                   the LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78856"
FT                   /db_xref="GOA:C5BXW2"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXW2"
FT                   /protein_id="ACQ78856.1"
FT                   /translation="MAVTLADIAARADLSESTVSRALSAPDKVNPATRERVLAIAKELG
FT                   YVPNRVARSLSSGRTDLIGLVVPDIANPFFPPIIKAVQARAAIKGWTVLIADIDERAAD
FT                   ELPLARTIRRRVDGLVIASPRTGADRLGELAQLAPVVFINREIPGSTSVIIDAGDGMGQ
FT                   AVEHLAALGHRTIAYLNGPRRSWSNEQRRHAVEQTAERLGLTLVQHGPFEPQVQSGVHA
FT                   ADLVLAGEATGVIAYDDLIALGVLARVAERGLRVGTDLSVIGVDDSPMSAMAYPTLTSV
FT                   HVPGTEAGVTAVDTLLALIDEPDSGPGHVTLETQLVVRSSTGPVAAR"
FT   gene            657224..658423
FT                   /locus_tag="Bcav_0594"
FT   CDS_pept        657224..658423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0594"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: Oxidoreductase family, C-terminal alpha/beta
FT                   domain; Oxidoreductase family, NAD-binding Rossmann fold"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78857"
FT                   /db_xref="GOA:C5BXW3"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXW3"
FT                   /protein_id="ACQ78857.1"
FT                   /translation="MGHLRIGVVGYGNRGVIAQRAAELDGDASVVAVAEPLAPGQARAR
FT                   RDFGPETQVVADVAGLVAVGVDAAFITSPDFLHEEHAVELLEGGVAVFVDKPLAITLDG
FT                   ADRILETARRTGSRLYVGHNMRHMPVIRLMRDLVADGAIGEVKAVWCRYFVGDGGDNFF
FT                   KDWHADRSKVNSLLLQKASHDIDVIHWLAGGYTSRVVAMGEQTLYAGITDRADHSHQLV
FT                   REWHSREDNWPPLRQTGLNEVVDVEDLTMVQMALDNGVLASYQECHYTPDYWRNYTVIG
FT                   TEGRLENFGLGPTGVVRVWNRRSEFAEHGDLEIPIPHVEGGHHGADPALFSEFLNFVRT
FT                   GEPTQTSPVAARAAVATAALATDSMRSGSAPRQVPSLDPDLRAYFEAGQPASAHATPSR
FT                   "
FT   gene            658462..660399
FT                   /locus_tag="Bcav_0595"
FT   CDS_pept        658462..660399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0595"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: Bacterial extracellular solute-binding
FT                   proteins, family 5 Middle"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78858"
FT                   /db_xref="GOA:C5BXW4"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXW4"
FT                   /protein_id="ACQ78858.1"
FT                   /translation="MEKTLAAMTRRGFLAVGSAGLGGAALAACTSSSETPEFAADTDAL
FT                   ESPMLAELVAAGSLPELAERLPATPMVVEPIEGTGAFGGTLQRAQTDATATGVMQSFAP
FT                   TGLLEWNVASDASQESLAESYEISDDNRVYTFTLREGLKWSDGEPFTSADLAFAIENWL
FT                   GNATLVPVPPFWYSDVDQQLPMFDAPDERTVVIEFREPFSLFEKYMCHPGVSTQFIKPK
FT                   HYLEQFHPDFADQADVDAASAAAGFDSWDQYFADRDNTWTNPDRPTMGAFKVTAPASAQ
FT                   SGTATLERNAYFWKTDPDGRQLPYVDKIQVQVLDQSALDLRAANGDLDFQGYYLGYSTT
FT                   ETYLANAESRGFEVLRWTDTWSLLSLCFNLSHQNEALREVFLLRDFRFAMSHAINRDEI
FT                   NSTLLGGLGIIRNPVAPEGTEYGVDGSGQTAIEYDVDRANELLDGLGLALAGDVRALPD
FT                   GTPLELTLLYMDDNQGMSRADAFGMVQEMWAAVGVRLNLRPVDSTLYAQLRLANDFDVD
FT                   GTSMIEEDFDLEPVWFVPTGGNSHTAPGFGLWYSTSGADGIEPPDEFKQLLANWDALRS
FT                   APTADDRVASGQEIMQAHNDNVYVIGLMKLPFQPVVVNSSLKNVRDDAPKMSFYYGREG
FT                   ITKTEQIFFE"
FT   gene            660407..661399
FT                   /locus_tag="Bcav_0596"
FT   CDS_pept        660407..661399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0596"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78859"
FT                   /db_xref="GOA:C5BXW5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXW5"
FT                   /protein_id="ACQ78859.1"
FT                   /translation="MLRYIGFRALNAVPTLVVVSFVAFFVIQLPPGDFVTTQLQQLESQ
FT                   GATVDPAFAEALRDRYGIGEPFLVQYGTWIRNIVLDGDMGLSFQYQRPVTELIGERLPL
FT                   TLLLGVATLLVTYLIALPAGVYAAVRQRSGADYTISVIGFIALATPNFLLALVLSYIGF
FT                   KYFGQSVGGLFSPEYVDAPWSLAKVGDLLAHLWVPVLVLGIGGTAGIIRTLRANLLDEL
FT                   NKPYVTTARAKGLPEGKVVRKYPVRVALNPFVSTAGWHLPSLFDGEVIVAVVLSLGTVG
FT                   PLLLASLKSQDMFLAGGILLIVAVLTVVGTLLSDILLAAVDPRVRFGRA"
FT   gene            661399..662679
FT                   /locus_tag="Bcav_0597"
FT   CDS_pept        661399..662679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0597"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78860"
FT                   /db_xref="GOA:C5BXW6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXW6"
FT                   /protein_id="ACQ78860.1"
FT                   /translation="MGRTGEPARLGRPGHGLGAEDMPPDDDAVRAAVAGVETDEAVHTS
FT                   PVAEEPEWAPQRPGRGEDDGAGPAAPLAQLSQSRLIWRRFRRHRAALVAVVVLVLMYLV
FT                   ALFAGFFAPADPAATSADHAFQPPQVPHVSLSEGAWVHPSVGVTDPETMARVFTEDTSR
FT                   RIQLGFFVRGDSYDILGIVHADVHLFGPVDAAERWYPLGADRKGADLASRIIFGSQVSL
FT                   SIGLIGVAVSLVLGLVLGGISGYFGGWVDNVVQRVIEFIMSIPTLPLWLSLAAAIPPGW
FT                   GAVQTYLMITVILSLIGWTSLARVIRGRFLQTRDEDFVLAARLDGVSTPRIIGRHLVPS
FT                   FASHIIATVSLAIPAMILAETSLSFLGLGLRAPAVSWGVLLQDAQNVQTVATAPWLMLP
FT                   GIAVVLAVVAFNFVGDGLRDSADPYDN"
FT   gene            662690..664456
FT                   /locus_tag="Bcav_0598"
FT   CDS_pept        662690..664456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0598"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: Oligopeptide/dipeptide transporter, C-terminal
FT                   region; ABC transporter; TIGRFAM: phosphonate C-P lyase
FT                   system protein PhnK"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78861"
FT                   /db_xref="GOA:C5BXW7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXW7"
FT                   /protein_id="ACQ78861.1"
FT                   /translation="MNDTPDHVLDVRDLRVSFVTDHGAVRAVDGISFAVPRGSTTCLVG
FT                   ESGSGKSATARSILQVLDVAGRIDGGEILFRAAAGADAVDLAALDARGPAIRDVRGRDI
FT                   GMVFQEPMSALSPVHTIGNQIAEVLAIHEGLDPRSKEARRRVVAELELVGIPRAAERFD
FT                   AHTFQLSGGMRQRAMIAMALISRPALLIADEPTTALDVTTQAQILDLLAELKDTLGMSM
FT                   LFITHDLGVVAEIADDVAVMHDGNVVEAGGVRQIFHAPRDRYTRHLLASLPQRADSPLA
FT                   VHEPEPSAVAAEETSTAQEKPLLEVEDLVMEFRLPSRSRFGRSKEILRAVDGVSLALHP
FT                   GRTLGLVGESGSGKTTVGRTILRAYEPKQGSIRYRTTSGDEVDLARLGNAALRPFRREI
FT                   RMVFQDPYSSLNPRMTVEQVVTEPLRTAGVKDRDERRERAASMLRRVGLNPAMLARYPH
FT                   AFSGGERQRIGIARALITQPRIVVADEAVSALDVSVRTQVLELLAELREEMGLAYLFIS
FT                   HDLSVVERVCDDVAVMYRGSIVERGEVDAVFADPQHGYTQALLSAVPIADPDERGTRTR
FT                   VTYAPELVAQPA"
FT   gene            complement(664571..666526)
FT                   /locus_tag="Bcav_0599"
FT   CDS_pept        complement(664571..666526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0599"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78862"
FT                   /db_xref="InterPro:IPR008391"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXW8"
FT                   /protein_id="ACQ78862.1"
FT                   /translation="MADVARPGFRANLDGYLDTELALHRLVERRTRELVRQWQDRRRLL
FT                   TSPADLAQEQQRIRDAVLRGLGGAPDVDPTPPPVTVTATRHEDGLDVDLLHYAATPTTH
FT                   VTATLYRPTAPASSRGAVFFACGHAETAKADPVYQHVARRLAAAGLVVLMADPLGQGER
FT                   HSYVRDDGSLAVGWGTQEHTVAGIQHWWHGRSVARGFLRDAMAGISLLASLPDVDPARI
FT                   GVTGNSGGGLLTTLLMAVDPRVAAAAPGTFVTARTAYQVTGGWQDAEQHLLSGTLDGVD
FT                   HVDLLLAFAPRPTLVLAAEYDFFPIEGTRATVAEAHDLLARCGGSRSSLELASFPVPHR
FT                   YDPAMADAAAAFFAHHLGGDAVADDRVSTAPLTADRLRVTRSGEVALDVPGETFLFDDQ
FT                   LAELPGPLPPGPDDDDAVAWLSGRVSVPRRRVDGAPRWFEADDAATPEGSRVRRGFWFT
FT                   EDGVPVAGVVRTPLDGVRDDLPLTIELQDAGTPALAPDWAPDDDAVLALDVRGTGALVP
FT                   HERDGRDPRTIGSSTFKLGCDLLWLGDSWQAGRAWDVVETVRLLREGLVPGLRPGPIRL
FT                   RAWGLHTFTALLAGVLDAEIAEIELHGHVDPRTDLTTRAWDADSGRWQWVLPGYAGRFD
FT                   EARVERLLGDRLRLLP"
FT   gene            666671..667954
FT                   /locus_tag="Bcav_0600"
FT   CDS_pept        666671..667954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0600"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: Oxidoreductase family, C-terminal alpha/beta
FT                   domain; Oxidoreductase family, NAD-binding Rossmann fold"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78863"
FT                   /db_xref="GOA:C5BXW9"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXW9"
FT                   /protein_id="ACQ78863.1"
FT                   /translation="MCGLSNRGVASFLRPLLGSRGGSESSVGFGANVEDYSGSAELVAV
FT                   LDADAARIGEFRDTLLPAGYGPVAEYGADDVGRMLDETRPDVLLVTGPDHTHAGHVLAA
FT                   LERGVDVIAEKPMTSTAHDAARVLAAERASTARVRVTHNLRYTPRHRQIRRLIADGAIG
FT                   RPTHVTLEYHVDTRHGASYFLRWNRTRAASGGLSIHKSCHHLDLINWLIGDLPASVVAH
FT                   GAQNYFGPRSPHRPAPGDVDPYAAALSASGALPGADGVRRGLFDLAYREQYPQPMSLYD
FT                   DEIDVEDTYLALVRYGGGAALAYSIDFSSPWEGYTLGISGTHGRIEATYGRERDGQPRE
FT                   GSDHIVHYPLFGSRSRIDVATGAGGHDGADALMRADLFGTPSAESAELGLAASTQQAAY
FT                   AVAAGEAMWRSASTGAPVDVAALLEGEA"
FT   gene            667951..669309
FT                   /locus_tag="Bcav_0601"
FT   CDS_pept        667951..669309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0601"
FT                   /product="Mannitol dehydrogenase domain protein"
FT                   /note="PFAM: Mannitol dehydrogenase Rossmann domain;
FT                   Mannitol dehydrogenase C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78864"
FT                   /db_xref="GOA:C5BXX0"
FT                   /db_xref="InterPro:IPR000669"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR023027"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXX0"
FT                   /protein_id="ACQ78864.1"
FT                   /translation="MSAPRLTRESARGVSARPGVRGPLVEPAAVGVVHLGIGAFHRAHQ
FT                   AVYTERAAALAGEREWGILGVTGRRPDVARVLDASGGVYGVLVRDGADVSVDVVGAVVE
FT                   AASPDQDAERVVAAIAAETTAVVSLTITEHGYAGPPFSPPIELLVRGLRRRAAHGAPLS
FT                   VLSCDNLVDNGAVLRRIVRAAVSGDDGVARWVDDAVRFPRSMVDRIVPATTAEDRRAAA
FT                   VLTGFDDAGLVVAEPFSEWVIEDDLAERRPRWELAGARVVPDVEPYERLKLRTLNATHS
FT                   LLAYEGEARGHTTIAEALDDDELARRVEALMAESGLTLEQPPGIDVVAYRAEVLRRFRN
FT                   RGMRHTVAQIGHDGSRKLPIRVGGTIGDLVAQGVTPDATARVLAAWAVHLRRGAVVDPL
FT                   ADELQAAARAARDAVELAELVLRLPGIVPDAVAGRRDVRDAVAAHTAEILALA"
FT   gene            669363..669740
FT                   /pseudo
FT                   /locus_tag="Bcav_0602"
FT   gene            complement(669749..669825)
FT                   /locus_tag="Bcav_R0010"
FT   tRNA            complement(669749..669825)
FT                   /locus_tag="Bcav_R0010"
FT                   /product="tRNA-Pro"
FT   gene            complement(669891..670817)
FT                   /locus_tag="Bcav_0603"
FT   CDS_pept        complement(669891..670817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0603"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: Calcineurin-like phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78865"
FT                   /db_xref="GOA:C5BXX1"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXX1"
FT                   /protein_id="ACQ78865.1"
FT                   /translation="MGAGVLGWSLLEARRYTLRHVPVPVLSPGARPVRILHLSDLHLVP
FT                   RQADKRAWLRDLATTGPDVVVDTGDNMAHREALPAVLDALEPLLALPGAFVMGSNDYFA
FT                   PKIKNPLRYFLDDPRGFGDEGPSGDRLPGKELGAAFRAAGWRDLTNRRDTIDVGGTRLD
FT                   LVGVDDPHLERDVLPPPVTAPADGGAAPGSSVRIGVAHAPYQRVLRGMQDDGAQLVLAG
FT                   HTHGGQLCVPGYGALVTNCDLDTRRASGLHGWPGARPDEPGGEGSLWLHVSAGLGTSPY
FT                   TPVRLACRPEATLVDLVPRDSRRPSAW"
FT   gene            complement(670856..673357)
FT                   /locus_tag="Bcav_0604"
FT   CDS_pept        complement(670856..673357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0604"
FT                   /product="glycosyl transferase family 51"
FT                   /note="PFAM: Transglycosylase; Penicillin binding protein
FT                   transpeptidase domain; PASTA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78866"
FT                   /db_xref="GOA:C5BXX2"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXX2"
FT                   /protein_id="ACQ78866.1"
FT                   /translation="MASPRRSTSRAVNPVQLVSLLVAYLLVAGAGGVLTAGLVMPAIAA
FT                   AGATSEAGNQLFDDLPTELGPQTPSERTTILAADGSHLATYYARNRIVVPLDQISQYMR
FT                   DAVVATEDRRFYEHSGVDIEGIMRGAVSTLSGDIQGASTLTQQYVKNVLIEAGDVAGDE
FT                   EAIEAARETSLGRKLREAKLAIALEKVMTKDQILEGYLNIAQFGASQYGVEAASQFYFG
FT                   HSAADLTLPEAALIAGITQSPGKYDPVRDEANGYENSTNRRNTVLYLMFQQGYITQEEH
FT                   DAAVAIAVPDMLHITQTPVGCQTAGGGVSAFFCQYVTEVLLNDPILGETEEERRQALNR
FT                   GGLTVTTTLQPPAQQAAYDSLTGRVPVNDPSYNSRQGELGVSGAISTVEPGTGNIVAMV
FT                   QNTPFGQPTAEQPRATRVNYNVDRAYGGGDGFQTGSTFKAFVLTQWLIDGHTLSDVVNG
FT                   SNGQVFPANSWTISCYPNAVSSWPPKNLESGASGQMTVLRATQESINTAFAYMANQDMD
FT                   LCALRDTAARMGVHVGTGTVQPNGQALFDSQAGEAMLTTPSMVLGANTIAPLTMAAAFA
FT                   TYASGGVYCEPRAITSITDTNGEAIPVPEPECSQALEPHIAAAATYAMQQVVQNGTATS
FT                   AQIGRPLAGKTGTANDDYHAWFIGYTPQLATAVWTGHHEGNISMFDSVINGRYYSQVFG
FT                   GALPAPIFSDYMSQVMAPYPVEDFPRAGEREIYGDLVQVPGVIGQDLAAAQQTLTAAGF
FT                   QVQVAEPVTSDQAAGTVAEMDPAEGSRVRPGTTITLRPSSGPEEEEEDDDDRGNLPPVI
FT                   PPGGGDDDDRGGGGGNGGGDN"
FT   gene            673529..673891
FT                   /locus_tag="Bcav_0605"
FT   CDS_pept        673529..673891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0605"
FT                   /product="transcription factor WhiB"
FT                   /note="PFAM: Transcription factor WhiB"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78867"
FT                   /db_xref="GOA:C5BXX3"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXX3"
FT                   /protein_id="ACQ78867.1"
FT                   /translation="MSDGGLTPEASWTLNAACAAEAPQEMADDLFVQGAAQRDARRICF
FT                   ACDVRLECLAEALQTRAPFGVWGGMTERERRALLRRRGDVASWWDEIRTDEELTTTFSA
FT                   QRLSLDDGRRRVRSTA"
FT   gene            673972..674136
FT                   /locus_tag="Bcav_0606"
FT   CDS_pept        673972..674136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0606"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78868"
FT                   /db_xref="InterPro:IPR025234"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXX4"
FT                   /protein_id="ACQ78868.1"
FT                   /translation="MTTWEYATVPLIIHATKQILDQWGSDGWELVQVVPGPDGNGLVAY
FT                   LKRPREGQA"
FT   gene            674133..674600
FT                   /locus_tag="Bcav_0607"
FT   CDS_pept        674133..674600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0607"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78869"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXX5"
FT                   /protein_id="ACQ78869.1"
FT                   /translation="MTPSQRLAELGLELPAVPEPLAAYVPAVTSGEYVWTSGQLPMRDG
FT                   ALVATGKVGEGPGLVSPADAKELARIAALNALAAIAQQAGGLDRVVQVVKVVGFVASDP
FT                   SFTGQPGVVNGASELIGDVFAEQGIHARSAVGVASLPIDAPVEVEVVARIA"
FT   gene            complement(674714..675391)
FT                   /locus_tag="Bcav_0608"
FT   CDS_pept        complement(674714..675391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0608"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="PFAM: Cyclic nucleotide-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78870"
FT                   /db_xref="GOA:C5BXX6"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXX6"
FT                   /protein_id="ACQ78870.1"
FT                   /translation="MNEDVVRTAPIFADLDDDTVAALRAAMDEVTVRRGEVLFREGEPG
FT                   DRLFVIASGKVKLGHTAPDGRENLLAILGPGEIVGELSLYDPGARTATATALAPSNLLE
FT                   LDNPDLVALLEDHPSLARQLLRSLAQRLRRTNNALADLVFSDVPGRVAKALLDLSHRFG
FT                   RPVPGGIRVPHDLTQEELAQLVGASRETVNKSLAEFSARGWIQLDGRAVVLLDVPRLER
FT                   RAR"
FT   gene            complement(675481..676089)
FT                   /locus_tag="Bcav_0609"
FT   CDS_pept        complement(675481..676089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0609"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78871"
FT                   /db_xref="GOA:C5BXX7"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXX7"
FT                   /protein_id="ACQ78871.1"
FT                   /translation="MTRPTTARSNWAGYYAAGEGRDVRDLVVRGAAATAAPGRALDLGC
FT                   GDGTETAWLLERGWRVWALDVTPEAMPLVRAKAEAARAGDRLDTVVADLATAALPAADL
FT                   VLACASLPFVEPGAFDGAWSRVRAALRPGGVLAVNLFGTNDSWADAETGVDGMTFQARA
FT                   EVEELLAGLHVVELTETEWDGPSGRGPKHWHRFDVVAHA"
FT   gene            complement(676086..676982)
FT                   /locus_tag="Bcav_0610"
FT   CDS_pept        complement(676086..676982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0610"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78872"
FT                   /db_xref="GOA:C5BXX8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXX8"
FT                   /protein_id="ACQ78872.1"
FT                   /translation="MSVDPSIVLVEGPWTHTYVAANGARFHVALAGPDDFRAPLVVLLH
FT                   AFPQLWYAWRAQLPALAEAGYRVAAMDLRGFGASDKPPMGHDTPSLVADVAGVIRSLGA
FT                   SEAVVVGHGYGGGIAWSMPAFAPEVTRAVATLGAPHPVALRRRRLPMRTLATLARLQLP
FT                   WFPERALRTPGGVTRLLRAWGAPGWEGDATQLYNDAMRLPFVAHTSLELVRWQVRSTPR
FT                   PDGRRYLAALHDPVTVPVLSLHGTRDRFVAPSASRRDAEFVDGPYAFRTIEGAGHFLPE
FT                   EAPDDVTRHLLEFLETV"
FT   gene            complement(677244..679247)
FT                   /locus_tag="Bcav_0611"
FT   CDS_pept        complement(677244..679247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0611"
FT                   /product="acetate/CoA ligase"
FT                   /EC_number="6.2.1.1"
FT                   /note="PFAM: AMP-binding enzyme; TIGRFAM: acetate--CoA
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78873"
FT                   /db_xref="GOA:C5BXX9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXX9"
FT                   /protein_id="ACQ78873.1"
FT                   /translation="MPENGPVESGPALENLLVEERTFPPSPEFAAAAVASADLYEQASA
FT                   DRLGFWADQARELLDWDTAFTEVLDFSDAPRARWFADGTLNAAFNAVDRHVAAGLGERV
FT                   AIHWEGENGDTRTLTYADLQREISRAANVLGDLGVSTGDRVAIYLPMIPEAVIAMLACA
FT                   RIGAPHSVVFGGFSAEALHSRIVDAEAKLVITADGGYRRGAPSALKPAVDEALAKGGTP
FT                   VEHVLVVRRTGQEVAWTDDRDVWWHESVDAASETHAPVAVDAEHPLFILYTSGTTGKPK
FT                   GIFHTTGGYLTQSAYTHRNVFDLHPETDVYWCTADIGWVTGHTYVTYGPLVNGATQVMY
FT                   EGTPDTPHRGRWWEIVQKYGVTILYTAPTAIRTCMKWGGDIPAQFDLSSLRVLGSVGEP
FT                   INPEAWMWYRRVIGGDRTPVVDTWWQTETGAIMISPLPGVTAAKPGSAQVPLPGIVADV
FT                   LDDAGKSVPNGSGGYLVLTEPWPSMLRGIWGDEERFRETYWSRFPGSYFAGDGAKKDAD
FT                   GDIWLLGRVDDVMNVSGHRLSTTEIESALVSHPWVAEAAVVGAQDATTGQAVVAFVILR
FT                   AEAVEKADEEGEGHDVVAELRNHVAKEIGPIAKPRSILVVAELPKTRSGKIMRRLLRDV
FT                   AEHRQVGDVTTLADTSVMDLIATGLATAPSTD"
FT   gene            679784..680323
FT                   /locus_tag="Bcav_0612"
FT   CDS_pept        679784..680323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0612"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="PFAM: Sigma-70, region 4; Sigma-70 region 2;
FT                   TIGRFAM: RNA polymerase sigma factor, sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78874"
FT                   /db_xref="GOA:C5BXY0"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXY0"
FT                   /protein_id="ACQ78874.1"
FT                   /translation="MKPRSEDRLRELWLAHAADVHRFAQRALPHHDAEEVVSETFVVAW
FT                   RRLADVPEDARPWLFATARNIMMTRARSTGRRYALIARIEREPTTTPEPTDEQALARHD
FT                   LARAWLSLYEQDRECLALIVWEGLSNRDAARVVGCSPTAFAVRVMRARRRFEKALEDKP
FT                   EPRPLPIPLGATHEQD"
FT   gene            680310..681110
FT                   /locus_tag="Bcav_0613"
FT   CDS_pept        680310..681110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0613"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78875"
FT                   /db_xref="GOA:C5BXY1"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXY1"
FT                   /protein_id="ACQ78875.1"
FT                   /translation="MNRTDIDALIGAGDPHPRTTFDPTAHVERVRTILRDPPQNRPVRL
FT                   ESSQSPRRRRGWIAAAVAATGAALGAVTLTSLPTAPAFAGWTTSPASVSPVSADVLSDA
FT                   CPGQAREIVDTDGGPAVNLLPLPRVIVDVRGPYTYVVSASEQGWEECLITPDAEGGIDV
FT                   VTNDAAYGQPVSTQVDADEVSVVVGLDRTTSWRQGADGLPGALTSAFGRAGSDVVSVTV
FT                   TTASGSAVEATVHNGWWAVWIPGEVDLEGSISASLEDGSTISVL"
FT   gene            681398..682120
FT                   /locus_tag="Bcav_0614"
FT   CDS_pept        681398..682120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0614"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78876"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXY2"
FT                   /protein_id="ACQ78876.1"
FT                   /translation="MMRTGNRIKLAVVAVLAAAGVSWALTAGANPELAEAESSPAPTNL
FT                   PGIPAPGAPDHVWRAWAEEDTLDLRAYDWEQDSAQRGCTIEAIDFVEEVAADYNLAMGA
FT                   PDDLVTLRVDRIENCTTSEPEIVPFDMPPGPGPICNSQTHGPGTICISKSGGKVHASWA
FT                   YRGSGAVSGYLRIYQAPTTSACGTNTTWHTGPNTAWNSGDTHSISKTQTQNGGYTAVIW
FT                   KYNGIGSYTNWGRTCAVL"
FT   gene            complement(682508..683482)
FT                   /locus_tag="Bcav_0615"
FT   CDS_pept        complement(682508..683482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0615"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78877"
FT                   /db_xref="GOA:C5BXY3"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXY3"
FT                   /protein_id="ACQ78877.1"
FT                   /translation="MSTEPDKNADDAASGSTTGSHSAPRPVPPVDAREESAGAGESVDA
FT                   TRVNPVVPQDRPAGADEPATPPASGASSTGPETPAESAGPAGTRPAAGADAPVDTPQDP
FT                   ATEPAAAAAPTTEPTRPMTTSTSATQPLPASDVAREYPADDPRAGAFDEPGWEDERPRR
FT                   TAAHLWSVVITLVLTPVAWFLLTDGALRTFFSLEQDPGDVNLAGLLSLAGGLLALVLIM
FT                   ITARWSGLGAMLIGTIVTLAGVAFLVFPSPVTEWLEQNRDVFLVINDGFGTNVYSYLLD
FT                   TGRAGLLVLFGVILVMTGVVSHGARRQGRREGQAAARREAVSA"
FT   gene            complement(683646..684665)
FT                   /locus_tag="Bcav_0616"
FT   CDS_pept        complement(683646..684665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0616"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78878"
FT                   /db_xref="GOA:C5BXY4"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXY4"
FT                   /protein_id="ACQ78878.1"
FT                   /translation="MTAPPATVPVPPRSRVAAHLVGTALALVVAPFAWLACAGAAGAFA
FT                   EGAADGGGAPPSAVVALLAGALVLAGIVAWAARSAVAAIVVGATYGVAAALVHTFARSR
FT                   VNTVTDALPETWLDLPVQAGAELLFRAQAPVLVGGVMLAAGITAFAARRAGRYTEREDA
FT                   RRTAALGATTAPRPRIVAHVVSVVVGAVGTPVLLATAGAFTAATLMSESRTRVAVVALA
FT                   GALAVAVVVGIAAVSSLGAFVAGALWVIAGLGYLAAPDGARSLLAGPVTRIEELLLGEP
FT                   VGDAVHALGATGTVLLVGVVLLGAGVAAHGARRDGRNLERSEIALVRDRDAVVSRPNG"
FT   gene            complement(684895..686637)
FT                   /locus_tag="Bcav_0617"
FT   CDS_pept        complement(684895..686637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0617"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="PFAM: PAS fold; GAF domain; Stage II sporulation
FT                   protein E (SpoIIE); TIGRFAM: PAS domain S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78879"
FT                   /db_xref="GOA:C5BXY5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXY5"
FT                   /protein_id="ACQ78879.1"
FT                   /translation="MTSIDDIYRAAQASQVSIVVTDAREDDEPIVWVNEAFTRTTGYAR
FT                   DAALGRNCRFLQGPATDPAAVARLGLAVRADEPVAAALLNYRPDGTPFWNDVSISPVRD
FT                   DAGAVTHHVGVQVDVTARADAERERDRVISASRTAQRRLELLRRIGDDLHGVFDADAEA
FT                   AMLPGILVPELADWAMVVSLDDAGRLRPPHVATVGGGSGPAHEAAAVLTSLGRGDLDPS
FT                   GALSRLLVSDDGALLVSSEVAAWWGRQTLRDDVPAAVATLGAHHVVAVPLDARGARLGV
FT                   LVLGAGDARHLDERDLATARMAASRAAVALDNARLYRRESSRVRDLQRTLVPHLTPLDG
FT                   LEIATHYGPADATDVGGDWFDAFRANDGNVGIVIGDVAGHDLRAAGSMGQLRSLIRARA
FT                   WGGTGPGRTLTEVDAIAQDLGSIDLSTCLYAHLERVADDDGEHVVVGWARAAHPPMLAV
FT                   TPDGVVHVLDGGLSTPIGLTHPHGERPEMHAAFPLGTTLVLCTDGLVERREESLEAGLA
FT                   RLAAAVGEMPDAPVEAVRDHVVSQLEPEGGWRDDTTLVVARVVALPADGQQEPDLVRRG
FT                   PGGS"
FT   gene            686892..687929
FT                   /locus_tag="Bcav_0618"
FT   CDS_pept        686892..687929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0618"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78880"
FT                   /db_xref="InterPro:IPR017746"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXY6"
FT                   /protein_id="ACQ78880.1"
FT                   /translation="MGETGLRVALRSSDPLLVGHVRRVTDVAGWALDVTPAGGTAPRAD
FT                   VHVDSVRERGPGDPPWARGVRSRREGPLWVAREQPGEWPAPEPASAVVHLLPEADAELA
FT                   EAIADRAELGHARVVGVVGARGGVGASVFVGALAREAAGAGATCALVDLDPAGGLDVLL
FT                   AIEHEPGPRWADLDATAGSIPPDALAAALPVWHAVHVLAGDARGGPSAGALVPALRALR
FT                   EAHDVVLLDLSRRADDAGATALAACDDVVVLAPGDVHGAAGLLSLAPRVAGRGHLVVRQ
FT                   GTAGDAVLAAPDELAVASGLGLAGVVRHERALRAGLERGMAPGDRRRSPLVRTARAVAR
FT                   RLVPA"
FT   gene            687926..689164
FT                   /locus_tag="Bcav_0619"
FT   CDS_pept        687926..689164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0619"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: Type II/IV secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78881"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR022399"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXY7"
FT                   /protein_id="ACQ78881.1"
FT                   /translation="MTGRALAAEVRAALGSAPAPAGVATAVRGGAGLRGRREVVALERE
FT                   VRAELFGAGPLVQALLEAPDVTDVLVNSPTDVFVDAGIGLERVDVGSGVGDVRALAVRL
FT                   AAAAGQRLDDASPVVDGRLPDGTRLHAVLPPIAAEGAVISLRTVRRRALTLDEWRAHGG
FT                   IDDATLRVLRAMVQRRANVLVSGATGSGKTTLLASLLSAAAPAERIVCIEEARELAPDH
FT                   PHVVHLQSRAPNVQGTGGVGLPELVRAAMRMRPDRLVLGECRGAEVREVLTALNTGHDG
FT                   GLATVHANAAADVPARLVALGALAGLAPRTIAAQATSALDAVVHLARAGGRRHVREIAV
FT                   LVRDGGELGAVLAAERPAGGELRLGPGWPVLGRRLGLLAPEAADCSASGVLGAPSGETT
FT                   GGRPSSGAVREPW"
FT   gene            689614..690039
FT                   /locus_tag="Bcav_0620"
FT   CDS_pept        689614..690039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78882"
FT                   /db_xref="GOA:C5BXY8"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXY8"
FT                   /protein_id="ACQ78882.1"
FT                   /translation="MAWRSGGAALGADGVPAVLLERAGDSPALDAAIAACRLAHTSGTP
FT                   LADVLTSCAAGIVEADAAEAARRVALAGPTSTARLLGWLPVVSLVAGTALGADPIGVVL
FT                   AGGVGLVAVLGGVALMVLGRRWSAALVASAERGGEAG"
FT   gene            690039..690578
FT                   /locus_tag="Bcav_0621"
FT   CDS_pept        690039..690578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0621"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: Bacterial type II secretion system protein F
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78883"
FT                   /db_xref="GOA:C5BXY9"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXY9"
FT                   /protein_id="ACQ78883.1"
FT                   /translation="MAAALVVGLLVVVAAVPWLWPPRRLPVPRPAQERRAVRVDAAVAC
FT                   ELVAAVLDAGAAVPTALDALGRAIDGDDGRALRSCGGALLLGASWSEAWSGVPGRWAIV
FT                   ERALEPAWTDGVAPGPALRAAADGVRARRAELAKEAAARLGVRLVLPLGLCYLPAFVLL
FT                   GLLPVVIATGGSLLGG"
FT   gene            690735..691061
FT                   /locus_tag="Bcav_0622"
FT   CDS_pept        690735..691061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0622"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78884"
FT                   /db_xref="GOA:C5BXZ0"
FT                   /db_xref="InterPro:IPR025338"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXZ0"
FT                   /protein_id="ACQ78884.1"
FT                   /translation="MSKESKRSTGSREVVSAVARVWLTAARVVRCVLTRAAEGPVAALG
FT                   RVVAMGRARRRLVVASAEAGMATAEYAIATLAAVAFAGLLLVILRSGEVREMLLSIIRD
FT                   ALSV"
FT   gene            691058..691435
FT                   /locus_tag="Bcav_0623"
FT   CDS_pept        691058..691435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0623"
FT                   /product="putative TadE-like family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78885"
FT                   /db_xref="GOA:C5BXZ1"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXZ1"
FT                   /protein_id="ACQ78885.1"
FT                   /translation="MSESSPRRERGDEERGSVTAELAVALPALVVILVAVLLAASAGLT
FT                   QVRCQDAARAAARAAAIGDDDARVRAVALELGGPSAGVTVARDGEWVVVTVEREVTTGV
FT                   PSWSVTVSATARAWIEPGEPP"
FT   gene            691471..691926
FT                   /locus_tag="Bcav_0624"
FT   CDS_pept        691471..691926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0624"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78886"
FT                   /db_xref="GOA:C5BXZ2"
FT                   /db_xref="InterPro:IPR021202"
FT                   /db_xref="InterPro:IPR028087"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXZ2"
FT                   /protein_id="ACQ78886.1"
FT                   /translation="MCGRDRGPAGDCDPGADLAADGHLGARAGSRDRDRGSATVLVLGL
FT                   VGALAVLLVAVALLGAVARARGTAQTAADLAALAAARVANDPWASGDPCAVADAVARAH
FT                   AAELTSCSVTGGVLDVTTAVPVSVTRGADGPMVAEASARAGPVGPAG"
FT   gene            complement(692171..694582)
FT                   /locus_tag="Bcav_0625"
FT   CDS_pept        complement(692171..694582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0625"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: DEAD/DEAH box helicase; Helicase conserved
FT                   C-terminal domain; Domain of unknown function (DUF1998)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78887"
FT                   /db_xref="GOA:C5BXZ3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018973"
FT                   /db_xref="InterPro:IPR022307"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXZ3"
FT                   /protein_id="ACQ78887.1"
FT                   /translation="MTRPDTLSVLLTSAARRTSLVHLEEREPRPGSTAAWPDWADAELV
FT                   TAYVRLGVERPWVHQVEAADAAWSGTHTVLATSTGSGKSLAAWLPALTAVRRPPEQPGR
FT                   ISSLRRRAAVLYLAPTKALAADQRHGLERLLAAGELRDVRVATCDGDTPLDERDWARDH
FT                   ADVVLSNPDFLHFSMLPGHRRWDRLLRGLRYVVVDECHAYRGVFGAHVSLVLRRLLRLA
FT                   EAAGAAPTVVMASATTGDPGATAARLIGVAPDRVHAVTRDASPQGRRRIALWEPPPTRE
FT                   TGAAPAPVSVEEGGDAADAGVLEGDFPRRSALAETADLLADLVRGRRRTLAFVRSRIGA
FT                   EVVATEALDHLGDAVAGARRPPVAAYRGGYLPEERRDLEADLRTGDLLALATTNALELG
FT                   VDVAGLDAVLMAGWPGTRVSFWQQSGRAGRAGAEGLAVLVASENPLDTYLVHHPEAIFD
FT                   EQVEATSFDPTNPYVLAPHLCAAAAERPLTDVDLERFGLPDASLLDELERRALLRRRPT
FT                   GWYWNHALVDPPSRLTDLRGSGGQAPVQVVEDGTGRLLGTVDGSRADATVHAGAVYVHQ
FT                   GRTFEVLGLADDVALVTAQHVTYRTRSRSTTHVRVAAELRTTSWGPVTWGYGQLEVSSQ
FT                   VLGYDRRRLPGMEIIGSYPLELPVRTFATTGVWWTAPLDALREAGLDVGDVPGALHAAE
FT                   HAAIGMLPLLATCDRWDIGGLSTALHEDTGQPTVFVYDGYPGGAGFAERGYGIADRWIS
FT                   ATADAIAACACVTGCPRCVFSPKCGNGNSPIDKAGALRVLDYLRARAAGA"
FT   gene            complement(694715..695242)
FT                   /locus_tag="Bcav_0626"
FT   CDS_pept        complement(694715..695242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0626"
FT                   /product="putative two component transcriptional regulator,
FT                   winged helix family"
FT                   /note="PFAM: Transcriptional regulatory protein, C
FT                   terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78888"
FT                   /db_xref="GOA:C5BXZ4"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXZ4"
FT                   /protein_id="ACQ78888.1"
FT                   /translation="MSIDVADTDRGYVLCVGLPLEACSEVARLMGNQAVVVAAADTDGA
FT                   RALLGGDRVEWSHAGVAAAPPDPPPRKPSRVGALQRGPLRVDLGTREVTIAGRRVHLST
FT                   REFDLLVALASEMDRVWSFAELTVHVWHTGYLGDPDTVTSAVKRLRKRLAAVGGLEVAS
FT                   VRGIGYRLLVPS"
FT   gene            695544..700049
FT                   /locus_tag="Bcav_0627"
FT   CDS_pept        695544..700049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0627"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: Cna protein B-type domain; Subtilase family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78889"
FT                   /db_xref="GOA:C5BXZ5"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR021720"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXZ5"
FT                   /protein_id="ACQ78889.1"
FT                   /translation="MRTPVLVARRLVIAASAVAGLVATLAVGAVPALAEPTPVVPATAD
FT                   EKFTAEALQVLEESETADFWVRFADRADLDAASSVDDWDARGIAVYEALRETAAASQAG
FT                   TIAALDAADASYVPYWVANAILVKGGTLDLAQSLAASPEVLEIRQTTVYPLEEPVMTPD
FT                   TTMGPQAVEWGIQAINADDVWATYGTTGEGIVVANIDSGVDYTHPALVSHYRGNNGDGT
FT                   FTHDYNWLDTSAACDVGPCDTDGHGSHTMGTMIGSDGGANEIGVAPGAEWIAANGCSTC
FT                   SDADLMEAGQWMLAPRPIGGDDDSGDPTKRPHIINNSWGSRFPSNDPFMEAIITDWEAA
FT                   GIFGSWSNGNSGPACETSGSPGSRTITYSVGAFAQNGSIASFSARGPGQDGTIKPNIAA
FT                   PGVAVRSSLPGGAYGNGDGTSMAAPHLAGAIALLWSAAPSLVGDIRGTWALLDETAVDV
FT                   EDLTCGGTADDNNVWGEGKLDALALLQAAPVGDSGTLAGTVTDEAGAPVAGAAVNVAGP
FT                   TERDITTDEAGAFSLGVVPGDYTLTATAFGFSPGTATATVVPGETATVTIALTPAATFA
FT                   VTGTVTNSVTGDPVGGATVSLGAPIADVTTAADGTYAFADVPAGEYTLSVTAGACAEPY
FT                   AAAVTVDGAETFDVALAAVSDAFGYYCTLGTDGYRQGDTLLDLTGDDVATTVDLPFDVE
FT                   FYGDRYSQAHVSTNGNLNFLAPVTTGANAVLPRPAAPNAAIYAFWDDLDVDAEAGVYTA
FT                   ATEIDGEQAFVVEYRNVKIWGTAQTGRLSFSITITESGDVTIGFGDVTADDARAGGSSA
FT                   TIGIENADGTIAHVFTHNTAGSVTPGLTVSYGLPDHGHISGVVKDYNDSLPIAGATVTA
FT                   TPDDGGEPVVLETDAEGRYDGLLFFGAYTVTIEADGYRTVTRDVVIDVEEEQITFSPKL
FT                   RTGIANVDPASFEWILTEGQSRTAELTIGNSGSTPLDFTIGEVPRNVSSEAPAPALSAS
FT                   TLANEQVPAGATSLAEANALVAERAEAADAVDPNARTALGEYTSEQLEAFSAPSFEPDA
FT                   AGDVLAQWNTGLTVAWGVGYTGDVWVSDPEDITNTQFTPDGVELGSYPADWGGTWPGDM
FT                   ALDSSTGDMCQVNVGGDNGIHCFDPATGAETTVITGGEDWDATSQRGLAYNPTDDVFYI
FT                   GGWNSDAIFTVAGLSHDTPGAQLNVCVPEDPSVAGLAYNPTSGTLWMVPSSLTTVFYQL
FT                   VPEDCSTVSTVDYPGDDQGPGAGLELDATGALWAANQLTGDVYLVDVGVPNVSDVPWLS
FT                   VDPTEGRVPVGGERTLDVTVDTTGLEPGVYGANILVQTNAGRVSTISVPVTLVVSAYQV
FT                   GVNAGGGEYTDAGEFTWSADQQLTGSATWGWVGQRSEVSTTTRAIGGTTEDTLFQSRRS
FT                   GVFSYVFEDVPAGTYAIDLGFAEFNRNFPERDRLFDVLVNGDYQIVAHDVAEEVGGLYA
FT                   DQHVLQVEHSGGDLEVQFLNRRSYDFPIVNTVRVTERGDL"
FT   gene            700218..700571
FT                   /locus_tag="Bcav_0628"
FT   CDS_pept        700218..700571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0628"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="PFAM: STAS domain; TIGRFAM: anti-anti-sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78890"
FT                   /db_xref="GOA:C5BXZ6"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXZ6"
FT                   /protein_id="ACQ78890.1"
FT                   /translation="MELTVAGTDRSGVPVVSVTGEVDVYTGPVLREELEKALARGTTGV
FT                   VVDLSGVAFIDSTGLGVLVTAHRQLASRGGRLHVCAPEGKITSVIALTGLDAVLAVHSA
FT                   LDDAVHAAAPASA"
FT   gene            complement(700614..701330)
FT                   /locus_tag="Bcav_0629"
FT   CDS_pept        complement(700614..701330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0629"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78891"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXZ7"
FT                   /protein_id="ACQ78891.1"
FT                   /translation="MRATIARPTTVPAPHEGVPFDGAVELERQVSRLLDLGYPELLGVD
FT                   EATFRTRLEPLRSHARDLGERTAWDADAVGRDDAIPFVLVLPGIPADAAARRMELAGRA
FT                   GTSMLTEEEWAGFVPRPDVALPRDDDGERSFAYLLTDIDTGSDLRDVTPEDAVRAIQAR
FT                   DRSPLTVAEGIAVVTQRPDMLRRNRCYSLAGSRRGDQRVPAVWISGERAPKLGWCWDRN
FT                   PHTWLGTASAQERRAA"
FT   gene            701451..703232
FT                   /locus_tag="Bcav_0630"
FT   CDS_pept        701451..703232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0630"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="PFAM: tRNA synthetases class I (R); DALR anticodon
FT                   binding domain; Arginyl tRNA synthetase N terminal domain;
FT                   TIGRFAM: arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78892"
FT                   /db_xref="GOA:C5BXZ8"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXZ8"
FT                   /protein_id="ACQ78892.1"
FT                   /translation="MDAGTSPERGYRWRMFDPAAILGPRVSAAIEAAFGLRDVDPVLRP
FT                   SQFADVQVNAALALAKQVGAPPRDVATRLVAALDADGAFADVAAKVEVSGPGFLNITLR
FT                   DDWIAAQVGAQAGDPRRGLPTPEPQVVPIDYSAPNVAKEMHVGHLRTTVVGDALARTLE
FT                   ALGHRVVRQNHIGDWGTPFGMLIEHLLEVGEDSDAARLLETDPNTFYQAARAKFDAEEG
FT                   DFATRSRARVVALQGGDEATLAIWRRMIELSKHYFNRIYTTLDVTLRDEHLAGESTYDP
FT                   MLEGICDELEAKGLAVVSQGALCVFPPGFTGRDGTPLPLIIRKSDGGYGYATTDLATIK
FT                   HRAQDLHADRILYVVGAPQHLHLSMIFEVARLAGWLGDTEPVHVQIGNVLGADGKILKT
FT                   RSGAPIRLMALLEEAVERAGAVVDAARGDLDDDERSAIARQVGIGAVKYADLSVAHDTE
FT                   YVFDFDRMLALNGNTGPYLQYAAARIYSIFRKAGLDPADARGAVVLGEPAERALGLALL
FT                   DFGAVVGDVAALLAPHRLCTYLFELAQAFTAFYDACPVLTAPTDELRASRLALTAAVLG
FT                   TLVEGLDLLGIAAPERM"
FT   gene            complement(703275..704156)
FT                   /locus_tag="Bcav_0631"
FT   CDS_pept        complement(703275..704156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0631"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78893"
FT                   /db_xref="UniProtKB/TrEMBL:C5BXZ9"
FT                   /protein_id="ACQ78893.1"
FT                   /translation="MTAARRRALLATTTVLLVLPVVGACAARQELPADPPIADPGYPSS
FT                   QTPSAEPTSTPLPTAPVSPPPSSTDPTDPPAEPSASPSPEPTPDDEPTTPEPEPTRTPE
FT                   AVAFVPECGAELEAPRTLGELRIDLASDVPTTIGPEDWFATTATATNLTDATIPDVRLF
FT                   TSVTIAQDGVVVGRWLGGSEAPVAADLASGEQVELSVEHSFAQTCEGATAGPAPTDSTP
FT                   AEALGTEDPTQEHTPSDSPTAETPAPDRLPAGEYTVLVALHVVVDGGDPLDPLAPPSVL
FT                   ATAGPVDVVVTD"
FT   gene            complement(704230..705525)
FT                   /locus_tag="Bcav_0632"
FT   CDS_pept        complement(704230..705525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0632"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78894"
FT                   /db_xref="GOA:C5BY00"
FT                   /db_xref="UniProtKB/TrEMBL:C5BY00"
FT                   /protein_id="ACQ78894.1"
FT                   /translation="MSDEFRDLARELHDAADRAPVDPDALAAALPAMRREVRRRRTVRG
FT                   LGVAGVSVAAVAVLAVAATALPGLFDDDAPVPPATPSPTQSPTDGPTQAPTDEPTGEPT
FT                   GEAIVGSEPVQPVCGEPFALPDRPSQLALEASFPEPVAFPADPAGLGTRLGAVVELTNR
FT                   GEAWIDETTPYEAQLVVVGLDGAVVAAYEDPDIGYGEGTSALAVAPGDTFELSASLLLD
FT                   FACGETAPTDATLPPGEYEVYGLLPAQGDGDLQGQGGPWPLTVVDGQQPEEWPTPERSG
FT                   QPEGAVPWTYECGAAWEPPAITTGFTLEAEQPIRSPRPATDHLEGFWSLTTTQELRGPT
FT                   VFGQVVLVQDGRAVSEPLPGGDAVTVPFASPDGAFSLLAAGNLVGCDGSSLPPGGYEVH
FT                   VVALLIPGDAQDGEGEHLVAVAVSDVESVTIE"
FT   gene            complement(705522..706097)
FT                   /locus_tag="Bcav_0633"
FT   CDS_pept        complement(705522..706097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0633"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="PFAM: Sigma-70, region 4; Sigma-70 region 2;
FT                   TIGRFAM: RNA polymerase sigma factor, sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78895"
FT                   /db_xref="GOA:C5BY01"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C5BY01"
FT                   /protein_id="ACQ78895.1"
FT                   /translation="MASWEEALTTVVSERGARLLRTAYLLCGDRSGAEDLVQDALVKTF
FT                   ARRRTTPRLRIDAAGTRDVVALGEAESYVRRAILTLYLDEARRSGRWRKVRHLVAAQEQ
FT                   TAGHESRVTGRVDVERALAVLAPRERACVILRFYDDLTVPQVARELGLAEGTVKRYLSD
FT                   ASATLAGQLDPGGADVRRRPARETGGSR"
FT   gene            706291..708606
FT                   /locus_tag="Bcav_0634"
FT   CDS_pept        706291..708606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0634"
FT                   /product="V-type H(+)-translocating pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="PFAM: Inorganic H+ pyrophosphatase; TIGRFAM:
FT                   vacuolar-type H(+)-translocating pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78896"
FT                   /db_xref="GOA:C5BY02"
FT                   /db_xref="InterPro:IPR004131"
FT                   /db_xref="UniProtKB/TrEMBL:C5BY02"
FT                   /protein_id="ACQ78896.1"
FT                   /translation="MLELGTTSLIIVGVIAVVALASLVVAAVLRRQVLVAGEGTTAMQD
FT                   IARAVQEGASAYLNRQFRTLAIFAVVVFGLLFLLPGDGGIKIGRSVAFLFGAAFSAAIG
FT                   YLGMSLAVRANVRVAAAAQHPDGRAVGARLAFRTGGVVGMSVVGLGLLGAAGVVLVYRG
FT                   DAPAVLEGFGFGAALLAMFMRVGGGIFTKAADVGADLVGKVEQGIPEDDPRNAATIADN
FT                   VGDNVGDCAGMAADLFESYAVTLVAALILGKAVMGEQGLIFPLLVTAVGALVAVLGVWT
FT                   TRVRGNENGLRAIYRGFYISALAGVVLAAVAAFTYLPSSFEGLGGTADLGDVTVDPRLA
FT                   AALAVAIGVVLAGIILWITGYFTGTTTRPTRHVAATSRTGAATVVLSGVGVGFESAVYT
FT                   AGIIAAAICGVFLIAGGSIWLSLFLIALAGCGLLTTVGVIVAMDTFGPVSDNAQGIAEM
FT                   SGDVGEEGAKILTDLDAVGNTTKAITKGIAIATAVLAATALFGSYADAVSISLAEVGDR
FT                   VAGADDALVAAMMNYQIISPITLVGVILGAATVFLFSGLAVDAVTRAAGAIVLEVRRQF
FT                   REMPGIMTGQTRPEYGKVVDICTRDSLRELATPGLLAAFAPIAVGFGLGVGPLAGFLAG
FT                   AIGAGVLMAVFLANSGGAWDNAKKIVEDGTHGGKGSPAHEAVVIGDTVGDPFKDTAGPA
FT                   INPLLKVMNLVALLVAPAVVAMSVPADANHALRVGIAVVAALIAGGAIVMSRLRATRTD
FT                   DANAARAEEERVTADAQQ"
FT   gene            complement(708732..710102)
FT                   /locus_tag="Bcav_0635"
FT   CDS_pept        complement(708732..710102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0635"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: Major Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78897"
FT                   /db_xref="GOA:C5BY03"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR024671"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5BY03"
FT                   /protein_id="ACQ78897.1"
FT                   /translation="MSHDDALPAPTEHLPAAPGAAGAPAPRRQVVAWGFWDWGQQAFQT
FT                   IILTFVFSVYLTTAVAEQVNDSDTRGTQALSNAQTIAGVAIALLCPLMGVLADRYGRRR
FT                   RLLAIATLALVACMVAMFFVRPDQQYLVLGVTLVALASVFSEIAGVFYNGMLLQIATPT
FT                   TFGRVSGMAWGLGYLGGLVSLVICLFAFVLPDVGLFGVTTDDGLAIRAVALFSAVWCLV
FT                   FCLPLLVLGPDTPAGEGSRGSLNPVTAYRDIGLRIAHMWRNERGLLHFLVASAVYRDGL
FT                   GAVFAFAGVLAASAYGFSTTEVIYLGIAANLGAGVGTWIAGRIDDAVGPRRLIVTSLTA
FT                   IVVLGAVVATSPSPVVFWVCGIGISLFVGPVQSASRSLLARITPFGHENENFGLYATAG
FT                   RAVSFLAPAAFALAIALFGFNRAGIIGIVAVLLIGLLLFLPLRVPANVHLASTDAPR"
FT   gene            complement(710248..711816)
FT                   /locus_tag="Bcav_0636"
FT   CDS_pept        complement(710248..711816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0636"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78898"
FT                   /db_xref="GOA:C5BY04"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="UniProtKB/TrEMBL:C5BY04"
FT                   /protein_id="ACQ78898.1"
FT                   /translation="MVAPVLSRRSALTLGLGASAAIATLPATGVGRAHAAGAPRDYTSR
FT                   GVFDSYDEFFHAGDINGQPDQENANETGGYAWAQSYVLDGFAAMYRAYGDPVYLDRMVT
FT                   NIDLILERTDAARGVTDYRGESLPAWRAMGPYTVGSAPLLDDAGDVAFEYRTSRGPADV
FT                   TSVEVRHEADGLFALVVRNSARGTTDEFTGLSADPASARYAVAVVYDAFGTAANNSTLH
FT                   DLGTGARPAAGVYAATALPAIFAVHTGMVTAPIAAFVGIVRGEGRLQRRYGGRVARYLR
FT                   AVEAAVAVHDHEWVDLGAGRGTYRWPKGMTVPYDGNDQPVNQSLGLGRTLCELAHLTRR
FT                   RRYADRVRALAKLLRSEIWTEDGAAQWHYWPSTASIFSGYAATGDPASDVSLHNPSYGT
FT                   PGNGADQIEDTSHGAISVQFAAAAHRYRLGIGEADLRALARTFTHKLATTGADGLATVF
FT                   TRVNGTGVAPSGQYLQAPRWIDAAEWDPAVFEHALAIYSDHQPEPGLGSGLASIGNLNW
FT                   FAATH"
FT   gene            complement(711918..713663)
FT                   /locus_tag="Bcav_0637"
FT   CDS_pept        complement(711918..713663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0637"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: Sodium/hydrogen exchanger family; TIGRFAM:
FT                   Na+/H+ antiporter, bacterial form"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78899"
FT                   /db_xref="GOA:C5BY05"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:C5BY05"
FT                   /protein_id="ACQ78899.1"
FT                   /translation="MEFAIVAVLGILAIVAVNALAPRVGVAAPLVLMLLGVAISLLPFV
FT                   PLVEVEPEWILMGVLPPLLYSASVSMPAMDFRRDFRAISGLSVLLVVITAVLLGWLFSV
FT                   LIPDINLATGIALGAIVSPTDAVATSIVKRLGAPTRVVTILEGESLLNDASALVLLRSA
FT                   IAATATAVSLWGVVGDFLFAVVVAVAIGGVVGILNLRARKAIRQATLNTAISFVVPFVA
FT                   YVPAEELGASGLVAAVTAGLVTGWGSTRYLRPQDRLAQTENWRTIELVLEGAVFLVMGL
FT                   EVVDIVTDVTESHGSVALAVGIAALTILGLVVIRAAFLAPLLRSLGRRADRAATVRAAM
FT                   ADNQQRWEDAAAADPERVRKVAERFGQDAYERRRARFTLAFTRRIADVDYLASARLGWR
FT                   EGGLLVWAGMRGVVTLAAAQTLPRDTPARSLLVLVAFLVAGGSLLVQGGTLPWLVRRLG
FT                   LTSTDTTESDDERQRLQVALADAATGALDRLTTDDGGTYDAGVVAQVRLESTFGIGEET
FT                   EEESAGPTSRFAQYRSLRVKVIEAQRAELLHLRAVGTYDSTALTRALEVLDADQIRLEL
FT                   DGEPA"
FT   gene            713712..715238
FT                   /locus_tag="Bcav_0638"
FT   CDS_pept        713712..715238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0638"
FT                   /product="methyltransferase small"
FT                   /note="PFAM: Methyltransferase small domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78900"
FT                   /db_xref="GOA:C5BY06"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5BY06"
FT                   /protein_id="ACQ78900.1"
FT                   /translation="MSTPPRVDPDGAAALRADLAPFTVDALTELLGPVAASALRREQAV
FT                   PARAVAAASDEPAATLLRLFVLGDDVPRPALDAALPRLGTAGAERLGLVTASGNAPDAV
FT                   VRATCDLTPYAATDAAGDVAWWIASDRGELATGGPLPADYVLGVGGASTTLAQVTVPDR
FT                   RERVLDLGTGCGIQALHATRHAGGVVATDVSARALAYAAFNAALAGAELDLREGSMLEP
FT                   VAGERFDLVVSNPPFVITPRTAGVEEYTYRDGGRSGDDVVRDLVTGVGAVLAPGGIAQL
FT                   LGNWEHRRGEPWQERVEAWLVESGLDGWVVQRELQDPAEYAELWLRDGGTTPDRDPASW
FT                   AAGYEAWLADFAARGVEGVGFGIVTLHRPTASRASWHRVEEMTGTVAYPLGAAILASVR
FT                   TADLLAGMDDDGVLGRAWRVARDVTEERYLTPGDADPRVILLRAGGGFGRTVQAGTALA
FT                   AFVGACDGELTGAQLVGALAALLDAPADALAAELAADVRALARDGLLLPA"
FT   gene            715784..716389
FT                   /locus_tag="Bcav_0639"
FT   CDS_pept        715784..716389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0639"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78901"
FT                   /db_xref="UniProtKB/TrEMBL:C5BY07"
FT                   /protein_id="ACQ78901.1"
FT                   /translation="MHRRRGLPEPQGTPARTEPAVTAVDRVDRAHHADDVVGILTETVR
FT                   AGVDPERILEAVAARSRMRHRRLVLDVLAAAVAGVESPLEYRYHRDVERAHGLPTSRLQ
FT                   VREVVGGRWIRADVVYEEYSMRSELDGELGHPGGRTDSDTWRDNDVVLDRGQVTLRYRW
FT                   GHVAGRSCAVAGQVGRGLRTGGWAGSPRRCGPPCRLEA"
FT   gene            complement(716433..716984)
FT                   /locus_tag="Bcav_0640"
FT   CDS_pept        complement(716433..716984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0640"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78902"
FT                   /db_xref="GOA:C5BY08"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:C5BY08"
FT                   /protein_id="ACQ78902.1"
FT                   /translation="MHEPDAAWRTRFPDLFSETYVAYAGCRTSFTTAAAPDPLVSRLHV
FT                   VAVTPGGHVVVCRSDQDHRFLPGGTREPGETLLALARRELLEEAGAELVGDLRHVGSHV
FT                   ADSDRPAPYRPHLPHPQAHWSWAVADVRLAGAPTNPDDGETVVEVLTLPPHEATDYLEV
FT                   HDPVHAAIVRLAGAMGLLAA"
FT   gene            complement(717030..717452)
FT                   /locus_tag="Bcav_0641"
FT   CDS_pept        complement(717030..717452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0641"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78903"
FT                   /db_xref="GOA:C5BY09"
FT                   /db_xref="InterPro:IPR021299"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:C5BY09"
FT                   /protein_id="ACQ78903.1"
FT                   /translation="MKQLFHAAAAYLVAGLASGLYYRELTKHYEFTGSTQLAVAHTHLL
FT                   TLGVIVLLIALVLEKVFTVSASPRLFRWFLWTYNAGVVLSSAMMIWHGTLTVAGQESTK
FT                   MIAGIAGLGHILLTVGLVLFFVALRRRVIAAPSAAG"
FT   gene            complement(717586..718341)
FT                   /locus_tag="Bcav_0642"
FT   CDS_pept        complement(717586..718341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0642"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /EC_number="1.1.1.125"
FT                   /note="PFAM: short chain dehydrogenase; TIGRFAM:
FT                   2-deoxy-D-gluconate 3-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78904"
FT                   /db_xref="GOA:C5BY10"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PDB:3UF0"
FT                   /db_xref="UniProtKB/TrEMBL:C5BY10"
FT                   /protein_id="ACQ78904.1"
FT                   /translation="MTGPFSLAGRTAVVTGAGSGIGRAIAHGYARAGAHVLAWGRTDGV
FT                   KEVADEIADGGGSAEAVVADLADLEGAANVAEELAATRRVDVLVNNAGIIARAPAEEVS
FT                   LGRWREVLTVNLDAAWVLSRSFGTAMLAHGSGRIVTIASMLSFQGGRNVAAYAASKHAV
FT                   VGLTRALASEWAGRGVGVNALAPGYVVTANTAALRADDERAAEITARIPAGRWATPEDM
FT                   VGPAVFLASDAASYVHGQVLAVDGGWLAS"
FT   gene            complement(718338..719156)
FT                   /locus_tag="Bcav_0643"
FT   CDS_pept        complement(718338..719156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0643"
FT                   /product="4-deoxy-L-threo-5-hexosulose-uronateketol-isomer
FT                   ase"
FT                   /EC_number="5.3.1.17"
FT                   /note="PFAM: 5-keto 4-deoxyuronate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78905"
FT                   /db_xref="GOA:C5BY11"
FT                   /db_xref="InterPro:IPR007045"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR021120"
FT                   /db_xref="InterPro:IPR027449"
FT                   /db_xref="UniProtKB/TrEMBL:C5BY11"
FT                   /protein_id="ACQ78905.1"
FT                   /translation="MDIRHSTHPDDAARLDPEELRARFLVEDLFAPGEVRLTLTHDDRI
FT                   VIGGAVPDGAPLTLEPPAELRTATFCARRELAVVNVGDGAGTVTVDGSAFDLGHHDVLY
FT                   VGVGASSVAFAGDTRFYLVSAPAGARHPTTLARAADAETLHLGEPAASNVRSLRRYVHA
FT                   GGVASERLVLGITTLEPGSVWNTMPPHTHDRRTEVYLYTGLGAEGRVIHLCGRPDELRT
FT                   LVVGDGQAVVSPPWSVHTGAGTAAYSFVWAMAGENQAFDDMDAVAVADLR"
FT   gene            complement(719165..720271)
FT                   /locus_tag="Bcav_0644"
FT   CDS_pept        complement(719165..720271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0644"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="PFAM: Mandelate racemase / muconate lactonizing
FT                   enzyme, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78906"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:C5BY12"
FT                   /protein_id="ACQ78906.1"
FT                   /translation="MLADHRIASIETSRVSTRYPRNVGRNARIGNHGTGFDTTAVIVRT
FT                   DAGASGWGVVEGSLDGADAVVGRPLLDVFDPAAGVTDTAALPLDFALHDLAATILDVPA
FT                   HTLLGGLGESEVTTYSGAIYFDDLDPDDAPRGLEAVLANCAEDWAAGFRAFKLKIGRGN
FT                   RWMETEAGFARDVEVTRAVREAYPDARLLVDANNGFSPERTIRFLTAVADCDLFWVEEP
FT                   FQEEADGLRLLRDHLASTGSRTLVADGEFEPDEPQLLELAAAGLLDVLLMDVVSYGLTA
FT                   WRRIMPTLAELGVAASPHAWGMPLKTLYAAQMAAGLGNVLTVEGVPGRTEGADTSAYAL
FT                   TDGVLAVPDAPGFAIPLTAPVTTDAVAR"
FT   gene            complement(720303..721082)
FT                   /locus_tag="Bcav_0645"
FT   CDS_pept        complement(720303..721082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0645"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: Bacterial transcriptional regulator; IclR
FT                   helix-turn-helix domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78907"
FT                   /db_xref="GOA:C5BY13"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5BY13"
FT                   /protein_id="ACQ78907.1"
FT                   /translation="MSPRTAATNESTSGTLARGLTILEFVAEHGRVGVGEIAAELEISR
FT                   SAAYRLVSQLRDRGFLSEPSDGGGVRLGGTAVRLGLQALGGVDLFELAAGRLRTLVETV
FT                   RETAFLATVDGAEVVYVLQEVGPSAVTMTAKPGSRRPIYGTGLGKAYLAALPPSQREEA
FT                   IAGLDLRPVTASTLTDLPSLRAELDATAARGYAIDDGELEPEVRCIAAAVRDHRGAPVA
FT                   SVSVGGPAERILAKQDAIVTAVVDTVSALSRDLGSSP"
FT   gene            complement(721121..722026)
FT                   /locus_tag="Bcav_0646"
FT   CDS_pept        complement(721121..722026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcav_0646"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Bcav_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ACQ78908"
FT                   /db_xref="GOA:C5BY14"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5BY14"
FT                   /protein_id="ACQ78908.1"
FT                   /translation="MATLTPAPASSGAMTDGDVRHVVHQRPTRPWTRVPFYLVLFVLSV
FT                   AFFAPILWMIS