(data stored in SCRATCH3701 zone)

EMBL: CP001620

ID   CP001620; SV 1; circular; genomic DNA; STD; PRO; 2446804 BP.
XX
AC   CP001620;
XX
PR   Project:PRJNA38011;
XX
DT   25-MAY-2009 (Rel. 100, Created)
DT   09-JAN-2015 (Rel. 123, Last updated, Version 6)
XX
DE   Corynebacterium kroppenstedtii DSM 44385, complete genome.
XX
KW   .
XX
OS   Corynebacterium kroppenstedtii DSM 44385
OC   Bacteria; Actinobacteria; Corynebacteriales; Corynebacteriaceae;
OC   Corynebacterium.
XX
RN   [1]
RP   1-2446804
RX   DOI; 10.1016/j.jbiotec.2008.03.004.
RX   PUBMED; 18430482.
RA   Tauch A., Schneider J., Szczepanowski R., Tilker A., Viehoever P.,
RA   Gartemann K.H., Arnold W., Blom J., Brinkrolf K., Brune I., Gotker S.,
RA   Weisshaar B., Goesmann A., Droge M., Puhler A.;
RT   "Ultrafast pyrosequencing of Corynebacterium kroppenstedtii DSM44385
RT   revealed insights into the physiology of a lipophilic corynebacterium that
RT   lacks mycolic acids";
RL   J. Biotechnol. 136(1-2):22-30(2008).
XX
RN   [2]
RP   1-2446804
RA   Tauch A., Schneider J., Szczepanowski R., Tilker A., Viehoever P.,
RA   Gartemann K.-H., Arnold W., Blom J., Brinkrolf K., Brune I., Goetker S.,
RA   Weisshaar B., Goesmann A., Droege M., Puehler A.;
RT   ;
RL   Submitted (13-MAY-2009) to the INSDC.
RL   Department of Genetics, Bielefeld University, Universitaetsstrasse 25,
RL   Bielefeld, NRW 33615, Germany
XX
DR   MD5; c9092d349df8ecc2826b26aac8f36d5e.
DR   BioSample; SAMN02603033.
DR   CABRI; DSM 44385.
DR   EnsemblGenomes-Gn; EBG00001006363.
DR   EnsemblGenomes-Gn; EBG00001006364.
DR   EnsemblGenomes-Gn; EBG00001006365.
DR   EnsemblGenomes-Gn; EBG00001006366.
DR   EnsemblGenomes-Gn; EBG00001006367.
DR   EnsemblGenomes-Gn; EBG00001006368.
DR   EnsemblGenomes-Gn; EBG00001006369.
DR   EnsemblGenomes-Gn; EBG00001006370.
DR   EnsemblGenomes-Gn; EBG00001006371.
DR   EnsemblGenomes-Gn; EBG00001006372.
DR   EnsemblGenomes-Gn; EBG00001006373.
DR   EnsemblGenomes-Gn; EBG00001006374.
DR   EnsemblGenomes-Gn; EBG00001006375.
DR   EnsemblGenomes-Gn; EBG00001006376.
DR   EnsemblGenomes-Gn; EBG00001006377.
DR   EnsemblGenomes-Gn; EBG00001006378.
DR   EnsemblGenomes-Gn; EBG00001006379.
DR   EnsemblGenomes-Gn; EBG00001006380.
DR   EnsemblGenomes-Gn; EBG00001006381.
DR   EnsemblGenomes-Gn; EBG00001006382.
DR   EnsemblGenomes-Gn; EBG00001006383.
DR   EnsemblGenomes-Gn; EBG00001006384.
DR   EnsemblGenomes-Gn; EBG00001006385.
DR   EnsemblGenomes-Gn; EBG00001006386.
DR   EnsemblGenomes-Gn; EBG00001006387.
DR   EnsemblGenomes-Gn; EBG00001006388.
DR   EnsemblGenomes-Gn; EBG00001006389.
DR   EnsemblGenomes-Gn; EBG00001006390.
DR   EnsemblGenomes-Gn; EBG00001006391.
DR   EnsemblGenomes-Gn; EBG00001006392.
DR   EnsemblGenomes-Gn; EBG00001006393.
DR   EnsemblGenomes-Gn; EBG00001006394.
DR   EnsemblGenomes-Gn; EBG00001006395.
DR   EnsemblGenomes-Gn; EBG00001006396.
DR   EnsemblGenomes-Gn; EBG00001006397.
DR   EnsemblGenomes-Gn; EBG00001006398.
DR   EnsemblGenomes-Gn; EBG00001006399.
DR   EnsemblGenomes-Gn; EBG00001006400.
DR   EnsemblGenomes-Gn; EBG00001006401.
DR   EnsemblGenomes-Gn; EBG00001006402.
DR   EnsemblGenomes-Gn; EBG00001006403.
DR   EnsemblGenomes-Gn; EBG00001006404.
DR   EnsemblGenomes-Gn; EBG00001006405.
DR   EnsemblGenomes-Gn; EBG00001006406.
DR   EnsemblGenomes-Gn; EBG00001006407.
DR   EnsemblGenomes-Gn; EBG00001006408.
DR   EnsemblGenomes-Gn; EBG00001006409.
DR   EnsemblGenomes-Gn; EBG00001006410.
DR   EnsemblGenomes-Gn; EBG00001006411.
DR   EnsemblGenomes-Gn; EBG00001006412.
DR   EnsemblGenomes-Gn; EBG00001006413.
DR   EnsemblGenomes-Gn; EBG00001006414.
DR   EnsemblGenomes-Gn; EBG00001006415.
DR   EnsemblGenomes-Gn; EBG00001006416.
DR   EnsemblGenomes-Gn; EBG00001006417.
DR   EnsemblGenomes-Gn; EBG00001006418.
DR   EnsemblGenomes-Gn; EBG00001006419.
DR   EnsemblGenomes-Gn; EBG00001006420.
DR   EnsemblGenomes-Gn; EBG00001006421.
DR   EnsemblGenomes-Gn; EBG00001006422.
DR   EnsemblGenomes-Gn; EBG00001006423.
DR   EnsemblGenomes-Gn; EBG00001006424.
DR   EnsemblGenomes-Gn; ckrop_r01.
DR   EnsemblGenomes-Gn; ckrop_r02.
DR   EnsemblGenomes-Gn; ckrop_r03.
DR   EnsemblGenomes-Gn; ckrop_r04.
DR   EnsemblGenomes-Gn; ckrop_r05.
DR   EnsemblGenomes-Gn; ckrop_r06.
DR   EnsemblGenomes-Gn; ckrop_r07.
DR   EnsemblGenomes-Gn; ckrop_r08.
DR   EnsemblGenomes-Gn; ckrop_r09.
DR   EnsemblGenomes-Gn; ckrop_t0001.
DR   EnsemblGenomes-Gn; ckrop_t0002.
DR   EnsemblGenomes-Gn; ckrop_t0003.
DR   EnsemblGenomes-Gn; ckrop_t0004.
DR   EnsemblGenomes-Gn; ckrop_t0005.
DR   EnsemblGenomes-Gn; ckrop_t0006.
DR   EnsemblGenomes-Gn; ckrop_t0007.
DR   EnsemblGenomes-Gn; ckrop_t0008.
DR   EnsemblGenomes-Gn; ckrop_t0009.
DR   EnsemblGenomes-Gn; ckrop_t0010.
DR   EnsemblGenomes-Gn; ckrop_t0011.
DR   EnsemblGenomes-Gn; ckrop_t0012.
DR   EnsemblGenomes-Gn; ckrop_t0013.
DR   EnsemblGenomes-Gn; ckrop_t0014.
DR   EnsemblGenomes-Gn; ckrop_t0015.
DR   EnsemblGenomes-Gn; ckrop_t0016.
DR   EnsemblGenomes-Gn; ckrop_t0017.
DR   EnsemblGenomes-Gn; ckrop_t0018.
DR   EnsemblGenomes-Gn; ckrop_t0019.
DR   EnsemblGenomes-Gn; ckrop_t0020.
DR   EnsemblGenomes-Gn; ckrop_t0021.
DR   EnsemblGenomes-Gn; ckrop_t0022.
DR   EnsemblGenomes-Gn; ckrop_t0023.
DR   EnsemblGenomes-Gn; ckrop_t0024.
DR   EnsemblGenomes-Gn; ckrop_t0025.
DR   EnsemblGenomes-Gn; ckrop_t0026.
DR   EnsemblGenomes-Gn; ckrop_t0027.
DR   EnsemblGenomes-Gn; ckrop_t0028.
DR   EnsemblGenomes-Gn; ckrop_t0029.
DR   EnsemblGenomes-Gn; ckrop_t0030.
DR   EnsemblGenomes-Gn; ckrop_t0031.
DR   EnsemblGenomes-Gn; ckrop_t0032.
DR   EnsemblGenomes-Gn; ckrop_t0033.
DR   EnsemblGenomes-Gn; ckrop_t0034.
DR   EnsemblGenomes-Gn; ckrop_t0035.
DR   EnsemblGenomes-Gn; ckrop_t0036.
DR   EnsemblGenomes-Gn; ckrop_t0037.
DR   EnsemblGenomes-Gn; ckrop_t0038.
DR   EnsemblGenomes-Gn; ckrop_t0039.
DR   EnsemblGenomes-Gn; ckrop_t0040.
DR   EnsemblGenomes-Gn; ckrop_t0041.
DR   EnsemblGenomes-Gn; ckrop_t0042.
DR   EnsemblGenomes-Gn; ckrop_t0043.
DR   EnsemblGenomes-Gn; ckrop_t0044.
DR   EnsemblGenomes-Gn; ckrop_t0045.
DR   EnsemblGenomes-Gn; ckrop_t0046.
DR   EnsemblGenomes-Tr; EBT00001532438.
DR   EnsemblGenomes-Tr; EBT00001532440.
DR   EnsemblGenomes-Tr; EBT00001532444.
DR   EnsemblGenomes-Tr; EBT00001532445.
DR   EnsemblGenomes-Tr; EBT00001532446.
DR   EnsemblGenomes-Tr; EBT00001532447.
DR   EnsemblGenomes-Tr; EBT00001532448.
DR   EnsemblGenomes-Tr; EBT00001532449.
DR   EnsemblGenomes-Tr; EBT00001532450.
DR   EnsemblGenomes-Tr; EBT00001532451.
DR   EnsemblGenomes-Tr; EBT00001532452.
DR   EnsemblGenomes-Tr; EBT00001532453.
DR   EnsemblGenomes-Tr; EBT00001532454.
DR   EnsemblGenomes-Tr; EBT00001532455.
DR   EnsemblGenomes-Tr; EBT00001532456.
DR   EnsemblGenomes-Tr; EBT00001532457.
DR   EnsemblGenomes-Tr; EBT00001532458.
DR   EnsemblGenomes-Tr; EBT00001532459.
DR   EnsemblGenomes-Tr; EBT00001532460.
DR   EnsemblGenomes-Tr; EBT00001532461.
DR   EnsemblGenomes-Tr; EBT00001532462.
DR   EnsemblGenomes-Tr; EBT00001532463.
DR   EnsemblGenomes-Tr; EBT00001532464.
DR   EnsemblGenomes-Tr; EBT00001532465.
DR   EnsemblGenomes-Tr; EBT00001532466.
DR   EnsemblGenomes-Tr; EBT00001532467.
DR   EnsemblGenomes-Tr; EBT00001532468.
DR   EnsemblGenomes-Tr; EBT00001532469.
DR   EnsemblGenomes-Tr; EBT00001532470.
DR   EnsemblGenomes-Tr; EBT00001532471.
DR   EnsemblGenomes-Tr; EBT00001532472.
DR   EnsemblGenomes-Tr; EBT00001532473.
DR   EnsemblGenomes-Tr; EBT00001532474.
DR   EnsemblGenomes-Tr; EBT00001532475.
DR   EnsemblGenomes-Tr; EBT00001532476.
DR   EnsemblGenomes-Tr; EBT00001532477.
DR   EnsemblGenomes-Tr; EBT00001532478.
DR   EnsemblGenomes-Tr; EBT00001532479.
DR   EnsemblGenomes-Tr; EBT00001532480.
DR   EnsemblGenomes-Tr; EBT00001532481.
DR   EnsemblGenomes-Tr; EBT00001532482.
DR   EnsemblGenomes-Tr; EBT00001532483.
DR   EnsemblGenomes-Tr; EBT00001532484.
DR   EnsemblGenomes-Tr; EBT00001532485.
DR   EnsemblGenomes-Tr; EBT00001532486.
DR   EnsemblGenomes-Tr; EBT00001532487.
DR   EnsemblGenomes-Tr; EBT00001532488.
DR   EnsemblGenomes-Tr; EBT00001532489.
DR   EnsemblGenomes-Tr; EBT00001532490.
DR   EnsemblGenomes-Tr; EBT00001532491.
DR   EnsemblGenomes-Tr; EBT00001532492.
DR   EnsemblGenomes-Tr; EBT00001532493.
DR   EnsemblGenomes-Tr; EBT00001532494.
DR   EnsemblGenomes-Tr; EBT00001532495.
DR   EnsemblGenomes-Tr; EBT00001532496.
DR   EnsemblGenomes-Tr; EBT00001532497.
DR   EnsemblGenomes-Tr; EBT00001532498.
DR   EnsemblGenomes-Tr; EBT00001532499.
DR   EnsemblGenomes-Tr; EBT00001532500.
DR   EnsemblGenomes-Tr; EBT00001532501.
DR   EnsemblGenomes-Tr; EBT00001532502.
DR   EnsemblGenomes-Tr; EBT00001532503.
DR   EnsemblGenomes-Tr; ckrop_r01-1.
DR   EnsemblGenomes-Tr; ckrop_r02-1.
DR   EnsemblGenomes-Tr; ckrop_r03-1.
DR   EnsemblGenomes-Tr; ckrop_r04-1.
DR   EnsemblGenomes-Tr; ckrop_r05-1.
DR   EnsemblGenomes-Tr; ckrop_r06-1.
DR   EnsemblGenomes-Tr; ckrop_r07-1.
DR   EnsemblGenomes-Tr; ckrop_r08-1.
DR   EnsemblGenomes-Tr; ckrop_r09-1.
DR   EnsemblGenomes-Tr; ckrop_t0001-1.
DR   EnsemblGenomes-Tr; ckrop_t0002-1.
DR   EnsemblGenomes-Tr; ckrop_t0003-1.
DR   EnsemblGenomes-Tr; ckrop_t0004-1.
DR   EnsemblGenomes-Tr; ckrop_t0005-1.
DR   EnsemblGenomes-Tr; ckrop_t0006-1.
DR   EnsemblGenomes-Tr; ckrop_t0007-1.
DR   EnsemblGenomes-Tr; ckrop_t0008-1.
DR   EnsemblGenomes-Tr; ckrop_t0009-1.
DR   EnsemblGenomes-Tr; ckrop_t0010-1.
DR   EnsemblGenomes-Tr; ckrop_t0011-1.
DR   EnsemblGenomes-Tr; ckrop_t0012-1.
DR   EnsemblGenomes-Tr; ckrop_t0013-1.
DR   EnsemblGenomes-Tr; ckrop_t0014-1.
DR   EnsemblGenomes-Tr; ckrop_t0015-1.
DR   EnsemblGenomes-Tr; ckrop_t0016-1.
DR   EnsemblGenomes-Tr; ckrop_t0017-1.
DR   EnsemblGenomes-Tr; ckrop_t0018-1.
DR   EnsemblGenomes-Tr; ckrop_t0019-1.
DR   EnsemblGenomes-Tr; ckrop_t0020-1.
DR   EnsemblGenomes-Tr; ckrop_t0021-1.
DR   EnsemblGenomes-Tr; ckrop_t0022-1.
DR   EnsemblGenomes-Tr; ckrop_t0023-1.
DR   EnsemblGenomes-Tr; ckrop_t0024-1.
DR   EnsemblGenomes-Tr; ckrop_t0025-1.
DR   EnsemblGenomes-Tr; ckrop_t0026-1.
DR   EnsemblGenomes-Tr; ckrop_t0027-1.
DR   EnsemblGenomes-Tr; ckrop_t0028-1.
DR   EnsemblGenomes-Tr; ckrop_t0029-1.
DR   EnsemblGenomes-Tr; ckrop_t0030-1.
DR   EnsemblGenomes-Tr; ckrop_t0031-1.
DR   EnsemblGenomes-Tr; ckrop_t0032-1.
DR   EnsemblGenomes-Tr; ckrop_t0033-1.
DR   EnsemblGenomes-Tr; ckrop_t0034-1.
DR   EnsemblGenomes-Tr; ckrop_t0035-1.
DR   EnsemblGenomes-Tr; ckrop_t0036-1.
DR   EnsemblGenomes-Tr; ckrop_t0037-1.
DR   EnsemblGenomes-Tr; ckrop_t0038-1.
DR   EnsemblGenomes-Tr; ckrop_t0039-1.
DR   EnsemblGenomes-Tr; ckrop_t0040-1.
DR   EnsemblGenomes-Tr; ckrop_t0041-1.
DR   EnsemblGenomes-Tr; ckrop_t0042-1.
DR   EnsemblGenomes-Tr; ckrop_t0043-1.
DR   EnsemblGenomes-Tr; ckrop_t0044-1.
DR   EnsemblGenomes-Tr; ckrop_t0045-1.
DR   EnsemblGenomes-Tr; ckrop_t0046-1.
DR   EuropePMC; PMC4219376; 24299240.
DR   EuropePMC; PMC5078570; 27818775.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001620.
DR   SILVA-SSU; CP001620.
DR   StrainInfo; 169571; 1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2446804
FT                   /organism="Corynebacterium kroppenstedtii DSM 44385"
FT                   /strain="DSM 44385"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:645127"
FT                   /culture_collection="DSM:44385"
FT   gene            1..1818
FT                   /gene="dnaA"
FT                   /locus_tag="ckrop_0000"
FT   CDS_pept        1..1818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="ckrop_0000"
FT                   /product="chromosomal replication initiator protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0000"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16800"
FT                   /db_xref="GOA:C4LGB0"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGB0"
FT                   /protein_id="ACR16800.1"
FT                   /translation="MDLGGSPHQFGQASEDFFNTWNNVVAQLMAMNPREDIPGQAPGTR
FT                   ITPQDKAWLKQAAPVGLIGGVAVISTPNRTAKSVFERKLGDIISAELTAAIGEPIKLAI
FT                   SINSAATETDDSSAEPPRTEPPRAETPPTQPRTTQSRPTETRSAESYHDFSQLNTGPKT
FT                   GTPSENVAQQNTQPSHEMPRPTSYEDDPYVLQYPDSSPQGERPSTYPDATPTEPAYSNS
FT                   GDAHVGNSYDTPAETAPQPWNEGYINNARPQRRQEQKPDSERSWLNENYTFDNLVAGEG
FT                   NRVVRAAAIAVAENPAQAYNPLFIWGGSGLGKTHILHAIGHRALELRPNLRVRYVSIEE
FT                   YTNEWINSIRNNRGEDFKRKYRSFDILLVDDIQFLAGKPETQIEFFHNFNALHGAQKQI
FT                   VLCSDRSPKELTELEPRLRTRFQWGFTQDIQKPDLETRIAILRLKAERENAQVPSEVLS
FT                   FIAEQKAESVRELEGALNKVLIVSSIQHTPVTLEMARDQLQDLVAPEVVEITAPTIMSV
FT                   TAEYFNLTTADLTGPGKARPIAHARQVAMYLCRELTDLSLPKVGNKFGGRDHTTAMYAE
FT                   RKIRKEMSEKRSTNEAIQEITARIKDQAR"
FT   gene            2477..3661
FT                   /locus_tag="ckrop_0001"
FT   CDS_pept        2477..3661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0001"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /function="DNA polymerase sliding clamp subunit (PCNA
FT                   homolog)"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16801"
FT                   /db_xref="GOA:C4LGB1"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGB1"
FT                   /protein_id="ACR16801.1"
FT                   /translation="MEANGVSFRVAKDDLSAALSWVARSLASKPTQPILRGVMMTADDE
FT                   GLLLAGFDYEVSTRVRISAEVLEPGQVLVAGKLANDIIGSLPHKDVAISVDGTKVHVTC
FT                   GQSNFELPAMTIEDYPELPSLPEETGHIDPHVFTAAIGQVASAAGKDDSMPMLTGIKME
FT                   VKGDNVVLAATDRFRLAVREFTWEPSSPDVDAEILIPARTLADSARTLDTRLNDPIQLA
FT                   MGAAQDVGKDGLLGIVSENRQTTTRLIDADFPKFRPLLPKSHSSMAIVEIAPLLDAIRR
FT                   VSLVAERNAQVKLEFSEDQLVLSAGGSEAGTAEETLPAQFAGEPLLIAFNANYLKEGLA
FT                   SIDTKNVVFGFTQPSRPAILIPEPETMPEQDSDGQFPTPSTYFTYLLMPVRLPG"
FT   gene            3712..5001
FT                   /locus_tag="ckrop_0002"
FT   CDS_pept        3712..5001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0002"
FT                   /product="DNA replication and repair protein RecF"
FT                   /function="Recombinational DNA repair ATPase (RecF
FT                   pathway)"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16802"
FT                   /db_xref="GOA:C4LGB2"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGB2"
FT                   /protein_id="ACR16802.1"
FT                   /translation="MYIRALQLRNFRSWPELDLHLGPGITVFSGPNGHGKTNVVEALDY
FT                   VAHLGSHRVSTDAPLVREGREYTTVSATAINSGRELTAHMLIKARGSNKAQINRAPCKS
FT                   PRQLLGIVKTVLFSPEDLALVRGEPEHRRRFLDDLLIGRFPRWAGTRSDYDKILRQRNT
FT                   LLKRASRTLRQGYGGGNDSDSALDTLDTWDSHLAAAGAQVMAQRIVLAHVLSPYVKNAY
FT                   QRLAPESRPAQITYRSTVDKALVEAGITPETVANDVAGATPVIEAVLLSELARRRDTDI
FT                   QRGTSTCGPHRDDVELLLGTQPARGYASHGESWSFALALRLASFEWQREQGTDPILILD
FT                   DVFAELDAARRRALATVAKDAEQTLVTAAVGDDLPQDLVNSDIRVLTVEASTVDDSDIR
FT                   SSRITHDSADGGATEGTATDTDDEGGDAHE"
FT   gene            4994..5719
FT                   /locus_tag="ckrop_0003"
FT   CDS_pept        4994..5719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0003"
FT                   /product="hypothetical protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16803"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGB3"
FT                   /protein_id="ACR16803.1"
FT                   /translation="MNDPVAEALARVYSHGRVPMPPNMRKVLQSITPTGHNADQDSATR
FT                   KNGVSRTNSAAHKDGVNNKTTDKSGEGSVGKKVDKDKNSRNSQGLPRAKTTSATSVFRE
FT                   FSRTSRVYPTGPDGHRRKNTRRYESLGSIVNREVVRRGWTEKISHGWITANWSTVAGDY
FT                   LGAHSRIRMIKDTTLFLECDSTAKASELRYLQTELLSRIAHHVGPDVITAVKIFGPRPP
FT                   SWRHGPLHVKGRGPRDTYG"
FT   gene            5896..7944
FT                   /locus_tag="ckrop_0004"
FT   CDS_pept        5896..7944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0004"
FT                   /product="DNA gyrase subunit B"
FT                   /function="DNA gyrase (topoisomerase II) B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16804"
FT                   /db_xref="GOA:C4LGB4"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGB4"
FT                   /protein_id="ACR16804.1"
FT                   /translation="MAENAAENNTRHDYDASSITILEGLEAVRKRPGMYIGSTGERGLH
FT                   HLVWEVVDNSVDEAMAGYATHVDVTIMKDGGIEVVDDGRGIPVSMHPSGAPTVQVVMTQ
FT                   LHAGGKFDNDSYAVSGGLHGVGISVVNALSTRVEAEIKRDGYRWYQNFTDAIPDELVQG
FT                   KKARGTGTTIRFWPDPDVFETTEFKFETIARRLQEMAFLNKGLYITLTDKRSQATETPE
FT                   DADDTVEEAAAAKSAEEAAADAEQKAKKSKERTETFHYPDGLKDYVASINKTKTAIHPT
FT                   IITFDAKGDEHEVEVALQWNSGYAQSVHTFANTINTIEGGTHEEGFRAALTSLMNRYAR
FT                   EHKLLKDKEPNLSGDDCREGLAAVISVRVADPQFEGQTKTKLGNTEVKSFVQKQVFENV
FT                   SHWFESNPAEAKIIVNKAVSSSQARVAARKARDLVRRKSATDLGGLPGKLADCRSKDPT
FT                   LSELYIVEGDSAGGSAKSGRDSMYQAILPLRGKILNVEKARLDRVLKNNEVQAIITALG
FT                   TGIHDEFDIKKLRYHKIILMADADVDGSHIATLLLTLLFRFMRPLVEEGHVYLAQPPLY
FT                   KLKWGKGAPGFAYSDVERDELLAEGLEQGRKINKDDGIQRYKGLGEMNPKELWETTMDP
FT                   SIRILRQVQLEDAAKADEIFSVLMGDDVIARRSFITRNAKDVRFLDI"
FT   gene            8340..9764
FT                   /locus_tag="ckrop_0005"
FT   CDS_pept        8340..9764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0005"
FT                   /product="putative amino acid permease"
FT                   /function="Gamma-aminobutyrate permease and related
FT                   permeases"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16805"
FT                   /db_xref="GOA:C4LGB5"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGB5"
FT                   /protein_id="ACR16805.1"
FT                   /translation="MGSNAKTETSSSGDKGLKRGLSARHVHFIALGSAIGTGLFYGSAD
FT                   AIQSAGPAVLLVYLLGGAVVYFMLRALGEMAVRMPVSGSFAEYCRIFLGPWSGYITGWM
FT                   YAFEMVIVCLADLTAIGTYMRFWFPDSPQWVWVAVTLLIVGAVNITSSRLFGELEFGLT
FT                   IIKVSAVVAMIAGGTIILIFGLGNHADSGVHNLWSHGGFFPHGPWGMAMALVVVMFAFG
FT                   GSEIIGVTAGDAEDPAKTIPKAIHSVPIRILLFYVLAIAVIVTINPWSSINGESSPFVQ
FT                   IFNDLGVNWAAALLNVVVITAALSAINSDLFGAGRVVHGMAAEGLAPRSFARTSAKGVP
FT                   IFTTTVMLGVLVIGVVINFLIPERVFLVIAALATFATVFVWLMILLAHLASRTGDQAPS
FT                   NKDLTYPVPLWPWGQYFALAMVVITIIMMMFSDDTRLALVVGVAWTALMSVVWVVRGRQ
FT                   TYEDYLATRDAEKSHV"
FT   gene            complement(10119..10565)
FT                   /locus_tag="ckrop_0007"
FT   CDS_pept        complement(10119..10565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0007"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16806"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGB6"
FT                   /protein_id="ACR16806.1"
FT                   /translation="MSELSDILTKDGTREPVVADLAESTENSINNLSGLSGKAIKTAFS
FT                   GTVKARPNLVKDMTDRLLPHLTDRLNPYWQAYQNGKPEGGFGKYLETRSDEVTKDLADL
FT                   SDERMGSINNSGAQKIYKTFRGKLEGIVEKGLPDLGDIIEKHAS"
FT   gene            10692..12068
FT                   /locus_tag="ckrop_0008"
FT   CDS_pept        10692..12068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0008"
FT                   /product="putative aminopeptidase"
FT                   /function="Aspartyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16807"
FT                   /db_xref="GOA:C4LGB7"
FT                   /db_xref="InterPro:IPR001948"
FT                   /db_xref="InterPro:IPR023358"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGB7"
FT                   /protein_id="ACR16807.1"
FT                   /translation="MSSSHSDQYINAYMNFMDQSPTSYHAVAVMAAGLHQAGFHAQKET
FT                   DPWDVRPGGHYVVRDGAMIAYVIPPQAASASTTDRESVGKNNAENKNDDGARHPAYRII
FT                   GVHTDSPALALKPTPQSTTSDGWGQLAVEVYGGALLSSWLDRELCVAGRVVDKTGATHL
FT                   VGTKPIARVPQLAIHLDRKVNEGLELNPQKHIHPVWTVDDDSADIMDIIAESAGLSNKR
FT                   EIIGWDLKLVPTQKAATFGAHSQFIASGRQDNLSSVFAAFHVLHQLDTDAIPGDDILVF
FT                   VANDHEEVGSGTRSGAAGPFLEDVLHRTAVALGYDADGEARMMARSVCISSDAGHSVHP
FT                   NYAERHDPDTRPMMGRGPMVKINANQRYVSDAVGEAIWQRACETAGIQHQAFVSNNAMP
FT                   CGSTIGPITATRLGMVTVDVGIPLLSMHSAREMSHEYDCFALSKAMDALWTMESLEYGQ
FT                   "
FT   gene            complement(12048..12899)
FT                   /gene="rocF"
FT                   /locus_tag="ckrop_0009"
FT   CDS_pept        complement(12048..12899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rocF"
FT                   /locus_tag="ckrop_0009"
FT                   /product="arginase"
FT                   /function="Arginase/agmatinase/formimionoglutamate
FT                   hydrolase, arginase family"
FT                   /EC_number="3.5.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16808"
FT                   /db_xref="GOA:C4LGB8"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGB8"
FT                   /protein_id="ACR16808.1"
FT                   /translation="MNTLRLLYPDFVSGGLDTYYFGAELLKHLLPQNDNQPWKTVPIDP
FT                   PDDNQQLPTKNGIYGLDTLTQGIHSAQSILDDNHPDRVITIGGSCLVSVAPFDYLHGVY
FT                   DDVGIIWIDAHPDVSSPADDYPYAHAMALSILLGDDSVPLSAELRNKPFPGDHILYVGL
FT                   QDIFDYQRTVLENYQVPYTVQSDQFLSTQAVSDFARRFDHLAVHFDIDVLNPRNFHSTY
FT                   FANPNLTGDGSGGGSMTMDQLQTILSAIDSAGPIDGLTIAEYLPFDEERLHATLRSLSI
FT                   FQ"
FT   gene            13008..13808
FT                   /locus_tag="ckrop_0010"
FT   CDS_pept        13008..13808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0010"
FT                   /product="secreted lipase"
FT                   /function="Predicted acetyltransferases and hydrolases with
FT                   the alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16809"
FT                   /db_xref="GOA:C4LGB9"
FT                   /db_xref="InterPro:IPR012908"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGB9"
FT                   /protein_id="ACR16809.1"
FT                   /translation="MLPKTMKAAAVAVGISCAGVCGAITPAAQAGDAGDALPTTTDVHS
FT                   ENSHPVVFILPGQSVGTLPYGKIKSNLQAGGYDARVLALKGTDVVADAHLIADEVHRVH
FT                   ENNPDAEISLVGHSAGGISAREYLKHQGGTEDIARYIAIGSPQYGSPGACVQSGTAKDL
FT                   CLGSEYLNRLNAGDDTPGPTEYYAIRGEHEWADGRLDGGQCRMKPVASPSPLINGGFHH
FT                   SIEPLQSEVSATVLAALNNTCTGEYVDEPIDSIQAKDTIFQDGL"
FT   gene            complement(13901..14611)
FT                   /locus_tag="ckrop_0011"
FT   CDS_pept        complement(13901..14611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0011"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16810"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGC0"
FT                   /protein_id="ACR16810.1"
FT                   /translation="MRRLLRASIAALSITLAAVGMPMAANEAHAVEHPTYSHHPWPDAS
FT                   KDFKTKGVFTTPNNRTITVHQGATIRSGSGGTCSITLIGDRTGYTAEHCSHGRWTRGTE
FT                   IFDQSNHRIGRVAAMSRGLDAVKINLDPSVRVDGRWEKRDYNTLNVGEPVHVLGLGQRF
FT                   NESRVTDRPLMGWNGRPNTVALVSPLNSKPGTSGGAMVDRYNRVIGINVGYLENYTGKY
FT                   GAYIPWNVVDSELR"
FT   gene            15228..16472
FT                   /locus_tag="ckrop_0012"
FT   CDS_pept        15228..16472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0012"
FT                   /product="permease of the major facilitator superfamily"
FT                   /function="Sugar phosphate permease"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16811"
FT                   /db_xref="GOA:C4LGA4"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGA4"
FT                   /protein_id="ACR16811.1"
FT                   /translation="MVTTPDGGADSASVSNAPHTHVSLVTKSAVVLLGMTALLNLYLTQ
FT                   PILGEIAAWAHIPTTDAAWTISTTTAGVAITAPFAGMLSDRIGRRRVILAAVAAMAVMT
FT                   VAALTSWSYPALLAFRCAQGMCCPFVFAVVVAYIGEEYEPGSASTLNALYVAGTALGGF
FT                   SGRMVAAVLSDWAGGWRLSFLGNAVILVLTLAVTYWGLPPERHFIRTADRGVGGFFANA
FT                   GRLLRKPRIVMSVLVGFALLFQQVASFTFASLALAHPPFSLSTSTIGLIFVVFLIPTVT
FT                   TPRFGTLMDKWGPRRAFLASQSVSVGGLVLTLFPTIPTVIIGLALSCVGVFAGQAAGTL
FT                   MVGRLAAGARSTGVGLYLTGYYIGGAIGGVAPISCYSAAGWSAVVAVVLGVVLCATAMG
FT                   WWAWRPFESNNAPAA"
FT   gene            16746..18002
FT                   /gene="lldD"
FT                   /locus_tag="ckrop_0013"
FT   CDS_pept        16746..18002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lldD"
FT                   /locus_tag="ckrop_0013"
FT                   /product="L-lactate dehydrogenase"
FT                   /function="L-lactate dehydrogenase (FMN-dependent) and
FT                   related alpha-hydroxy acid dehydrogenases"
FT                   /EC_number="1.1.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16812"
FT                   /db_xref="GOA:C4LGA5"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR008259"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR037396"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGA5"
FT                   /protein_id="ACR16812.1"
FT                   /translation="MVQRQFPNPKEIREYLHFKKPELNLKKRRLENALTIYDLRKIAKR
FT                   RTPASAFDYTDGAAEGEISIARARKAFEDVEFHPSILKDASEIDMSTSILGGPSSLPFG
FT                   IAPTGFTRLMQTEGEVAGAGAAGAAGIPFCLSTLGTTSIEDVKATNPTGRNWFQLYVMR
FT                   KREISYGLVERAAQAGFDTLFFTVDTPVAGNRMRDVRHGFSIPPQLTVKTVVDAIPRPW
FT                   WWIDFLTTPPLEFASLSSTGGTVGELLNNAMDPTISFDDLKTIREMWPGKLAVKGVQNL
FT                   EDSKKLADLGVDSIVLSNHGGRQLDRAPVPFLLLPEVAREVGKDVEIMVDTGIMNGADI
FT                   VAALALGADFTLIGRAYLYGLMAGGRAGVDRTIEILRSQIERTMKLLQVTSIEELGPQH
FT                   VTQLTRFNRVDSSRDDATV"
FT   gene            18388..20094
FT                   /gene="lldT"
FT                   /locus_tag="ckrop_0014"
FT   CDS_pept        18388..20094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lldT"
FT                   /locus_tag="ckrop_0014"
FT                   /product="L-lactate permease"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16813"
FT                   /db_xref="GOA:C4LGA6"
FT                   /db_xref="InterPro:IPR003804"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGA6"
FT                   /protein_id="ACR16813.1"
FT                   /translation="MRITGVMSSTYQPDLAPLADNLFVSALVAFLPLATIFVTLGVLRW
FT                   KAHWAGLTALAVSFVIAIAAYGMPAHLAGLAATQGAVFGIFPIMWIVIAAIWFYEITVR
FT                   SGRFQDLRALIDRLSDDPRVQAILIAFCFGGMLEALAGFGAPLAITGVMLLTIGFSRMR
FT                   AAVSVMVANTAPVAFGAVATPIITAGALSGIDYQHIGAIVGRQTPILSVFIPLFLCILV
FT                   DGKRGLKECWPIAFVIGLVFSLTKFVFSNYISVELTDIAAALMGVAATVIMLRVWKPRG
FT                   TEEARERLFVERHKEDQEAGTQDIAGAETVAQETEERELTAGRTFMALFPYLLVLVVFS
FT                   LAELCDPVKHFLKSTDVTIHWPGSDGHILTAGGKVSGATVFEFTWLSSPGTLLIISGFI
FT                   VAAVYRVSLKVLGQAYWENLVKMKFSILTVASVVALAYVMNQSGQTITMGTWIAGVGAA
FT                   FAFFAPILGWLGTAVTGSDTSANALFSTLQQTAAVKANVDPALMVASNTSGGVVGKLVS
FT                   PQNLTIVATAVGLVGRESEILRKVVLWSVGLLIALCIINGLQATVLSWMIP"
FT   gene            complement(20122..20550)
FT                   /locus_tag="ckrop_0015"
FT   CDS_pept        complement(20122..20550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0015"
FT                   /product="conserved hypothetical protein"
FT                   /function="Predicted flavin-nucleotide-binding protein
FT                   structurally related to pyridoxine 5-phosphate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16814"
FT                   /db_xref="GOA:C4LGA7"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGA7"
FT                   /protein_id="ACR16814.1"
FT                   /translation="MATLTDPMKEMISQQLPFLATVTDAKTLRPNLGPKRSLRVWDDHT
FT                   LVYNENTGRQHYENLREGSLAAVAVVDWAELDGYRFIGPAEIHRTGPVWDACLAYAEAH
FT                   GYAPPKAGVLIHVQQIYTLMIGAHAGELIDSDDPDYRV"
FT   gene            20792..21235
FT                   /locus_tag="ckrop_3000"
FT   CDS_pept        20792..21235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_3000"
FT                   /product="NrdI protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_3000"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16815"
FT                   /db_xref="GOA:C4LGA8"
FT                   /db_xref="InterPro:IPR004465"
FT                   /db_xref="InterPro:IPR020852"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGA8"
FT                   /protein_id="ACR16815.1"
FT                   /translation="MPSSSSAPGTHLVYFSSASGNTARFVDKLHLPAARIPMKLKAPEL
FT                   HVSEPYVLITPTYGGGDIARAVPRQVIRFLNDEQNRRLLRGVITSGNTNFGAAFCCAGP
FT                   VIASKCHVPELYRFELLGTSRDVEKVRNGLTDFWKRVEEKETL"
FT   gene            21249..22301
FT                   /locus_tag="ckrop_0016"
FT   CDS_pept        21249..22301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0016"
FT                   /product="ribonucleoside-diphosphate reductase beta chain"
FT                   /function="Ribonucleotide reductase beta subunit"
FT                   /EC_number="1.17.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16816"
FT                   /db_xref="GOA:C4LGA9"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR026494"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGA9"
FT                   /protein_id="ACR16816.1"
FT                   /translation="MSYIDDSITPAEWAKCSEKPLRPVNWNRLQDPKDLEVWQRLTGNF
FT                   WLPEKVPLSNDISSWNSLPDDLRQLTVKIFTGLTLLDTVQATVGEVSQIPDGRTEHEQA
FT                   VYTNIAFMQSVHARSYSSVFSTLCSTPEITDAYGWATQNTVLQRRATTVMKHYYARDPL
FT                   KRKVAATLLSSLLLYAGFYLPLWLSCRAKLMNTADMIRLILRDKAVHGYYSGYKFQRGL
FT                   DAHPERKNELQEFTYSLVDELLNLEKIYSGELYGGITAPNNSHKSAESSFTSRPNFAGV
FT                   MAFVYYNANKALMNLGYPALYEDEAERTEPDILAALTPEASETHDFFSGSGASYVIGKT
FT                   EATEESDWDF"
FT   gene            complement(23252..23431)
FT                   /locus_tag="ckrop_0017"
FT   CDS_pept        complement(23252..23431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0017"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16817"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGC1"
FT                   /protein_id="ACR16817.1"
FT                   /translation="MNDWTENLRRAIANSERHGETPERGAYIDAGLPVPEKATDEYQQA
FT                   PLWRRIINFFEPVW"
FT   gene            complement(23424..23744)
FT                   /locus_tag="ckrop_0018"
FT   CDS_pept        complement(23424..23744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0018"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16818"
FT                   /db_xref="GOA:C4LGC2"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGC2"
FT                   /protein_id="ACR16818.1"
FT                   /translation="MDTEAWLRLVQLIIAAGGLIAVILTLQQKTNSDNRSEWWRRFTWA
FT                   VENASDDTTTDEVRRAARIELDELDHNSLARNTERELITRFYRQRTNGTDTMKEKDGGN
FT                   NE"
FT   gene            complement(23850..24008)
FT                   /locus_tag="ckrop_0019"
FT   CDS_pept        complement(23850..24008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0019"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16819"
FT                   /db_xref="GOA:C4LGC3"
FT                   /db_xref="InterPro:IPR031596"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGC3"
FT                   /protein_id="ACR16819.1"
FT                   /translation="MDAVTIIVMILYLALVWGLLIIAAIHLTKHPDENSGKLGTTDLDD
FT                   LPQYTKV"
FT   gene            complement(24011..25699)
FT                   /locus_tag="ckrop_0020"
FT   CDS_pept        complement(24011..25699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0020"
FT                   /product="putative transporter of the
FT                   neurotransmitter:sodium syporter family"
FT                   /function="Na+-dependent transporters of the SNF family"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16820"
FT                   /db_xref="GOA:C4LGC4"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR037272"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGC4"
FT                   /protein_id="ACR16820.1"
FT                   /translation="MPQNISVSSGDEPASAANSPANKPAKRATFGGRSMFIFAAIGSAI
FT                   GLGNIWRFPYISYDNGGGAFLFPYVIALLTAGVPVLILDYVLGHRFRGSAPLVWRRISR
FT                   KTEAIGWVQTGITYIIAVYYCVILAWAAMYTWFSLKLAWGTDPEKFFTGDFLHADTTSL
FT                   TSANVVWPIAIVLALVWAAITAVMVLGVRKGTGLLSSIFVPLLIIMFIILVIRALFLPG
FT                   AAEGLEAFFTPQWGALLDPQVWIAAYGQIFYSLAIAFGIMMTQASYLQKRANLSGLGAV
FT                   VGLSNSAFEVLAGIGVFATLGFMAVTQHVAVADVATNGIGLAFIAFPTIINNMTGGPIF
FT                   GVLFFGSLFIAGFTSLVTIVEVVLSSVQEKFGLSRRRAAVYVCVACAVPSLVFFPVSTG
FT                   LATLDIVDKFVNVIGIVVIAVVAIIVIGWVLRRLPELRQHVNQISSLQLGRWWDFCLLV
FT                   LTPLVLGTTFVLEIITLVRDGYEGYPTAKVAIFGWGLAVLFYGGALVMSRVPWPRGTIL
FT                   DGPPVSDYGVPLTGKGAPFGQHLDNPYESIRDRERRLEVAGLKEA"
FT   gene            complement(26240..26312)
FT                   /locus_tag="ckrop_t0001"
FT   tRNA            complement(26240..26312)
FT                   /locus_tag="ckrop_t0001"
FT                   /product="tRNA-Ala"
FT                   /anticodon="(pos:26277..26279,aa:Ala,seq:tgc)"
FT   gene            complement(26354..26430)
FT                   /locus_tag="ckrop_t0002"
FT   tRNA            complement(26354..26430)
FT                   /locus_tag="ckrop_t0002"
FT                   /product="tRNA-Ile"
FT                   /anticodon="(pos:26394..26396,aa:Ile,seq:gat)"
FT   gene            complement(26596..27084)
FT                   /locus_tag="ckrop_0021"
FT   CDS_pept        complement(26596..27084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0021"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16821"
FT                   /db_xref="GOA:C4LGC5"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGC5"
FT                   /protein_id="ACR16821.1"
FT                   /translation="MTGPGPHGLTPEGNQANQSDQDLGTRRWTGNLADDGAGPLGSAPS
FT                   TSGTPQGERVVEVTHIDLHRAARISGAVSAIIALVWILAALLMFGLLAGMGAWGNMNDA
FT                   LNDVADTSVPTSMVIIAIIALAVFEAIIGTLLGVVAAAIYNGLARMRAVGGVRMVVRD"
FT   gene            complement(27084..29684)
FT                   /locus_tag="ckrop_0022"
FT   CDS_pept        complement(27084..29684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0022"
FT                   /product="DNA gyrase subunit A"
FT                   /function="DNA gyrase (topoisomerase II) A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16822"
FT                   /db_xref="GOA:C4LGC6"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGC6"
FT                   /protein_id="ACR16822.1"
FT                   /translation="MSDDSGNTGGNDLFDRVSPIDIQEEMQSSYIDYAMSVIVGRALPE
FT                   VRDGMKPVHRRIIYAMYDNGYRPERSYVKSARPVADTMGHFHPHGDSAIYDTLVRMAQP
FT                   WSMRYPLVDGQGNFGSRGNDGPAAMRYTECRLTPLAMEMVRDIRENTVDFEPNYDGKTL
FT                   EPTILPSRVPNLLMNGSGGIAVGMATNIPPHNLTELAQAIFWCLDHYDADEATTLEAVM
FT                   ERVKGPDFPTAGLIVGDKGIKDAYTTGRGSIKMRGVTSIEEERGRTIIVITELPYQVNP
FT                   DNLVSSIAEQVRDGKIAGISKIDDESSDRVGMRIVVTLKRDAVPRVVLNNLYKHSQLQT
FT                   SFGANMLSIVDGVPRTLRLDQLLRLYVDHQIDVIVRRTQHRLDEAEKRAHILRGLVKAL
FT                   DMLDEVIALIRASQTPEIARTGLMDLLDIDELQADAILRMRLRQLAALERQKIIDELKE
FT                   LELTIADLKDILARPERQRQIVRDELEEIVNNYGDDRRTQIIAATGDVTEEDLIARENV
FT                   VATITSTGYAKRTKVDLYRNQKRGGKGVRGAELKQDDVVRHFFVTSTHDWILFFTNFGR
FT                   VYRLKAYELPEASRTARGQHVANLLEFQPGEHIAQVIQLQTYEDAPYLVLATKQGRVKK
FT                   SKLTDYDSARSGGLIAINLNEGDSLIGAQLCSANDDLLLVSEEGQAMRFTADDDTLRPM
FT                   GRATAGVKGMRFRGEDALLALTVVREDSYLMVATSGGYAKRTKMEEYPAKGRGGLGVAT
FT                   FKYNKKRGKLIGALVVDQDDEIFCITTDGSVVRSNVKDIRPSSRQTMGVRLVHLDKGSE
FT                   LLAIDRNVEDEGEEHAAKTAEKGNAPTDPAEPDPNDPNADGSDGDGSSDAKDGK"
FT   gene            29858..30082
FT                   /locus_tag="ckrop_0023"
FT   CDS_pept        29858..30082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0023"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16823"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGC7"
FT                   /protein_id="ACR16823.1"
FT                   /translation="MSMAMTLRLTDDQDRALTLLAEMTGTSKHEAAVRAIVSTAARTVD
FT                   NEEVRQLARSRVPEYAELVKKVRAKKVRR"
FT   gene            30079..30414
FT                   /locus_tag="ckrop_0024"
FT   CDS_pept        30079..30414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0024"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16824"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGC8"
FT                   /protein_id="ACR16824.1"
FT                   /translation="MTAPGVGGSHGMDDELTAGAGFGSRPLTAEQLLIIIDEFRAAAGS
FT                   GVYLVHPWACAAITAAGQGRIGGIPTHRSEAEMLDAVGEAITRLKPLNKANGKLAELVI
FT                   DIMTMRR"
FT   gene            complement(30401..30754)
FT                   /locus_tag="ckrop_0025"
FT   CDS_pept        complement(30401..30754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0025"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16825"
FT                   /db_xref="GOA:C4LGC9"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGC9"
FT                   /protein_id="ACR16825.1"
FT                   /translation="MSKPLFKFPLIEAIITVISFVFLAGSPGAAAFVFAAFAPAMIYHC
FT                   VLVLFKVQHLAVWIALAGVVTIAGIIDFIVGPMGFLDVYILPTGIGLFIACALYAFWLK
FT                   IGRDAAHQRISVA"
FT   gene            31129..32202
FT                   /gene="mvaK1"
FT                   /locus_tag="ckrop_0026"
FT   CDS_pept        31129..32202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mvaK1"
FT                   /locus_tag="ckrop_0026"
FT                   /product="mevalonate kinase"
FT                   /function="Galactokinase"
FT                   /EC_number="2.7.1.36"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16826"
FT                   /db_xref="GOA:C4LGD0"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006205"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGD0"
FT                   /protein_id="ACR16826.1"
FT                   /translation="MQPLRHSDADVITSSRRSEAPDYARLNEGQRYKQPAEGPHYSALA
FT                   DEARGFGRAHAKIILFGEHAVVFGEPAIAFPMQCLTLRATAEPCDGELWLTANNYDGPL
FT                   ADAPTFLSPVGATIKACLDLLEYPQSGMHISCRGNVPPARGLGSSAAASAAMVDSIIDF
FT                   SGKDVDYHSRYELVQIGERVAHGSASGLDAHTVLNTHPVLFQGGRSEPITVSLGSPLVV
FT                   ADTGQPGDTLSAVRGVDELRRTHKKRFTRNVDAIRHHTVEARIDLALDDRASLGERMNA
FT                   VHEHLADLGVSSPELENLISAARNAGALGAKLTGGGRGGCIIALSKDENHAIALSDALR
FT                   AAGARRTWLMHPSEFQR"
FT   gene            32199..33326
FT                   /gene="mvaD"
FT                   /locus_tag="ckrop_0027"
FT   CDS_pept        32199..33326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mvaD"
FT                   /locus_tag="ckrop_0027"
FT                   /product="diphosphomevalonate decarboxylase"
FT                   /function="Galactokinase"
FT                   /EC_number="4.1.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16827"
FT                   /db_xref="GOA:C4LGD1"
FT                   /db_xref="InterPro:IPR005935"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR029765"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="InterPro:IPR041431"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGD1"
FT                   /protein_id="ACR16827.1"
FT                   /translation="MTATHPSMGDIGPITPRTARATAHPNIALVKYWGKRNADLVLPAT
FT                   GSLSLTLDIYPTDTVVNPDPSLTSDIFTLNGEPAPGTPTHRVRAFLDLVRKLSAEQNPE
FT                   LAHMYARINSVNSVPTGAGLASSASGFAALATAASKAYGLPGDPRSLSRLARRGSGSAT
FT                   RSILGNLVIWHPGDGDDENADLTSYAESVPGPDLAMVICVVSGAQKAVSSRVAMADTIR
FT                   TSPFFDGWVSSTQRDLVDMQQALAEGDYTRVGEITESNALRMHAAINGNRPPVRYLAPT
FT                   SVAIFDTIAQLRNDGLEVYGTADAGPNVVALCQAKDLDATHAALRERFPDLELIPARAG
FT                   SGAYLTPVEETSGNEQIRAHEEDSAQASDAANRQE"
FT   gene            33332..34561
FT                   /gene="mvaK2"
FT                   /locus_tag="ckrop_0028"
FT   CDS_pept        33332..34561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mvaK2"
FT                   /locus_tag="ckrop_0028"
FT                   /product="phosphomevalonate kinase"
FT                   /function="Mevalonate kinase"
FT                   /EC_number="2.7.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16828"
FT                   /db_xref="GOA:C4LGD2"
FT                   /db_xref="InterPro:IPR005917"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR035102"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGD2"
FT                   /protein_id="ACR16828.1"
FT                   /translation="MTQTSVHASAPGKLYIAGEYAVVHPGHAALLIAVDRYVHVTLTPT
FT                   GTDAGTLRSDASDPTKPDEAPVRWEASFDPMAAARFHTDETGFHKYVAAAVLTVERWRA
FT                   EKHLPTSGYDIDISSHLDDATSGAKFGLGSSAAVTVATVAAAARHHGLQPTPEQIYRLA
FT                   AIATVRVTTKTSGGDVAASALGGWVEYHSPDRAWLEDRAWGSGSRTTTISDLLTGEWPG
FT                   LSLRRITPAAPGIQLSVGWTGTPADTTELVGHVVKKTALPDDLLQRSDAAVGSLVEALT
FT                   GENGGCEAGSGEPASGDVNSDGRATSATGNAVAQARQVLGEIATQRGVAIETPALRTLI
FT                   TTALDEGWWAKSSGAGGGDCGIALTVPGVDAHALHERWTAAGIRPLNLHVSPTGADTAP
FT                   DDTPTEGDGK"
FT   gene            34558..35844
FT                   /gene="idi"
FT                   /locus_tag="ckrop_0029"
FT   CDS_pept        34558..35844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="idi"
FT                   /locus_tag="ckrop_0029"
FT                   /product="isopentenyl-diphosphate delta-isomerase"
FT                   /function="L-lactate dehydrogenase (FMN-dependent) and
FT                   related alpha-hydroxy acid dehydrogenases"
FT                   /EC_number="5.3.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16829"
FT                   /db_xref="GOA:C4LGD3"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR011179"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGD3"
FT                   /protein_id="ACR16829.1"
FT                   /translation="MSGSRKDDHLALAARQQREAHGEPPQPTDATTPAPDNASSAPSPR
FT                   PAGSNSTYCAWDDVRILHHSLAGIDPGQADISTTIPTDRSAGGNTNAVTNASTGAHTAQ
FT                   PLHWGLPFYINGMTGGSELTAGVNRVLAETAARTGIAVATGSMSIYLREPDTLPTFRIL
FT                   RDRNPHGTVWANLSADATPDDAARVVDALQADALQIHVNAVQETVMPEGSRGYASWPRN
FT                   IEAIVNALEATHTPVIVKEVGFGMTRNTLQQLHDLGVSIADVSGRGGTNFARIENDRRS
FT                   DRDFSYLTGFGQSAAFSLLDATTADPDTLPTLFASGGVRQPYDVLRGLALGADAMGVAG
FT                   TFLHTALSTGVGDATRSPQERTQGIDAAVDALTSQINRWAEHLQALYEMVGATSTSDLH
FT                   NTDALITGPLAESARARGIDLTAVANRRR"
FT   gene            35988..37097
FT                   /gene="mvaA"
FT                   /locus_tag="ckrop_0031"
FT   CDS_pept        35988..37097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mvaA"
FT                   /locus_tag="ckrop_0031"
FT                   /product="3-hydroxy-3-methylglutaryl-coenzyme A reductase"
FT                   /EC_number="1.1.1.34"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16830"
FT                   /db_xref="GOA:C4LGD4"
FT                   /db_xref="InterPro:IPR002202"
FT                   /db_xref="InterPro:IPR009023"
FT                   /db_xref="InterPro:IPR009029"
FT                   /db_xref="InterPro:IPR023074"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGD4"
FT                   /protein_id="ACR16830.1"
FT                   /translation="MSDNLYAPIPMSWIGPVHISGNVVSGETAGWNAEDGTQNQESGAS
FT                   YEAVSIPMATYETPLWPSVGRGAKVSRYVEGGIRATLVDERMTRSVYFEAPNAGVALRV
FT                   ATELDRRRDELQAVVAHASRFAKLIDLHVQYAGNLLFVRFEFTTGDASGHNMVTLASDN
FT                   LMPWILQQYPELRYGSISGNYCSDKKATAVNGILGRGKNVVTEMLIPRNVVEERLKTTP
FT                   EQIADLNVRKNLVGTTLAGGLRTANAHYANMLLGFYLATGQDAANIVEGSQGITHAEVR
FT                   DGDLYFSCNLPNLIVGTVGNGKGQGLEVVEENLRRLGCREDRPAGDNARRLAVLCAASV
FT                   FCGELSLLAAQTNPGELMAAHVKIERKGE"
FT   gene            37094..38287
FT                   /gene="mvaS"
FT                   /locus_tag="ckrop_0032"
FT   CDS_pept        37094..38287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mvaS"
FT                   /locus_tag="ckrop_0032"
FT                   /product="hydroxymethylglutaryl-CoA synthase"
FT                   /function="3-oxoacyl-[acyl-carrier-protein] synthase III"
FT                   /EC_number="2.3.3.10"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16831"
FT                   /db_xref="GOA:C4LGD5"
FT                   /db_xref="InterPro:IPR011554"
FT                   /db_xref="InterPro:IPR013528"
FT                   /db_xref="InterPro:IPR013746"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGD5"
FT                   /protein_id="ACR16831.1"
FT                   /translation="MNAPVNTAVNPIGIHDITFATGHHSFALETLAAKHGIDVGKFHKG
FT                   IGQEVMSQPAADEDIVTMAATAAKRIIDRNGTDGIRTLLFATESGVDQSKSAGVYVHGL
FT                   LGLPSRVRTIEMKQACYSGVGALQVALGIVARNPQEKVLVVASDVARYDLNSGGEPTQG
FT                   AAAAAFLVQANPGILAVEPASGVYTYDVQDFWRPNDRHTALVDGKLSIDAYLNAVRGAY
FT                   DDFIDHGGADFAAIDRFCYHQPFTKMAVKAHMALREHVGLSADKAETAAELETTMHYNR
FT                   MIGNSYTASVFLALMSLLETESDNLVGKRVGILSYGSGAVAEFFTGTIVDGYQKLLHAD
FT                   EHKKALDSREPLTYDAYRDLHPGTRVADITDYDTPEVTDAPFRFAGVKDHSRIYQRR"
FT   gene            complement(38284..39375)
FT                   /locus_tag="ckrop_0033"
FT   CDS_pept        complement(38284..39375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0033"
FT                   /product="putative membrane protein"
FT                   /function="Membrane-associated phospholipid phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16832"
FT                   /db_xref="GOA:C4LGD6"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGD6"
FT                   /protein_id="ACR16832.1"
FT                   /translation="MAQAPTLPTHQADDSQAWASESQPDAARTTPPPAQNPGTTPRRQH
FT                   DGGGVNTTAVTALLGVATVLLIIFTFTDKQVSDAVINHDSVFGTLFQSYGEFPPAVLTA
FT                   LAMQVLAGCLLRSSLPGIARGLGSILLTWASFLSVLGWSEQAESYRRSWSANLAAGTPI
FT                   GVANNDDSGTMTWSQFAPAMFMDIVLLIIISMVAWLLVRNLSTETLRLIAISAVIMLAI
FT                   VWAGHGVNDGMKSLWGRFRPYEVDAGKGPYQPWYHINLPNGHRSFPSGHTQEGITLAAL
FT                   AIVLRPLGGKAWRIALWVGTVWGILMAASRVIIGAHWATDTVASFILTYGLILIGLWLT
FT                   TWVARRVNSTTITNDAGTPVRTS"
FT   gene            complement(39619..41247)
FT                   /locus_tag="ckrop_0034"
FT   CDS_pept        complement(39619..41247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16833"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGD7"
FT                   /protein_id="ACR16833.1"
FT                   /translation="MNSSDTTMFLRAARNLSDARKQRKDNKEARDFDPVERLVEYAKAK
FT                   ESNPGKPRGQGDNGKIDQNANDSSSDNSSEAKGKKDKKAAKKAKKQEKKKDKKSSSQSS
FT                   SKENSAMSKKKSTLEQLRASANPTAVAVVDRIREESERAYDLASDKADKAGKKLNKARA
FT                   KAEKKAKKVQKKADKKASKARKQNAKKADALQKRAEAFQKKAAEFADKATDKAAEFADK
FT                   ASDKASEFAGKAQDTASDVRGKAAETASNVAAAASNNLPDSVSDRLPDSVTDSLDQAAG
FT                   KKTKRSKKPLFIVLFVALVAGGWATYKSRSSKNVSTEPPKNNDEPHLVYKTETPTSNSS
FT                   ADSKEDKVEDAKEKAADAQAAAAEKADQAKEKTDEVKKAAQSKAEELKDAAKDKAEDLK
FT                   AAASDVADRAADKAEQAKADAKDAASRADDKADEVKKAAQSKAEDLKKEAKDVKAQAEK
FT                   KAKDAKKSDGKKSAPKNSAPKNSAPQAPSAKAKAGKGSGKGNATKNNGAQKPGASKNNG
FT                   GKKGNNGKSNSANGAGRHALKDDKK"
FT   gene            41360..41899
FT                   /locus_tag="ckrop_0035"
FT   CDS_pept        41360..41899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0035"
FT                   /product="peptidyl-prolyl cis-trans isomerase"
FT                   /function="Peptidyl-prolyl cis-trans isomerase (rotamase) -
FT                   cyclophilin family"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16834"
FT                   /db_xref="GOA:C4LGD8"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGD8"
FT                   /protein_id="ACR16834.1"
FT                   /translation="MSVVSTQKTATAILHTNRGDISIDLFGNHAPQTVDNFVGLAKGTK
FT                   DYSERNASGGEEGPFYDGAIFHRVIDGFMIQGGDPTGTGRGGPGYRFGDEFHPELQFDR
FT                   PYLLAMANAGPGTNGSQFFITVAPTPHLNNHHTIFGEVTDADSQKVVDTIAETKTDRFD
FT                   RPLDDIVIDSVEIVEN"
FT   gene            42019..42855
FT                   /locus_tag="ckrop_0036"
FT   CDS_pept        42019..42855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0036"
FT                   /product="putative membrane protein"
FT                   /function="Uncharacterized membrane protein (homolog of
FT                   Drosophila rhomboid)"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16835"
FT                   /db_xref="GOA:C4LGD9"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGD9"
FT                   /protein_id="ACR16835.1"
FT                   /translation="MLTRTIRQTPVTSGALIACIVVYLVTVVQSGSLDGNTHESSLAAS
FT                   WWLYLPALTPDNEALLRGLTFSFLHSGLTHLLFNGVMLWVFGVGIERTYGSLAMAIIFA
FT                   GTSYGSAAMIQWRDPLSLTVGASGVIYGLMAVAAGMYLNNKPQMRALIVLIVVNLGYSL
FT                   ITPGISLWGHIGGLLTGALMAIAIYGAQIVTGVRGPGRRVGRFVAAGLGTAGMAHGVGS
FT                   MSSGTSLLGGAGGAMMGAGGSQRRLIARLSASVAVFVVGCGAMVVYIAQVDSALGV"
FT   gene            43401..43643
FT                   /locus_tag="ckrop_0037"
FT   CDS_pept        43401..43643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0037"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16836"
FT                   /db_xref="GOA:C4LGE0"
FT                   /db_xref="InterPro:IPR012667"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGE0"
FT                   /protein_id="ACR16836.1"
FT                   /translation="MTDSSLHAAQPASSRTSARALAEAIDVPSSFVWLFSALVIGLLVY
FT                   YFVGIDQGATSVFGNDMHIHEWVHDSRHFLGFPCH"
FT   gene            43699..44550
FT                   /locus_tag="ckrop_0038"
FT   CDS_pept        43699..44550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0038"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16837"
FT                   /db_xref="GOA:C4LGE1"
FT                   /db_xref="InterPro:IPR012666"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGE1"
FT                   /protein_id="ACR16837.1"
FT                   /translation="MERQFVLRCGGFGLLAGLLSFIFAKLWAEPIISRAIDYEEGRDEA
FT                   QDALDKAAGIATGGDETELFSRTIQSTVGIGTGMVLMGLALGLLYAVVFSLYLRYAKPT
FT                   NIRAAAIGVAAAMFACLYIVPCLKYPSNPPAVGNPDTIKQRTWLFLTMIIASVIVMVGV
FT                   VFLHKVLSARMDSWVAFLISAVVFAVIMYAFSRLLPSLGHLHANIDEFGRHNSETPRPL
FT                   TDPDGKIVYPGFPADDLYYFRVYSFMAQCILWGVIGFGTALVSKKAIHKAAVQAEKEKV
FT                   AA"
FT   gene            45439..46047
FT                   /locus_tag="ckrop_0039"
FT   CDS_pept        45439..46047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0039"
FT                   /product="putative secreted protein"
FT                   /function="Fructose-2,6-bisphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16838"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:C4LLS0"
FT                   /protein_id="ACR16838.1"
FT                   /translation="MRRFHRQSRTTIGVVRLIVVSAPLASARLPRFASSEDTVRWADYR
FT                   HELRRYEEFSDINDAGPGTEEAAKSTRLRVFVGNPGPWDVGEWAGKPLPLVSPMKVAQW
FT                   RKNPDYDGHRGESLRTYIDRVAKWADDLEPGEYVTVSDQSLGRALLVHALDAPPDAFWR
FT                   CDIPPEWQMRFHRRHSGDKEMWTLRGLAPVDPASSRMLR"
FT   gene            complement(46077..46349)
FT                   /locus_tag="ckrop_0040"
FT   CDS_pept        complement(46077..46349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16839"
FT                   /db_xref="GOA:C4LLS1"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/TrEMBL:C4LLS1"
FT                   /protein_id="ACR16839.1"
FT                   /translation="MPKSKVTESSESRPASSSTSTRTPVKLNNASTPLWYRIIMFGFII
FT                   AGLLWLVVNYIAGPQIPFMQDLNAWNYAIGFGLFVVGLLMTMGWK"
FT   gene            complement(46612..48237)
FT                   /locus_tag="ckrop_0041"
FT   CDS_pept        complement(46612..48237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0041"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16840"
FT                   /db_xref="GOA:C4LLS2"
FT                   /db_xref="InterPro:IPR025902"
FT                   /db_xref="UniProtKB/TrEMBL:C4LLS2"
FT                   /protein_id="ACR16840.1"
FT                   /translation="MPSLSSMWSHASDLTSLRKLSSRTPREKRIDNTFFLLAGLASIWL
FT                   AGEYFKLSFVLDFRLLLIIPAWGVIAYLTLPRLHRILTRIYVPNYFIGRTRTSDGLLGD
FT                   PVNIAFDGTAEQLHRSMTEAGWTLADPVTFRSSAKIVWSSITRASYPAAPVSPLILFDR
FT                   EQDLAYQQEVDGSPSRRHHIRLWRCPKDWPLPGGHRVDWVGSASYDTAVGVSFFTLQVT
FT                   HRIAADIDRERDHVVSTVRSYVPESSVSMIEDFSTGYHHVNGGGDKIHTDGDLPIVDVS
FT                   RVGLRSGSADHDGASADETPEELPDDIEAATAESDAPSEITENDAEAENTAEESSDAEP
FT                   LTARGSDNVDSTINGTRYTGRASTHYGNDISDEERAARRPKNAQRTPRPPNLMLSMGML
FT                   FLVVAWQSVVLLYKADQHRFIPGTLQDMGFSHHTAYVATQWYVGLLTLGTLILVLLTLG
FT                   GFTHARDALMLFLTIAIVISILDRNGMRMIAAGHNNLLLTTATIIALLALSSDDVRNWI
FT                   RGHEPAVVWGPVRKIHLPIDDHSR"
FT   gene            48588..50120
FT                   /gene="oadA"
FT                   /locus_tag="ckrop_0042"
FT   CDS_pept        48588..50120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oadA"
FT                   /locus_tag="ckrop_0042"
FT                   /product="oxaloacetate decarboxylase"
FT                   /function="Pyruvate/oxaloacetate carboxyltransferase"
FT                   /EC_number="4.1.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16841"
FT                   /db_xref="GOA:C4LLS3"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C4LLS3"
FT                   /protein_id="ACR16841.1"
FT                   /translation="MQQPTNRLNVVAMTTRKIGVTELALRDAHQSLMATRMALEDMVDA
FT                   CEDIDKAGYWSVECWGGATFDACIRFLNEDPWERLRTFRKLMPNSRLQMLLRGQNLLGY
FT                   RHYEDGVVDKFVEKSAENGMDVFRVFDALNDPRNLEHAMQAVKKVGKHAQGTICYTVSP
FT                   LHDVQGYIDLAGRLLDMGADSIALKDMAALLKPQPAYDIIRGIKDTYGEDTQINVHCHS
FT                   TTGVTMVTLMKAIEAGADVVDTAISSMSLGPGHNPTESLVEMLEGTDYETGLDMDRLIN
FT                   IRDHFKTVRPKYAEFESKTLVNTNIFQSQIPGGMLSNMESQLKAQGAGDRIDEVMKEVP
FT                   VVRKAAGYPPLVTPSSQIVGTQAVFNVLMGRYKVLTAEFADLLLGYYGEAPGERDKDLI
FT                   EQAKKQTGKEPITERPADLLEPEWDNLVEEADELDGTDGSDEDVLTNALFPQVAPGFFK
FT                   TRPDGPKNVGKTKEQLEREEAKASGDATAIREPIMYKVTTGGRSHTVSVEPA"
FT   gene            50164..51747
FT                   /locus_tag="ckrop_0043"
FT   CDS_pept        50164..51747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0043"
FT                   /product="putative acyl-CoA carboxylase, beta chain"
FT                   /function="Acetyl-CoA carboxylase, carboxyltransferase
FT                   component (subunits alpha and beta)"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16842"
FT                   /db_xref="GOA:C4LLS4"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:C4LLS4"
FT                   /protein_id="ACR16842.1"
FT                   /translation="MSEQPHDPSMPERLGQLEEERNRIRLGGGQARLDKQHDRGKMTAR
FT                   ERITKLVDEDTFQETGMFAKHRTTHFGMDKADAPADGVVTGSGAVYGRPVHIASQDFSV
FT                   MGGSAGEMQSNKVVAMMKASATTGTPFVFINDSGGARVQEGIDSLSGYGRVFYNNVLLS
FT                   GLVPQVSIIAGPCAGGAAYSPALTDFIIQTRKANMFITGPKVIESVTGEKVTADELGGA
FT                   DAHMSTAGNIHFVADDDEQAILIAQKLLSFLPQNNTEEPPIVDPDEVVEPDDSLRDIVP
FT                   VDGRKGYDVRDIIRKIVDYGDFLEVQAGYAQNLVVGFARVVGRTVGIVANQSQVMSGVL
FT                   DINSSDKGASFVRFCDSFNIPLLTLVDVPGFMPGVAQEHGGIIRHGAKMLFAYSAATVP
FT                   KLTVVLRKSYGGSYLAMCSKDLGADRVWAWPTAEIAVMGADGAVNVVFRKEIKKAQEEG
FT                   GDEAAAAKKSELVQLYKDTFSTPYMAASRGLVDDIIDPADTRREIALALELLTNKRENR
FT                   PSKKHGLAPN"
FT   gene            51758..52045
FT                   /locus_tag="ckrop_0044"
FT   CDS_pept        51758..52045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0044"
FT                   /product="putative acyl-CoA carboxylase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16843"
FT                   /db_xref="UniProtKB/TrEMBL:C4LLS5"
FT                   /protein_id="ACR16843.1"
FT                   /translation="MNTDNASSAELSQLLARLSNQVEKLSRNVTKLENEVAALKQRSDE
FT                   EIPEDVLIAISAAVSAYMGNRGTVRAVHFLRHRSWSQQGRQAVQHKAKWQ"
FT   gene            52072..52443
FT                   /locus_tag="ckrop_0045"
FT   CDS_pept        52072..52443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0045"
FT                   /product="putative acyl-CoA carboxylase, alpha chain"
FT                   /function="Biotin carboxyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16844"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:C4LLS6"
FT                   /protein_id="ACR16844.1"
FT                   /translation="MKLTVTVNGVPYSVDVEVEHEERPTLGTIITGGNSNGPTPTAPTT
FT                   SSVQGVSANSVTAPLAGSVSKVLVEEGQAITAGEVIVVLEAMKMETEITAPNDGTVTAL
FT                   HVQPGDAVQGGQSLLEIGD"
FT   gene            52730..52969
FT                   /locus_tag="ckrop_0046"
FT   CDS_pept        52730..52969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0046"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16845"
FT                   /db_xref="InterPro:IPR008462"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:C4LLS7"
FT                   /protein_id="ACR16845.1"
FT                   /translation="MDAARCVAKLEQKEKPMGISDDIKNKADEFGGKAKEAAGDVTDNK
FT                   DLKAEGKGDQAESKIKQGIEDLKDKASEFLNKDK"
FT   gene            53093..53728
FT                   /locus_tag="ckrop_0047"
FT   CDS_pept        53093..53728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0047"
FT                   /product="putative methylated-DNA--protein-cysteine
FT                   methyltransferase"
FT                   /function="Methylated DNA-protein cysteine
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16846"
FT                   /db_xref="GOA:C4LLS8"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:C4LLS8"
FT                   /protein_id="ACR16846.1"
FT                   /translation="MPADASAERRDDHCDHLDDRTYRTQRFPTPFGDIDVTINGHAIVA
FT                   AQYIIGSGTTDPDITDPGATSDMSEAQRHLFTQIGEQLDEYFSGTRQAFTLPLDVEDDP
FT                   TEFTKSVREEMSHISPGDVLTYGELAEAAGRPRAARAVGSVCRTNPIQLFIPCHRVVAA
FT                   GGSLGGYMGGARGLILKQQLLEREGVPFTADGKVDFRELGRRQETQFH"
FT   gene            53798..57135
FT                   /pseudo
FT                   /gene="lysX"
FT                   /locus_tag="ckrop_0048"
FT                   /note="lysyl-tRNA synthetase"
FT   gene            57437..62050
FT                   /gene="gltB"
FT                   /locus_tag="ckrop_0050"
FT   CDS_pept        57437..62050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltB"
FT                   /locus_tag="ckrop_0050"
FT                   /product="glutamate synthase large chain"
FT                   /function="Glutamate synthase domain 2"
FT                   /EC_number="1.4.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16847"
FT                   /db_xref="GOA:C4LLS9"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:C4LLS9"
FT                   /protein_id="ACR16847.1"
FT                   /translation="MTTVPSRQGLYDPSFEHDACGVAFVANMHGDKSRDIVDKGIQALV
FT                   NLEHRGAAGAEKNTGDGAGILIQIPDAFYRREMAKQDIELPPAGQYATGIAMLPAARMA
FT                   ALDAVRYVEDIIKEEGLTLIGWRDCPVDDSSIGAMARDAMPLFHQVFISGTKDDGTPLE
FT                   GIDLDRAVWFVRKRAERELGSKGAGAGSGEDTVYFPSLSARTVVYKGMLTTPQLREFYL
FT                   DLQDPEVESAIAVVHSRFSTNTFPSWPLAHPYRMVAHNGEINTVRGNENWMRARESVID
FT                   SEVLGSIDRVLPICDPGGSDTARFDEALELLHLGGRSLPHAVLMMIPEAWEHNADLSDD
FT                   VRAFYEYNSCLMEPWDGPADVVFTDGTVIGAVLDRNGLRPGRIWITDDGLVVGASEAGV
FT                   LPIDPEHVAERTRVKPGEMFLVDTSQGRVVLDEEIKTDLASQAPYGEWVSHNLVRKEDL
FT                   PDADYHWMPHHRAVLRQRVFGFTQEIVDIIVKPMALNGAEAIGSMGTDTPIAALSDHPS
FT                   YLFDFFKQRFAQVTNPPLDSIREKLMTSLFTHLGAQRDIMHPDADAAKLIHLDDPILRN
FT                   RDLARLVHANDGGEFPQFDVAIISGLYAVAHGGRGIQEALRRIRREVSDAIADGKTLIV
FT                   LSDRESDERFAPIPSLLLTSAVHQHLVRERTRTRASLIVEAGDVREVHDIAMLITFGAD
FT                   AINPYMGFETIDELRKQGSLGDMDLETAFDNYTKAAVKGLLKVMSKMGIAAVASYRGAQ
FT                   LADVVGLNQEFLDEYFTGSFAPIGGVGLEAIAEAVGDRHREAFLPRPEEQAHRELELGG
FT                   EYKWRREGEYHLFNPETIFTLQHATRTGRYEVFKRYTEKVNNQSKRLATIRGLFKFNPN
FT                   RPPVDIDEVEPVSAIVKRFSTGAMSYGSISAEAHQTLAIAMNRLGGMSNSGEGGEDSDR
FT                   FTKDPNGDWRRSAIKQVASGRFGVTSHYLNNCTDIQIKMAQGAKPGEGGQLPPHKVYPW
FT                   IAEVRITTPGVGLISPPPHHDIYSIEDLAQLIHDLKCANPDARIHVKLVSEQGVGTVAA
FT                   GVSKAHADVVLISGHDGGTGASPLGSLKHAGAPWELGLAETQQTLLMNGLRDRITVQCD
FT                   GQLKTGRDVVIAALLGAEEFGFATAPLVVEGCIMMRVCHLDTCPVGVATQNPDLRAKFS
FT                   GRAEYVVNFFQFIAEEIREYMAELGFRTVDEMVGHSEILGVNREVADRHPDAAKLDLSP
FT                   IFAQPDSPFMYQDKHCTKKQDHSLDKALDNQIIRDAREVIDAKSECEPLELSYRISNVD
FT                   RSVGAMVGSEISRVGGADGLREGALTVEFEGSAGNSFGAFLPHGVTLALTGDANDYVGK
FT                   GLSGGRIVVRPDPHYVSAVEKAGRDVSGDIIAGNVIGYGATSGELFVRGTVGERFCVRN
FT                   SGATAVVEGIGNHGCEYMTGGRVVVLGHVGRNFGAGMSGGIAFLPDDGIPAGQGGIRDR
FT                   IDTALADIEEPTAEDVAWLDQTVASYREWTGSTTPVGTFVKVMPRDYRRVLTIMESCQA
FT                   QGRDEAATAEAIMEAVH"
FT   gene            62050..63588
FT                   /gene="gltD"
FT                   /locus_tag="ckrop_0051"
FT   CDS_pept        62050..63588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltD"
FT                   /locus_tag="ckrop_0051"
FT                   /product="glutamate synthase small chain"
FT                   /function="NADPH-dependent glutamate synthase beta chain
FT                   and related oxidoreductases"
FT                   /EC_number="1.4.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16848"
FT                   /db_xref="GOA:C4LLU3"
FT                   /db_xref="InterPro:IPR006005"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C4LLU3"
FT                   /protein_id="ACR16848.1"
FT                   /translation="MADPHGFQKYSRHDKAHRPVPLRLLDWHEVYEKQDLTDLRQQATR
FT                   CMDCGIPFCHDGCPLGNIIPEWNDLVRLGRWREAFDRLHATNNFPEFTGRLCPAPCEGA
FT                   CVLGINDDPVTIKNVELEIVEYGFEHDFVKPIRPSFSTGQSVAVVGSGPAGLAAAQQLT
FT                   RAGHDVTVFERHDRLGGLMRYGVPEYKMEKKWINRRLEQMVAEGTQFRTNISPSVSDLQ
FT                   GFDAVVLAIGSTIGRDLPIEGRDLEGVYQAMEYLPEANKVQEGDREVSMIDARGKNVVI
FT                   VGGGDTGTDCFGTALRQGAKSVVQFDIGPKPPRPRAASTPWPTFPRKLRVATAHEEGEY
FT                   EVSGEEEKELVEKLGLDARVKGHPLGNRQWKTNTVEFIGTDGKITGLKGTLVDRTPEGT
FT                   IPIEGSDFEIDADLVLLAMGFASVDRAGIVDELGLEIDGRGRIVRDENFRAEVPLTAGF
FT                   RAPVFVAGDAGRGQSLIVWGISEGRSAAAAVDRQLMGESSLPTAIVPTDVPMRA"
FT   gene            complement(63605..64213)
FT                   /locus_tag="ckrop_0052"
FT   CDS_pept        complement(63605..64213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0052"
FT                   /product="hypothetical protein"
FT                   /function="Nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16849"
FT                   /db_xref="GOA:C4LLU4"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:C4LLU4"
FT                   /protein_id="ACR16849.1"
FT                   /translation="MSITAPFIINDEALNVLFRDAHTTSAFEDTSIDPEVIKSVRDLVK
FT                   WGPTSMNGQPLRIIEVPKDKRSRLVPHMMGNNQAKTEKAPLAFVLAADTNFHNHLPQQF
FT                   PAGGDGPRDMFEGNEEVRTAVALQSANLQAAYFILGLRAVGLGVGPMGGFDADAVTKEF
FT                   LRDGEQAIMVIIAGVPADTDAHHPRGPRMDDADVFRIAD"
FT   gene            complement(64296..64421)
FT                   /locus_tag="ckrop_0053"
FT   CDS_pept        complement(64296..64421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0053"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16850"
FT                   /db_xref="UniProtKB/TrEMBL:C4LLU5"
FT                   /protein_id="ACR16850.1"
FT                   /translation="MHHILRYGWVKRIKETRAVRLTDSGRATLAHAGIRLEDTPF"
FT   gene            65319..66635
FT                   /locus_tag="ckrop_0054"
FT   CDS_pept        65319..66635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0054"
FT                   /product="permease of the major facilitator superfamily"
FT                   /function="Permeases of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16851"
FT                   /db_xref="GOA:C4LLU6"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4LLU6"
FT                   /protein_id="ACR16851.1"
FT                   /translation="MLDTTIVNVALPNMATSLNTNVVTLQWVVDAYTLAFAALLLSAGA
FT                   ACDRLGARAVYVFGLVEFGVLSLVCALSSSGGVLIIARALQGIGAAAIVPGSLALLATV
FT                   YPDPAERARAIGLWGGAGGIASACGPVLGGLLVSAVGWQTVFWVNLPIIAFGCWLTFHS
FT                   IDASPHDRTHRLDPAGQALSIGALVAITYSVISSGERGWTQEQLLVLWIGGVLSLLFVW
FT                   VEYRHPDPMLPIGLFRSPRFSAATLVGFALNVSFFGQLFALSLFSQTYRDYEPIIAGLA
FT                   LAPQACSAVVASPLGGRVAAHIGAFPAMFIGLLIGTVGFGSLVILSSTTPYLLIAIVSF
FT                   IAGFGMAFAMPAATSAAVTTAPPSYTGVAGGVINAARQTGSVFGVAVLGGMIAGKDTFL
FT                   AGFHQAVGTASAVFAVAAVLVLIFLATTRAPVSNKARTH"
FT   gene            68083..68523
FT                   /locus_tag="ckrop_0055"
FT   CDS_pept        68083..68523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0055"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16852"
FT                   /db_xref="UniProtKB/TrEMBL:C4LLU7"
FT                   /protein_id="ACR16852.1"
FT                   /translation="MDEVETWCFFTKFVCRYDDLDQAKARHQRCVDALRITNTVHFSSE
FT                   DAYQAGHTEPTFRLLLTEIIPPGKEITPEKKKEYKEEYSVFVFVTIVDIPNTPDSDGDE
FT                   VRIVGEKLEIDFEEGLPARFPSRTRGIRVSRTGNEINGCIYQ"
FT   gene            68797..70188
FT                   /locus_tag="ckrop_0056"
FT   CDS_pept        68797..70188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0056"
FT                   /product="ABC-type transport system, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16853"
FT                   /db_xref="GOA:C4LLU8"
FT                   /db_xref="UniProtKB/TrEMBL:C4LLU8"
FT                   /protein_id="ACR16853.1"
FT                   /translation="MEKAFTVLKELRDLHPMAASILIVTAVSSWMLTLSLGLTIVGAQA
FT                   SGTDAGEQFAAIGGLQIALTCLSVILCAPSVVRLAIRQDSRRVALWQVIGASPRQARWR
FT                   YVLLASLSSLVGSLLGAFLGYVSWPAFTDLVRRTGFLLTPGLESKSINIGALLSGPLSA
FT                   FGVVLLATLFGSAAMSKIDPVQAVAETPEQRGKTGFLRLFPSIAIVAGIAVGYIAIANT
FT                   SPVTKPDSLSGLISAYWGAALGLLLAYGISDKALVHPVVRLVGALFSFTKSDSWFIAKT
FT                   SACRRSIVSTSVITPLVVAAASVGSVFGMVAQTKNVSVALGQSEEDLQVSPPGQIILVF
FT                   GLPVIIAASSAIVSVYLTSRLRNHDITLLEVLGARPSTIRVAAVCESLIYYLSSTVIAF
FT                   LMLAVNAFFMGKVLAAGPVPHASPVWFGSETFLLLTASFILLSISIIVPTMRSSSELNV
FT                   TTLTR"
FT   gene            70194..70916
FT                   /locus_tag="ckrop_0057"
FT   CDS_pept        70194..70916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0057"
FT                   /product="ABC-type transport system, ATP-binding protein"
FT                   /function="ABC-type antimicrobial peptide transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16854"
FT                   /db_xref="GOA:C4LLV1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4LLV1"
FT                   /protein_id="ACR16854.1"
FT                   /translation="MMNSLVEVSNLKKSFQINRRDYDEILKGINFSAGEGEFVSIVGPS
FT                   GSGKSTFLYCISGLETFDSGKSILCGNDLGSMSRNDRSRARRRNASFIFQDYNLIDSMT
FT                   ALENVELSLKFSKKRVSKRDIRREFERFGIDDKLKFYPAQLSGGQRQRVAIVRALLVRP
FT                   RVLFADEPTGALDSSSTNVVIGELSRLSSRGTTVIMVTHDLEIAAQADRAVVISDGKLV
FT                   RNLVSPTAASLFSAIESR"
FT   gene            70943..71332
FT                   /locus_tag="ckrop_0058"
FT   CDS_pept        70943..71332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0058"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16855"
FT                   /db_xref="GOA:C4LLV2"
FT                   /db_xref="InterPro:IPR025962"
FT                   /db_xref="UniProtKB/TrEMBL:C4LLV2"
FT                   /protein_id="ACR16855.1"
FT                   /translation="MPVVAALIASVGLVIVSILCLTIPENAVSGKVPRNSAIGIRTAET
FT                   KKSDEGWDVGHRAAAPILKRTGIVALILTAALFLSSFFGGEMSVVAVTCGVLGYAVIIG
FT                   GLCWAAVVANNAAKEINDQMEAEGV"
FT   gene            complement(71881..73470)
FT                   /locus_tag="ckrop_0059"
FT   CDS_pept        complement(71881..73470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0059"
FT                   /product="putative ABC transport protein"
FT                   /function="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16856"
FT                   /db_xref="GOA:C4LLT0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:C4LLT0"
FT                   /protein_id="ACR16856.1"
FT                   /translation="MRHRNNSAFAALVSQLLSSVSEGNFYKPLTPLLLTLLATSVFTAS
FT                   TTYVTSIAADRAVRDMRKKITDHLLYLKMSEFEKRGAGSFTSRITSDTSIVSTAFSSTV
FT                   IDFVGGFTVIIGSLVYMAVVDWKLLLVVIAVLLIALVIIVLVSSSLRSLSSRVQDHLAA
FT                   LGDILQPALSAFRTIKAFRSESKVARDISVEIDHAYQHRRKMSLVEAVLEPLSTVASYL
FT                   ALVTVALVGSIRLNNGDLSAETLTIFVTALFLMLAPVAQVTQSFGTLFEAKGALERIDD
FT                   LFSLDIENRDEDGFTRSRDVSVEGAVEFESVSYFRNGQTILNDVSAAIKRGEKIALSGV
FT                   SGSGKTTLFGLILRFYDPSAGDIRVGGRSLKDWCMRDLRKAITYVEQEPDLLPTSLRNN
FT                   LILGTNHAPSDDTLITLLEQFGLDKFASSDGLNRPVGYSNSGLSGGERQRVAIIRAILQ
FT                   DSSVVLVDEPTSALDASSAELAMERLLNIDATVIFASHDRNVIKRADRVLRLTGGKLVE
FT                   DDVPASEKGINE"
FT   gene            75309..75545
FT                   /locus_tag="ckrop_0060"
FT   CDS_pept        75309..75545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0060"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16857"
FT                   /db_xref="GOA:C4LLT1"
FT                   /db_xref="UniProtKB/TrEMBL:C4LLT1"
FT                   /protein_id="ACR16857.1"
FT                   /translation="MRTMSNQSNHPPAQRITRAMLLVLVIAVGVMVIEWLLLSALNVGN
FT                   RVTVFVIVAAITSVTIGSVVGQWTRKRWHKEKA"
FT   gene            75567..75908
FT                   /locus_tag="ckrop_0061"
FT   CDS_pept        75567..75908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0061"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16858"
FT                   /db_xref="GOA:C4LLT2"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C4LLT2"
FT                   /protein_id="ACR16858.1"
FT                   /translation="MRHHLCHTHVLAYTSGMSSFPVTAIRDSSIKLGQFIKLASLVETG
FT                   GEAKEVISAGRVEVNGQVETHRGHTLHHGDVVTIGSIGAEVGGPDNEDDYFDEATADDD
FT                   FDPEKWRNM"
FT   gene            75908..76750
FT                   /locus_tag="ckrop_0062"
FT   CDS_pept        75908..76750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0062"
FT                   /product="hypothetical protein"
FT                   /function="Predicted enzyme related to lactoylglutathione
FT                   lyase"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16859"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:C4LLT3"
FT                   /protein_id="ACR16859.1"
FT                   /translation="MPAFFASEGMPFWNELRTYDLERSSDFYRGLFGWEIDSADNSANS
FT                   SGYYYARKQGMPIAGIIPVASDIGSTAQHQPNQWMLSFLTDDVRAVADRSREHGGTAGE
FT                   PVDGPRGPMVAATDIVGAQLGFIHPASEPFIAGGEPGTPVWHELAAILPDGVSIDDVAT
FT                   YYTQVARWNTMRHGEGAHTVITAVSEGGAYAGVWFPGEQGAAELNASGSRWTTYFGVEN
FT                   IVDAAEYAQAHGGDIIVQPQNTEFGQIAILADPTGAALTVCEAPEHVEEPHEGDNIFG"
FT   gene            complement(76797..76949)
FT                   /locus_tag="ckrop_0063"
FT   CDS_pept        complement(76797..76949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16860"
FT                   /db_xref="UniProtKB/TrEMBL:C4LLT4"
FT                   /protein_id="ACR16860.1"
FT                   /translation="MDIHKYTYHVSWSENDQECIAIVAELPSLPCLGLGPDRHPNTHPQ
FT                   RHLPH"
FT   gene            complement(78344..79735)
FT                   /locus_tag="ckrop_0064"
FT   CDS_pept        complement(78344..79735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0064"
FT                   /product="putative sugar transferase"
FT                   /function="Sugar transferases involved in
FT                   lipopolysaccharide synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16861"
FT                   /db_xref="GOA:C4LLT5"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:C4LLT5"
FT                   /protein_id="ACR16861.1"
FT                   /translation="MVLLIAAADFLPFTAHNARAFALGSCTGTVPMFVPEVILFALWMM
FT                   VGRMMRTTDIAVLGQGALEYSRIARAATFAFGLFAILCELTQYTSGFRFLVFTYPVGLV
FT                   TLRLIRYGWRRVYCWQLDHKKLSQRVIFIGDPHSISEVYGTLRRQLDNRFDIVGFCSTQ
FT                   SDEHSEEQLAELKRRFPDAEIHDNWHQIDVMVSLLQADSVIVTVSNQIGMNDMRELMWR
FT                   LDGLNLELLVAPAVANVTGRRVQMLPIAGVPLLKLEHPQHARTHCVAKIVFDRVVAALL
FT                   LLMASPLLLVCALAIKLDDGGPVFYTAERMGKNNKPFGMIKFRSMVQNADQMVAQLKDQ
FT                   SDGNDVLFKMKNDPRVTRVGSFLRRYSIDELPQLFNVLRGDMSLVGPRPPLRREVEQYT
FT                   GLVGNRMLVLPGMTGLWQVSGRSNLSWEESVSLDLNYVENWSFMADLMILWKTGRAVLT
FT                   SDGAY"
FT   gene            80400..81299
FT                   /locus_tag="ckrop_0065"
FT   CDS_pept        80400..81299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0065"
FT                   /product="glucose-1-phosphate thymidylyltransferase"
FT                   /function="dTDP-glucose pyrophosphorylase"
FT                   /EC_number="2.7.7.24"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16862"
FT                   /db_xref="GOA:C4LLT6"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C4LLT6"
FT                   /protein_id="ACR16862.1"
FT                   /translation="MKGIILAGGTGTRLHPITLGTSKQLTPVYDKPMIYYPLSTLILAG
FT                   ITDVLVITTPHDATAFHRLLNDGSAFGISISYAVQPSPAGIAQAFVLGEEHIGNEPVCL
FT                   ILGDNIFYGPGMGTQLRRHTAPDGGVIFAYWVKDPTAYGVVEFEHQGDAPRQHTSVSQF
FT                   RALGIEEKPAHPKSHYAVPGLYFYDNDVVDMAKDLAPSARGELEISDINQRYLDAGRLT
FT                   VEVLPRGTAWLDTGTHDSLLDAGNFVRTIESRQGLKIGSPEEVSWRMGHLTDDQLRERG
FT                   EALVKSGYGSYLLDLLRR"
FT   gene            complement(81333..81824)
FT                   /locus_tag="ckrop_0066"
FT   CDS_pept        complement(81333..81824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0066"
FT                   /product="putative serine acetyltransferase"
FT                   /function="Serine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16863"
FT                   /db_xref="GOA:C4LLT7"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:C4LLT7"
FT                   /protein_id="ACR16863.1"
FT                   /translation="MILDMFIFQDAPARRSENGLHGLLNVGFLAVVIFRLSQVAGKRVP
FT                   LLGSVVKQINHVVTGADLAWEVSVGPGFMLYHPTGVVMGRRVKAGANLKVQSSVTISEA
FT                   PRGQETVLGNNVRLGAGCRIIKPLSLADDVSVGANAVVTKSCERPEAVLVGIPAHELSA
FT                   "
FT   gene            81931..82962
FT                   /locus_tag="ckrop_0067"
FT   CDS_pept        81931..82962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0067"
FT                   /product="hypothetical protein"
FT                   /function="Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16864"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:C4LLT8"
FT                   /protein_id="ACR16864.1"
FT                   /translation="MKILHVTECFAGGVATAINMYASLVPEHEHMVLHTARRANSPADP
FT                   DPELFSRSWRLPDEHRAAIDTVRRVRDEIAPDVIHAHSSFAGAYVRLARLRGSRRRTPT
FT                   VYTPHGVAFARKDISALHRAVFYSAEWALSWGTSVFAPCGQWEGDVLRRLNRRIPQVVI
FT                   PNATMPTGVTWNPTGAPTVGISGRVTPQRSPELFAAIARRVHEERPDVEFQWLGGGDAD
FT                   LTASLQRAGVHVTGWLDKDDLYSRLAGVNVGLHTALWDGYPMAVLEMNDIGVPVLVQNI
FT                   PALRECPAEARFDGVDDAARKVIRAIDEPESLRNAWEKVQDNHSVATLTDALHVCYSKA
FT                   GGN"
FT   gene            83131..84423
FT                   /locus_tag="ckrop_0068"
FT   CDS_pept        83131..84423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0068"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16865"
FT                   /db_xref="GOA:C4LLT9"
FT                   /db_xref="UniProtKB/TrEMBL:C4LLT9"
FT                   /protein_id="ACR16865.1"
FT                   /translation="MRAAPSTDLGGRRSSTPRSRVRDNHMFFSPEDIIVLWFLGLLCSL
FT                   VISGLHSHLLPPKFDRDAQVIQNLLAKPGLVRYEDYGSFATITSVYHALGLANSPTLAG
FT                   FFGVIIAHCALAVVLWRMRPIRVTAFSVCALVLYSLLVGVYQGVYTKEIIISTVVIVVA
FT                   AVPTGLQSAWIWDCVLAVVMAALGHYFRPYWVLIAVFFFGLRLFVSNTALSRRWITTRR
FT                   FVLLMVACSLVASLVIVARGFPADHYRTLVNAGRGADTGSLIGRFVEHPEPIAGIVNVV
FT                   LSTVMLMFPVTLAAKLSPYYLVIFVVIASFWASYFYAVRQWLRSDHRPPLVGRAVCLIA
FT                   AFAVVQGLFEPDYGSALRHLTPLIPLFFIVAAGERGAERVAEHGVPGGSRAGRGVTSPP
FT                   LPTPTQLSPPAHPPSPPNRPSDHPSARQSES"
FT   gene            84424..86310
FT                   /locus_tag="ckrop_0069"
FT   CDS_pept        84424..86310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0069"
FT                   /product="hypothetical protein"
FT                   /function="Capsular polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16866"
FT                   /db_xref="GOA:C4LLU0"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4LLU0"
FT                   /protein_id="ACR16866.1"
FT                   /translation="MTYPQYSDHADAYPHPAGVAMPPEEDRTQIVLRIWAVIRRNTWIL
FT                   ALFIVLGVAGAWGVSMLMPTKYTSTASVFVSVDSDGSISDAYQSTQFAEQRMQSYAQLV
FT                   SGDVLAEQVIKDLNLDMTPRDLTKELEATVVQDTVVMEISATDTDAAQAQRIASDAVKV
FT                   LSNQAEQLEARTDNNDNGNSRSRTSSNQQSTTTPRISLINSPEKATQPSSPKMAMNLIL
FT                   GGVLGFLVACILVALRFFLDRSVRSSEELERRTGLPKLGSVPVIPEAQRTKPLDFNDDR
FT                   VRPAEAFRELRVNVRFVNVDNPPRVISVTSAQIGDGKSMTSLNLAGALAADGDTVCLVD
FT                   ADMRRSKMTTYFGGAIHSSVGLSTALAGDADVADVLQETEITGLDVLAAGVTPPNPGEL
FT                   LGSQAFRHILDELRERYDWVIVDTPPILPVTDGALVATTVDAVIVAVRYGKRNYDDVTR
FT                   TLASLRAVHAPIIGTVLTAVPQKSDEGRYVGSYSRYESGSDHKAVAAAPASSTTSVGDE
FT                   DKSEKDKSDVVEQPDVDESSTAEDDAVGDGTSADEGAAGADVDEDAADETVKADTSEDT
FT                   AEAEANGSDTVDDTAEAETAVQVDTEATDDTSTDDAAKEGTEEAKEDDGKDD"
FT   gene            86326..86910
FT                   /locus_tag="ckrop_0070"
FT   CDS_pept        86326..86910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0070"
FT                   /product="putative phosphotyrosine protein phosphatase"
FT                   /function="Protein-tyrosine-phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:C4LLU1"
FT                   /protein_id="ACR16867.1"
FT                   /translation="MKIVFVCTGNQCRSPVAEYVARSFANELAAQAKTKGPQLADSSSL
FT                   TLEFASAGTHAHRGTPMDPRALRFLAAEGINSDGFSSTRLNRAALAGADIVVGMETAHV
FT                   EHALRIAPTLLKKAATLRQLAAWSTIDSVHFPDDIAHLRATRAGKEILDAHGPDIPDPA
FT                   AGNDDDFMRISREVRDDIKALVKAFVNGQNA"
FT   gene            86960..87538
FT                   /locus_tag="ckrop_0071"
FT   CDS_pept        86960..87538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0071"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16868"
FT                   /db_xref="UniProtKB/TrEMBL:C4LLU2"
FT                   /protein_id="ACR16868.1"
FT                   /translation="MRPSHRSHIRRHHPVRRAIAVIAAIVVAWCVFASRFLWFPHVDKQ
FT                   PAHVDAIVQLGGPHGGVDTYEATRNMAREYTTNLVISDPYTEKPDLGARICAPEPGVAV
FT                   YCIHPDPSTTRGEAQAIEQLAEEHGWSHIMVYATGKYHVARARMIIGRCYNGDLNVGYH
FT                   KTSLSWKDTIWEWAYQTGGVAKVLVYRGC"
FT   gene            87728..89935
FT                   /gene="bglP"
FT                   /locus_tag="ckrop_0072"
FT   CDS_pept        87728..89935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bglP"
FT                   /locus_tag="ckrop_0072"
FT                   /product="beta-glucoside specific PTS system component"
FT                   /function="Phosphotransferase system IIC components,
FT                   glucose/maltose/N-acetylglucosamine-specific"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16869"
FT                   /db_xref="GOA:C4LLU9"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:C4LLU9"
FT                   /protein_id="ACR16869.1"
FT                   /translation="MTDTPSERPSEDVTTSQTAPHKSATGKDNVVEIVAPVSGRVIPIE
FT                   DVPDPMFSEKVVGDGLGISKPKSGKILAPVSGKVMMVAKTGHAFALKTENGLEVLVHLG
FT                   IDTVELKGEPFDMTISRGDQLHAGDKVGIMDVDVIKSAGKDTTVIVAITNTAKKLDDLK
FT                   VTHKAVTSGDPVAAATLKKPKSAEKSTTSGTQGSSAAGAAGGAAAGSTPASVPAASGEG
FT                   ADAEQGNAAEQGNVAAERPADLSGYDATAWDVINNIGGKENISSLTHCITRVRFYLKDE
FT                   SKANDDAVRDTDGVIDVVKAGGQYQVVIGPAVEDVYDAVTKQLGDVETTDAADAEPKER
FT                   PTTLWGWAKLGFSSLIGVITESMIPVIGLLAAAGILKGILALLVQAGWVDDSTQTYIII
FT                   DAMGDAVFYFLPIFVGFTAARRLGSDPIIVAIVGGVLAYPTLVDMASKPGDKSLLGMSL
FT                   NAEFFGLPFHMASYSYSIFPMIVAAWLASIVEPWLKKVIPTVLRMIFVPLCEVVIVSLA
FT                   IMLILGPAVMFVSEGIASTLMWIYHLSPTISGLIIGGFYQCLVIFGLHWAVIPIVTDQV
FT                   SGPGGDSPINAIISATMVAQGGAVLAIFLKTKLLKIKELAGPAAISAFCGITEPAMYGI
FT                   NLKYGRVFIMASIGGAAGGILTGMFHVTMYAFTGALVGFPSFLPPGVGIGANFWGYLIA
FT                   SVTSLVVSFVLTYFFGFKDSDVENGREVKKVRLGRRDPVQK"
FT   gene            complement(90010..92301)
FT                   /locus_tag="ckrop_0073"
FT   CDS_pept        complement(90010..92301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0073"
FT                   /product="putative membrane protein"
FT                   /function="Predicted drug exporters of the RND superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16870"
FT                   /db_xref="GOA:C4LLV0"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:C4LLV0"
FT                   /protein_id="ACR16870.1"
FT                   /translation="MKTTPHSPGGSPRSEGDTTSPATPARGSSSVGKNGTSPRTGKLVA
FT                   LSVIIIAIWLGIASFGGPQFGNLSNVATNDQSSFLPQSSESAQVQEKIKEFGDQDRLPA
FT                   IIVVEQSDGKPLDISALGPVTQQLRDAAGGDDSASPFIPSDDKTAAQMLVLLPSDSNPT
FT                   DAVEDLTSTLKSDLPSDVKGWVTGPAGYTADLSDAFSGIDGLLLLVTVAAVLVILVAVY
FT                   RSPFLPFLVLLGSMIALAAAVGVNVALASSEVVMINGQIQGILFILVIGAATDYGLLYT
FT                   ARYREELRKLPPSDTRLGSAWQATRAAWLGSWRPILASAGTVSAGLLCLLFSDLASNSG
FT                   LGPVAAVGIGCAMVISLTFLPAVLFLTGSRVFWPRVPTPSEGKADAASPVWSWVAKTVS
FT                   RRPWQLAVGVSVVLAAGCVGVTTLHADGVPQSEFVLGDSQARDGQAVLDEHFPGGSGSP
FT                   AYVVVPEEKMASAVRVIQGTTGVESVSVSSTDSPSGSLPLSPDGTVQAGTMDAGTANSQ
FT                   PSQSGSPTVVDGYVLLSATLTSPVYSDDAQQTVTTLRHELKGMNAEVGGTTAINVDTNA
FT                   TSVHDRKVIVPIVLALITILLAALLRSLLAPLVLVLCTVLSYGAALGVASLLFTAVGLD
FT                   RADPTVPLYGFIFLVALAIDYTIFLMTRVREEAPGAGTREGMRRSLVSTGGVITSAGLV
FT                   LAATFAALFVIPIQFLVQLAIIISLGVLIDTFIVRTFLVPSIVELIGRRVWWPSRLSRK
FT                   SGSTTTDTSA"
FT   gene            92427..92525
FT                   /locus_tag="ckrop_0074"
FT   CDS_pept        92427..92525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0074"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16871"
FT                   /db_xref="UniProtKB/TrEMBL:C4LG35"
FT                   /protein_id="ACR16871.1"
FT                   /translation="MPESSVDNKKVGRKDRGDNAQQSLSWAVAAGA"
FT   gene            92589..93905
FT                   /locus_tag="ckrop_0075"
FT   CDS_pept        92589..93905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0075"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16872"
FT                   /db_xref="UniProtKB/TrEMBL:C4LG36"
FT                   /protein_id="ACR16872.1"
FT                   /translation="MTIPRDRTTLRRRLTSLFQDWRWDGTWSLRTIPTDGRAPLFGDDA
FT                   QCQRHRRVITDMITEGFPGTDVHFVNLESSAAEPDASDDPAAPACLITLMCHDLADKDE
FT                   RPLTQIFVYQLGVWRGFAIHHMWGDGPTMRDRLGSVYAYVGSLWPCGRFASVGHDQPEN
FT                   GKPTVAPRKLTRNDATFLMQFGAWVETLIRRPRATLRSVKDVLSAEKASSDNHANDQQA
FT                   MNRQPVDAGPAELLTTTLTYTWEGQEGEKPRAIPLAWDWWNELNNQLDEGDGYLDPNEF
FT                   WLIVGLRRNSKILAHRGGNLLVRSRITVGGSRDTDIAATKERLKSPFAVTRAALSAAPQ
FT                   LVKQLLQLPRTVSLPPMDIRSATSPSSITTMWTYNRLATDEPQEVAVGTQGLGTLLVGS
FT                   FEEGHTYRVIISGFVSQKVHRAGVEALDRVVKDAGYTRV"
FT   gene            complement(93957..95198)
FT                   /locus_tag="ckrop_0076"
FT   CDS_pept        complement(93957..95198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0076"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16873"
FT                   /db_xref="GOA:C4LG37"
FT                   /db_xref="UniProtKB/TrEMBL:C4LG37"
FT                   /protein_id="ACR16873.1"
FT                   /translation="MGNALTRLRQLYSRFGPALIGQALNFVAMVVPVVAKQPGMVAYML
FT                   FPVSLGMIVSRTMTLSYHSVYLRLPDDRLSFSTAASGFMAMVGTVMLGVVGVALMWLHP
FT                   AWSARVLWAMLATVAITVYNMYVAITIREDRMDVYSRVRFLYGVVNIVATCVVVFLVPV
FT                   REGLIYVAALNYVVGAVLLARATNQQVGAAIKREWSSLVAFPSVFASPLRSYIREHKEA
FT                   TTGTFFGDIGFQIQGMVTPVLGSYANAWAIVVRLYGGFLTLAQQVVSPSFEAPASKAIR
FT                   NNDPDGYRVQLRIATIVAVVLGVGTALVQYAAIVWNDRAYLGADYLPLFIALSLYATTG
FT                   MVSAMLSKYPVIVGKQRGYMVWSGARAVLFMLAPLVLHGGPVVYLFCAIMTVSIVAVPY
FT                   LCSPVSTQGRHAQV"
FT   gene            complement(95270..97447)
FT                   /locus_tag="ckrop_0077"
FT   CDS_pept        complement(95270..97447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0077"
FT                   /product="putative endopeptidase"
FT                   /function="Predicted metalloendopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16874"
FT                   /db_xref="GOA:C4LG38"
FT                   /db_xref="InterPro:IPR000718"
FT                   /db_xref="InterPro:IPR008753"
FT                   /db_xref="InterPro:IPR018497"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR042089"
FT                   /db_xref="UniProtKB/TrEMBL:C4LG38"
FT                   /protein_id="ACR16874.1"
FT                   /translation="MNNPEPTAPSGNASAQNEPSQNNHASETSIPDNISEVPASRPSPR
FT                   DDLYRYVSGPWLSHHPIPDDRPVDGTFHTLRDQAEEDVNAIIKDADPTTRIGAGFTSFM
FT                   DVDGDKSVNQAGFAPMKEDLTRINVDNLEDFARALGALDVVGISGLAGYYVAKASDSPV
FT                   DAAYLNQGGLSLPDEAYYREDAHRPIVDKLKEHIATMLTMARDATSGPEWQDSPLVPAE
FT                   FADESNEKLAEAIIDFETRLAKGHWNVEDTRDALKTYNPTPVDDLPTGFPWKTWLEATE
FT                   LSTDTIVVSEPSYLEHVATLAQETDLSVLKLWAGWQILTQRASLLAEDVSRESFNFYGR
FT                   VLSGSTEQRARWKRAVSFLDGSISDDIGREFVARHFPPEHKQKMLSLVDYLLKAYRQRI
FT                   SNLDWMTPDTRDRALEKLGTFRAKIAYPDQWKTYDNLEFSPHGEDLVANSRRAAAWRHR
FT                   YEIAKVGNPTDRSEWVAPAQMVNAFYNPVVNDITFPAAILRPPFFNPDADMAQNFGGIG
FT                   AVIGHEIGHGFDDQGSQFDGEGNLNSWWTSEDREAFEKLTGKLVDQFNPLIPKGLGQRG
FT                   LTAQHVNGRFTLGENIGDLGGLGIAVVAYRLYLEDQGLTPETSLEMPFLLTDGTALAPL
FT                   GKESDGDTGMNYDDAPTFTAMQRLFLAWANVWRTAIRPQLSAQYLAIDPHSPSEFRCNV
FT                   IARNINEFAEAFDVHPGDGMWLDPKDRVQIW"
FT   gene            97754..98590
FT                   /locus_tag="ckrop_0078"
FT   CDS_pept        97754..98590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0078"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16875"
FT                   /db_xref="GOA:C4LG39"
FT                   /db_xref="UniProtKB/TrEMBL:C4LG39"
FT                   /protein_id="ACR16875.1"
FT                   /translation="MARIHTTYRRGGEAPQEGQPPTSSSVAGVDGGVGEGQNPDTAGDL
FT                   DTARELDADASRYQPLPQGSKKTAIWAASLIIVGGLLAAPVIIDKGAPGDYPGDKHGGD
FT                   ITVGMKDSTNFTGPNLGECYDQSDDNPYGSTYKCGNVNIDTATMTGNDDVDHVFRRGIR
FT                   ATAHVKINGDLPTTEASNGEWDARVTALEPKESVTNPNAKKVVSAAFTKKDDKSTTIIA
FT                   TVSSADDEALANTMSKIVSARGLKTDAVRMALTKSATSDNDSRGESDEHLPHTGEA"
FT   gene            98590..99504
FT                   /locus_tag="ckrop_0079"
FT   CDS_pept        98590..99504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0079"
FT                   /product="putative membrane protein"
FT                   /function="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16876"
FT                   /db_xref="GOA:C4LG40"
FT                   /db_xref="InterPro:IPR026898"
FT                   /db_xref="UniProtKB/TrEMBL:C4LG40"
FT                   /protein_id="ACR16876.1"
FT                   /translation="MRKDVFTWTYIVLAVVCLVAGGLMSAMTLAETPDAVAVGVVGAVI
FT                   YLTVFFVIMRFLPIWRKGSLIWVIVSLYWGAFMVISTVMITELAFSDILKEAGLGRFEA
FT                   SATGAIPEELAKALGVFVILFMARRVWDRPWHGLLAGLSVGMGFEVMENFVYSGGGALY
FT                   NATSDVQGATEIWILRTGLGFGLHPMCAGLAGFGMASALMLTNKSMLWRLMVGIGSVLA
FT                   AIAFHGWWNFQWPSSLQLVAVIADWLVLFAVTIVILVKNWSKAKRDKKRPLPSHKEAWD
FT                   LIPVRDTPYPSVPDPSVPTSAAE"
FT   gene            99663..101087
FT                   /locus_tag="ckrop_0080"
FT   CDS_pept        99663..101087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0080"
FT                   /product="putative lysozyme precursor"
FT                   /function="Lyzozyme M1 (14-beta-N-acetylmuramidase)"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16877"
FT                   /db_xref="GOA:C4LG41"
FT                   /db_xref="InterPro:IPR002053"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018077"
FT                   /db_xref="UniProtKB/TrEMBL:C4LG41"
FT                   /protein_id="ACR16877.1"
FT                   /translation="MSDLRKPSVARSRTRFRRIIPGLNPFPKTMKHRRFAGAALMTGSL
FT                   LTTAALVSTATGFTPADALNGIDVSSNNHFGGQAIDWDSVANDNQSFAFIKATEGTSYT
FT                   NPYFASDSKKAKAAGLTIGSYHYARPGGDPRQEAQFYTKELASQPQPSLPPALDLEETG
FT                   GLSPSQLQKWVLDWVDEVEKQTGRTPIMYTYYSFWINNMGNTTEFSDMPLWLAYYEDSL
FT                   PSTIPGGWNHVTFWQHSGSGSVDGVNTEVDLNKYDGSDSELASLAKSMKEDTPVGGVAT
FT                   TVKPAVDADVASASVSNDIQHQLQTSSNPVLKTIGNSFNVPIPDSVLVATLGVAAGTVS
FT                   LSQLWDTIREEGFGGQLADQLVRAVSEVSQNGGLPKDKLQGLLGENAGTTLGQLEKALS
FT                   DAMVALGSGGAPDSDGSDANSSGSSGSADASGSAGTSSSGSTAGSSDTSGSASGSTGST
FT                   QLDQGQQVQSVPGSNS"
FT   gene            101134..102456
FT                   /gene="glrK"
FT                   /locus_tag="ckrop_0081"
FT   CDS_pept        101134..102456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glrK"
FT                   /locus_tag="ckrop_0081"
FT                   /product="Glycerate kinase"
FT                   /EC_number="2.7.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16878"
FT                   /db_xref="GOA:C4LG42"
FT                   /db_xref="InterPro:IPR004381"
FT                   /db_xref="InterPro:IPR036129"
FT                   /db_xref="UniProtKB/TrEMBL:C4LG42"
FT                   /protein_id="ACR16878.1"
FT                   /translation="MMRVLIAPDKFKGSLTAAEAAEAMERGVKRALPRAECTTIPVSDG
FT                   GEGLIEVALSTSRRGRVSGGDNAHAGHDGGSASYADYDADLRVTRVRGPLGDDHDARWV
FT                   LIKPAHSNGSHAGRIDEFTESSGSPDGNEGHDSIAVIEMAEASGLAWITPGPDASLRAD
FT                   SYGTGQLIRAAVDAGATTIICGIGGSACTDGGSGALRALGARILDGDGNDVAFGGKGLC
FT                   DASVIDTSNLIPDLRLRHSDSETHQVRIIIATDVSNPLLGDDGAAAVYAPQKGAGPEEI
FT                   DALEKGLSQWATCLSRFNADFDPANEGMGAAGGFASGLTALCSAVTVPGFDAVAQLNGF
FT                   DDALGAGADLLIVGEGSLDKQTLSGKVPVAAARRAEARGIPAVAVAGAVNVQKDELADA
FT                   GISDVIGLAEISDRAGDKDDTIQHAAEYVERATEKLVRRFQ"
FT   gene            complement(102504..106124)
FT                   /gene="embC"
FT                   /locus_tag="ckrop_0082"
FT   CDS_pept        complement(102504..106124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="embC"
FT                   /locus_tag="ckrop_0082"
FT                   /product="arabinosyl transferase C"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16879"
FT                   /db_xref="GOA:C4LG43"
FT                   /db_xref="InterPro:IPR007680"
FT                   /db_xref="InterPro:IPR027451"
FT                   /db_xref="InterPro:IPR032731"
FT                   /db_xref="InterPro:IPR040920"
FT                   /db_xref="InterPro:IPR042486"
FT                   /db_xref="UniProtKB/TrEMBL:C4LG43"
FT                   /protein_id="ACR16879.1"
FT                   /translation="MVSSQERDVDSQHVSRVKTDGNKGSSPASQQPDNEGSGGDSRIRR
FT                   TKIVAAVTGIAAFLLFILTPLLPVKQTQSSIDWPQNDNINSVVAPLISYSPESLDFTVP
FT                   LSLADNLNDNQTDLLSTLPHDSRFVASRGLIVRATDDGVDVINRSQVILQITNSTLDSL
FT                   PDDATLKVHSDATSTTVDVPGQTDKNGKKLSTTVDGDRRPQMTGVYTEVSSSAKNDAIN
FT                   AGFHAHATIDSRFTSRPTLVKYVVMIAGLVLALVSLAALCRLDKVGTHDRVPLLPKNWK
FT                   KFTPLDGIVSTVLIYWYFFGANTSDDGYLLTMARASKHSGYMANYYRWFGVPESPFGAP
FT                   YYDLLGLMARVGTTSTWMRLPEIIAAFLTWFLLSRCVIPRFGPEIASRKVPYWTAGFVF
FT                   LAVWMAYNNGLRPEPVIALGAILTWVLLERAICTDRLAPAALAVIVASISLAAGPTGLM
FT                   AVAALLAALSGIFRIVIHRLDALGTPKSSSKKAVVGGVTALLAPFLAVGTAILVAVFGD
FT                   QTLSTVMQSIKLRGFIGPSLHWYEESVRYEALFSATENGSFSRRFPIFMVILALGTVLA
FT                   AMLRHKTVLGARPGPAQRLVLVVIGTAFFMAFTPTKWTHHFGVYAGVGAAVAALASVAA
FT                   SQFAARSVRNRFLYLGITVFLGALALAGINGWWYVSSLGVPWYDKPISIKDTQVSTIVL
FT                   VIALLIMAWGVIQSFRLDIQETLAETNSESEALEKRERARAQRFAALTSSPIAVLCAVV
FT                   VVFNCAAMGKAFIKQYPAYSVGLGNIRTLAGKTCQMADYVEVEKHPSSNMLSTADGSKF
FT                   KDSLTADNNQNFGANNIPAAIYPDIDFNTVDTVDAAEKEKAENNKSRNSTNNSTDTDSS
FT                   DQSTNKSTNGSQTSGTSRGEAGAGDSEKANARGSSSSTTNTTSSAGTKGGTQHTRGIND
FT                   SAAALPFGLDPKKIPVVGSYSSGIQVPAETKTSWYKLDERTSPLIVVSAAGSIKHIDSN
FT                   GVVQPGLDLVLEYGHRDDSGKVTNTGELLPIDPGPAPMWRNLRFLTSDIPDDANVLRLH
FT                   AKDKELARRDWLAFTPPRMPQLETLNSYVGRKDPVFLEWETPLQFPCQRQYDHWAGVTE
FT                   LPKYRIAPSYDSQRANSGWMDYSGGGSLGLVETTTVPMALPTYFRDDWGRDWGELDLLL
FT                   PPANSKKKQIKPGHITEKTETRSGLWTPGPMNYKDQGSSA"
FT   gene            complement(106146..108287)
FT                   /locus_tag="ckrop_0083"
FT   CDS_pept        complement(106146..108287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0083"
FT                   /product="arabinofuranosyl transferase A"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16880"
FT                   /db_xref="GOA:C4LG44"
FT                   /db_xref="InterPro:IPR020959"
FT                   /db_xref="InterPro:IPR020963"
FT                   /db_xref="UniProtKB/TrEMBL:C4LG44"
FT                   /protein_id="ACR16880.1"
FT                   /translation="MAISPLSHRYAMIYPMASKKGSDTSHKDPASTPVADSTTTTHDAD
FT                   SVDNADAAASADPILPATNRTADHIGLSRTLINMALAVVGGAIMSLVFWRLMKTTHYPA
FT                   FSNSNVLKALSTLTSAILIVVVAALLIWWVHDEKQAGRGSVDTNNGAKNSSARNGADSP
FT                   AVRRPRWRVWLTYIITYMSPAGLVGTVLTIPLSATRLYLDGISVDQAFRTQFLTRMTAQ
FT                   FGLHDMAYPDIPTFYPAGWFITGGRFAHYTGLAGWAAFQPWAIITLSATACMLVPVWQR
FT                   ITGSLPLATTIALTTTAIMLSLSSFEPYAAIVGMGIPAAAVFAWRAINGARWSALATAL
FT                   FLGASATLYTLFTGVNALAIVVIGLVIAIRRKSFLPIIRLAGIGMGSLLIAATVWAPYI
FT                   KDLLTKPHGSTDTAQHYLPADGTQIPTPMFHMTILGFLCLVGVVWLIVRFTHPIAMPIA
FT                   IAVLTYYAWVLLSMAATLHGTTLLGFRMEPPITMLLATAGVLGLRDALAHGIPTIYPER
FT                   FATAAPTITLVIGVLVGIAATEFAATIPWSISHSINSAYSDTDGDGHRNDGVPADSGTY
FT                   YQKVADTIGREPTDTVLLADEQAFMAYRPYLDFQALTAHYANPLGEFVQRNAAIEKWSE
FT                   AETPEELNSAMDDMPWRKPDAILFRGSVDDDDWALNVADDVYPSDPNVHFRSIHFHPEA
FT                   FSDWTVTQVGPFIVAVRPQ"
FT   gene            complement(108317..110236)
FT                   /locus_tag="ckrop_0084"
FT   CDS_pept        complement(108317..110236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0084"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16881"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:C4LG45"
FT                   /protein_id="ACR16881.1"
FT                   /translation="MLERTLVFVDTSYLLASFYNSWEEGARTQLEIDLPEVCSVLDRMI
FT                   TQHVGQPVQRQNWYDGIPDSGPHRYQRALRTVDGVQLRAGLLIETGQRRTQKAVDTRLV
FT                   ADMILAAVRQQCSDMVLVSGDQDMIPGVVEASAMGVRVHLYGFSWDSMSNALRHKCDSI
FT                   TVLDPREDFADTMQIQPLEGPIPPSIPPRPLEAQDPIVDGHTAENETSGGATNGDASAG
FT                   DASGEATDGNGDSEAGTDVSDSGTSTSGTRTSSTAETHVNAGKPSGNGRSGYNGQLAKN
FT                   KGDEDHSSCPDSNHAHEANAHEADRHGKGGQPANTSDETWTSRRVRGNNAAADGEHGDH
FT                   STSAHESHSAESSPSRPTPADMMACARRSANAADRRSNGNGGPDASTTPSQTRAADADQ
FT                   AVPGQTEHSPSGGAPATRIPESSVGKQRTTQPAEAVGGALAANEGSTTEAADTPAPKDD
FT                   SKPEDPRSADRPATVATPGSVAARHQAAHLAASQQASDGSADATSGGDSGNGSNDDNAS
FT                   ETATPAPQSKPAPKPSMMAPRRKLRSRYVPLPNEIWTTTGFQTPFDVGQQYATWWFHHV
FT                   ATEEQRDSAHVLSGGGLPPNVDRPLLQFACESLHEYTLSESQRVSLRDGFHTGIRAILI
FT                   TGDD"
FT   gene            110484..111389
FT                   /locus_tag="ckrop_0085"
FT   CDS_pept        110484..111389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0085"
FT                   /product="ABC-type transport system, ATP-binding protein"
FT                   /function="ABC-type oligopeptide transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16882"
FT                   /db_xref="GOA:C4LG46"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4LG46"
FT                   /protein_id="ACR16882.1"
FT                   /translation="MEGMDLRSTDPTADARDGSAGEWREWDPADAPIAWMRKAMVAEAR
FT                   RVWSVPWEARRRKDASVLVRDCNLALHEGLIYSFVGDAAAGSAGSRTTAAPTATSSPTT
FT                   TSRPTTATPNVATPSPSASAASILHVLAGQEGISGGIISVFGEAPYDNARTMDSTVMAG
FT                   MSVRYPAQWRVDRVLRTAARRYPNWDDDYAEMVSRAFQLDLSTKVNHLSTQARTLLSAV
FT                   VAVAARAPLTLWDRPCEGLNPERRKLVMQTLVADCAAHPRTVVMNQADRRADNLVHASA
FT                   DRLLVVSGGTIVGDFPTDDA"
FT   gene            111400..112293
FT                   /locus_tag="ckrop_0086"
FT   CDS_pept        111400..112293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0086"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16883"
FT                   /db_xref="GOA:C4LG47"
FT                   /db_xref="UniProtKB/TrEMBL:C4LG47"
FT                   /protein_id="ACR16883.1"
FT                   /translation="MQVRDRLSLADVSTGTRWLVDLMVVLALWMDASQPVFGVATAMVW
FT                   CILTPYGNPRLLAYRAFGLTISRYVRDYVLVAAVRSVALVAVGCLIGVLVRRGVAGWSL
FT                   PPFLGSSQAESVTPFIVYLLVVAFAGVVLGLGFNAFAGSRTMSMRQYPGLGGEQKLDGD
FT                   RYAESRFVGEGAGLSDLTVELWGGRSSAETPRTEEEQHNLTWHFLPTRETCWGVFAVAL
FT                   LLCGISFATGSMIVVVVGLLVTCVLVGLVLVAIARNAISFGVPRAIMWRKNSVLALGQA
FT                   VWIAVLFIITAVSIAS"
FT   gene            complement(112351..112599)
FT                   /locus_tag="ckrop_0087"
FT   CDS_pept        complement(112351..112599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0087"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16884"
FT                   /db_xref="UniProtKB/TrEMBL:C4LG48"
FT                   /protein_id="ACR16884.1"
FT                   /translation="MKESPPQPPTQPTTKQLTFQLPGGCLGDDKEHYTPHPHTTNPQHN
FT                   TTKHTNRKQKKGPHTRSLSVRSIVGNETVSPRVKAVS"
FT   gene            112976..114476
FT                   /locus_tag="ckrop_r01"
FT   rRNA            112976..114476
FT                   /locus_tag="ckrop_r01"
FT                   /product="16S ribosomal RNA"
FT   gene            114890..117984
FT                   /locus_tag="ckrop_r02"
FT   rRNA            114890..117984
FT                   /locus_tag="ckrop_r02"
FT                   /product="23S ribosomal RNA"
FT   gene            118068..118187
FT                   /locus_tag="ckrop_r03"
FT   rRNA            118068..118187
FT                   /locus_tag="ckrop_r03"
FT                   /product="5S ribosomal RNA"
FT   gene            118350..118778
FT                   /locus_tag="ckrop_0088"
FT   CDS_pept        118350..118778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0088"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16885"
FT                   /db_xref="GOA:C4LG49"
FT                   /db_xref="InterPro:IPR021299"
FT                   /db_xref="UniProtKB/TrEMBL:C4LG49"
FT                   /protein_id="ACR16885.1"
FT                   /translation="MRKLYIAATVWLAIGLIAGVFYREFTRAHDFEGATQLSVVHTHSL
FT                   ILGMTMNLLFLVFALLLRIDKDRRFTAFFWVYNAGAAWTVGFLAFHGICQVLGQDFPES
FT                   LAIVAGMGHIIITVGFVLFFVILNKYLKRWQKKNNVSQ"
FT   gene            119071..120702
FT                   /locus_tag="ckrop_0089"
FT   CDS_pept        119071..120702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0089"
FT                   /product="ABC-type transport system, substrate-binding
FT                   protein"
FT                   /function="ABC-type oligopeptide transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16886"
FT                   /db_xref="GOA:C4LG50"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C4LG50"
FT                   /protein_id="ACR16886.1"
FT                   /translation="MRLRSVAAAIATLALSATGLVACGDGGGATLDGAGDPNIVRTAAS
FT                   EPQNGLIPTDTNESNGSQVLELLYRGLVSYGENGKSHNQVADSITANPDNTEFTVRLKD
FT                   GWTFTDGTPVTADSFIDAWNYGAAGKNAQKQQDFFSNIKGFDEVKDPSSSVEKLSGVQK
FT                   VNDKEFTITLSDPDSQFPISLGATPFFPLPQSFFDDPKSFGEHPVGNGPYKLDGQNAWT
FT                   HNSSIRTVANDKYAGDDKPKNGGVTFKLYENLDTAYTDLQASNLDIIGLTVPPTAMQTF
FT                   KDDFPSTHLIKSIASNGGFVIPQWLDHFGNDEEGHLRRQAISMAINRKQISDKIMNGTR
FT                   VPAKDFTATTLGDVPNVEGNEALDYNPDKAKELWKKADEIKPYSGKLEIAYNSDGGHKE
FT                   WVEAVSNSIHNVLGIDAAGKAYPNFKALRNEVSSGSIHTAFRSGWQADFPSQANFLQPQ
FT                   FATNGASNDGKYTNTEFDNLLKDASKESNPKKAQEIYAKAQAILMRELPEIPLFYYTAS
FT                   AAWTTSLSNVNYDWKGVPIFTDITKS"
FT   gene            120739..121665
FT                   /locus_tag="ckrop_0090"
FT   CDS_pept        120739..121665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0090"
FT                   /product="ABC-type transport system, permease protein"
FT                   /function="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16887"
FT                   /db_xref="GOA:C4LG51"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C4LG51"
FT                   /protein_id="ACR16887.1"
FT                   /translation="MFWYIGKRLLQMVPVFLGATFLIYAMVFLTPGDPVAALAGDKPLS
FT                   PEIIHSIRSQYHLDQPFIVQYLLYLKGIFTGDLGQTFSGQSVGTVLGNAFPVTIRLALM
FT                   AIVIETVFGIGFGVLAGLKKGGLFDSTVLVISLFIIAVPIFVIGFVAQFLFGIKWGILP
FT                   ATVGAQGDFKHLLMPAFVLGLVSFAYVLRLTRSEVAEALGRDFVRTAYARGMSKPQVIL
FT                   HHVLRNSMIPVVTFIGADLAALMGGAIVTEGIFNINGVGGLVYHAVMLGEAPTVVSVVT
FT                   VLVIIFVVSNLLIDLLYALLDPRIRYA"
FT   gene            121658..122743
FT                   /locus_tag="ckrop_0091"
FT   CDS_pept        121658..122743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0091"
FT                   /product="ABC-type transport system, permease protein"
FT                   /function="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16888"
FT                   /db_xref="GOA:C4LG52"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C4LG52"
FT                   /protein_id="ACR16888.1"
FT                   /translation="MPNPSHTPAHRSSAGKTSRKLPTSHGADSLAAETPSPTVGRHEGH
FT                   GAGLVTSSRTERWVAETVAADEPSRDDLLADKKPLSTWAEAWQRLRRRPLFWVSMVIIL
FT                   AVLLVTFFPGLFTSTDPKTADLSKSLEGPEASHPFGFTRQGYDVYSRTLYGARASVVTG
FT                   VSVTVVITILGTIIGSVAGYVGGWLDAVLSRLTDIFFAIPLILAGIVLMQLFSERNTLT
FT                   VILVLSAFGWPQMARIVRGAVMTVKNNDYVMASRALGLSQWKILLRHIIPNCLAPIIVM
FT                   ATTSLGIYIVAEATLSYLGIGLPPQTVSWGNDISTAQNTLRAAPSTLFYPAGALAITVL
FT                   GFIMLGDALKDALDPKERTAS"
FT   gene            122740..124578
FT                   /locus_tag="ckrop_0092"
FT   CDS_pept        122740..124578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0092"
FT                   /product="ABC-type transport system, ATP-binding protein"
FT                   /function="ABC-type uncharacterized transport system,
FT                   duplicated ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16889"
FT                   /db_xref="GOA:C4LG53"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4LG53"
FT                   /protein_id="ACR16889.1"
FT                   /translation="MTSIPYSAPRHSAEAQSVETQSTTARSVKAESTNKPKHSVGTQNS
FT                   SDDASPLLQMRDVDIAFGGKKRPIPTVFGVNLDIYPGETVAIVGESGSGKSTTAHSIIG
FT                   LLPGGGHVTGGTITFDGRDITHASPKELTALRGADIGLVPQDPMSNLNPVWKVGFQVKE
FT                   ALKANNVATGSAAHKRAVELLSEAGLPDADKRVNQYPHEYSGGMRQRALIAIGLAARPK
FT                   LLIADEPTSALDVTVQRHILDHLDSLTHELGTAVMLITHDLGLAAERADRIVVMSQGRV
FT                   VESGPAQEILQDPRHPYTQKLVGAAPSLRARRHDVIEQREKVAHEAEERALERTTGPHA
FT                   AQDGDVEHIIEVHDLGKDFPIPGGPPWKKSMFTAAADVNFYIRRGTTTALVGESGSGKS
FT                   TVAKMILGLLQPTRGSVTFNGRDVTALNRKQELAFRRRVQPIFQNPFGSIDPMYSVFNT
FT                   IAEPLKIHNIGNRASREKKVRELLDRVAMPAAMMHRFPSELSGGQRQRVAIARALALDP
FT                   DVVICDEAVSALDVLVQSQILNLLNELQAEMGLSYLFITHDLAVVKQIADDVLVMRQGR
FT                   LVERGTTDELFDHPREEYTRSLIDSIPGGSIDLGGA"
FT   gene            complement(125608..128226)
FT                   /locus_tag="ckrop_0093"
FT   CDS_pept        complement(125608..128226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0093"
FT                   /product="ABC-type transport system, permease protein"
FT                   /function="ABC-type antimicrobial peptide transport system
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16890"
FT                   /db_xref="GOA:C4LG54"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:C4LG54"
FT                   /protein_id="ACR16890.1"
FT                   /translation="MNASATPNNQLRHHPMWTLSFRNLRAHKVRLALTVLAVILGTAFV
FT                   SGSFIFTATLNKAFTEIVTTMYDGVDIAVKPGHATDFAHQRDTINNIPGVRATNEMTDM
FT                   NVAVAHDDGTMIDTGGATAQILPNYPDDEQANTAWSITQGHAPTKSGEATLNSNAAKKN
FT                   NISLGDHLIVATPTMRTDVTIVGFYTTSTNFGGWAGVAMNPDQFRELAGTSISSYNVAI
FT                   QPGADKQKVMAAISRAVPGSTVQTGENASKEMTSSISNQLTFINYFLLAFGAIGLIVGT
FT                   FIIANTFSMIVAQRIREFSLLRSLGASRGQITRSVLIEALIVGIVGSLIGIAAGFGLVH
FT                   LLVSGLSKTGLDMPDSSIPLTWQSMAWPLVIGIIVTLVSAWAPAWRAGSTRPVESMNAT
FT                   TQSAPLLRRTLIGLIVLGGGAALAWWGSYADDFATRNRMIILGIGAVAIIVGTLAVSAA
FT                   LSLPLVSGIGRVLGLPWRSVGKLAATNSSKNPRRTATTAFALTLGLALVSSVGMIGASM
FT                   KSTVSDLVDNELTAALVATPPGATTGSMFSLPGGVNKDIASVDGVTGVAPFYTLANATL
FT                   RGDDKNRGYVIFTPDNPHGYIDLKMKEGSEDLSRGGTIIHASFAKKHNLHVGDTVDIDA
FT                   LTAASPGSAGVLISQGGAPADAHATSTVIGIMDSKLFPTALVSQQDIDKISPDKHTWRS
FT                   LMTTIRTDHTVDDVTMQKRIKEKVKHYVIVQVQTRDEFKGQQAQLVNQLLSILYGLLAL
FT                   SVVIAIVGIINTLALSIVERRQEIGMLRAVGMVRGQVRRMITLESIQLSLYGAIIGVII
FT                   GLYIGWMFMNVMKTQGITQIVIPWEQIIAMLIASAFVGIIAAVWPGIRASRISPLDAIA
FT                   D"
FT   gene            complement(128223..128990)
FT                   /locus_tag="ckrop_0094"
FT   CDS_pept        complement(128223..128990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0094"
FT                   /product="ABC-type transport system, ATP-binding protein"
FT                   /function="ABC-type antimicrobial peptide transport system
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16891"
FT                   /db_xref="GOA:C4LG55"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4LG55"
FT                   /protein_id="ACR16891.1"
FT                   /translation="MSSTPADANAPIARADAISKYYGKGDTRVTALDSVSVEFRTREFT
FT                   AIMGPSGSGKSTLMHCMAGLDSVSEGSTFVGDTDLSTLNDKQLTRLRRDRIGFVFQSFN
FT                   LVPTLTASENITLPMDIGGHRVDKEWFTHIVTSFGLTKRLDHRPSELSGGQQQRVACAR
FT                   ALIGRPDIIFGDEPTGNLDSNSSTEVLTTLRSVVDDYNQTVVTVTHDPRAASYADRVIF
FT                   LTDGHIVDELTDPTTEAILSTMATIDNPDNQAS"
FT   gene            complement(128999..131293)
FT                   /locus_tag="ckrop_0095"
FT   CDS_pept        complement(128999..131293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0095"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16892"
FT                   /db_xref="GOA:C4LG56"
FT                   /db_xref="UniProtKB/TrEMBL:C4LG56"
FT                   /protein_id="ACR16892.1"
FT                   /translation="MATRDPEQHSSDAKTAGYEGKKTPVTDSAAQSAGARVSFITSWLS
FT                   ALALAVIFAIGGWQRRWISDDGLIVLRTVRNLLAGNGPVFNAGERVEANTSVVWQYIIY
FT                   AIAAVSSARLETIAIYTGLVFSVLAVAIAALGSAALHRSPAALFVPCGLLLYICLPPAR
FT                   DFATSGLEWGLSIFWIAVLWFLMAYWNNARDEATPARTPGGHSRLRLPRSSYALAFWTG
FT                   LSWLVRPELALYGAATIVVLLIIHRRWTLLAWAVPLPLLYEIFRAGYYGLLVPNTAVAK
FT                   SASGSDWKQGWRYVVDFANPYWLWLIIPIAIIIGIAVFRADGRRTPLPVIIMVSCGILH
FT                   VLYVIRIGGDFMHGRMWLLPLFALAMPIAVVPIRFARASSTQAQLPTVDGHTWQKRHEH
FT                   SRATQQPLAASAIIIIAGCASVGIWGIIRLCAGHPFTQPTTVADFKHLDIVDEREFWTT
FT                   FTGHSAHDPLTKAEDFLAAPTMINYTGSLEGTIPHVDSSSHSGTPDKDLTTDGPRVQPF
FT                   ASVPTKPYKDIRFVWTPVPNFTSPEEKEALAKLGKKSSTVDDATSHYDDVLRTASGLDN
FT                   TPVTVSYINLGMTSMNAPLDVRVVDPMGLANPLAARQSRQSNARIGHDKSLPLYWQLAD
FT                   SATPVADTPFWDSEKKVHAARIALHDSDFVALFEAYRSPMSPSRFLKNIGFALTKGNSL
FT                   AFSSKPSDYTTKTTTDDTQPNSVPVIQWGHKTKLDSDKRLPRSLQPGYTAPKTTVFPDA
FT                   ETTEENHTIYP"
FT   gene            complement(131346..132440)
FT                   /locus_tag="ckrop_0096"
FT   CDS_pept        complement(131346..132440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0096"
FT                   /product="putative pseudouridylate synthase"
FT                   /function="Pseudouridylate synthases 23S RNA-specific"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16893"
FT                   /db_xref="GOA:C4LG57"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:C4LG57"
FT                   /protein_id="ACR16893.1"
FT                   /translation="MLVCMVRALGIRDGLNPSHARVPAGAAPITADDFLEHLISSQRHR
FT                   HPSDTAAARAERFTAGLVRDGRGRVLNPTDLLQPHDEMWFYRIPAYETPVPGHCTPVFS
FT                   SPGILVVDKPPFLATMPRGRHITETATVRLRRATGNDNLVPAHRLDRPTSGLLLFTTHP
FT                   RYRGPYQTLFARRQVRKTYQAIAPYHPVLAESTDRAEIEHVAIDSGTISLEDDGIHVHQ
FT                   RMEKTHGFIQARLEPGKPNAETVISSIRMLTDDDERALREGYHNWFGDPLCDTRYALYT
FT                   MHPLSGKTHQLRMCLNSLGVPIVGDQVYPRILPEAIDAHQHVDEAWHQPLCLRSTQLSW
FT                   TDPNLHRPITVTAPDLTHTLGLSG"
FT   gene            132613..133773
FT                   /locus_tag="ckrop_0097"
FT   CDS_pept        132613..133773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0097"
FT                   /product="putative monooxygenase"
FT                   /function="Coenzyme F420-dependent N5N10-methylene
FT                   tetrahydromethanopterin reductase and related flavin-
FT                   dependent oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16894"
FT                   /db_xref="GOA:C4LG58"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019949"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C4LG58"
FT                   /protein_id="ACR16894.1"
FT                   /translation="MVNPDNPSSDQVTAGHVPSDQPSDASTNDLRNIELGLLDLVPVSE
FT                   GMTMSDALHATIRSAQAAERAGYDRFWLAEHHNSKSLASSATTIMIGQVGAATHSISVG
FT                   AGGVMLPNHAPLHVAEEFGTLDALYPGRIELGLGRAPGTDPMTAQALRRGKSDVRDFEH
FT                   DLAELRRYMGPMAHRVNAFPGLRSHVPFFMLGSSENGAMIAARAGLPFVFASHFAPFRL
FT                   STALKTYRNNFVAGAYGDTVDGDTVDGDTSDGGVGSSAARSSAVSGSSLSTPHVTVGIN
FT                   VMVAETEEKARHLFTTHEQSFYGIVTGTRGLFRPPKDVRDGNVMAWQQVDAALQVNAVG
FT                   TPDQVRDKIARIVQATGAQGVIASIYAFDVEDRLRAIEMLGEALRS"
FT   gene            134015..134914
FT                   /gene="uspA1"
FT                   /locus_tag="ckrop_0098"
FT   CDS_pept        134015..134914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uspA1"
FT                   /locus_tag="ckrop_0098"
FT                   /product="universal stress protein"
FT                   /function="Universal stress protein UspA and related
FT                   nucleotide-binding proteins"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16895"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:C4LG59"
FT                   /protein_id="ACR16895.1"
FT                   /translation="MVKQNVIVVAVDGSAASQTATRWAANTALKRKEPIRLVSTYSMPQ
FT                   FLYAEGMVPPQELYDDLEAEAMEKIDTARKIIADFDESIEVSYQVEEGNPIDMLLDISQ
FT                   DVTMIVMGSRGLGGFSGMVMGSVSAAVVSHAKCPVVVVREESDVSTATKYGPVVVGVDG
FT                   TGVAEKAIEMAFAEASARKAPLRAVHTWIDMQVQASLAGLNAAQKQWEEIEEDQKRLLA
FT                   ERISGYKDKYPDVEVEQIITRDRPVRALADASEDAQLLVVGSHGRGGFRGMLLGSTSRA
FT                   LLQEAPCPLMVVRPESKV"
FT   gene            135095..135715
FT                   /gene="mcbR"
FT                   /locus_tag="ckrop_0099"
FT   CDS_pept        135095..135715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcbR"
FT                   /locus_tag="ckrop_0099"
FT                   /product="transcriptional regulator, TetR family"
FT                   /function="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16896"
FT                   /db_xref="GOA:C4LG60"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C4LG60"
FT                   /protein_id="ACR16896.1"
FT                   /translation="MPAAKTTTRRRRDRPSPRQRLLKAATRLFTTEGIRVIGIDRILRE
FT                   ADVAKASLYSLFGSKDNLVIACLEQLDEQWRSSWHELADQREKPQDKILAFFDICISEE
FT                   PGKNYRGSHFQNAASEYPRPENDGERGIRQAALEHRRWCRDTMAELLTKKYGYASRTIA
FT                   EQIMVFLDGGLAGAKMSRDVVPLQIARELARQLLSAPPGNYVI"
FT   gene            complement(135755..135907)
FT                   /locus_tag="ckrop_0100"
FT   CDS_pept        complement(135755..135907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16897"
FT                   /db_xref="GOA:C4LG61"
FT                   /db_xref="UniProtKB/TrEMBL:C4LG61"
FT                   /protein_id="ACR16897.1"
FT                   /translation="MYAWIWRHLPGPTWFRVVEALVLIAAVVLILMQFVFPVISDWMPY
FT                   NDVRV"
FT   gene            complement(135920..136885)
FT                   /locus_tag="ckrop_0101"
FT   CDS_pept        complement(135920..136885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0101"
FT                   /product="putative sortase-like protein"
FT                   /function="Sortase (surface protein transpeptidase)"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16898"
FT                   /db_xref="GOA:C4LG62"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042003"
FT                   /db_xref="UniProtKB/TrEMBL:C4LG62"
FT                   /protein_id="ACR16898.1"
FT                   /translation="MVRHSKETVTSPVSPGELAAQQSEQADTGDTHSSTSATQASADTA
FT                   PSLDNATTSSGGSVSAGAGRRQTSTASKILGVSGELILTIGIAIMLFVIYEAYWTNIQS
FT                   DHEQSQAKSQLDDKWANARNTLNADEGEAMGKLRIPTFGSDWNYAIIQGTSASDLSRGP
FT                   GHYTRTQNPGDKGNFALAGHRVSRGAPFNDLGYLKTCDSIVIETRESWYVYRVLPIDEK
FT                   GADRETALAHCTSPAVAKQATTGDYASVRGLYITTPSNISTIAPVPGKEDSTPESAGLS
FT                   MITLTTCHPQFSNAERMVIHAVLDRVETKDGNKTPAELES"
FT   gene            137103..138446
FT                   /locus_tag="ckrop_0102"
FT   CDS_pept        137103..138446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0102"
FT                   /product="putative membrane protein"
FT                   /function="Preprotein translocase subunit YidC"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16899"
FT                   /db_xref="GOA:C4LG63"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="UniProtKB/TrEMBL:C4LG63"
FT                   /protein_id="ACR16899.1"
FT                   /translation="MIYSLFAYPVSGVIKLWHVLLTALGADPISSWIASLFLLVMTVRL
FT                   ILLPFAYAQYKSTRIQVNLRPVINQIREEYKDKPGTAARKERIAKEQKARKDAGYRLSA
FT                   GCLPVFIQLPFFLGLYRVLIHMARPKGGLGTTEHQPIGFLTSQDVGQFLQAKAFGVPLP
FT                   AYAAMASERLQAMGTDKSTIYTLAVPLVLIASTFTTINMSYSTYRSYRQLEHDNPIAVR
FT                   MQKIIIPMAIMGSASPLLFGLTSPVPVAILFYWVGNNLWTMSQNILLYRTIDKKYPYTQ
FT                   EFREHFARTKAEHDEKKHAKKEKKRTLKRNKWRRRGRGLIRPWRIPALWLEGHREKKAY
FT                   KQEKKQAKLDKKREKQEKRAADREADRQARQAAAAAAARANRPQIKAIETGRHALKETL
FT                   ETPELDEKRKKIVAAQTHGAMVPQQIAHTAKKPKKRRGPSYSGWGPRE"
FT   gene            complement(138486..139142)
FT                   /locus_tag="ckrop_0103"
FT   CDS_pept        complement(138486..139142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0103"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16900"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="InterPro:IPR018567"
FT                   /db_xref="UniProtKB/TrEMBL:C4LG64"
FT                   /protein_id="ACR16900.1"
FT                   /translation="MKRHLTRHKSSRVAFSTVLAAITALSLAACSSDGSSGSDSDGSTA
FT                   SSQAVSAEVAADGLPIDARPSSDASDSTPCPYLANQDMADLNGQRVTGVSVDKRFNPPA
FT                   CQWLSYGNTPQAQTIIRTAKNEQAAIDMISAAITHPGTTDDGATITKNADNSVSGGDVE
FT                   HTNQPTGWEGYRAQAENSAVYAIRKGPVVVIVHSDQTQTVKTQKIAETVIEHLQL"
FT   gene            complement(139288..139656)
FT                   /locus_tag="ckrop_0104"
FT   CDS_pept        complement(139288..139656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0104"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16901"
FT                   /db_xref="InterPro:IPR024412"
FT                   /db_xref="InterPro:IPR042254"
FT                   /db_xref="InterPro:IPR042261"
FT                   /db_xref="UniProtKB/TrEMBL:C4LG65"
FT                   /protein_id="ACR16901.1"
FT                   /translation="MARRYVPQIFDDLDGTELTESDATEIHFSVDGTAYMLEVSEDNAR
FT                   KFHEALEPFISSATKESGRGRRRSSYRNNVSSEATKARNRAIRKWANENGYHVAPRGQI
FT                   KKEIIEAYDRAHPVNKDS"
FT   gene            complement(140176..140802)
FT                   /locus_tag="ckrop_0105"
FT   CDS_pept        complement(140176..140802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0105"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16902"
FT                   /db_xref="UniProtKB/TrEMBL:C4LG66"
FT                   /protein_id="ACR16902.1"
FT                   /translation="MGLLKRARQKRRDRKLAEKIAKRQAKSRAKDEKKLNAKKEKYLNK
FT                   TAKKVMKQDAKDRKDQRKHEKDLAQAAVQQIRERSFSPAKAAKWAGALRVAAPVVIPLI
FT                   YRAVNGIEGRSVANKAKKLGLSAQDLSRFRGDGAPLKARVENVRVQAKDAPSGFARDVN
FT                   KRLDLLLNNIESAEKMPKQQRNRALSKASAELDAMQSEIHHKISH"
FT   gene            141000..142970
FT                   /locus_tag="ckrop_0106"
FT   CDS_pept        141000..142970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0106"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16903"
FT                   /db_xref="InterPro:IPR038720"
FT                   /db_xref="UniProtKB/TrEMBL:C4LG67"
FT                   /protein_id="ACR16903.1"
FT                   /translation="MNLMTAPRPHPTDTPVEATELSGCRYRIRQRRTFDREGHPRPPRE
FT                   AARARQARSELERTLVFGQLSDDGATVPGVGNKKSLTMTIADCVQEAGSTTDAGSATAA
FT                   ETQADRDHAGTQPTSQDREEMWDAQECATLEALAEGVRVIINPRLTARISMAELQSARP
FT                   SVDVANPWWLADPTDPALNPTDDIIIRTAPDLLVRVDSSALPHEARYMPVTVSTHQGIV
FT                   PDPTRRIMSVSLPRLGTSAPLWRSGRAKTHSGDIHPLVAAHYALRDVGLSSDLIGIVGQ
FT                   GAHDVAVWPVGTMTDGFVDAVRVPISTQPRKIKACSTCRFERDCHAELKQMDDISLVLH
FT                   GARADKYRLAGISTVHQLADADCGDASIMAYAYTQGWTAVHRPDKVRQRRNRSRENTAD
FT                   ENTARVNGVRTGLARGDADVVRRADVEIDVDMEAYLERGCYLWGTWDGSTYRPFVTWQH
FT                   LNSDAEARNFAMFWAWLMDQRDRAHARGQSFAAYCYGAQGENMWLKRSAQRFGGLTFST
FT                   AASEASEPAPAPAATVTVPTVAEVNQFIRSPEWVDVYAAVKSELVGPAGLGLKTVAPLA
FT                   GFHWEDADMDGEASLSVFMQSKGVDPLAPIPTGVTSKHDARALLLRYNRDDCRATAVVR
FT                   NWLTAGAPGAHTMPAPHAALN"
FT   gene            complement(142963..145872)
FT                   /locus_tag="ckrop_0107"
FT   CDS_pept        complement(142963..145872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0107"
FT                   /product="putative membrane protein"
FT                   /function="Putative multicopper oxidases"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16904"
FT                   /db_xref="GOA:C4LG68"
FT                   /db_xref="InterPro:IPR001287"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="UniProtKB/TrEMBL:C4LG68"
FT                   /protein_id="ACR16904.1"
FT                   /translation="MSSRDESLPVSPDSSARSSHSTDDNSAGQTSPGRSHGPTSGRPRE
FT                   SSSSKTSAKSWHRRASRPVSLWLAAIIVLALAHPFVPNNRWMMVHFFTLGALMNSIMVW
FT                   SQHFTEKFLHQRLPDSSRPRQVALIYALNVGVILCVIGQAFNDAARGAQGWAWIVVTVG
FT                   AVIVGVAVAIHAISLISQWVKARRGAAKSGSELGDYAAIVMFYIAASLILPIGAGLGAT
FT                   LAHPLPGTWHDRLIVMHMAVNVLGFVGLTAAGTLTILFPAIWRARVSAFRPVPTLAAML
FT                   AGILVLSIGTISGRFELVGIGMVVYGAGWILCARPWAGIVRNSRRVSHEPPAIFARSSV
FT                   AFAVVWVIGTMLVAGISQILNPDEIISTPTVPLVVGFGAQLLIGVMCYLLPSTMGGGGK
FT                   AVSQGLATLDFMGPARTTMVNVGLILWVLPVGGWLHIVGSFAAGIGLAMFVPLAAVSAK
FT                   NQVKAIRAQAAARRKKADESATSSASPADEAGANAARAIPPNPPHSRSPLAQVAATMSA
FT                   IALIACATLAITGTGSGSSDNSDGSTVAATGHTTSVTVTAKGMSFSPNSIDVPAGDRLK
FT                   VTLKNDGDQVHDLKLADGIETGKVDPGESKTFTSGVITKKTKGWCTIPGHQMRGMELTV
FT                   NTKGGSNGSAGANSTDSDSSGDAASDKDDVHASGHSMASTNTDSPLKPEVIRDPSVDPA
FT                   PEGTTHNIDLTVSQVNRTIREDGTKRASWTFNGAPMGPVLRGHVGDEFVVHLKNDGSIS
FT                   HSIDFHAGMVSPDQPMRSIKPGESLEYRFRAEHAGIWLYHCGTAPISMHIAAGMFGAVI
FT                   IDPPDLDPVDHEYIMVQSELYGLGKDKDNPVDSALLHSEQPSKVVFNGLENQYVQKPLE
FT                   LKHGERARFWLLNAGPNISESFHIVGTQFDTSYKEGSYTLRHGRDAFGVDDGGSQALDL
FT                   LAAQGGFVEADFPEAGTYTMVNHQFADAERGAMGKIKVS"
FT   gene            145988..146650
FT                   /locus_tag="ckrop_0108"
FT   CDS_pept        145988..146650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0108"
FT                   /product="Peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16905"
FT                   /db_xref="GOA:C4LG69"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4LG69"
FT                   /protein_id="ACR16905.1"
FT                   /translation="MGFLFGTRPTPTSIVNREDALPGRDEPILPHPAPHTVLGTPIDGP
FT                   WKDGQRSVVVGLGCFWGAEKLFWQIDGVESTAVGYAGGYTPNPTYREVCTGRTGHAETV
FT                   RVIYDPQEVSFEDLIRTFFEAHDPTQGFRQGNDVGTQYRSVIYAQTDDEVQKAREIAES
FT                   FSHSLADAGYGGITTDISLLSDTPTKTMYLAEDEHQQYLDKNPNGYCPVHSTGVACR"
FT   gene            complement(146627..147862)
FT                   /locus_tag="ckrop_0109"
FT   CDS_pept        complement(146627..147862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0109"
FT                   /product="permease of the major facilitator superfamily"
FT                   /function="Permeases of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16906"
FT                   /db_xref="GOA:C4LG70"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4LG70"
FT                   /protein_id="ACR16906.1"
FT                   /translation="MATQGLPDGYTPQSPMYRKVILAMVGAGLASFNALYCTQALLPVL
FT                   SEDLHVTPATASLTVSATTGMLALSIIPASIISERFGRKRVIMLSALSATLLGLLLPLS
FT                   TSVGMLIILRGLQGIAVAGVPATAMAYLSEEIHPKHVPQVMGLYVAGTSVGGLSGRVIP
FT                   SGVLEFASWRWALAATVAVAIIFAFITSWALPDQQRFQPKRLTFRSEFSAIAQHVKNPR
FT                   LSALFTLAFLFMGAFVSLYDYVGYRLTGHFGLSEGVAGAIFFLYLSGTWSATQAGTMVH
FT                   KFGRAHVLVGSIVGMMIGMAVLFSPELISSILGILLFTACFFAAHSVASGWVGVVATTN
FT                   RAEASSMYLFCYYMGSSIVGWLSGHVLHSWEWGGLVVWLLTGLAIATVIALFIARTTPS
FT                   TRATPSPAGDSR"
FT   gene            complement(148025..148630)
FT                   /locus_tag="ckrop_0110"
FT   CDS_pept        complement(148025..148630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0110"
FT                   /product="Superoxide dismutase"
FT                   /EC_number="1.15.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16907"
FT                   /db_xref="GOA:C4LG71"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:C4LG71"
FT                   /protein_id="ACR16907.1"
FT                   /translation="MAVYELPDLPYDYDALEPHISGEIMQLHHDKHHATYVAGANTALE
FT                   KLEKAREEGADANEIRALSKNLAFNLGGHTNHSIFWKNLSPNGGGEPTGELAEAINRDF
FT                   GSFEKFKDHFSAAATGLQGSGWAVLGYDHIAGRLIIEQLTDQQGNVSVDFTPLLMLDMW
FT                   EHAFYLQYKNVKADYVKAVWNVFNWEDVAERYARAKSK"
FT   gene            149117..150103
FT                   /gene="ldh"
FT                   /locus_tag="ckrop_0111"
FT   CDS_pept        149117..150103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ldh"
FT                   /locus_tag="ckrop_0111"
FT                   /product="L-lactate dehydrogenase"
FT                   /function="Malate/lactate dehydrogenases"
FT                   /EC_number="1.1.1.27"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16908"
FT                   /db_xref="GOA:C4LG72"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011304"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR018177"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4LG72"
FT                   /protein_id="ACR16908.1"
FT                   /translation="MADQEHRRLGNKIVLIGAGDVGIAYAFALINQGVCDELAIIDIDE
FT                   KKTAGNVMDLNHGVVWASSPTNVKVGTYDDCEDAAMVIVCAGAAQKPGETRLQLVDKNI
FT                   KILNSIIGDVMKHNFDGIFLIASNPVDILTYATWKISGLPKERVIGSGTVLDSARFRSM
FT                   LGDMYDVAPSSIHAYIIGEHGDSELPVLSSSTVGGVSMRKKLEKDPELHGRLEKVFEET
FT                   RDAAYTIIDAKGSTSFGIGMGLARITRAVLQNQNVVLPVSAYLQGEYGEDDIYIGTPAL
FT                   VNRGGIHRVVELELDDHEAEQMKASAAQLREIKDRFYGPNADQEATK"
FT   gene            150146..152185
FT                   /locus_tag="ckrop_0112"
FT   CDS_pept        150146..152185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0112"
FT                   /product="putative pyruvate kinase-like protein"
FT                   /function="Pyruvate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16909"
FT                   /db_xref="GOA:C4LG73"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C4LG73"
FT                   /protein_id="ACR16909.1"
FT                   /translation="MEQNGHNGELNDASTSGASSSKATTTNSATTSLNELIRGVDSLLT
FT                   MLSEVDQDKRDRIDAADAEHREGVRNVQHFARLQADDARHIVAQLRAVGIRVSDQAPVA
FT                   DQLRAAKTLLQNLGGQSSADRAAEGESYDIARLAAAIERSQEQLASNSSALLGEPRDGM
FT                   PSCVMVTLPTEAADDPDLVQSFADAGMDIARINCAHDTPEAWRAMAANVRAASARVGRD
FT                   IKISMDLPGPKLRVGAIEPGPRIARTRVTRTKTGRILTPSKLWITPFDHNATTPAPVPE
FT                   GLPGRPTLAIQVDPEWLQTVNEGDELSMLDARGSKRYMTVHKVTDEGVLAYGRQNVYLA
FT                   NGSLVACQYIKTRIHGIGRSEQSVHVDVGSRLTLTSDPTPTDPTDDIPAVNCGEPEAIR
FT                   SLGVGSKVLFDDAKIECEVTSVTRAGEKDSEGNTAEYDSAELVALHTREGGKNLREGRG
FT                   IHFPGAHVRLPAMTDEDRAILPEIVRTADIIAPSYVRSAEDLTEILGAIEKEIDVAASE
FT                   SDSHSVDATDTAGGSEDPATVSARIRNLGVMLKIESEECYNDLPNVVTELLRHRNSGVM
FT                   IARGDLAMELGFSRMSEAREQIMDVANAAHIPTIFATQVLETMAKSGLPSRAEITDADV
FT                   ALRTQGVMLNKGTHIPDAINILNSIGTALNTSDNSLDSRSRGRA"
FT   gene            152224..152967
FT                   /locus_tag="ckrop_0113"
FT   CDS_pept        152224..152967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0113"
FT                   /product="hypothetical protein"
FT                   /function="Glycerophosphoryl diester phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16910"
FT                   /db_xref="GOA:C4LLQ6"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:C4LLQ6"
FT                   /protein_id="ACR16910.1"
FT                   /translation="MEIIAHRGASCNHPEQTLAAYDAALSEGADGIECDIRLTKDGHLI
FT                   CSHDRTFERVAGDKRPIAELTRDDLPSINVGTTAEPQQPLLFDTLLDLVEGTDCGLFVE
FT                   TKHPSRYGAQLEKTLVSVLRDRGHVDNPRLHVISFSAMSLARMRHLEPSVHRILLRREI
FT                   QRPLGPILWRMDIPQAYGPSIINAKLRPGLIRRGDGCYTWTVNTRNDVMWAAQHGIDWL
FT                   ATDKPRQAREWMDEASAQAEYPTAS"
FT   gene            153067..153987
FT                   /locus_tag="ckrop_0114"
FT   CDS_pept        153067..153987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0114"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16911"
FT                   /db_xref="UniProtKB/TrEMBL:C4LLQ7"
FT                   /protein_id="ACR16911.1"
FT                   /translation="MSRKKKKNENLPEGMTRRQAKLAKRAAERAALERDPRPFGGFASE
FT                   ADLIAMQEFAPSARAKISVKGVDYPVYLVTVLPGATAAIVRDTDGDTPPTAFVALQRQH
FT                   RGPNPHKDLAHTLAWLQTAQPGQTLGTSIADGTEPELSELMDPTQKLDVQVEKDFDWWL
FT                   PEGQTIDPAMQQNMKQVNESMLPTERVDVSAPGAVWWTDGGDKGYIRWIRQDDEDALFT
FT                   ALARLYAAGDLTLGEGTRFAGAFRTHGVAVPVFDVDPTVTTQEFQEPIQKLAVALEKAL
FT                   AVDTPLTADERKARDTIRSRQVTIR"
FT   gene            complement(154049..155506)
FT                   /gene="lytR1"
FT                   /locus_tag="ckrop_0115"
FT   CDS_pept        complement(154049..155506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lytR1"
FT                   /locus_tag="ckrop_0115"
FT                   /product="putative transcriptional regulator, LytR family"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16912"
FT                   /db_xref="GOA:C4LLQ8"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:C4LLQ8"
FT                   /protein_id="ACR16912.1"
FT                   /translation="MNTTSDDDYLRGPDGRPIVDRYGRPIRRRSGKNTTSSGNGAGGGA
FT                   HRHEADSRRTGSDWANESHVDYSGGSSPARHEKHEYQHFRAQPGPASSRAKYRSGQSER
FT                   TDSPQSPRRRDEQRSGDYSSSSRRYSQPLPPRGIEEHNRRTGAPSYPPAGSRPSDKSRP
FT                   SGASRGRRWLPSSPSRGRRWRSSGWGRKLGALLGVLILVALGTMVWVDLRLHRVDALTN
FT                   YGGRPSGGSGTNWLLVGSDSRDGLSEDQQAELSTGGDTGGGRTDSIILVHIPFVGKATM
FT                   VSIPRDSYVDVPGHGKDKVNASYALGGPQLLQQTVEQATGLRIDHYAEIGFGGFAGVVD
FT                   AVGGVKICVEQPMDDPLAGINLQPGCQKLDGPTALGFVRSRHSMDDGDIGRARNQRTFL
FT                   AALVKKALSPTTFLNPFRFFPFVSRMTDSFTVDKHDHVWNLARLGIGLGMSPRNETIPI
FT                   ASYESTDVGDVDVWDDDGAQELFKSLR"
FT   gene            complement(155517..158495)
FT                   /locus_tag="ckrop_0116"
FT   CDS_pept        complement(155517..158495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0116"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16913"
FT                   /db_xref="GOA:C4LLQ9"
FT                   /db_xref="InterPro:IPR018584"
FT                   /db_xref="UniProtKB/TrEMBL:C4LLQ9"
FT                   /protein_id="ACR16913.1"
FT                   /translation="MPALLLRSGSRFGTGRAREALSRAHSRSSANSSAAIIGWPAHVLG
FT                   LLVGLLTQLVWHGPRENGDWAALWIAGKLLRQGDDPHIYDYAPDDFAAWAGPFWQPFAQ
FT                   QDVTSASPHPFVQAPFVAQMAEALTFVMSFHTSVFFLTVASGWALVVLVAGAFYVWFHR
FT                   PIPMGVLVGVTLVVWLSTPFQWSITLGQTTPLVTAGIAYSIAAARRRPWSAGIVLGVVS
FT                   VIKLTPLALIPLMLLFRRSRRTSLIAIATTALCFGFSVLTVGWPLHEIWRARIHMFSTF
FT                   KVIAPTSQTFVSIMKRHLIDEGPAGAPIIQDTPGWMVVTPMMLAAVIALALAIAAYRCR
FT                   GRAFEILMVGAMCVATCFSGFVWTHYFIIAVLPAFGVFALTARRKWAVACIAMVSVLYF
FT                   PPLSDVISAEHDNRYFAQTVFYVPGGALMATIIMLFLLAAAVVVPAHRVTSAGLPNSAP
FT                   ESRAPWGARASASGRTSGHTTAPVVRRSIPRVGARSTVTRWFAHASSPHSTFISGSSPR
FT                   QRGHIVGKMGHIVAVISGLITVLAWNSHRQTDDWSSLWIAGELVAQGDAPHIYDYNRQD
FT                   FARWAGEYWAPFANEHVTSPLPHPFIQAPIVAEVMSLITRIMSYDFSTLLLGFFSGWAM
FT                   VITVACAYRVWVGRPIPLVLLLPVVVVAWLSAPFSMAIRLGQTSPLIYAGIAYAIAAAR
FT                   TRPRSAGIVLGLVSVVKLSPFALIAAMFLFRRSRRTAGIAVVTTVVAFLVSLVTLGTEI
FT                   FRTWVRVIRDLSSARIVAMESQSFASIMLRSHLGDDDNVWVPIIRNPPTWVVVIPLILA
FT                   ALLAILVLAAAYVRREYAFPLFMVGITSIATACSGLVWTHYFQVALLPAFGSVVLAERR
FT                   RLAGFLTIGLGLFFVPPLSDVVGSAAQARVHVQSGSLIALIGLILLMCIMALLPGSVLP
FT                   PRTRSRITQWQQAHDRDDEWLRSSGPSLSHRYRNDMTAPLPVVTDAPRASSGRHHVRRR
FT                   HTQ"
FT   gene            complement(158733..159434)
FT                   /locus_tag="ckrop_0117"
FT   CDS_pept        complement(158733..159434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0117"
FT                   /product="putative membrane protein"
FT                   /function="Predicted metal-dependent membrane protease"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16914"
FT                   /db_xref="GOA:C4LLR0"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:C4LLR0"
FT                   /protein_id="ACR16914.1"
FT                   /translation="MTFGMSGLRATLRLVEALVSPTPLKGQTAQLNPSQAPAAWLDVSL
FT                   QVLSAGTLVAWGALAVYMLWVHPVTTNPLWFLRWSGLSDVWHGLAAAAAIGLPGLCFYG
FT                   VARACGLSATVDPAAGVRAWWSYVLLVISACATAWAEEVVVVGWLQTRLAQCGVSGAPR
FT                   VAASALLRGLYHVYQSPSAGMGNAIMGLVFGTYFERTGRVWPLMIAHATIDCVAFVGAA
FT                   LLAGHLPWLGL"
FT   gene            complement(159478..160941)
FT                   /locus_tag="ckrop_0118"
FT   CDS_pept        complement(159478..160941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0118"
FT                   /product="putative amidase"
FT                   /function="Asp-tRNAAsn/Glu-tRNAGln amidotransferase A
FT                   subunit and related amidases"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16915"
FT                   /db_xref="GOA:C4LLR1"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:C4LLR1"
FT                   /protein_id="ACR16915.1"
FT                   /translation="MDFHDVLDAPLADILAMVRGGRRRVGTEDVATPSDQHGRDQRLSP
FT                   DVLAGLARDRVQAARESTGLSTQELGFALDDIPVTYPSAQRESAAFAGLPIPIKDLLPV
FT                   RGIPCTQGSADRVSVPDKNDPVAEALLDAGATIFGASATSELGLSCYTEPTHLPTVVNP
FT                   ALSGRAPGGSSGGAAALVARGIVPVAHGSDGGGSIRVPAACCGIVGFKPPHDPTDGQLR
FT                   ADGFLARTVADVAVASSLITFPGQPRVTRTEWVPGASNVGVPSRRLRVGILTKPLHSAG
FT                   QNAPHPAPHGASHPAPRPASNSLMMGALRIAADRVRAAGHDVVPVTNPYPPETIELLRI
FT                   VLAYRCRNLDGALSPLSTYFRDLGTTITAEQYKDTLARLRELPDLVLSQWSDAANVDLV
FT                   LNPTIAYPPPPVGTFAALPPEEDFAAQTAWTPWCTLWNLTGWSGLSVPVVTTAIEGPWH
FT                   GWPVSMHVGAVGDRVSPWEVLGVGLIVEK"
FT   gene            161173..162243
FT                   /locus_tag="ckrop_0119"
FT   CDS_pept        161173..162243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0119"
FT                   /product="Prephenate dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16916"
FT                   /db_xref="GOA:C4LLR2"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="UniProtKB/TrEMBL:C4LLR2"
FT                   /protein_id="ACR16916.1"
FT                   /translation="MAMLEFAGHGWCDTPPQGTRAWAAGAENTGVDATEPTVANDHRIV
FT                   PLPVDSPQHAVDAVIRGRADWACVAIESSVEGPVTRTFDALAGSHPLQIYREIAIPIAF
FT                   SILVRPGTRPQDIATWSAHPVARPQVTSWVDDHLPPAEFVAAHSNAAAAEMVARGEVDA
FT                   AAAPARAGQLYGLDSLADGVADVAGAQTRFVLVGKPGKPTAHTGRDRTSVVFNVRNEPG
FT                   ALARTLTVVSSNGVDLTRIESRPTRKALGEYRFYMDMSGHISDPHVATALQHLHRTVQV
FT                   LRFLGSWPIDDGPHVATTSGQAVASDTVTASDAVAPSSTMSPDKPSTATPDEWFTAQEW
FT                   IAHRAKGTAPDTDVLW"
FT   gene            162344..163270
FT                   /locus_tag="ckrop_0120"
FT   CDS_pept        162344..163270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0120"
FT                   /product="putative phosphoglycerate mutase"
FT                   /function="Phosphoglycerate mutase 1"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16917"
FT                   /db_xref="GOA:C4LLR3"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:C4LLR3"
FT                   /protein_id="ACR16917.1"
FT                   /translation="MNNVGTTVNSGTSNSGVSGEKQQNAPRGRLILFRHGQTTSNLITA
FT                   LDTAVPGADLTSMGVEQAFTGGERIVADGTLSGVGEVQEGDAPAGSPRPVIISSEALRA
FT                   RKTARFAAQGMVNQGASVFTASPSTDGVKTVPITAELDDPTVPTAIPGLTEVTAGDLEM
FT                   NTDMESIHTYRYTQLQWSSGKMDMRMPGGQSGWETRRRFLEGITPMLPLLVPGAVRSDT
FT                   ATPSDLIVVVHGSVMRFIAGQLAGVEAHFVQDGYVSNCRWIVLDSPASLDLAAASYSDV
FT                   DQSCGSWRVKQWAWLPGDRVRLKGSVQ"
FT   gene            163346..164014
FT                   /locus_tag="ckrop_0121"
FT   CDS_pept        163346..164014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0121"
FT                   /product="para-aminobenzoate synthase component II"
FT                   /function="Anthranilate/para-aminobenzoate synthases
FT                   component II"
FT                   /EC_number="2.6.1.85"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16918"
FT                   /db_xref="GOA:C4LLR4"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C4LLR4"
FT                   /protein_id="ACR16918.1"
FT                   /translation="MRILVVDNYDSFVYNLVQYIGQLGETCTVWRNDDDRLVDSAEDRA
FT                   AGRSVVQRFDGVLISPGPGTPSAAGQSIPLIKACIRHEVPMLGVCLGHQALAEALGGSV
FT                   VRADELLHGKTSPVWHDGTGVMRGLPDPVTVTRYHSLTVDEASLPEELVVTGRSDSGMV
FT                   MSMRHASLPLHGVQFHPESIMTSCGHRIVANWMGCAGFLVDEERVRELENRHNAVLSGL
FT                   "
FT   gene            complement(164120..166261)
FT                   /locus_tag="ckrop_0122"
FT   CDS_pept        complement(164120..166261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0122"
FT                   /product="serine/threonine protein kinase PknB"
FT                   /function="Serine/threonine protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16919"
FT                   /db_xref="GOA:C4LLR5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C4LLR5"
FT                   /protein_id="ACR16919.1"
FT                   /translation="MDSNTLLGGRYTLSEIIGTGGMSDVYAGTDTLLGRDVAVKMMRPD
FT                   LARDTTFLERFRREALNAAKLNHHAIVAVYDTGQTSEADGSVPYIVMERVRGRTLRDII
FT                   REDGPLDPEYAATVMADVADALHFSHEAGIVHRDIKPANIMITATGSVKVMDFGIARAL
FT                   GDATSSMTQTAAVIGTAQYLSPEQARGHSADPRSDIYASGCVLYELITGQPPFQGESPF
FT                   SVAYQHVQSTPVPPSHVDGIRLNPTTATNVDAVIMTAMAKDPADRYDDAADFADDLRRL
FT                   ASHRTPLAAQHRTNPYSPMPHQNDPSDVATTVMPAAGAAGAAGAAGIAAGSGAHSAATP
FT                   GTHAAQPGQDAPGQAQRAHAAVAPAGSDTATRNSGGKHASKHSEQGEKKRSALSTWIRI
FT                   IWTLVILAVLGIGGAVAWSYYHDNTTSSSLPHVDTNDNKKISIPDVRNLTEDDAIAKLE
FT                   DAGFKVKTREASNADVEKGHVIDTSPAAGSQVPKGTQVTLTISTGKEQTDVPNLTGKDT
FT                   QEASRLLQEAGLVLDQTVKEAPSDSVPSGRIIEQTPASGSHVAKGSTVTITVSTGPERV
FT                   RVPVVTGQSIDDARGNLEGAGFKVTVTEVDSTRPEGTVLRTANEGNQMPKGATIELQVS
FT                   RGNQLTMPNLVGQSTSQALSALRSAGWTGGTARLTTHDQKTNDLTKINEIMTQSIPAGQ
FT                   AVDKDSTIDVGVGSFSLLP"
FT   gene            complement(166265..168151)
FT                   /locus_tag="ckrop_0123"
FT   CDS_pept        complement(166265..168151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0123"
FT                   /product="serine/threonine protein kinase PknA"
FT                   /function="Serine/threonine protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16920"
FT                   /db_xref="GOA:C4LLR6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C4LLR6"
FT                   /protein_id="ACR16920.1"
FT                   /translation="MTNDNDLQPDRSDIERVQRLVGTHYRLNWIIGRGGMSTVWLATDN
FT                   DTGDPVAIKVLKPEYTDNTEFRERFRNEANASSLIDSPNVVHTHAYREVLDAGLTFCFI
FT                   IMEYVRGESLADVLAREKKLPEKLALDVLQQSALGLQAIHAAGMVHRDIKPGNLLITPD
FT                   GTVKVADFGIAKAAEAVPLTRTGMVVGTAQYVSPEQAQGMKVGPASDIYSLGVVGYEML
FT                   TGQRPFRGDSTVSVAIAHINTTPPALPESIGRNTRELIATALRKDPRARYANGAELTMA
FT                   VAHVRNGDMPPLPETLHQQINQDGMVTPGGPDAPTAMFATNGEPQPTAQFVSPTAPGES
FT                   IAQVTEQPQTPAPKVQGPAPQPGGTVHPSLGGAATNRGPSDGTRISPAAQQNAAAPGAA
FT                   AAAANRPGGTPNRGQSPARNTNKGAAPNKNNNSKATRWLWTLIGLLVLIVVAIGAWMAF
FT                   GVHRDGGRDETGETVTSVITTVVPGENDDNDTAPAETYQPPQRTSTEQQTNPGTEIRPV
FT                   QPTETGDQGTNNTPGTDNDTTGGNGNNGTTDGNSGNTNTGGNNSNGGTNNGSGNAGNNG
FT                   SRGNSNGGNSGSGNTNQQNSAINGGTGTGGTTGQGHSSHNGTSNGNSARSGV"
FT   gene            complement(168155..169618)
FT                   /locus_tag="ckrop_0124"
FT   CDS_pept        complement(168155..169618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0124"
FT                   /product="putative penicillin-binding protein 2"
FT                   /function="Cell division protein FtsI/penicillin-binding
FT                   protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16921"
FT                   /db_xref="GOA:C4LLR7"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:C4LLR7"
FT                   /protein_id="ACR16921.1"
FT                   /translation="MNRSIRAVTIFCLLLVVAMVANLTWIQGFQTDHLAKNSLDRRQYY
FT                   DMKSRQRGQISAGGEILAHSVKGANDMYNREYVSDPDAFGPIEGYLSDRYGTAGIEASQ
FT                   NNILNGTDDSLFTKRFTDTLTGKETQGANVELTIDPKTQRVAYDAMTSRGYTGAVVALR
FT                   PSTGEVLAMASTPGYDPRSIVTPNAEEAQQNWAALNNNPESPLLNHATQQTLPPGSTFK
FT                   LITTAAAMEKNNVNANTTVTAEPQITLPDSYTTMENYDGERCGSGSVTTLSTAFTLSCN
FT                   TAFAQLGMAAGTEQFKKTAKAFGVGESVDDFGLPVQTSTVGEIADQPSLAQSSIGQRDV
FT                   SITPLQDAIIAATIANKGKRMKPYVVKQITDSSLKPIKTTKPEQVNTAVNEDIANRITQ
FT                   LMIGSEKGTSGYAGADIASKTGTAEHGENSRSSKPHAWYVAFGPSQNADVAVAVVVENG
FT                   GDRGQAATGGSVAAPIGRAVIAQALKDGV"
FT   gene            complement(169615..171072)
FT                   /locus_tag="ckrop_0125"
FT   CDS_pept        complement(169615..171072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0125"
FT                   /product="cell division protein RodA"
FT                   /function="Bacterial cell division membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16922"
FT                   /db_xref="GOA:C4LLR8"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:C4LLR8"
FT                   /protein_id="ACR16922.1"
FT                   /translation="MTYSHPSTAGNAVAYPATTTGQATDNTGPIARPKRPRRWIELGLL
FT                   LAVTAILALAVIAVEIAANHPLTTDVAYLLGGFIIIFTVAHLVILWKAPYSDQIMLPVA
FT                   ALLNAIGLVMIYRLDLATGNNLVRSQIMWTVIGVAMMVAVIVGLRDHRSLQDYSFLLGI
FT                   AGLVFMAVPMVWPTSLNADANVWVQVGPFSIQPGEFSKILLLLFFASLLTTKRALFNVA
FT                   GTKFLGMRFPRLRDLGPILVVWGIALVIMAGENDFGPALLLFGTVLGMLYIATSRPSWI
FT                   IIGLGLAAIGAVGIYNISAKIQTRVDNFIDPISHYNEGGYQLSQALFGLSWGGITGTGL
FT                   GRGYPEEVPVAHSDFILAAIGEELGLVGLSALIVLYAIFVARGMKTALKTRDTYGKLVA
FT                   SGLSLTIAIQVFVVVGGISRLLPMTGLTTPFVAHGGSSLLANYMLLAIILRISNSARQP
FT                   ASVSGSAATANRKTNQQASTNQKEAQQ"
FT   gene            complement(171073..172731)
FT                   /gene="ppp"
FT                   /locus_tag="ckrop_0126"
FT   CDS_pept        complement(171073..172731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppp"
FT                   /locus_tag="ckrop_0126"
FT                   /product="serine/threonine phosphatase"
FT                   /function="Serine/threonine protein phosphatase"
FT                   /EC_number="3.1.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16923"
FT                   /db_xref="GOA:C4LLR9"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:C4LLR9"
FT                   /protein_id="ACR16923.1"
FT                   /translation="MTYALTYAAASHVGLIRGNNEDSAYAGPHLLALADGMGGHAAGEI
FT                   ASQLMISHIAHVDDVGPGDDMCGQLADAMAEGNAAIANQIDINPATEGMGCTLDAFFFN
FT                   DDTLAICHVGDSRGYLYRDGQLEQITKDDTYVQSLVDEGQLAPEDVSNHPQRSLILKAL
FT                   TGRPVEPTLMLREVRPGDRYLLCSDGLSDPVSHDTIADIVSRGTLDQAAERLIDLALRS
FT                   GGPDNVTVVLGEIVDTSDDDYAPAAPLLVGALDPEQTDVARPDTAAGRAVGMKLIQQNK
FT                   EAQAQRNPGGRSGSQPASPDNGGSSNNGGAQASRGDLADPVRGAGDRADSAHGGSAVAG
FT                   GHGHNHEKHNKKKGRRIGLTVGVIVLVLAVIIGAGGWWGKKTLDNRYYIATDNNELVVY
FT                   KGADETILGKTLHSTYQRACLDAKGNLTLLDANSTKKCHRFQLTDLPPSTRTNVDNLPS
FT                   GDYNDVQTQMERLAKQALPVCVTRESSHGNADNPDAGRDDRSGEPAPSDAATSGEPAPS
FT                   APSAGESAANNASGDTANGQPGDLTTPGDTCREVK"
FT   gene            complement(172746..173255)
FT                   /locus_tag="ckrop_0127"
FT   CDS_pept        complement(172746..173255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0127"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16924"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="UniProtKB/TrEMBL:C4LG74"
FT                   /protein_id="ACR16924.1"
FT                   /translation="MPTMQSTVLFLVKLAILILLWLFIALTLRALKRDSATPSATVLAA
FT                   PAVAAPQGGPDPTVAPNADGRRNQRNKAPISELVVTNGPQRGQIIDLTSQSEVFVGRAS
FT                   SCTLVLSDDYASSRHARFIRNGNDWFVEDLESRNGTYLNEQRIDQLETLTRGDAIRVGR
FT                   TTLHVQ"
FT   gene            complement(173565..174551)
FT                   /locus_tag="ckrop_0128"
FT   CDS_pept        complement(173565..174551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0128"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16925"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="UniProtKB/TrEMBL:C4LG75"
FT                   /protein_id="ACR16925.1"
FT                   /translation="MDMLGRFRKLDSSLQRGMDNGFARVFGGSVVPAEIEELLKQEAED
FT                   SLVYGPHGTLYAPDRYVVYLAAKDLDKINDADPDLNFDLSDLLGRFIRNEGWRTYEAVT
FT                   VDLKSDKGLHTGQLKCHSSVSEHQDARPVSPPTEVYASQHNNSANQDQPGQAGQPEGQS
FT                   GYPHSVDSDSYRHAQAWSEVADAADTANPAPGTGHVSPADAAAAPNAQDNGGYVPGQAS
FT                   VSGQANEQAAVTLLLQDGSSRTYHVHEGTNIIGRGNQVDFRLPDTGVSRRHAELVWDGK
FT                   EAVLVDLHSTNGTTVNDTPIDNWLLADGDVITVGHSYIEVRINTPQK"
FT   gene            174972..175058
FT                   /locus_tag="ckrop_t0003"
FT   tRNA            174972..175058
FT                   /locus_tag="ckrop_t0003"
FT                   /product="tRNA-Leu"
FT                   /anticodon="(pos:175005..175007,aa:Leu,seq:cag)"
FT   gene            175257..176417
FT                   /locus_tag="ckrop_0130"
FT   CDS_pept        175257..176417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0130"
FT                   /product="permease of the major facilitator superfamily"
FT                   /function="Permeases of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16926"
FT                   /db_xref="GOA:C4LG76"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4LG76"
FT                   /protein_id="ACR16926.1"
FT                   /translation="MSAMNATVRRLYDGVALSYGMTMVVLGSTIPSGLYSIYQRDWGLG
FT                   SSSTVVFFSFYVVGVVIALLFGHVSDTVGRKPVILTCVALSLASSVTFTLTTNFPGLCI
FT                   ARTLSGLSVGLCTGAFTAALQEAISPALGALLSTIYTSLSLALGPLFGAVIALHSGLPL
FT                   RIPFIIYGILTVVAGALVLLITETLENRGRLSLKVQIGVPKNLVSAFIPFAVAIGVAYG
FT                   TNGLFQSVVPLSMKGLGVSSQLGMAFTTFLMLAVSAVTQIGMAFLPREPSLAAGMIILV
FT                   VGLGSTAVSLIIGEPIVAWFGICISGIGQGISFRTSLAGTAELSPRSDKAKTVSTYYVV
FT                   GYVATAVPALAAGIVGGQPYAVATVCAVVAAFAISNVFLLRSSKRR"
FT   gene            complement(176522..176662)
FT                   /locus_tag="ckrop_0131"
FT   CDS_pept        complement(176522..176662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0131"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16927"
FT                   /db_xref="UniProtKB/TrEMBL:C4LG77"
FT                   /protein_id="ACR16927.1"
FT                   /translation="MWLVTIPKYDIFGQANRREDGEAVAKEITALWFDTEEENIEVTLD
FT                   N"
FT   gene            176848..178356
FT                   /pseudo
FT                   /locus_tag="ckrop_0132"
FT                   /note="putative NAD-dependent aldehyde dehydrogenase"
FT   gene            complement(178370..179209)
FT                   /gene="eutC"
FT                   /locus_tag="ckrop_0134"
FT   CDS_pept        complement(178370..179209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eutC"
FT                   /locus_tag="ckrop_0134"
FT                   /product="ethanolamine ammonia-lyase, small subunit"
FT                   /EC_number="4.3.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16928"
FT                   /db_xref="GOA:C4LG78"
FT                   /db_xref="InterPro:IPR009246"
FT                   /db_xref="InterPro:IPR042251"
FT                   /db_xref="InterPro:IPR042255"
FT                   /db_xref="UniProtKB/TrEMBL:C4LG78"
FT                   /protein_id="ACR16928.1"
FT                   /translation="MTRQLDVTTTGGDAGRAKDDHRPDAWARVRDLTPARIGLGRHGAA
FT                   QPTSSKLSFAAAHAAARDAVHSSHAGGADDSGDAGSSGTTNGLSFLADASLVRSRAGNR
FT                   SEYLRRPDLGRLPNDEDLEKLPTREAGWDVGIVMADGLSPDALSYHGKATEEALRDTLH
FT                   RICPELSIAPTVRADQARVALGDHIAHAMNMRVVVVIIGERPGLSVPYSLGMYITYNAS
FT                   PGTTDERRNCISNIHPPDGLSYDHAAFTAADLISKMMKLGKSGAALKATRQAISSSS"
FT   gene            complement(179206..180603)
FT                   /gene="eutB"
FT                   /locus_tag="ckrop_0135"
FT   CDS_pept        complement(179206..180603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eutB"
FT                   /locus_tag="ckrop_0135"
FT                   /product="ethanolamine ammonia-lyase, large subunit"
FT                   /EC_number="4.3.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16929"
FT                   /db_xref="GOA:C4LG79"
FT                   /db_xref="InterPro:IPR010628"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C4LG79"
FT                   /protein_id="ACR16929.1"
FT                   /translation="MFSQHLAGHTYSFDSLTEVMAKASPIRSGDQLAGCAANSAAERVA
FT                   AAMVLADVGLSEFLRRPLIEDAVTDLIHRTHDSDAFRPLAHMTVGSFREYLLEQAYRGA
FT                   DISSLAWALTPEMAAAVSKLMSNGELIAVSAALSVVTKFRTTLGLPGCLSSRLQPNHPT
FT                   DDPAGVAASVLDGLLFGCGDAVVGINPAGDSPEAVRDLLLLLDEVRRRYSIPMQSSVLT
FT                   HISTTIDLMEAGAPVDLPFQSIAGTQGALRSFGVSLDMLAEAEQAADELHRGTVGTNAL
FT                   YFETGQGSCLSAGANIGVDGPVDQQTLEARAYGVARAYRPLLVNTVVGFIGPEYLYDGK
FT                   QIIRAGLEDNFCGRLLGIQMGCDVCYTNHAETDSDDMDTLLHLLAAANTGFVIAVPGAD
FT                   DIMLGYQSLSFHDIAQVRATMGKRPAPEFEEWLHTTGVTDEAGLLADDGPAPALSPEHA
FT                   IELGWTS"
FT   gene            complement(180603..182129)
FT                   /gene="eutP"
FT                   /locus_tag="ckrop_0136"
FT   CDS_pept        complement(180603..182129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eutP"
FT                   /locus_tag="ckrop_0136"
FT                   /product="ethanolamine permease"
FT                   /function="Amino acid transporters"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16930"
FT                   /db_xref="GOA:C4LG80"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004757"
FT                   /db_xref="UniProtKB/TrEMBL:C4LG80"
FT                   /protein_id="ACR16930.1"
FT                   /translation="MTATLETTTQLSTHLKQGSFNWVVLAGLGVSFVISGDFAGWQFGL
FT                   GSGGWGGLFCALLIVAVLYMGMCLALAELSAALPSAGGGHLFAQVAVGDFAGFMTAIAI
FT                   LLEYVLAPAAIATFISSYVESLHIPGVPAGWPIYLFCYIAVVVVHLAGAGEALKAMCVV
FT                   TIIAVAALVLYTVVMAPHVHISAFTDGWSGASSHTAPGTPDRISLFDGGFAGIWAAIPF
FT                   AMWFFLAIEGVPMAAEEAKDPARSVPKAIVVAMMILLVAAITMMVVGPGAAGTGVVAES
FT                   GNPLVAALERVGANHAVVVAINYAALLGLVASFFSIIYGYSRLTFSLSRAGLLPAFLST
FT                   TNRRGAPTWALIVPACVGFALTLVADGDALMSVAVFGAVVSYALMMVAHIVLRVRRPEL
FT                   PRPYRTPGGVVTSGVALVLSLGAVVATFMNAPVLAGCALGVMALAAVGYAVWGRNTSPV
FT                   DIAQERAARERARQERPERDLRARDLEAPDLQTPAHTPRTTTILQAEEVR"
FT   gene            complement(182715..182924)
FT                   /locus_tag="ckrop_0137"
FT   CDS_pept        complement(182715..182924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0137"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16931"
FT                   /db_xref="GOA:C4LG81"
FT                   /db_xref="UniProtKB/TrEMBL:C4LG81"
FT                   /protein_id="ACR16931.1"
FT                   /translation="MVTEKTEESMEVSPQVIEKVCGWRLKAHKLTALDLHKAQRLAVVV
FT                   LFGKIHSLFDVMLYFRPHLTFSTF"
FT   gene            183204..183587
FT                   /locus_tag="ckrop_0138"
FT   CDS_pept        183204..183587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0138"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16932"
FT                   /db_xref="GOA:C4LG82"
FT                   /db_xref="UniProtKB/TrEMBL:C4LG82"
FT                   /protein_id="ACR16932.1"
FT                   /translation="MQVVNVVTVRDGNVAATRTVLVRVVLVDRVSFSGAFVPVVLVLVV
FT                   EVTVVYIVDVVTVRDGNVAATRTMLVGVILVNDVLSSHSAQPSCAFIDATDTLRALLNS
FT                   DLNDIHHIWKIAGKGITGSLIEN"
FT   gene            183685..184761
FT                   /locus_tag="ckrop_0139"
FT   CDS_pept        183685..184761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0139"
FT                   /product="hypothetical protein"
FT                   /function="Predicted Rossmann fold nucleotide-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16933"
FT                   /db_xref="GOA:C4LG83"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:C4LG83"
FT                   /protein_id="ACR16933.1"
FT                   /translation="MTASSYSSARKAQPHLCSLAASPSQGETPDQTLIRELDEELNLRV
FT                   GTEDLTFVGTFRTNAANEANTQLLADVFTLDGSLRWDNSADDDNDGDDTDVGNNDNNDA
FT                   HDVTPHAEIDAAHWFTSEDIKTEREPIAPLTREVVPQLYGRGFLLFTGSALGNNPVYRE
FT                   AVESLVHSIGAHNDHVVYGGGRAGLMGVVGDTAAEDGTLCIGVIPYLLAGVDGPNGFNQ
FT                   GGRSYVIPRADGTVPTPARGEIAHDRLTRLELVPTMSARKTRMGELADIVVGLPGGAGT
FT                   VDELFDAWTQQQLGYTQHAVALLNVNGYWDPLISAIKHMVAEGFLSSAYLESLIIADTP
FT                   RELYEKVDTWVPPAPKWG"
FT   gene            complement(184797..186209)
FT                   /locus_tag="ckrop_0140"
FT   CDS_pept        complement(184797..186209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0140"
FT                   /product="putative aldehyde dehydrogenase"
FT                   /function="NAD-dependent aldehyde dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16934"
FT                   /db_xref="GOA:C4LG84"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:C4LG84"
FT                   /protein_id="ACR16934.1"
FT                   /translation="MSTFALENPSTGKTEDQFNRIDDADRDKILDQSTEAYKQWKETSL
FT                   EERVNVLNKVADLYEERADELASYIGREMGKLTRWAQGEIQIVVNIYRWYAEHAYELMQ
FT                   DTELPRQGAIRTFVRHDPMGPILGIMPWNFPYYQVARWAAPNLLLGNSLVLKHASICPL
FT                   SSQACQDLLEEAGLPKGVFINMYASGSQMDAFVADKRIKGVSLTGSEAAGAAVAKTAGE
FT                   NYKKSLLELGGNDPFIVLDDDNLDDVLDNFVKIRMYNTGQACNAPKRLIVMESFYDKVV
FT                   SGLEERISKMTVGPWDDEKADIGPLSSIDARDGIAERLDKAAKEGKATIKVGGHALDRD
FT                   GAYMEPTLLTDVDPASDVGCNEIFGPVAIVYPAKDADEAVHIANDYSDYGLSGSVWGSD
FT                   LDKAWEVASQLKDGMTFVNESSVTEAGLPFGGVGRSGYGREMERWGVKEFANEHLFRIS
FT                   EGPNGGGLSPAM"
FT   gene            complement(186254..186631)
FT                   /locus_tag="ckrop_0141"
FT   CDS_pept        complement(186254..186631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0141"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16935"
FT                   /db_xref="UniProtKB/TrEMBL:C4LG85"
FT                   /protein_id="ACR16935.1"
FT                   /translation="MSSDKARWGLTTLYTVAGFGHFVTPKPFEEIVPTYAPGTARFWNY
FT                   LSGAGELGTAALLAAPNNKANKYGGLISAALLLAVWPGNFESVRQRLDRPWTEQIGWIA
FT                   RLPLQLPMIHASWKIWKGTTD"
FT   gene            complement(186761..187417)
FT                   /locus_tag="ckrop_0142"
FT   CDS_pept        complement(186761..187417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0142"
FT                   /product="recombination protein"
FT                   /function="Recombinational DNA repair protein (RecF
FT                   pathway)"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16936"
FT                   /db_xref="GOA:C4LG86"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/TrEMBL:C4LG86"
FT                   /protein_id="ACR16936.1"
FT                   /translation="MFEGPLQDLIDEFSRLPGIGPKSAQRIAFHLLHTDPDDIDRLRAA
FT                   LTSVRDGITFCRICGNISRNDVCRICADPNRDATTICVIEEPKDIEVIEATGEYQGRYH
FT                   VLGGALDPLANVGPKDLSITQLLQRIAGVLPDRETADSTPDEPRYEDAPTIKEVIIATD
FT                   PNTEGEATSSYLARLLKDFPDLTTSRLASGMPIGGDLEYVDELTLSRALAGRLPL"
FT   gene            complement(187530..187832)
FT                   /locus_tag="ckrop_0143"
FT   CDS_pept        complement(187530..187832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0143"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16937"
FT                   /db_xref="GOA:C4LG87"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4LG87"
FT                   /protein_id="ACR16937.1"
FT                   /translation="MAEPDFNEIMAQAQQMQEELQRVQGEIAQSEISGSAGNGLVKVTM
FT                   KGTGEVTNVTIDKSVVDPDDVDTLQDLVLGALQDANTALQSYAQEKMGPFSQALG"
FT   gene            complement(187996..190968)
FT                   /gene="dnaX"
FT                   /locus_tag="ckrop_0144"
FT   CDS_pept        complement(187996..190968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="ckrop_0144"
FT                   /product="DNA polymerase III, gamma and tau subunit"
FT                   /function="DNA polymerase III gamma/tau subunits"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16938"
FT                   /db_xref="GOA:C4LG88"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4LG88"
FT                   /protein_id="ACR16938.1"
FT                   /translation="MALYRKYRPATFADVVGQEHVTVPLSRALDAGRINHAYLFSGPRG
FT                   CGKTSSARILARSLNCVHGPTSTPCGECESCRALAPGGPGSLDVTELDAASHRGVEDMR
FT                   DLRDRAIYAPAESRYRVFIIDEAHMITKEGFNALLKIVEEPPEHLVFIFATTEPEKVLT
FT                   TIKSRTHQYPFRLLAPNDMRGLLERICSEEKVQVEDSVYPLVIRAGGGSPRDSLSVLDQ
FT                   LLAGADENGITYAHAAGVLGITDSALIDAAVESVANNDPAGLFTTINNVLDAGHDPRRF
FT                   ATDLVDRFRDLLVLQSIPDAFDQGLVDAPLDQRETLADEAQSLGPATLTRCAAVVSDGL
FT                   NELKGATSPRLLLEIMCARMVMPGAADGIEALSQRVEALESGQPTASRSTSDNGHRVGS
FT                   TSSSASEDGTRAAGSGAADNGASGSDANATPPRAKGGGRIIWPRKNKKTETPTPQTSPS
FT                   SEANTETSQEAKGTEHRDTGNAKPQETQSTSSGAPETPASPQEDAATPSQDEAAASSQA
FT                   EAAPSQESVDPRTMDRETLSKYLREQALQQERETRAREAEERMHRIEEKEGPAVVLPES
FT                   ERSADAQNTHADSARSDDTPTTGSENSETTDTNENSEANAGPEANGHEDQPSDTETNQH
FT                   DQHADAGVETDQADSDTTDHETGLTADGLRPQWTQIKQAVGKRSKVAQVMVSEAVILGV
FT                   FRNHVVLGHHTGALAQRLNDQHINTSIVDAITDATGQTVTVEAVIGTDDAALQRWKDAH
FT                   PDHPRSAVADNSAATATTDTEPSDDTATSADADSGNGSATSDIAGTTSPASPASPTSIL
FT                   SDSARTALTAAAAWKKAQEQQQSNADETSQGQRDGHAHPRHDATPQSRNGQSRPTHTPP
FT                   AGRRADSPQEFSDGSPLPPEPDDPDGYGPPPDDYYPASNNAPAGTSGDTANTRGNSDTG
FT                   GSNTGVATAEAPSSESTEYTQEEAEEEMVNATRDDPNYDHRSAKDIAMELLIKELGAQP
FT                   L"
FT   gene            complement(191035..191736)
FT                   /locus_tag="ckrop_0145"
FT   CDS_pept        complement(191035..191736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0145"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16939"
FT                   /db_xref="UniProtKB/TrEMBL:C4LG89"
FT                   /protein_id="ACR16939.1"
FT                   /translation="MNLLETQTWLESILPGETHWTSIKVSPDSPPFTVTSLLINDDGTA
FT                   EPVDSADDNEEQPRGRHAKVADDLRQTLACTADAGRYSTGLTSPDGMDVRAELLAVGLA
FT                   RPGEMGQLVTAAATMLSEEGSGRLAQPGTFLPGLGAMVNPAFTTKHGLLVVPYIWPKGV
FT                   PTVTEHPDLTTADGQPVNPTHPGRMTLIAQIIMLTEQEFLHGMTHGIDSLQTRLSEGGA
FT                   DLRDLRRASVI"
FT   gene            complement(191780..193084)
FT                   /locus_tag="ckrop_0146"
FT   CDS_pept        complement(191780..193084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0146"
FT                   /product="aspartate aminotransferase"
FT                   /function="Aspartate/tyrosine/aromatic aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16940"
FT                   /db_xref="GOA:C4LG90"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024551"
FT                   /db_xref="UniProtKB/TrEMBL:C4LG90"
FT                   /protein_id="ACR16940.1"
FT                   /translation="MVSRKVHMSPQVTPSKINVEALTGSKADIEQAYNELKAKNLALDL
FT                   TRGKPSSEQLDFGDELLGLPGAGNYTADDGTDCRNYGGLRGIVDIRKIYADLLGLPVDN
FT                   IIAGDASSLNIMHDLIVWAYIFGTQDSPRPWKDEDTVKWICPVPGYDRHFSITEHLGFE
FT                   MINVPMTDEGPDLDAVAELLKDPQVKGMWTVPVFGNPTGISYSRETCEKLAALDAAASD
FT                   FRIVWDNAYAVHTLTDEFPEPINVLELAEKAGHPNRFWFMTSTSKITFAGSGVSFFASS
FT                   ASNLDWYASHAGIRGIGPNKINQLAHAKYFHDAEGVKAIMRKHSASLAPKFAAVDKVLH
FT                   ERLDDYNVATWTEPKGGYFISLDVPDGTASRVVELAKEAGIKLTEAGSSFPLHKDPDNR
FT                   NIRLAPSLPPIEQVEEAMDGVATCVLLAAAEAAEK"
FT   gene            complement(193135..193671)
FT                   /locus_tag="ckrop_0147"
FT   CDS_pept        complement(193135..193671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0147"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16941"
FT                   /db_xref="UniProtKB/TrEMBL:C4LG91"
FT                   /protein_id="ACR16941.1"
FT                   /translation="MLPTASSPATSSPSTRKNSHVIRRKVMAVATAVAVVGTLAACGND
FT                   DADSEPSTITKTKTTDQTTTKTATTTTRTTTPTYDDETTTEEYTPRQTYTTQQAPAQTQ
FT                   DTGNYDDSYDDEDADEDVPNAGWNGPKMEWRTLGPFGSGMGCEQNRDKQPIQTTACYRG
FT                   DDGNFYYESVVQAPR"
FT   gene            complement(193948..194036)
FT                   /locus_tag="ckrop_t0004"
FT   tRNA            complement(193948..194036)
FT                   /locus_tag="ckrop_t0004"
FT                   /product="tRNA-Ser"
FT                   /anticodon="(pos:194000..194002,aa:Ser,seq:gga)"
FT   gene            194772..195476
FT                   /locus_tag="ckrop_0148"
FT   CDS_pept        194772..195476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0148"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16942"
FT                   /db_xref="UniProtKB/TrEMBL:C4LG92"
FT                   /protein_id="ACR16942.1"
FT                   /translation="MSIAAAALLAGCSQSDGSGFGDMEPVAANSEDIDRFGPSEPATSH
FT                   INPAEELFSKRKAIGSTRPVPEEIRSGKGKNKDRPLWERPEVLAKYPVKAKKNPDGSYD
FT                   YSDPRFENADLCEDAPPGYWEGLGYRVVGPGYIKLRTLKNCVLQIGDGNWSDGFGVTTD
FT                   KLDKRKIVDSRSKQYSPSRYDQPKGDDDMKGCVSYIETSIGRVGFGYVDFDQKLDYVQL
FT                   CDISRKGLERIL"
FT   gene            195478..197262
FT                   /locus_tag="ckrop_0149"
FT   CDS_pept        195478..197262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0149"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16943"
FT                   /db_xref="UniProtKB/TrEMBL:C4LG93"
FT                   /protein_id="ACR16943.1"
FT                   /translation="MNLSIDPCSLDTAVGELEASSEPKFNKLLSLAFSDSGEYTGEPGL
FT                   RMLGEQHFQVVSGKVGSARHTLLQLRQLIRWLADGTKEMRGAFVGQDDASAAILCGLKS
FT                   IQAVDFTFPARPDGEFSPFDFSEPMSGDGDDPAAVLAMLDAGNDSDIYALADYWHNLSI
FT                   SLNETVDALARARTRLEENTGESIDAAAGCFSQVMATAQIFADNATAMHASVSQLPHIR
FT                   QAARTQIAAIEAEHTAAVAAATNPAGVQAAGEAARAATREFMTGPYQAMLTAAVPPLRN
FT                   LTERPDVGQGGGHLTVQSPSPINSPSTVPTTVTPAMAAAGAVGGAPTANNAPLNPTQPA
FT                   TVSADNVGTNSTHPAPAPPITPAAQTSPNLASNADSGPLGTAPTSINRDNARVAPGGVS
FT                   GNAFPRSPGNTPSPGYTPRTTQTPDRNLRSSTPNNGLGTTNRTPINGGHAPHGNGNYPR
FT                   NGVNGSGQLSKPGEIPRNRSVIIHPGPDTPMPRTGDNPHYPGSTPGEGKNTAPHYGRGA
FT                   AAPSPTGGDGSRPAMGRMGIAPMGGYGNSSKSQKQEPEGKYKPITSEFEAEYNLRQLRG
FT                   DIGLTTPHVIGAQLREPK"
FT   gene            complement(197274..198290)
FT                   /gene="dhaM"
FT                   /locus_tag="ckrop_0150"
FT   CDS_pept        complement(197274..198290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dhaM"
FT                   /locus_tag="ckrop_0150"
FT                   /product="dihydroxyacetone kinase"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /EC_number="2.7.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16944"
FT                   /db_xref="GOA:C4LG94"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR012844"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="InterPro:IPR039643"
FT                   /db_xref="UniProtKB/TrEMBL:C4LG94"
FT                   /protein_id="ACR16944.1"
FT                   /translation="MSEVLQRLEEEARKPRAVAGDAAAATASTATAGETAADSSADEAA
FT                   RSSADSSANRTTTEGTLTEDGLTEGTMMTSNNDAASGANEGSEQSPQVGVVVVSHSKRL
FT                   ADGLALLASQMAKDVLIVPAGGLDAGPEDKDNPDGGGIGTSYDAIEAAVNKVVDAGLAC
FT                   AIFTDLGSATMTVEMVVDMLDDEPVRFIDAPLVEATVAGAVAAQQGQDLDGVEREARRA
FT                   ISAFESESAGGDSAAAPGEDAAGDSTNSDDANGGGYSRRVKVADKAGLHARPAAKLAEM
FT                   AADSEEGILVNDADADSAMSLMGLGAECGEEVTVSGDRSEKALIDSIADAIAAGLDE"
FT   gene            complement(198302..198934)
FT                   /gene="dhaL"
FT                   /locus_tag="ckrop_0151"
FT   CDS_pept        complement(198302..198934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dhaL"
FT                   /locus_tag="ckrop_0151"
FT                   /product="Dihydroxyacetone kinase"
FT                   /EC_number="2.7.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16945"
FT                   /db_xref="GOA:C4LG95"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR012737"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:C4LG95"
FT                   /protein_id="ACR16945.1"
FT                   /translation="MSDLDKAWAERWIRGCAEAASEHREELIDLDRAIGDADHGENVDR
FT                   GFQAVVKKLDDDQPQDIAGVFKLTAKTLMSTVGGASGPLLGTAFMYAAKAVSGDALDAD
FT                   GVASVVESAVGGVEKRGKATEGEKTMVDAWAPAARAARSAADEGKSPAEVLRAAADAAN
FT                   KGAEATVDMTATKGRASYLGERSVGHKDPGATSSAYFLAEASKAVDA"
FT   gene            complement(198962..199966)
FT                   /gene="dhaK"
FT                   /locus_tag="ckrop_0152"
FT   CDS_pept        complement(198962..199966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dhaK"
FT                   /locus_tag="ckrop_0152"
FT                   /product="Dihydroxyacetone kinase"
FT                   /EC_number="2.7.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16946"
FT                   /db_xref="GOA:C4LG96"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="InterPro:IPR012736"
FT                   /db_xref="UniProtKB/TrEMBL:C4LG96"
FT                   /protein_id="ACR16946.1"
FT                   /translation="MKKLINDPHDVVTESIEGLGLAHPELVTVNSDPLFVTRSSENAKD
FT                   QGKVGVISGGGSGHEPLHAGFVGTGMLDAAVPGPVFTSPTPDPIFEAAKSADKGTGVVF
FT                   VVKNYTGDVLNFDTAADLADMEDIEVRQVIVNDDVAVEDSTFTAGRRGVAGTFLVEKIT
FT                   GAAAERGLSLDEVERVAQNAIKNVRSMGVALTSCTVPHVGKPSFDLDDSEIELGVGIHG
FT                   EPGRRRVPMSSADEITDQLLDPIVADLELKKSDRVIALVNGMGGTPLSELYIVFRRVAQ
FT                   RLSDLGVTLERSDVGNFVTSLEMQGVSVTLLRVDDELLSLYDDPAETPAFVQK"
FT   gene            200165..201055
FT                   /locus_tag="ckrop_0153"
FT   CDS_pept        200165..201055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0153"
FT                   /product="hypothetical protein"
FT                   /function="Predicted sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16947"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR020936"
FT                   /db_xref="InterPro:IPR022111"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="InterPro:IPR040503"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4LG97"
FT                   /protein_id="ACR16947.1"
FT                   /translation="MSMPKIVLFYVFTPLADPEAIRLWQKALAEKWNLKGRVIISKDGI
FT                   NATLGGELNDVKRYCRETRSYAPFKNADIKWSEGEGDDFPRLSVKVRPELVTFGAGDEL
FT                   KVNEEGVIGGGTHLKPEDLHHLMDERGDDVVFFDGRNAMEAEIGKFRNAVVPNTTTTRD
FT                   FLNEIESGKYDDLKKRPVVTYCTGGIRCEVLSVLMKNRGFEEVYQLDGGIVRYGEAYGN
FT                   DGYWDGSLYVFDKRMHMEFGSGTESLGHCVECGKPTAQFVNCANNDCRKLFLRCDECTA
FT                   AHKHQYCGECEPALV"
FT   gene            201383..201748
FT                   /locus_tag="ckrop_0154"
FT   CDS_pept        201383..201748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0154"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16948"
FT                   /db_xref="GOA:C4LG98"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="UniProtKB/TrEMBL:C4LG98"
FT                   /protein_id="ACR16948.1"
FT                   /translation="MLGVVACAVAVAAGSILAAPSVSAVENGYNAVYEPWSAEVLIGGI
FT                   CTGSVVSDRWVLTAAHCLGNSHGPGGHVKIGEHAQQTFNVDRVVREPGGADMALVRTDV
FT                   SMGVRPIMLPSPGPVPN"
FT   gene            201851..202051
FT                   /locus_tag="ckrop_0155"
FT   CDS_pept        201851..202051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16949"
FT                   /db_xref="GOA:C4LG99"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR033116"
FT                   /db_xref="UniProtKB/TrEMBL:C4LG99"
FT                   /protein_id="ACR16949.1"
FT                   /translation="MFETKSIIGGQEHGDSGGPFHIGPVIYGVLCSTSGKDADGKTIAN
FT                   YTKVDQFLPWIYGTIFTQSWP"
FT   gene            202879..203040
FT                   /locus_tag="ckrop_0157"
FT   CDS_pept        202879..203040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0157"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16950"
FT                   /db_xref="GOA:C4LGA0"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGA0"
FT                   /protein_id="ACR16950.1"
FT                   /translation="MCLRKQWCFHFRHSYFRLEHFRIEETLLEKTLGLVLVVVVSAVVP
FT                   IGVGWAID"
FT   gene            203108..203248
FT                   /locus_tag="ckrop_0158"
FT   CDS_pept        203108..203248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0158"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16951"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGA1"
FT                   /protein_id="ACR16951.1"
FT                   /translation="MLCFVVLTARIVPRTFGIIGRKLGVLGIIVWLFSDSSLMAIPRSV
FT                   E"
FT   gene            203668..205278
FT                   /locus_tag="ckrop_0159"
FT   CDS_pept        203668..205278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0159"
FT                   /product="putative membrane protein"
FT                   /function="Predicted transporter component"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16952"
FT                   /db_xref="GOA:C4LGA2"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGA2"
FT                   /protein_id="ACR16952.1"
FT                   /translation="MLITGLVLGTVLGYVMQRGRFCVTGMLRDIFTLKTWRGFVALLVV
FT                   IAVHAVGLAALTSLGVITPEVDDFAPFAVIIGGFLFGVGIVLAGGCASGTWYRSGEGLV
FT                   GSWIALLTYGLSAAAMKAGALQGINSGLREYTVPLTTIQQSLGVSTWALALPLAVLTAF
FT                   LVAKFVRAEAAQPKIAQLAAKKTGLAHLLAEKPWHVYTTGAIVGVLGVIAWPLSAATGR
FT                   NDGLGITTPSSDLVRFVTTGDATRINWGALLVLGILIGSYLAAKASGEFRVRVPSGTQS
FT                   VRSVAGGVLMGVGAAWAGGCTVGNGMVQTSLFSYQGWVALLFIALGVGFAAKLWLKPAE
FT                   PINPQDPDGYTLSPSTADATRAASAGGLAVTSAGDADLTPEPSGVESSGVLAESGDRKS
FT                   PEREPVLVGTSAGDGSVADSELGVGGFATAVGLPAVSVLERPADGGPNDVSPKLRGGLR
FT                   RVGERRFVLDTLGAVCPFPLIEAKAAMQQLSSGDELVIDFDCTQATDAIPRWAATDGHE
FT                   VTNFEATDDAGWTITVRKG"
FT   gene            complement(205298..206272)
FT                   /locus_tag="ckrop_0160"
FT   CDS_pept        complement(205298..206272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16953"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGA3"
FT                   /protein_id="ACR16953.1"
FT                   /translation="MSGSQAFTAGPPDPVSGSHAITAGGSKVAAGGASKSGPTGVLTST
FT                   KGLIGAAILGGGAVVGGGVAYNHYTTNDDSSEPTTYTHLFDDMPIGKDVLGGGDGVGFR
FT                   LADTNFNCYIGFSANMMNMLDCFQTDKHDPAEGAGSRQDSEQKFVYPQQEFKDNGDFYY
FT                   GGGVLHPGEKAPFHDTVCGVFEDKKATCIVDNNRIDFTDQGYTITKRKGDGTGVTGSKC
FT                   GDVEAPLATYNDETIKAPVLVHQGDVDCSHTFEAMQNYVDTRHFGSSSDNYEESTAPDK
FT                   NGWTCKPNEVVYKDDEDPNAIPGAASCKDSDGNIVYTPRQYYL"
FT   gene            206527..206664
FT                   /locus_tag="ckrop_0161"
FT   CDS_pept        206527..206664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0161"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16954"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGJ9"
FT                   /protein_id="ACR16954.1"
FT                   /translation="MGIESDACLLRPSVASAVDLAVVVLAEALQVAKIVAGAGSRARVD
FT                   "
FT   gene            complement(206669..206998)
FT                   /locus_tag="ckrop_0162"
FT   CDS_pept        complement(206669..206998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0162"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16955"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGK0"
FT                   /protein_id="ACR16955.1"
FT                   /translation="MKNMNEQQWGQKHRGEAWGDTENQNGNNPQNNNVPNDQNNVPNGQ
FT                   TAQSNGQWGAGTQSDTQPTTTFPPQGFNGPQGFNGPPPNGQFNYPPTPGNPPQPVNQPW
FT                   PGNQP"
FT   gene            207196..207864
FT                   /locus_tag="ckrop_0163"
FT   CDS_pept        207196..207864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0163"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16956"
FT                   /db_xref="InterPro:IPR025971"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGK1"
FT                   /protein_id="ACR16956.1"
FT                   /translation="MKVSSSHVVKGIALLASVVVLAGCNQGGDNDNSQATDQPTSEVTK
FT                   SSIATPSSENAAASEDSSSGAAESDEQDADSDNQTAAQQRKDQESGTDNIAAREYQDHA
FT                   AEVPPPSSGEWDIDLSSFLENQPCAALSWAVLVPMKIVDGSPPTQTMLFHNGRFIKTVS
FT                   QKTTYSPDVSRVDDSTINVNWKWSKPGDPLAEKTGRSFATFRWDDQSESVVMEGELPPD
FT                   "
FT   gene            208363..209829
FT                   /locus_tag="ckrop_0164"
FT   CDS_pept        208363..209829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0164"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16957"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGK2"
FT                   /protein_id="ACR16957.1"
FT                   /translation="MMSYPLLMVRICRKASTCETITKVSTKKLMLPSIRDHWWFVTEEK
FT                   NNGGIFRPPDCLDGNIVSMSINGDSLIALDKDGWMYTLSNLLSSPTRWGWIRAWGGPVW
FT                   LGKGLQSPTTEEGKWSFTLIDNNVDKTYSTPDGKEQPISYAKVTQVVALGQDGSHLYSL
FT                   DPWLARDYSYEIGTPFNSRFQAESVSASGSVIFITNKYGDMYTKLSDYDVRGADPAQFR
FT                   YQWNDPNNPDERPSATNALQQRLDNNTAPIAIEGQEWTHQPKIPGTITSRISIHTTAPG
FT                   STNRELRVEGTNSDGESGYWHKALDDKNWAFTATGLPLEGRKLENSSADRRTDTLADES
FT                   PFSYEGKVTDNASLSIDHFAYASENHDITVTVNGKKYPLLLETVDGRLGTPLSQRVSPG
FT                   EGEFGSRPAGLVEGIPRNYVAAIRVPQETKQAAEHDPELKSFLETYLKGEDPHQIFARV
FT                   TLSEFQIINSLVKDVAVPAPGAVATLKSVD"
FT   gene            complement(209861..212146)
FT                   /gene="manP"
FT                   /locus_tag="ckrop_0165"
FT   CDS_pept        complement(209861..212146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="manP"
FT                   /locus_tag="ckrop_0165"
FT                   /product="mannose specific PTS system component"
FT                   /function="Phosphotransferase system, fructose-specific IIC
FT                   component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16958"
FT                   /db_xref="GOA:C4LGK3"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR004715"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGK3"
FT                   /protein_id="ACR16958.1"
FT                   /translation="MCIASESKSNRKCISVEPAGVSKTRVVPMSTDGNREPSLGGTAAI
FT                   DQSTVNGSSAVDGENPSVAGSTILAITACPTGIAHTYMAAEKLEAAAKEAGTTIKVETH
FT                   GSIGVDNAFSHADIAAADAVIIAADIAIDKERFVNKRLVTAGVDAAISHPEDLLRRALV
FT                   APRWGQHGKENQGGDGDHGAGTGGRGGSGCLSPDADGTSMNGSASGSMSGESLNPATVI
FT                   YRALMAGVSRMIPFVVTGGLLIAVALSLGGHPTSEGMQIPKDSFWYDINQLGTLAFSLM
FT                   VPVLSAYIAEGIADRSALAPGFITGMVAVTGSLYGSEAGTGFIGGIVTGILSGYVALAI
FT                   RKIPVNKYVAPIWPIIVIPIVTTLIVGLLVIYVIGAPIASLFDDLTHWLASMNGTSSVV
FT                   LGAVLGAMIAFDMGGPFNKTAFLFGGGLIAAGNAAPMGMNAAAIAVPPLAMGIITFIRR
FT                   QWFTKPEKDAGIAALIMGCFGITEGAIPFAAARPFQVIPANVIGGAVAGALAGLWGVKD
FT                   NVMHGGPIVAVLGAIDGVVWFFIAVLAGIATTVAVMIGLTRISMSRSEHSPTSTSNASD
FT                   AGASSPRNTGAVSTSEPAGVVSGAKPAEESETPHLIDETLVVLDDDAPSGKREDVIRGL
FT                   VNHAVTAGRITDGEAVIQAALAREEQSTTAVGNEVAIPHARLAGVATPTVLFARIPDDG
FT                   VEWNSPDDKSVRFVFLIAVPEGANKKHMKILAQLARALMRDNFRTHLRDATTRGEIVDA
FT                   VRKAVGNL"
FT   gene            212556..214457
FT                   /locus_tag="ckrop_0166"
FT   CDS_pept        212556..214457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0166"
FT                   /product="putative BCCT family transporter"
FT                   /function="Choline-glycine betaine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16959"
FT                   /db_xref="GOA:C4LGK4"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGK4"
FT                   /protein_id="ACR16959.1"
FT                   /translation="MPASSHSSPPDQSGSSPRQHSAESPHPRRGTPQQVAQALKRAVNP
FT                   EPRLHPGLIPGLSVEDTDRKFPTNKTVFVVALTVAVAVVLWAAVAPGSISVVGADMQEW
FT                   ITTHFAWLLGGLMIAVLLFMLIVGYGPTGNIKLGADDSRPDYSTGSWIAMLFAAGLGIG
FT                   LIFYGPLEPLTHLLDPTPATDAKSGTMAAVLPSMSATILHQASLAWAIYAFVGGAIAYS
FT                   SYRRGRLSLISSIFEPVFPDGTHKILGGIIDIFAVLVTLFGTAISLGIGALQIRTGTSL
FT                   LTGKEIHGNAFLIGAMVLLTVVFIFSAVSGIKRGIRMLSNANMIIVVALAAFALITGPT
FT                   LFILDLFPTSIYALCQNFTAMMSISPSQGDAEKEFLTSWTTMYWAWWVSWSPFVGMFIA
FT                   KISKGRTLRQFTTVVIFVPALISTAWYTIYGGTAMWMNMKGPGLEVKGSGENVMFDLLD
FT                   NLPLTPITSTVVLIAVVIFFTTAADSATNVVGSMSQSGRALPSTPITIMWGVTLGLIAI
FT                   FLLLAGGQDALSGLQSIMVTSAFPFVFIVIGIMIAWAKDLRQDPYMIRRTYAREAISRG
FT                   VHRGIDMYGDDFVFGTSRVPSEQGAGAEFHSDDPSLTDWYVDHRGASTEGDDDNENG"
FT   gene            complement(214513..215892)
FT                   /gene="gntP"
FT                   /locus_tag="ckrop_0167"
FT   CDS_pept        complement(214513..215892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gntP"
FT                   /locus_tag="ckrop_0167"
FT                   /product="gluconate transporter"
FT                   /function="H+/gluconate symporter and related permeases"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16960"
FT                   /db_xref="GOA:C4LGK5"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGK5"
FT                   /protein_id="ACR16960.1"
FT                   /translation="MLTPLAADSTVTVHASHGQLIMAACVSIALIIVLITWLKLHPFLS
FT                   LLVGSGALALLAGITLTDTFTAFSSGMGSTVGGVGVLIALGAIIGALLVETGAADEIVD
FT                   TFLEHTSEHRLPWVMATLAFLIGIPLFFEVGLVLLIPVVMLVARRVHAPVVLLGIPALA
FT                   GLSALHGLIPPHPGPLIAIDSLSANLGLTLGLGLIVAIPTVIISGPISARFMAKWVPVP
FT                   APDTFDTDKNIPRESRPSFGVGISVILLPVVLMLARTVEETIGIDKGSAFGNALDFVGE
FT                   PLVALLITTFYAMIMLGLRTGHSLKETSDVAGGSFGPIAGILLIVGAGGGFKETLVETG
FT                   VATVIGDWIHGVGLSPILAGWLVAVAIRLATGSATVSTITTAGIMAPAAANLTDTHTAL
FT                   LVLAIGVGSVFLSHVNDAGFWLVKEYFGMTVGQTFKTWSLMETILSVTGLVSIMLLSLV
FT                   I"
FT   gene            complement(215892..216428)
FT                   /gene="gntK"
FT                   /locus_tag="ckrop_0168"
FT   CDS_pept        complement(215892..216428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gntK"
FT                   /locus_tag="ckrop_0168"
FT                   /product="gluconokinase"
FT                   /function="Gluconate kinase"
FT                   /EC_number="2.7.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16961"
FT                   /db_xref="GOA:C4LGK6"
FT                   /db_xref="InterPro:IPR006001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGK6"
FT                   /protein_id="ACR16961.1"
FT                   /translation="MDLSVPLHIVVMGVSGSGKTSVAQHLHDSTGFPYAEADDFHPQSN
FT                   IQKMESGIPLTDDDRWPWLRALRDWMSEHGDAGESTVVTCSALKRAYRDLLSEAHGNVL
FT                   FVHLDGPMELIANRMELRSGHFMPRSLLPSQFDTLETLEGDENGITLDISQTIEELDKQ
FT                   VLAIAQRSADAGGHV"
FT   gene            complement(216730..217920)
FT                   /locus_tag="ckrop_0170"
FT   CDS_pept        complement(216730..217920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0170"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /function="Glutamyl- and glutaminyl-tRNA synthetases"
FT                   /EC_number="6.1.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16962"
FT                   /db_xref="GOA:C4LGK7"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGK7"
FT                   /protein_id="ACR16962.1"
FT                   /translation="MGIAREHTQAPGADSIPKAHSTPEEPSKLGAGRFAPSPSGDFHLG
FT                   NLRTYTLAWLFAHSTGRRMLYRIEDIDQQRSHDSAALDQMEDLASFGMDWDSEPIKQSD
FT                   RFPLYDEALHWLAERGWVYECYCSRKDIREASRAPHVAPGMYPGTCRNLTDEERHEQCA
FT                   KLAEQGRKPAIRFNAHAAYEAVVGNDYATNGSHTTAPGLWTIHEDFATYGQQLDSAPSS
FT                   DSTQSSVPSGYSGPVDDIVLHRGDGNWAYNLAVVVDDLTMGVDQITRGDDLLSSAPAQN
FT                   FLATALHPWATHTSATTSATTSATPAVHPTRWRYNHVPLVVTKQEMKGHENTDHQLKRL
FT                   AKRDGAVTVRELGHDTAWAWVARSLGHSECASAPELLQVIDLEAMSHEPVVWTPPQ"
FT   gene            complement(217946..219229)
FT                   /locus_tag="ckrop_0171"
FT   CDS_pept        complement(217946..219229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0171"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /function="Queuine/archaeosine tRNA-ribosyltransferase"
FT                   /EC_number="2.4.2.29"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16963"
FT                   /db_xref="GOA:C4LGK8"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGK8"
FT                   /protein_id="ACR16963.1"
FT                   /translation="MTESPTVAGSRATDTSFDVINSAGKARAGVIHTPHGDIPTPAFIP
FT                   VATKATVKMLTPEQIRATGAQAILSNAYHLYLQPGPELVDEAGGVAKFENWHGPTYTDS
FT                   GGFQVMSLGVGFKKVLAMDTKDIKPEDVKARHKERYAHVDEDGVNFRSVINGSKHRFTP
FT                   EKSMQIQHGLGADIMFAFDELTTLMDSREYQEESVERTRRWAQRCLEEHNRLTETRAGK
FT                   PLQSLWGVVQGAQYEDLRRHAAQSLVDMSDQFEAEGRRGFGGFGIGGALEKSALGTIVG
FT                   WVTDVLPENKPRHLLGISEPDDLFTAIEAGADTFDCVSPTRLGRRGGVYTLDGRLSLKT
FT                   ARFTRDFRPIDDEIEGYVSQYSRAYIHHLLKAKEFLAGTLCSIHNIQFIVSLVHNARQA
FT                   LIEGRFHEYRDEFLGRYYANGGRAPEWK"
FT   gene            complement(219316..220722)
FT                   /gene="cfa1"
FT                   /locus_tag="ckrop_0172"
FT   CDS_pept        complement(219316..220722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cfa1"
FT                   /locus_tag="ckrop_0172"
FT                   /product="cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /function="Cyclopropane fatty acid synthase and related
FT                   methyltransferases"
FT                   /EC_number="2.1.1.79"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16964"
FT                   /db_xref="GOA:C4LGK9"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR020803"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGK9"
FT                   /protein_id="ACR16964.1"
FT                   /translation="MVKIPGLARHATSMVGADPTIMSALISTPLTKLIRPASHPMTVGE
FT                   IIDAIADFPIRVTAFDGSSAGGTNGAATSADASGDMGIHITKDGLAYIATAPGELGLAR
FT                   AYLTDNLRVSGTHPANPYDLFGVLRTVRLKKLSPSTVRRIIGSLAAMDAFRNLPQPPQE
FT                   MVPFWQRAIDGLSRHSQQRDAESISHHYDVSNRFYELFLGPSMTYTCAYYPDPSATLEE
FT                   AQENKYRLIFDKLRLQPGDTLLDVGCGWGGMVRYAARHGVKAIGATLSREQAEWANEEI
FT                   ARQGLSDRAEVRFQDYRDIPETDFDAISAIGILEHIGTANYHDFFSFLFNKLRPGGLIL
FT                   NHCITRPINEAKTNAGPFLDRYIFPDGELHCSGNIIANMQGAGFEVMHEENLRPHYART
FT                   LKAWCNNLEENWDAACEEVSEATAKLYGVYMAGSAWGFDHNIVQLHQALGVKPLQDGTM
FT                   AVPEHQWWES"
FT   gene            complement(220757..222055)
FT                   /gene="cfa2"
FT                   /locus_tag="ckrop_0173"
FT   CDS_pept        complement(220757..222055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cfa2"
FT                   /locus_tag="ckrop_0173"
FT                   /product="cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /function="Cyclopropane fatty acid synthase and related
FT                   methyltransferases"
FT                   /EC_number="2.1.1.79"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16965"
FT                   /db_xref="GOA:C4LGL0"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGL0"
FT                   /protein_id="ACR16965.1"
FT                   /translation="MTVADIIASITKGPLPFKVEAYDGSSIGSGDITVRLENEDALAYI
FT                   ATAPGDLGLARAYVTGALTVEGKGSHPAHPYVLFDDLQKAYSTISISKNPRVIAKLIRE
FT                   LRNHHAFRRLPIPHQEVIPGWHKALRGAMEGVAKSTRRHSKARDAQAISHHYDVSNSFY
FT                   EHFLGPSMTYTCACYPTENATLEEAQENKYRLVFDKLRLKEGDRLLDVGCGWGGMVRYA
FT                   AKRGVHALGVTLSHAQAEWANEEIKRQGLEEFAEVRYQDYRDVPESDFDAVSAIGILEH
FT                   IGPKNYRSFFSFLYGKLRPEGMILNHCITRPHNRPTRTGQFIGRYIFPDGELTGAGTII
FT                   TRMQDVGFDVVHEEDLRPHYAHTLRDWCLNLQKNWDEASTLVEPSTARLFGLYMAGSEW
FT                   GFDHNIIQLHQVLGQKLPDDGTWNLPLRPWWKA"
FT   gene            complement(222229..223908)
FT                   /locus_tag="ckrop_0174"
FT   CDS_pept        complement(222229..223908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0174"
FT                   /product="putative secreted protein"
FT                   /function="FAD/FMN-containing dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16966"
FT                   /db_xref="GOA:C4LGL1"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR040165"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGL1"
FT                   /protein_id="ACR16966.1"
FT                   /translation="MTLRDHLRPSALFGDSALGTTARSAAEGLSSAAVSGVSRVGSHIG
FT                   VDPDVVPGPRGGLPPEELTAAHWGNGSRRVIDPIGWFEHQKGIDELQKSFDAIPSEAQV
FT                   RLAKKTSNLFRSRTATKTPGLNVEGLGRVIAVDTKAQTADVQGMCTYENLVDTLLPFGF
FT                   APYVVPELKTITLGGAITGMGVESSCFRNGLPHESVIEMDILTGTGDIVTCSPVENVDL
FT                   FRAYPNSYGSLGYAVRIKIKIEKIKPFVELRHVRFHDLTSIAAAIDSIVSSHEYDGEPV
FT                   DHLDGVVFSPTEGYLVLGRQSAEIPPRVSDYTGEHIYYRSLQHPEGTTRDTLTTHDYLW
FT                   RWDTDWFWCSRAFGAQNPTIRRMWPDGLLRSSFYWKIVGADKRWDLADRIEAHHGRPAR
FT                   ERVVQDVEVTTDKVPEFLEWFFQASEIQPVWLCPIKLAEESSSLTTRGNVLSSDVALAD
FT                   GAGSHPWPLYPLSVGDVWVNIGFWSSVPVDLTDDPQPGAFNRVIERKIRDLGGHKSLYS
FT                   EAFYSKEEFSALYGGSIPELVKNIYDPNHRFPGLFDKAVGGK"
FT   gene            complement(223905..224861)
FT                   /locus_tag="ckrop_0175"
FT   CDS_pept        complement(223905..224861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0175"
FT                   /product="hypothetical protein"
FT                   /function="Predicted glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16967"
FT                   /db_xref="GOA:C4LGL2"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGL2"
FT                   /protein_id="ACR16967.1"
FT                   /translation="MPAKSHAVSSPSGSRRSSSQFQIGLILPDVLGTYGDDGNALIVRQ
FT                   RLRLRGVAAEIVPIHLGDPVPDSLDLYTVGGGEDTAQILASEHLRADGGIIRAANKGTP
FT                   ILAICAGLQVFGQSFRASGSMVDGLGLLDATTSSLKVRMIGELRSEPLQAEQQDAGSSQ
FT                   DATSVRTDDFTRGLTDQLTGFANHMGATILGPDARPLGRVLHGTGNCDAYGAEAVHLEG
FT                   DEADYQTSAEGAVQGSIIATYMHGPALARNPQLADVLIARALGVEVDDLPPLGDDIDPS
FT                   IRGGLDSLDMGSRHLELARELNNEVSQLRRERIDFTS"
FT   gene            complement(224851..226329)
FT                   /locus_tag="ckrop_0176"
FT   CDS_pept        complement(224851..226329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0176"
FT                   /product="putative UDP-N-acetylmuramyl tripeptide synthase"
FT                   /function="UDP-N-acetylmuramyl tripeptide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16968"
FT                   /db_xref="GOA:C4LGL3"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR013564"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGL3"
FT                   /protein_id="ACR16968.1"
FT                   /translation="MSSLHAFRRRADQVLRSSADSVSDSLEARITSVTSDTPKAQLNTQ
FT                   GRAALALADAATWASKKTGRGSGGMIGGMIAAAIDPMIMGRINAGRPIALVTGTNGKST
FT                   TTRMLAAAARTAFTTATNEGGDNMDAGVVSALRAGGDYDVATLEVDEMHVPAIADKLDP
FT                   QVLVLLNLSRDQLDRVGEINSIERALRGAVNKHPNMTVVANCDDVMVTSAAWDSPNVVW
FT                   VSAGLGWQGESTSCPRTGGAIIRREVSDESDSTNHVEWYAAKPLPDGSEFRRPSPDYSM
FT                   TPDGLRIDSASAAKATGLPAGTVLPLTLSLPGDANRGNAAQAVVAALALGADVKKGLAA
FT                   TENVQSVAGRYSTVSYAGRDVHLLLAKNPAGWQEALSMVDRSADGLVIATNGQVADGVD
FT                   LSWLWDVRFENLDELAVVAAGERGADLAVRLGYAGVRHQLVKDALEAIKTCPPGRVEVL
FT                   ANYTAFRDLKRALDRAVAKESKQNTADKEDTDAR"
FT   gene            complement(226508..228421)
FT                   /locus_tag="ckrop_0177"
FT   CDS_pept        complement(226508..228421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0177"
FT                   /product="DNA polymerase III, epsilon subunit"
FT                   /function="DNA polymerase III epsilon subunit and related
FT                   3-5 exonucleases"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16969"
FT                   /db_xref="GOA:C4LGL4"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGL4"
FT                   /protein_id="ACR16969.1"
FT                   /translation="MTSTSDHSSTSRGSDARTSHSHDVDADRGGNNTGGSRSNDGHRRS
FT                   RNNSRARRERRRRRATYSAQHGNKQQRAKDGSGSSTSNESSSGDNSSSQHGRNKNRRRA
FT                   RRRSNRPAAAPNAGQRSQQHEPKDQRPARQQEQSDSSTRPARRKPSSGTQPSSVTRAPA
FT                   TRKSGTRAPATPGPRRGHRGLTAEGVITNPDKDKYNAGNTHVRSPREPIPSIEDAPMVA
FT                   VVLRTTNIHPSTGRMLALDAAFFDADGLPVSNWQRVFNTDADPGPLHLFGLAPDAFRTA
FT                   PRFSSTLRQIDRVIDGRVLIVHDTATTWGFIAQEARRTVRSASAKNRRQRRRRHNGHVP
FT                   RPVSIIDTQATARRQGLPIAETRLRGIAAAYNLVDDTLPATTVLDMGSSPDAYTTLPGV
FT                   GAEASELRRSIDPLQLLQADAVLVGELAMEQLDRAGIEPISAAAFALHEARERRGDDRS
FT                   DSGRSDDHRDDEDHSDETGVGKKDNERPDDAPTPLVWADDDAWDNVDKRDPHDLRADRV
FT                   GLQRSAIRIDAALAPVIAPNPGVWSPGQKLKRGMVFTVAPEVDMNPDDLIEAAVRAGLT
FT                   YSEKLTRETSLVVFNGTGHGLEHDGAPHEGRALHAHRKGIPLVRDTEFMRLAEEATDAE
FT                   QR"
FT   gene            complement(228432..229214)
FT                   /locus_tag="ckrop_0178"
FT   CDS_pept        complement(228432..229214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0178"
FT                   /product="putative short-chain alcohol dehydrogenase"
FT                   /function="Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16970"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGL5"
FT                   /protein_id="ACR16970.1"
FT                   /translation="MSTSQHKNIFISGGASGIGREVALRFHKEGWIVGVYDIDAAALEE
FT                   LSRDYPDIITGELDVTNYNQWEEALADFTAHTGGRLDVLDNNAGIIGDHDIVDQSPEII
FT                   KKQCDINCTGVIYGARAAHPYLSRTPGAHLVNMGSAAALYGQPHITPYSASKFFVTGFT
FT                   QALDLEWRKSKIRVVALQPLWVQTALADVDAASTKRLGVRITPEQVAEVVWKAVHPANF
FT                   FERQRHFYSVSGLDLTLRYLIRLVPSFITRNVNKFVAG"
FT   gene            229215..230870
FT                   /locus_tag="ckrop_0179"
FT   CDS_pept        229215..230870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0179"
FT                   /product="putative aldehyde dehydrogenase"
FT                   /function="NAD-dependent aldehyde dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16971"
FT                   /db_xref="GOA:C4LGL6"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGL6"
FT                   /protein_id="ACR16971.1"
FT                   /translation="MINLTFFGRCSRTLRNMFAPKCSTFLPDRLPQGPLPDDLAAELRA
FT                   LTVNTTTGSVATEKRHNVENPWDGATVGWVGIGTTDDVTHAFRRAREVQKTWRETPFDQ
FT                   RKQILTRFHDLVLKKRDLLLDIIQLETGKDRASAFDEVMDVANNARYYANSAEKLMRPA
FT                   RRTAGIPVLGRAREYRSPKGVVGQITPWNYPLTLGISDAIAAIAAGNTVVAKPDSDTPF
FT                   CSLICVQLLKDAGLPADVIQIITGEGRVVGSAIADACDYLMFTGSTKTGQRLGQQVGRR
FT                   LVGFSAELGGKNPMIITGDADARRAASRAVNACFSNSGQLCVSIERIYVVQEIYDDFVS
FT                   AFSAEVNRMKLGAGFDWSVTMGSLVSKEQLATVESFVEDAREKGARILAGGRARPDLGP
FT                   CFYEPTVLEGVSDDMRLKREEVFGPVVYVERVNTVDDALARANDTNYGLNASIVGPSDT
FT                   AWNIARRVEAGTVNINDGYAAAWSTVDAPLGGVKDSGMSRRHGAEGLLKYTESHTIVEM
FT                   RGMSVSGPRFLSRKLYAAIMGRLLSVGQKLRLLK"
FT   gene            complement(230873..232714)
FT                   /locus_tag="ckrop_0180"
FT   CDS_pept        complement(230873..232714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0180"
FT                   /product="2-isopropylmalate synthase"
FT                   /function="Isopropylmalate/homocitrate/citramalatesynthase
FT                   s"
FT                   /EC_number="2.3.3.13"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16972"
FT                   /db_xref="GOA:C4LGL7"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005668"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="InterPro:IPR039371"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGL7"
FT                   /protein_id="ACR16972.1"
FT                   /translation="MSPVDEFISAPAHISTPDGDIPADQPSWNKQRPSQMPAGRYQPYF
FT                   TEVEHITLPDRTWPDKTIDHAPVWCAVDLRDGNQALIDPMSPERKRRMFELLVTMGYKE
FT                   IEVGFPSASQTDFNFVREIIEQDMIPDDVTIQVLVQAREHLIRRTFEACEGAKNVIVHF
FT                   YNSTSILQRDVVFRKDKEGIKKLATDAAELIKSIATDYPGTNWRWEYSPESYTGTEVAY
FT                   AKEVCDAVVEIMDPTPENPIIINLPSTVEMTTPNVYADSIEWMDRNLNRRDSIIISLHP
FT                   HNDRGTGVATAELGFMAGADRIEGCLFGNGERTGNVCLVTLGLNMLTQGVDPQIDFSDI
FT                   DKIRHTVEYCNQLRVPERHPYGGDLVFTAFSGSHQDAINKGLDAMVDKAEKSNATDDTT
FT                   DTERDRQRIVHRVPWEVPYLPIDPKDVGRTYEAVIRVNSQSGKGGVSYIMKTDHGINMP
FT                   RAVQVEFSGVVQAVTDAEGGEVNSKNMWDIFAGEYLDRDDPIDAISITVDGGQNENEGA
FT                   EVSAHLIINGEEQTITGHGNGPVAAYTNALESIGINVEVQDYSQHSRTSGDDAEAAAYI
FT                   LADVDGTKVWGVGIASSITYASLKAVTSAANRARAAA"
FT   gene            complement(232957..233805)
FT                   /locus_tag="ckrop_0181"
FT   CDS_pept        complement(232957..233805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0181"
FT                   /product="putative membrane protein"
FT                   /function="Permeases of the drug/metabolite transporter
FT                   (DMT) superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16973"
FT                   /db_xref="GOA:C4LGL8"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGL8"
FT                   /protein_id="ACR16973.1"
FT                   /translation="MHNNALAILFALASALTIAWGTVVRHRIAEEVPNDDDGGAPILTV
FT                   ITKPLWWAGTFCALGGYGLQVIALAFGTLLVVQPILVLSLMFTLPLSARYDGRRVSLSE
FT                   MTWAGLLTAAVAVLVILGRPIPGNTHPSLMTWILAVVTGIVVLTAIDRFAYRQIRREQA
FT                   LLLGVVTGAVFGYVAVFSKAAIDVFVQDGIVGGLLAWQTYALIIGATIGTAVQQSSFNA
FT                   GALKNSLPAMTITEPIVAFSLGYIVLGEYFQVHGMGWVVMAIALVVMIVSTTVLSRKGV
FT                   D"
FT   gene            233903..235300
FT                   /locus_tag="ckrop_0182"
FT   CDS_pept        233903..235300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0182"
FT                   /product="aspartate kinase"
FT                   /function="Aspartokinases"
FT                   /EC_number="2.7.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16974"
FT                   /db_xref="GOA:C4LGL9"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGL9"
FT                   /protein_id="ACR16974.1"
FT                   /translation="MPRADEERQNPVALIVQKYGGSSLENAERIRRVAERIVETKKKGH
FT                   DVVVVCSAMGDTTDEFLDLAAQVNPVPPAREMDMLLTAGERISNALVAMAIESLGAHAQ
FT                   SFTGSQAGVLTTERHGNARIVDVTPGRVQEALDEGKICLVAGFQGVNRETKDVTTLGRG
FT                   GSDTTAVALAAALNADECEIYSDVDGVYTADPRIVHNARKLDTISFEEMLELAAVGSKI
FT                   LVLRSVEYARAFNVPMRVRSSYSTDPGTLVTGSMEDIPVEEAVLTGVATDKSEAKITVL
FT                   GIPDTPGEAARIFRAVSDAEINIDMVLQNVSSLSDNKTDITFTCPRADASRAVEMLKKL
FT                   CEVPRDENPTVPVSDTPADAAKASMQPGSGASESAATAQPRVLFDDHVGKVSLVGAGMK
FT                   SHPGVTADFCEALRDAGVNIELISTSEIRISVLIRDSDLEKATRALHERFALGGDEEAV
FT                   VYAGTGR"
FT   gene            235381..236433
FT                   /locus_tag="ckrop_0183"
FT   CDS_pept        235381..236433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0183"
FT                   /product="Aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16975"
FT                   /db_xref="GOA:C4LGM0"
FT                   /db_xref="InterPro:IPR000319"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGM0"
FT                   /protein_id="ACR16975.1"
FT                   /translation="MTTIAVVGATGQVGRVMRSILEERNFPCDKVRFFASSRSAGTTLP
FT                   FRGDDVVVEDVAATSDEDLKGIDIAIFSAGGAVSKEQAPRFAAAGATVVDNSSAWRKDP
FT                   EVPLIVSEVNPGDKDKAVKGIIANPNCTTMAAMPVLKILHDEADLKVLHVASYQAVSGS
FT                   GLAGVKALKEQTDAVEKRDDVDLAHDGSGVQRVIDEEKLGYGPYVAPIAFNALPFAGNY
FT                   VDDGSDETDEEQKLRNESRKILNIPDLKVAGTCVRIPVFTGHTMVVHAEFARSITPERA
FT                   RELLDKAPGVEVVDVPTPLESAGIDDCLVGRIRQDQTIDDDRGLVLVVAGDNLRKGAAL
FT                   NTIQIAELLV"
FT   gene            complement(236521..237207)
FT                   /gene="sigC"
FT                   /locus_tag="ckrop_0184"
FT   CDS_pept        complement(236521..237207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sigC"
FT                   /locus_tag="ckrop_0184"
FT                   /product="ECF-family sigma factor C"
FT                   /function="DNA-directed RNA polymerase specialized sigma
FT                   subunit sigma24 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16976"
FT                   /db_xref="GOA:C4LGM1"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGM1"
FT                   /protein_id="ACR16976.1"
FT                   /translation="MEDRSIAFLQTPGRGDFLHQLGKVNTVTRHDKDDARVTALALRAG
FT                   QGDRAALTEFIRRTQKDVWRLLAHLADIDRADDLTQETYLRIISALPTFAGRSSARTWL
FT                   LSVARRVWVDSVRHDMARPQSTGTEWETVADQHTATNTAASSSWSDWVDVQLLMENLDP
FT                   DRREALILTQVLGYTYDEAATIVGVRVGTIRSRVARARTDLIEATSNHATKKHRHLSSV
FT                   QERAHG"
FT   gene            237334..238989
FT                   /locus_tag="ckrop_0185"
FT   CDS_pept        237334..238989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0185"
FT                   /product="Catalase"
FT                   /EC_number="1.11.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16977"
FT                   /db_xref="GOA:C4LGM2"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024708"
FT                   /db_xref="InterPro:IPR024711"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGM2"
FT                   /protein_id="ACR16977.1"
FT                   /translation="MSNDSSHDQRFTSDDVAQRGVCPVTGHGAPQADGRSISTRVNGAP
FT                   NASEEHSVTVGREGPIALHDVSLVEKLAHFNRERIPERVVHAKGSGAFGELTITEDVTQ
FT                   YTKADLFQPGRVTPMLARFSTVAGEQGSPDAWRDVRGFALKFYTNEGNYDLVGNNTPVF
FT                   FIRDGIKFPDFIRSQKRLAGRGTIDADMRWDFWTRTPESAHQVTYLMGDRGIPKTFRNM
FT                   DGFGSHTYQWINAKGERFWIKYHFKTRQGWDFLTDEEAAKLVGEDADSHREDLYAAIER
FT                   GDYPTWDVKVQIMPLEEAAGYKVNPFDLTKTWSQKDYPLIPVGHFTLNRNPENFFAQIE
FT                   SAAFEPSNLVPGIGLSPDKMLLSRAFAYADAKRYRLGVNADQIPVNKPVCPVNSYAKDG
FT                   AAVYDFPPASEPTYSPNRFERGGGYMDVDGTDAEGTGAVQKDIAPGESKYGFGRGQESG
FT                   LGAAEELGLWDDNYGGDLTRGAYVRHPEDDDFSQAGALVRDVMDDAARDRLANNIVGAM
FT                   AGVSDQVAKQAFNYWTHVDEWLGAEVEKRFTASK"
FT   gene            239156..239587
FT                   /locus_tag="ckrop_0186"
FT   CDS_pept        239156..239587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0186"
FT                   /product="organic hydroperoxide resistance protein"
FT                   /function="Predicted redox protein regulator of disulfide
FT                   bond formation"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16978"
FT                   /db_xref="GOA:C4LGM3"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019953"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGM3"
FT                   /protein_id="ACR16978.1"
FT                   /translation="MSDALYTARVTSTGGGRDGHVASDDGHIDLDVRPPKAMGGSGEGT
FT                   NPEQLVAAGWAACFNSALQLIAKQSGADLDKAPEVTVECSLVKDENDGGFRIKAALDVT
FT                   IFGVSEDQAKDFAEQADAMCPYSKAFRGDSETVVTAHAK"
FT   gene            complement(239857..240039)
FT                   /locus_tag="ckrop_0187"
FT   CDS_pept        complement(239857..240039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0187"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16979"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGM4"
FT                   /protein_id="ACR16979.1"
FT                   /translation="MNFNYSKAADAASGMDDTVNSGSKAGDLAGQIDANTIAGWFGDIS
FT                   GLASNIVKLVGALIK"
FT   gene            complement(240080..240187)
FT                   /locus_tag="ckrop_0188"
FT   CDS_pept        complement(240080..240187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0188"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16980"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGM5"
FT                   /protein_id="ACR16980.1"
FT                   /translation="MPTGQQPFPGYFDEDAARYAVNIVEFILDTIGKFV"
FT   gene            complement(240242..240838)
FT                   /locus_tag="ckrop_0189"
FT   CDS_pept        complement(240242..240838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0189"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16981"
FT                   /db_xref="InterPro:IPR041100"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGM6"
FT                   /protein_id="ACR16981.1"
FT                   /translation="MNFFTSKISRIAAGTLAAAAVVAGSATPAMASSADWPSRWWDPSN
FT                   VIESPVNPDHAEGALNNVSFTNKADGSHTVQAQSFATVQVKADGTGFTPGQYYTVRAGL
FT                   VKSNETSNIVVYTWQTYRATEDGKINIDLGIKSPGSTQAGEQLIGTVNVYNANDVRQDG
FT                   RPQKVDQRCALMCKRVAPLASHSDFNDANSTISFT"
FT   gene            complement(240841..241149)
FT                   /locus_tag="ckrop_0190"
FT   CDS_pept        complement(240841..241149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16982"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGM7"
FT                   /protein_id="ACR16982.1"
FT                   /translation="MRAYMSGQIVSQNNDDGPCHRRIQHDTFSTSISFPYVVVAPSVVD
FT                   KDHHTWRKVMGADTNPNAYQPLDPPNDPYPAFHWITEIGPYLVEAANSMIGFALGRL"
FT   gene            complement(241187..241444)
FT                   /locus_tag="ckrop_0191"
FT   CDS_pept        complement(241187..241444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0191"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16983"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGM8"
FT                   /protein_id="ACR16983.1"
FT                   /translation="MSAFSYAAEAAQAASDSASSASDAASSAASTASEHASSASDAASS
FT                   ASEHASSFFDGFNINTLTSLIGSATTLASAIMGLVKGLAG"
FT   gene            complement(241936..243006)
FT                   /locus_tag="ckrop_0192"
FT   CDS_pept        complement(241936..243006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0192"
FT                   /product="aromatic amino acid aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16984"
FT                   /db_xref="GOA:C4LGM9"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024892"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGM9"
FT                   /protein_id="ACR16984.1"
FT                   /translation="MIRPDLDQLPTYTPGKKADDALVLASNETSEPPLPAAIEAITSAA
FT                   HTLNRYPHMATSPLHHAIADLHGVAINEVAIGCGSSSLLQQLILATCKDGDETLFAWRS
FT                   FEAYPILSRIAGATPVAVPLDAHHRHDLDAMADAITDKTSLIILCNPNNPTGTLVTEDE
FT                   LEAFFTRVPERVTVCIDEAYLDYTDDELTPDSLGLVRRHPNVCFARTFSKCYGLAGARV
FT                   GYMIGTPEIISALNRTQVPFSVSTMAHDAAIACLNSPESKAERVSRTIPQRHRLRDFLI
FT                   NEFIHSSRWNLTEYDIPESQANFLWLNLGGQSDAFTEALGKEHILVRCFSSDGVRITVT
FT                   NTDETDQLISTLRSIA"
FT   gene            243262..243349
FT                   /locus_tag="ckrop_t0005"
FT   tRNA            243262..243349
FT                   /locus_tag="ckrop_t0005"
FT                   /product="tRNA-Ser"
FT                   /anticodon="(pos:243296..243298,aa:Ser,seq:gct)"
FT   gene            243538..243613
FT                   /locus_tag="ckrop_t0006"
FT   tRNA            243538..243613
FT                   /locus_tag="ckrop_t0006"
FT                   /product="tRNA-Arg"
FT                   /anticodon="(pos:243571..243573,aa:Arg,seq:acg)"
FT   gene            complement(243862..243999)
FT                   /locus_tag="ckrop_0193"
FT   CDS_pept        complement(243862..243999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0193"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16985"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGN0"
FT                   /protein_id="ACR16985.1"
FT                   /translation="MPTVDYNFLRGVEAYKAAFPNALQGLDAERLHTVVEAMQSGVLAG
FT                   "
FT   gene            complement(244245..244673)
FT                   /locus_tag="ckrop_0194"
FT   CDS_pept        complement(244245..244673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0194"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16986"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGN1"
FT                   /protein_id="ACR16986.1"
FT                   /translation="MDFLLQINEITQGPIKDLLVELNNVGLPAPAPAPAPAEPPTFNVN
FT                   FPEQVGDFAPHLQVTTGDINMPLSGDTGDINTPLSGDNLNMPLSGDLSGKMPLSGDLSG
FT                   DMPLSNNNLPFSGDTGDINLPLSGNIAPNIGGDAGESN"
FT   gene            complement(245055..247202)
FT                   /gene="dccT"
FT                   /locus_tag="ckrop_0195"
FT   CDS_pept        complement(245055..247202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dccT"
FT                   /locus_tag="ckrop_0195"
FT                   /product="putative dicarboxylate uptake system"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16987"
FT                   /db_xref="GOA:C4LGN2"
FT                   /db_xref="InterPro:IPR004813"
FT                   /db_xref="InterPro:IPR004814"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGN2"
FT                   /protein_id="ACR16987.1"
FT                   /translation="MEQNDSSAHAAPKLRDDRQNASRNSSAHGSNNDSPNGPSNVAVQR
FT                   AASTREFTLRTVILGGLITLVFTAANVYLGLKVGLTFATSIPAAVISMAILRNFKDHTI
FT                   AENNIVQTIASAAGTLSAIIFVLPGLVMIGWWSGFPYWETAALCAIGGILGVMYSIPLR
FT                   RALVTHSDLPYPEGVAAAEVLKVGDTHAQDSVNDGDQSSAGSSAVDENRMGLRMIILGG
FT                   LASGGYALLAALKTVATEISAAFRIGSGGTMIGGSLSLALIGVGHLVGLSVGFAMVVGL
FT                   LISYGVLLPLRTAGHIPPGTGASGLESIVSDSFSSDVRFIGAGTMAVAAVWTLIKITGP
FT                   IAKGIKDSLVSSRARHSGKAVDITEQDIPFPVVAGVTLFSMIPIGLLLWLFVKDTSIAH
FT                   HTGGLIAISIIYILLVGLVVASICGYMAGLIGASNSPISGVGIIVVISAALLIKVAMGA
FT                   ESRSHSDVLIAYTLFTSAVVFGVATISNDNLQDLKTGQLVGATPWKQQVALVVGVLFGS
FT                   AIIPPVLQLMMSGFGFAGEPGAGDDALAAPQAALLSSVAQGIFGDSLDWSLIGLGAAIG
FT                   VSVVIINEIVSATSHGKYALPGLAVGMGMYLPSSLTVIIPIGALIGYVYNRWAKKQRNP
FT                   ELARRLGVLLATGLIVGESLFGVLNAGIIAAAGDSDVLAIAPKEWEAGAAVCGVVLFIV
FT                   CIGCAYRYSRTLARGSSIRES"
FT   gene            247292..248734
FT                   /locus_tag="ckrop_0196"
FT   CDS_pept        247292..248734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0196"
FT                   /product="putative inosine monophosphate dehydrogenase"
FT                   /function="IMP dehydrogenase/GMP reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16988"
FT                   /db_xref="GOA:C4LGN3"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR005991"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGN3"
FT                   /protein_id="ACR16988.1"
FT                   /translation="MRFLNGMVPQYDLTYDDVFMVPSRSSVGSRQKVDLHTNDGTGTTI
FT                   PLVVANMTAVAGRRMAETIARRGGLAIIPQDVPADIVAHTIASVKSSDLFFDTPITVKP
FT                   HHTAGYTRHLLPKRAHGAAIVVDDGKPIGLVTEKDLRGVDNFTQVGRLMSTSLVTLCDD
FT                   TTPQEAFACLSEASRKLAPVVSKDGELKGIMTRKAALRATLYQPAVDKNNALRVGAAIG
FT                   INGDATGRATALVEAGADVIVVDTAHGHQQHMIDVLRKVKALDLGVPIVAGNIVTADGV
FT                   EDLAAAGADIIKVGVGPGAMCTTRMQTGVGRPQFSAVKECADKAREVGVHVWADGGVRH
FT                   PRDVALALAAGASNVMIGSWFAGTLESPGDLIKENDGRAYKESFGMASHRAVEHRNLHT
FT                   EEFERARRSMFEEGISQARMYIDPERPGVEDQVDHIVSGVRSAFTYAGADTIETFRERA
FT                   IVGIQSAAGYAEGRPLSSSWKA"
FT   gene            complement(248752..249789)
FT                   /locus_tag="ckrop_0197"
FT   CDS_pept        complement(248752..249789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0197"
FT                   /product="Prephenate dehydrogenase"
FT                   /EC_number="1.3.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16989"
FT                   /db_xref="GOA:C4LGN4"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGN4"
FT                   /protein_id="ACR16989.1"
FT                   /translation="MSISTPSGVYPDPATTPGKHHILHEDRPVCILGLGLIGGSIMRDV
FT                   QARGRRVFGWDRTQSTVTNIIDDGFDASNDCSAVLERAEDEDALVVIATPMSAVGTMLD
FT                   RVVEHAPTCGITDVVSVKQAVIREVRARGMHDRFVGGHPMSGTSHNGWEASQTGLFTGA
FT                   PWVVTFDNAPTNDGDGGRWLREWMSVVNLAYDVGAEVVPARAQSHDAAVARISHLPHVL
FT                   ADALAVAGDSGGALALSLAAGSFRDGTRVASSDPELTEAMCENNVKEVLRAIEEVQTML
FT                   DEARESLRATPPSVAELADAGHRSRIRYEARTGKRPVLRLHPGDAGWVDQLKQAENLGA
FT                   RIEVF"
FT   gene            249828..250340
FT                   /locus_tag="ckrop_0198"
FT   CDS_pept        249828..250340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0198"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16990"
FT                   /db_xref="InterPro:IPR023869"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGN5"
FT                   /protein_id="ACR16990.1"
FT                   /translation="MNAGVNDDGQTPTFAVALTSQDGQWMGRILPERATWDLDVATRAV
FT                   RDLRSEGPSFGMVCVDDDWFVLIRPTPRGAQLLLSDATAAVVDDYAAEVLDELDVDVPD
FT                   MDPDERADAEPWPEGDLEILEDLGVPSDVLAVICDDDELWASEQLLRIAEEINADEELA
FT                   DVAQLDY"
FT   gene            250361..250852
FT                   /locus_tag="ckrop_0199"
FT   CDS_pept        250361..250852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0199"
FT                   /product="putative cytosine/adenosine deaminase"
FT                   /function="Cytosine/adenosine deaminases"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16991"
FT                   /db_xref="GOA:C4LGN6"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGN6"
FT                   /protein_id="ACR16991.1"
FT                   /translation="MIGAGLPRPVPEQQTERWMQMALDVAKRTPPGDVPVGAVVVDASG
FT                   HVVGEGCNERESTGDPTAHAEVIALRAAAREVGDGWRLENHTLVVTLEPCVMCAGAAVT
FT                   SRIGGIIFGAYEPKTGACGSVIDVVRDPAWPFPTVDVRGGVLERECQDLVEEFFARRRK
FT                   "
FT   gene            251047..251208
FT                   /locus_tag="ckrop_0200"
FT   CDS_pept        251047..251208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16992"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGN7"
FT                   /protein_id="ACR16992.1"
FT                   /translation="MDLDNLNDKAKDAISDNRDKVEEKANDVADSKLGDKADKAKEGVK
FT                   KGLDSLDK"
FT   gene            251317..251404
FT                   /locus_tag="ckrop_t0007"
FT   tRNA            251317..251404
FT                   /locus_tag="ckrop_t0007"
FT                   /product="tRNA-Ser"
FT                   /anticodon="(pos:251351..251353,aa:Ser,seq:cga)"
FT   gene            251613..253091
FT                   /locus_tag="ckrop_0201"
FT   CDS_pept        251613..253091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0201"
FT                   /product="permease of the major facilitator superfamily"
FT                   /function="Permeases of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16993"
FT                   /db_xref="GOA:C4LGN8"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGN8"
FT                   /protein_id="ACR16993.1"
FT                   /translation="MLSVALPTIVGSLHGGDHILWISTSYMLASTIFLPMYGKLGDRYG
FT                   LKKLFLFALIVFIISCVYGTFVNSMPALVITRFIQGMGGGGLVVLSQALLAAAVPRRER
FT                   GKYMGFIGSVFVISTVAGPVLGGLITEYWNWRWTFGVNVPFGIASLFLCIKFLREPEPE
FT                   KQSSRIDVAGMVLIGAVSTFLVLCTAWAGHGGWGQPKVVLCMVGAAACVVACMWVEKHA
FT                   GDPVLSPYILTNRNFFLATLIGMLLALGTFGVTTYLPAYIQIVEGIDAVTAGFVLLPMT
FT                   ALMFAFSLISGFMVSKTEKYRALLVTSGVFCVAGFLALSSLHTGSGVYVLIAVLCVLGV
FT                   GFGLGTQLSVLVVQNSFSTKVMGTATASNSLFRDLAGTLGMSVVGAFFASRASARFAET
FT                   GTGVSFASLTPESMKQLHEPVHSIIAQAYHDALIPVLGTFVPLMIAVVVAAIFVRDDRL
FT                   RDTGTVTRVRLTTRAKLLIPACNYRLPPFPSRPP"
FT   gene            253155..253748
FT                   /locus_tag="ckrop_0202"
FT   CDS_pept        253155..253748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0202"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16994"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGN9"
FT                   /protein_id="ACR16994.1"
FT                   /translation="MKAIESSEWVIDGALTVWEPSTQMAEAPEHTPTDPTPPSFLQKDH
FT                   IRGVLTQRQSGNTHRAYTCAVATLPGPLNTDAMTEAVNNFVCSHEGLRSTFVVNTDTAG
FT                   TQGADAGAADAAAAKAGGGQPEFGGASVERKTVPASAIDLVPRVLAEAPDGAGETTAND
FT                   ILNDYLPTHAVFDHFPGFVIGAVDKGKYCEVFMQ"
FT   gene            253799..254641
FT                   /locus_tag="ckrop_0203"
FT   CDS_pept        253799..254641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0203"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16995"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGP0"
FT                   /protein_id="ACR16995.1"
FT                   /translation="MARYTGTPAPGLVEDTHPSFVEYTREEYQRAATVTPDSPGVKLMQ
FT                   EFVQATGGAPRFPLPTGIENNEPQPVKETQADFTLADANDVKVLRTLAHEKGVSFSTVV
FT                   FALLALAEHKAAKTTRYSTIVVNSTRGKKYATSQGWFCNFNPLTFDITGETLDEILPTV
FT                   AEAQQKMREVLYEPVHASIMPLLATGAVDASIFDSPQLVTYMDLSWFAEPEGANIRLLT
FT                   GAGKTKNASLWVFRNPDGLLVGSQAPDNPVAAESLQTFFRAFRDAVQDAVENAISQER"
FT   gene            complement(254664..256061)
FT                   /locus_tag="ckrop_0204"
FT   CDS_pept        complement(254664..256061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0204"
FT                   /product="putative glycosyltransferase"
FT                   /function="Glycosyl transferases, related to UDP-
FT                   glucuronosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16996"
FT                   /db_xref="GOA:C4LGP1"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGP1"
FT                   /protein_id="ACR16996.1"
FT                   /translation="MPTHPSQKSTHQNILFVLSGSRGDIQPAISLGLELQNRGHTVTFL
FT                   CTPSLTTFARTAGIQSVFPAGINIGEMTDRAQSTLASKNPIAIARLAARFLKHSVDDLH
FT                   QDLINYYFSHDSAQGSSDANRPGLTQPTLLIVNPMCQRQGTSLAEKWNIPLVVLRYAPI
FT                   SHNSYSGWPHKLTRNAPKWMKKNSWHIQEWFDFLLYGHWENAFRRHLGLAPRFHPFTRY
FT                   LRDRSVPQLQLCDPKVVPDIAREWTGSNKVVVGYLDLPVSARRRLNEPDTLPADLDHWL
FT                   SSGSAPLFVSFGSMPVSHPARLVDTIVSAARKRNLRVLFSGFDSTTNVTNDEPPTTSPV
FT                   GNKEHDEANDVYFTGAINQTAVLPRCCAAVHHGGAGTTAASLRSGNPTMIYTFGFEQPF
FT                   WASCIENLGVGVGSSLSHLTAEHFADDLDRALSSPVREAAQTFAAEMTTPDQALSTAIR
FT                   LIEKEAG"
FT   gene            256166..257542
FT                   /locus_tag="ckrop_0205"
FT   CDS_pept        256166..257542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0205"
FT                   /product="hypothetical protein"
FT                   /function="Non-ribosomal peptide synthetase modules and
FT                   related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16997"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGP2"
FT                   /protein_id="ACR16997.1"
FT                   /translation="MCYLDDIALSGPCTQYLLDWDGTPGSETFPLTLNQRNHLESVRTS
FT                   GRPSWVAGSFVLPSSVLDGTQKCTDVIADAIRTLIGDYDALRLVPSDSSESENSQRMWS
FT                   NDQLSISAEAFLTDSDADSSTIRQEVESRIDDACVPGHKPGLFFARCGRRLVVATDHFH
FT                   ADMASIHIILRRLWDLLTSSTEKLGNGNNNPEATDEKVGNSPAPDPATAPSFTDAVRKE
FT                   KEASARWHDSENSDELQRALAVWKRFFDRTEGIVPAFPAELGTATSVTPHHRTELLLPA
FT                   TDMTGPIATRTFAEVMAALASSVHTVVGAESLPCVVPIHTRGRSSSPYHGTVGWMVSNG
FT                   PVIAEPGNSDGVRQWLRDGINAVTVPLDIIMETFRPVMPTPQPFMVSYSDFRTGPGRSA
FT                   AIPGAVYFSSLAPTATVQLWFTRNDKGLSLRAKYPGTPQAEAILDECVDDLTRRLTGTA
FT                   "
FT   gene            complement(257597..257785)
FT                   /locus_tag="ckrop_0206"
FT   CDS_pept        complement(257597..257785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0206"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16998"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGP3"
FT                   /protein_id="ACR16998.1"
FT                   /translation="MMSDDDVYIWLNRTGEGLNVSMRYPNNAQAEESIAAFLSRFAAII
FT                   HSVVTTGDYAAAVPVRA"
FT   gene            complement(257782..259191)
FT                   /locus_tag="ckrop_0207"
FT   CDS_pept        complement(257782..259191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0207"
FT                   /product="hypothetical protein"
FT                   /function="Non-ribosomal peptide synthetase modules and
FT                   related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACR16999"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGP4"
FT                   /protein_id="ACR16999.1"
FT                   /translation="MQSRTQCSSTTARTTVVAALQLNKHIEVLAQKHGNKHTKDDTMEY
FT                   TELADYPLPTGQLSTWQFTDDASQWSEDERSLSINHEDHLREVLRTEKNNAEQGLPSVS
FT                   EDWIGGAFVIHQPLHTDAFREALTTWFSCHEAYRTTAVANDRDDATTTFTRYTLGSSAV
FT                   DVSRNDFGVYHDDQLLRHEIHRHFAQHVNGIGWPHVTVATIEPETSEAAQEFTVIFAAD
FT                   HAVMDAYTQLFTIAELRELYAAAVDKREPALPPAGSYVDFCAGERAVTESASARERAVE
FT                   EWKEFLTGTDGHLAPPVFPLPIRSGAESGSATPADQHRAQHSLSQWLLNEKDIAELGKR
FT                   AKANGGSTKSALLTALKLALTELSPVSSARYIMPMHTRHEPKYMLSAGWFVGLMPVDDP
FT                   LNGASSFTDAFSDTVQATKRHRDLSVYPYAAVSDALHINEPPRFVISYVDTRFVPGADT
FT                   WGIEIAFSVAL"
FT   gene            complement(259565..259891)
FT                   /locus_tag="ckrop_0208"
FT   CDS_pept        complement(259565..259891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0208"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17000"
FT                   /db_xref="GOA:C4LGP5"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGP5"
FT                   /protein_id="ACR17000.1"
FT                   /translation="MAKTNWTLKKAKYVDTAPIVATGLIGGWITARETGIRPLGGVVLG
FT                   AAGLYAGRTWLAKRGPAKAEALGAAYLAAFGASHPLAKKIGAWPSVLTVAGLTAAASYV
FT                   VSDM"
FT   gene            complement(259893..260486)
FT                   /locus_tag="ckrop_0209"
FT   CDS_pept        complement(259893..260486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0209"
FT                   /product="gamma-type carbonic anhydratase-like protein"
FT                   /function="Carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17001"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGP6"
FT                   /protein_id="ACR17001.1"
FT                   /translation="MENSAFAPQTASSTDGPLLLPFNGRRPRVHRTAWIAPNATLIGDV
FT                   EIGAHSSVYYGCVLRGDVNSIRIGERTNIQDNSVLHVDSDAPCTLGDDVTVGHMALVHG
FT                   STVENGVLVGMKSALLSHSVVHEGSLIAAAAVVLEGQEVPAKSLAAGVPAKVKRQLSDE
FT                   QSHSFIPHAAHYVENAESQPRRAESLKPEDVYFD"
FT   gene            complement(260554..261354)
FT                   /locus_tag="ckrop_0210"
FT   CDS_pept        complement(260554..261354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0210"
FT                   /product="putative oxidoreductase"
FT                   /function="Short-chain alcohol dehydrogenase of unknown
FT                   specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17002"
FT                   /db_xref="GOA:C4LGP7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGP7"
FT                   /protein_id="ACR17002.1"
FT                   /translation="MTSPSKDAFSATTNDSGAHGDGTKPVAVITGASSGIGAASAKALA
FT                   DAGYTVYIGARRVEKLQAVAEGIDAVALPLDVTDQESVDKFCEQVPRCDVLVNNAGGAH
FT                   GSESIADANVEDWQWMYDTNVLGTLRVTRALLPKVEASGDGQVINISSIAGHEPYRGGA
FT                   GYNAAKHAVAAMTRVLRLELLGKPVRVCEICPGLVNTEFSTVRFGGDKEKADAVYRGLE
FT                   PMVAEDIADAVVWIATRPSRMNIDHITIMARDQVSAQEVYRREE"
FT   gene            complement(261466..262815)
FT                   /locus_tag="ckrop_0211"
FT   CDS_pept        complement(261466..262815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0211"
FT                   /product="putative aminotransferase"
FT                   /function="4-aminobutyrate aminotransferase and related
FT                   aminotransferases"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17003"
FT                   /db_xref="GOA:C4LGP8"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGP8"
FT                   /protein_id="ACR17003.1"
FT                   /translation="MPVPQSDVGRRAYNDDRAHVFHSWSAQAELDPIVMESAHGSYIVD
FT                   ADNKEYIDFSSQLVYTNIGHQHPKVVQAIKEQADQLCTIAPAYANDKRSEAARLITSHL
FT                   PDHLNKVLFTNGGADAVEHAIRLARLHTGRYKVLSRFRGYHGATQIAMNISGDNRRWRN
FT                   DYGTSGAVHFFGPFLYRSQFHATTEEEECQRALEYLDNLIAFEGPELFAAFIMESIPGT
FT                   AGIMPPPPGYWQGVREICDKYGIVMICDEVMAGFGRTGNWFAFEEFGAKPDLVTFAKGV
FT                   NSGYVPLGGVAISDEIAADFDHTPYPGGLTYSGHVLATTAAVATINAMDEEGMVENARR
FT                   LGEDVFGPALRDLAAKHHSIGDIRGLGCFWAVELVKDQETREPLGAYGTTAPEVKELVA
FT                   ECRENGLVVFQNMNRIHICPALNIPDDVARQGLEILDKALTTLDQKVAIQ"
FT   gene            complement(263037..263384)
FT                   /locus_tag="ckrop_0212"
FT   CDS_pept        complement(263037..263384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0212"
FT                   /product="conserved hypothetical protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17004"
FT                   /db_xref="InterPro:IPR010428"
FT                   /db_xref="InterPro:IPR038555"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGP9"
FT                   /protein_id="ACR17004.1"
FT                   /translation="MISVSDERFDELIDRGIELIPESLLRNMNNVALVVEPWNRENPNT
FT                   LGLYEGVALTRRTSSYSFALPDKITIYKEAICAYCNSEEELVRQVAVTVVHEIGHHFGI
FT                   DDDRLHELGWA"
FT   gene            complement(263393..264424)
FT                   /locus_tag="ckrop_0213"
FT   CDS_pept        complement(263393..264424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0213"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17005"
FT                   /db_xref="InterPro:IPR026004"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGQ0"
FT                   /protein_id="ACR17005.1"
FT                   /translation="MKPTVRRSSVIVGLVALLCGGSAAGTFTYAQEKHSDSASDTPHTA
FT                   PGEDKESKQKSFTNAEAGQCLDWKTSSDGTVSDFQTVDCAKSHRFEVSHRENLAAYPAS
FT                   EFGSNAGMLSRKRQAELTDELCKQPTLSYLGGKFDPTGRFTIAPILPPQKSWADGDRTL
FT                   LCGLQVTGNNGHASALTGKAADQDQSPVFKPGECVAITEKKDVNQNKQTEGDTSVDATA
FT                   QVVDCNADHQYEVTDIIDLGEKFKEYPSIEDQNEYLNKRCTDSVTAFIGGDDKLYNSTL
FT                   EPFWTTLTEDSWKGGSRNVNCSLIKTGDNNSLSTLKGSAKGEFTINGNPPPPQPSRAPK
FT                   RGN"
FT   gene            264598..265869
FT                   /locus_tag="ckrop_0214"
FT   CDS_pept        264598..265869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0214"
FT                   /product="Seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17006"
FT                   /db_xref="GOA:C4LGQ1"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4LGQ1"
FT                   /protein_id="ACR17006.1"
FT                   /translation="MIDLKQLRDDPDRVRESQRTRGEDPGLVDQLLQADQARREAISAA
FT                   DATRAEHKAYTKSMGKKMRDASPEEKENLRAKGTELSNVVKEKEEAQRVAEASVHDLQM
FT                   QISNIVEGAPAGGEEDFVVVEKVGTPPQFDFEPKDHLELGESLGIIDMERGAKVSGSRF
FT                   YFLKGAGALLQLGMLQLAAQKAVQHGFELMITPVIVNPESMSGTGFLGQHADEIYYLQE
FT                   DNQYLVGTSEVALAGYHSKEIIDLSAGPKRYAGWSSCFRREAGSYGKDTRGILRVHQFD
FT                   KVEMFSYCKPEDAAAEHQKLLSMEREMLAAVEVPYRIIDVAGGDLGSSAARKFDTEAWV
FT                   PTQNTYRELTSTSNCTTFQARRLGIRYRDENNKTQIAATLNGTLATTRWLVAILENNQQ
FT                   ADGSVKVPEALQPYVGQDVLKPVK"
FT   gene            complement(266074..267231)
FT                   /locus_tag="ckrop_0215"
FT   CDS_pept        complement(266074..267231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0215"
FT                   /product="putative lysophospholipase"
FT                   /function="Lysophospholipase"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17007"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGQ2"
FT                   /protein_id="ACR17007.1"
FT                   /translation="MSSLKKASGAAVLSLAVIFGSGTIAAAEANPDGVVRTYNTYPGRI
FT                   TGMVAPDAQVTDGTFTSTDGKGTEIYWKKNIIPNAKGSIALIHGLAENQQRYDYITYRL
FT                   NLAGYNVYRLDHRGHGRSAEPYNNVHKGLIDNFNYVIDDMKQLVDMIHNEQQGKVFMMG
FT                   HSMGAMAAQMYSVVYPDTIDATVTNGGGIPVNNYGENTLMPEYKHADGQSYPFFVGPYL
FT                   PNDGRRPFEPLDAMLGYNVQGVLDQFGLKLPPDAGKPIESPEPLKTVDVPNAFKLGVVS
FT                   DPDVRDQLSNDPLNSKTLNVSTLYQIASALLYTGAHAKNYTKPTLIMHGDTDGLVPYPL
FT                   DINWYNAVGSTDKHMVLWKGSMHETMNEPSRDEVIDRAIGFIDAH"
FT   gene            complement(268259..269797)
FT                   /gene="glpK"
FT                   /locus_tag="ckrop_0216"
FT   CDS_pept        complement(268259..269797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpK"
FT                   /locus_tag="ckrop_0216"
FT                   /product="Glycerol kinase"
FT                   /EC_number="2.7.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17008"
FT                   /db_xref="GOA:C4LGQ3"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4LGQ3"
FT                   /protein_id="ACR17008.1"
FT                   /translation="MPEKYVAAIDQGTTSTRCILFRHDGSIATVAQFEHKQIFPKKGWV
FT                   EHDANEIWNNTRRAVGEAMAELDISVNDVVSVGITNQRETTVVWDKNTGEPIYNAIVWQ
FT                   DTRTNDIAQRLAGDEGPDRWRKTTGVRLNSYPAGPKIMWILENVEGAREKAEKGDLLFG
FT                   TIDTWLLWNLTGGVDGDNGNPALHVTDVTNASRTSLMDLKTLKWDEDLCKAMDIPQSML
FT                   PEIRPSIGDFRTVRARGSLAGVPIRGVLGDQQAAMFGQCCFGNGDAKNTYGTGLFMLLN
FT                   TGAKPKWSDNGLITTVCYQIENQKPVYALEGSVAMGGSLVQWLRDNLQLIPNAPSVENM
FT                   AKSVEDNGGVYFVPAFSGLFAPRWRPDARGAIVGLTRFANRNHLARAVLEATAYQTREV
FT                   LDAMVTDSGVDINALKVDGGMVMNEFLMQFQSDIINTEVVRPKNIETTALGAAYAAGLS
FT                   AGFWDSLNELKEQSTVDKVWKPKMGEDERKQLYSDWNRAVERTYNWEESTNEPS"
FT   gene            complement(269966..270715)
FT                   /gene="glpF"
FT                   /locus_tag="ckrop_0217"
FT   CDS_pept        complement(269966..270715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpF"
FT                   /locus_tag="ckrop_0217"
FT                   /product="glycerol transporter"
FT                   /function="Glycerol uptake facilitator and related
FT                   permeases (Major Intrinsic Protein Family)"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17009"
FT                   /db_xref="GOA:C4LGQ4"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGQ4"
FT                   /protein_id="ACR17009.1"
FT                   /translation="METLTGPQAMGWEFFGTMMLMLFGNGVCAAVNLRTSTARNTNWLT
FT                   IAFGWGLAVFIGASIADKTGGHLNPAVTLSLAIDDKLEWSLVPWYFGGQMLGAMAGAFL
FT                   AWAAFKQLFDANNLDENGNNVKGNATTQGIFFTVPAHPNNFWNALTEFIATYSLLVFIL
FT                   LGPSGGDLGPLKYFGVAFIIVAIGLSLGTPTGYAINPVRDLGPRLMYAFVLPIKDKGAA
FT                   QWGYAWVPIVGPMLGAVAAGLTAVALG"
FT   gene            complement(270717..272444)
FT                   /gene="glpD"
FT                   /locus_tag="ckrop_0218"
FT   CDS_pept        complement(270717..272444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpD"
FT                   /locus_tag="ckrop_0218"
FT                   /product="Glycerol-3-phosphate dehydrogenase"
FT                   /EC_number="1.1.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17010"
FT                   /db_xref="GOA:C4LGQ5"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGQ5"
FT                   /protein_id="ACR17010.1"
FT                   /translation="MAISATSTSLNKEQREQAWEDFGKEHYDMVIIGGGSVGAGTALDA
FT                   ATRGLKVAVLETRDFAGGTSSRSSKMFHGGLRYLAMLDFRLVAEGLRERELSMSGLAPH
FT                   LVKPLKFIFPLEHRIWQRPFMASGFMLYDLMGGAKSVPMQKHYTRKGMLKLSPGLKEDA
FT                   LVGGVRYFDTLVDDARHTMTVLRTAAEFGATIRPSTQVVDFEKDGDRITGARIVDTDSG
FT                   RTTTIHGSVFVNATGIWNDEIEKLAGVEGKFHVHTSKGVHIVVPKSVLPGDVALTFVTE
FT                   KSVLFVIPWGEYWIIGTTDTDWTMNLANPAPTRADIDYILEHINAKVKRQITYDDIVGV
FT                   YAGLRPLVAGSSDSTTNLSRNHAVARVTPGLVSVAGGKYTTYRVIGADTVDAAKEDIPF
FT                   DVPDSVTTDVPLLGADGYHALANQIPQLAKRLGISEKTVDHLLNRYGSLIYEVLAPADK
FT                   DKSLLEPIPGAPAYLMAEALYAATHEGAAHLEDILHRRMRLAMEYDHRGVECAEAVSKL
FT                   VADTMGWDEKARKEEIKVFTDRVEAQKKAEKELTDESANKIEASVEDTRPDVDTSQDR"
FT   gene            272977..275142
FT                   /locus_tag="ckrop_0219"
FT   CDS_pept        272977..275142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0219"
FT                   /product="hypothetical protein"
FT                   /function="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17011"
FT                   /db_xref="GOA:C4LGQ6"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGQ6"
FT                   /protein_id="ACR17011.1"
FT                   /translation="MRPMADPFYFGIIGLARTLFALEGLRFRVTGTENVPAKGGAVVVM
FT                   NHTGYLDFAYAGIPFRSCRRYVRYMAKSEVFDHPIAGPIMRGMKHIPVDRIDGSESYRQ
FT                   AVDYLRSGRLVGVFPESTISRSFEIKDFRKGAVRMAQEAGVPLIPVTIVGSQRVWTKGH
FT                   PKRLGRTRTPIYINVLSPIHPDGDAATETDHLRDVMVNDLDRLWEMYLQDNGPIKGDEY
FT                   WIPARYGGAAPPFEVAQREDNAVAEERHRIRKLRDDLNNLTHVVTTTTRDIVNKSVSMS
FT                   SDAWAKSSDAVKSASVSARDSVTESAAALNEKMPWQADEETKLRKRADKLEKNKRKEEI
FT                   KEAKTAEKEAEQAEKAAKNKAKNKRGDGAEKIVESLQTSFDSLYEETSKNNHEGASKII
FT                   EARDSFYRSSRELLQSVQSATASMTDATRDVEWMSLDKTLTSLIGQTKQIRDKIPARIK
FT                   SKLPSDVAAVCSDIDGTILHENTISDATRDAFEQLNAHGVEVLLATGRAIEEVEPVVDQ
FT                   LPISPVAICANGAVVYDTKDKRVLHVEGFFEGGADILTHQIEEDIPEAEIIVRTVDNTA
FT                   VKVVVKADMPSEDIADALDESVRERSALTYSTPYGSIELGPIGVNKSTGAEWYFHNKGI
FT                   DPSHVIAFGDMPNDTELLSYVGAGITMGNADRDLIRDASWVTSSVEDDGVAEVLKYVLK
FT                   RFEDQDADVQDADAADQADPSSPAAEK"
FT   gene            275151..276062
FT                   /locus_tag="ckrop_0220"
FT   CDS_pept        275151..276062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0220"
FT                   /product="hypothetical protein"
FT                   /function="Predicted hydrolases of the HAD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17012"
FT                   /db_xref="GOA:C4LGQ7"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGQ7"
FT                   /protein_id="ACR17012.1"
FT                   /translation="MDIDASRPQDTGNSSAGLPDAVDLARCVPAPLLVASDIDGTFVTS
FT                   AERVTPRLTSAIHRMVRAGTSLVLATGRPARWTLPVISQLPARPLCVCTNGSVIFDSAR
FT                   GEVLNAHEIPPEHVADMVQRVVDGLASDPRGIHVGFGVERVGTDLYSEKDQFLIEPNFD
FT                   HVWESQGFSLVSLEELVTEPAVKLLLRSPEVTSEELYQLVAPMIPVDKGHVTYSFSGGL
FT                   LEIAAPGVTKAGGLAEVADLLGVDAGETVAFGDMPNDTEMLEWARMGVAMGNAHPLLRE
FT                   VAKVVTTSNDEDGVARVINAWF"
FT   gene            276157..277173
FT                   /locus_tag="ckrop_0221"
FT   CDS_pept        276157..277173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0221"
FT                   /product="putative aldose-1-epimerase"
FT                   /function="Galactose mutarotase and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17013"
FT                   /db_xref="GOA:C4LGQ8"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR037480"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGQ8"
FT                   /protein_id="ACR17013.1"
FT                   /translation="MSEEESQVNNHPVVHLSHGPYAAEIATYGGGVRSFTYRVLPLMEG
FT                   YRDGEYPPLSANVVLAPWPNRIRDGRFHFHGQSHQLSITEPDRNNAIHGFVSDAAWDVV
FT                   AQSDDSAAVTLATTIEPQQGWPWTLQVTSTYELSDQGLTCTCEITHRADAPGAGAAPVA
FT                   YGFHSYLSALGAPIDECTLDMFVRSQLPLDPDRKLPSGDVIDATAGSPIHRIELRDQLL
FT                   DDCFGREALSDSASPDKASAEPPSNDVAPDVRAARLVNGDGCGVEMWVSPQIKWFQVFT
FT                   ADPSWGYPYPGRGRALAVEPMTVPPDAFNSGTDVAEIAPGDSLVVKWRIGYAEPLTR"
FT   gene            277223..278884
FT                   /locus_tag="ckrop_0222"
FT   CDS_pept        277223..278884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0222"
FT                   /product="putative transporter"
FT                   /function="Na+/panthothenate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17014"
FT                   /db_xref="GOA:C4LGQ9"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGQ9"
FT                   /protein_id="ACR17014.1"
FT                   /translation="METMVAAESVLRLDASWVDYSLVALYFVFVLGIGWAARARVSSSI
FT                   DFFLSGRGLPSWVTGLAFISANLGAVEIIGHSANGVQYGMQTMQYFWIGAVPAMVFLGI
FT                   VMMPFYYGSKVRSVPEFMLKRFGPTAHLVNAISFALAQLLIAGVNLLLLAKVVNSLLGW
FT                   PLWVTLLVAAVIVLSYITLGGLSAAIYNEVLQFFVIVAALLPLTLIGLHRVGGWGGLKG
FT                   SLNAESHFHTWPGQDISGFDNPIISAIGIAFGLGFVLSFGYWTTNFVEVQRAMASESLS
FT                   SARKTPIIGAFPKMLIPFVVVIPGMVASVLVTPIKDETAEPNDAILYLMRDLLPNGLLG
FT                   VAIAGLLAAFMAGMAANISAFNTVMSYDIWQTYVVKDRDDEYYLKFGRIATILAAVIAV
FT                   GTALVAMNFGNVMDYLQTLFGFFNAPLFATFILGMFWKRMTPTAGWVGLVTGTLAAVIF
FT                   WGLSLGSAPVVSLPGQGVAFVAASIAFATDIVVSILVTMVTKPKPDEELVGFVRSVTPK
FT                   AQLVDTTEAEQPWYHRTVPLGIVCLVLVIALNIAFA"
FT   gene            278987..279289
FT                   /locus_tag="ckrop_0223"
FT   CDS_pept        278987..279289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0223"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17015"
FT                   /db_xref="GOA:C4LGR0"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGR0"
FT                   /protein_id="ACR17015.1"
FT                   /translation="MTEHTSTPASAPEKHKAGAFDIRTVIAILLGIYGLVLVICSFALD
FT                   PGTNPDTGASKSATDNLWVGIGLLVVAGVFVAWAKLKPIIVDESKIVHDDEPGVG"
FT   gene            279342..280574
FT                   /gene="galT"
FT                   /locus_tag="ckrop_0224"
FT   CDS_pept        279342..280574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galT"
FT                   /locus_tag="ckrop_0224"
FT                   /product="Galactose-1-phosphate uridylyltransferase"
FT                   /EC_number="2.7.7.10"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17016"
FT                   /db_xref="GOA:C4LGR1"
FT                   /db_xref="InterPro:IPR001937"
FT                   /db_xref="InterPro:IPR005849"
FT                   /db_xref="InterPro:IPR005850"
FT                   /db_xref="InterPro:IPR019779"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGR1"
FT                   /protein_id="ACR17016.1"
FT                   /translation="MDSEQQMNSVSGERLNKNSDHPYSVTSMTLADGRELIYFDDDPEV
FT                   LNGSVKRTLTDSRELPRAKTDSEIRRDPLSGEWVAYASHRMNRTFMPPANEDPLAPTIP
FT                   DHLPTEIPSPDYDVVVFENRFPSFSMHMSRTPSTEGNDGGVEQLSADDDALLDNGMVPH
FT                   RPAVARCEVICFTPDISGSFKDLPVSRIRTVIEAWAHRTKALSAIPEVRHVYPFENRGE
FT                   EIGVTLQHPHGQIYSYPEIPPRIRNIVHSSKEYREENGSDLFDDLLSAELEEGTRIIDR
FT                   TDHFVVFVPAAAKWPLEVMVMPLRSVPDFDALSQEERADLAPLLKKLYTAVDKFFDGVE
FT                   RTPYIASWNQAPTVPEDRDYVRLHLQLFSLMRSPHRLKYLAGSESGMGFWINDTTPERI
FT                   AQRFREIWDDK"
FT   gene            280574..281950
FT                   /gene="galK"
FT                   /locus_tag="ckrop_0225"
FT   CDS_pept        280574..281950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galK"
FT                   /locus_tag="ckrop_0225"
FT                   /product="Galactokinase"
FT                   /EC_number="2.7.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17017"
FT                   /db_xref="GOA:C4LGR2"
FT                   /db_xref="InterPro:IPR000705"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006206"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR019539"
FT                   /db_xref="InterPro:IPR019741"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGR2"
FT                   /protein_id="ACR17017.1"
FT                   /translation="MTDSHAEPKDQSQAKTSRTPHDPEAIRWAEARSDQQLIADATTLF
FT                   TETFGGTPDGVWAAPGRVNLIGDHVDYAGGVSIPFALPHVTTVAARRRTDDTISIVSLP
FT                   PGAATESGDAVTGVEDNSSSPTHPEALRTTVELADIGLGHPADWSGYVAGPIWAGHQNG
FT                   VISSSNQHDNGLDLAIISDVPLGSGLSSSAALECSVALAARELAAPGQPLDQAAYQLLI
FT                   DAAIRAENDVVGASTGGLDQRSSLLATAGHALAIDFRTNVVNQVACDVESDGLAFLVAD
FT                   TNAPHSLSDGQYASRRGVIDGVTSHAGASTLLDIDDPIAAATSWADTDESTVTPDVARV
FT                   RVQHVIDETARTRRAQDALNSKNWKEFGRLMNESHESLRDLYDVSTPELNSARDAALDA
FT                   GAVGARMTGGGFGGSIIALVPTDRITAVAQEIHQRTVDKKLPNPTFLAITPAAGARRLV
FT                   "
FT   gene            281979..283178
FT                   /locus_tag="ckrop_0226"
FT   CDS_pept        281979..283178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0226"
FT                   /product="UDP-galactopyranose mutase"
FT                   /EC_number="5.4.99.9"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17018"
FT                   /db_xref="GOA:C4LGR3"
FT                   /db_xref="InterPro:IPR004379"
FT                   /db_xref="InterPro:IPR015899"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGR3"
FT                   /protein_id="ACR17018.1"
FT                   /translation="MTVTSNTSEYDLFVVGSGFFGLTIAERMASAGKKVLIVEKREHIG
FT                   GNAYSEAEPETGIEIHKYGAHLFHTSNERVWNYVNQFTDFTNYQHRVFAMHKGTAYQFP
FT                   MGLGLINQFFGRYYSPDEARQLIQDQTDGLDPAKAKNLEEKAISLIGRPLYEAFVRDYT
FT                   AKQWQTDPKELPAGNISRLPVRYTFDNRYFNDTYEGLPVDGYTAWLERMADHDNITVRL
FT                   NTDWFEVRDELRAASPNAPVVYTGPLDRYFNYSEGRLGWRTLDFETEVLDTGDFQGTPV
FT                   MNYNDADVKYTRIHEFRHFHPERKDRYPRNKTVIMKEYSRFAENTDEPYYPINTPEDRD
FT                   KLLAYRDLAAKEAHDHNVLFGGRLGTYRYLDMHMAIGSALSMVDNKLMPFFEDGQPIEA
FT                   "
FT   gene            complement(283288..285060)
FT                   /locus_tag="ckrop_0227"
FT   CDS_pept        complement(283288..285060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0227"
FT                   /product="choline dehydrogenase"
FT                   /function="Choline dehydrogenase and related flavoproteins"
FT                   /EC_number="1.1.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17019"
FT                   /db_xref="GOA:C4LGR4"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR011533"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGR4"
FT                   /protein_id="ACR17019.1"
FT                   /translation="MSSFASRLESAAASAGSKIGKLFPKSGSTVEHRDVVIVGAGSAGS
FT                   VLANRLSSDFSTSVMVLEAGRNDSLWDLYIHMPSAFSFPIGNKHYDWEYESVPEPEMHG
FT                   RRIYHARGKVVGGSSSINGQIFQRGNPMDYEKWGKRDGLEKWDWKYCLPYFKRMETALG
FT                   SPDDDPLRGHNGPLRMKRGPATSPLFKAFFKSIEQAGYNYTPDVNGYRQEGFGPFDANI
FT                   DRGRRLSAARAYLHPVLDRENLELRTRANVRRILFEGTKAVGVEYYWHGRTHQVRADKV
FT                   ILCGGAINSPQLLQVSGVGNKDLLNKVGVNVVKDLPGVGENLQDHLEVYVQYNCTKPVS
FT                   AQRYLDKWRWPMLGLQWLTTHKGPVATSHFEAGGFARSNENEDYPNLMFHFLPLAMRYD
FT                   GTKPEGDDGFQFHVGPMYSDARGYVRITAPTVDTKPDILFNYLSTEQDRREWVEAIKVS
FT                   RKLLDTPAMKEYTDGEISPGSAVQTDEEILEWVRDDAETALHPSCTCAMGPESDPMSVV
FT                   DPSTMQIHGTDGLYVVDASVMPSIPNGNIYAPTMMIAEKASDIIAGKTPLAADETPFYH
FT                   VKRGDPLNPPEQEK"
FT   gene            285397..287766
FT                   /gene="betT"
FT                   /locus_tag="ckrop_0229"
FT   CDS_pept        285397..287766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betT"
FT                   /locus_tag="ckrop_0229"
FT                   /product="high-affinity choline transport protein"
FT                   /function="Choline-glycine betaine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17020"
FT                   /db_xref="GOA:C4LGR5"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGR5"
FT                   /protein_id="ACR17020.1"
FT                   /translation="MGRLESSISARKTSTIPDHEDADDNDADNGTGKKDPTKNQVAGGS
FT                   QPTRTVDPPDVNWPVFIISGVLIICIALWAILAPDNALSVLTDIVGTVSKNAGWFYILT
FT                   ATVAVLFMLGVAITRAGLIKLGPDHAKPQFGLFSWASMLFAAGIGIDLLFFSVAEPVSQ
FT                   YYHPPSGDGESIEAARQAVVFTLFHYGITGWALYALMGMAFGYFAYRLNMPLSIRSALY
FT                   PLIGKRIHGPAGDAVDIAAMLGTVFGVATSLGIGVVQLNYGLKVLFNFPENLGWQIGLI
FT                   VLAVAVATISAVSGVDKGIKRLSEINVLLAIGLMLYILVTGRTAFLFDALVMNVGEYVS
FT                   KFPGMTMDTYAFSGAQEWLNSWTLFFWAWWVAWAPFIGLFLARISRGRSLRQFVVGTMS
FT                   VPFLFVLLWVSFFGNSALDKVIHGDSDFGHMAVDKPERAFYLLLNQYPAGMVVMAVASL
FT                   IGLLLYITSADSAALVMSNFTSKITDSQQDGRSWSRIFWAAAVGVLTISMLFVDGIPAL
FT                   QNATIIMGLPFAIVMYLVMYSLFKSLRLELLQSKSSARALHGAMSSRAAPAEAGMNWRK
FT                   RLNRAMSFPSYAQVETYIDKVAAPALDKVAKACKERGADVEYTRSIVEGLGLAQLDFRV
FT                   KFGSDKDFRYQIYPTQYPMPSFAGRIHLDSDSEELYYRLEIFTLTGSLGYDVYGYTESQ
FT                   LIENVLDLYERHMEFLHLQSDLPGGSDLSDNADPVVEWVDDYSDYAADSAATTGSSVRS
FT                   EKQGEADPSASTEESTTADHSSSASSQSSASPQNEK"
FT   gene            287797..289341
FT                   /gene="gbsA"
FT                   /locus_tag="ckrop_0230"
FT   CDS_pept        287797..289341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gbsA"
FT                   /locus_tag="ckrop_0230"
FT                   /product="betaine aldehyde dehydrogenase"
FT                   /function="NAD-dependent aldehyde dehydrogenases"
FT                   /EC_number="1.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17021"
FT                   /db_xref="GOA:C4LGR6"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGR6"
FT                   /protein_id="ACR17021.1"
FT                   /translation="MSQSTTQMKTAPTPAAEPESLFINGEWGSAIDGKTRTITCPANNQ
FT                   AVGVVAEASTKDTDRAIAAAREAFDSGVWSGWSGFDRGQLLLAVADGIEERKDEFALAE
FT                   SLDTGKRLMESNADMDDIIGCFRYFGKLAGNDAGRVVDAGDPSISSRIVREPVGVCGLI
FT                   TPWNYPLLQVAWKVAPCVAAANTFVLKPAELTPHTSMLLLDVMDKAGLPKGAGNLITGA
FT                   GKSAGAPLSSDPRVDMVSFTGGLETGRHLASEASLTVKKVALELGGKNPNVIFADADYD
FT                   AALDNAMNAAFVHSGQVCSAGARLVVEESIAERFVTDLVARAEKVRLGGPFDEKAETGA
FT                   LISEAHREKVSNYVAHAREQGARVRCGGAFGTGPTADGSASLDDGWFYLPTVIDQCTQD
FT                   MDCVHDEAFGPTVTVETFSTEEEAIRIANDTNYGLAGAVWTSDAGRAERVARGLRHGTI
FT                   WINDFHPYLPQAEWGGFGQSGMGRELGPTGLEEYTEPKHIYHNTTPAVTGWFSPEE"
FT   gene            complement(289325..291637)
FT                   /gene="nagE"
FT                   /locus_tag="ckrop_0231"
FT   CDS_pept        complement(289325..291637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagE"
FT                   /locus_tag="ckrop_0231"
FT                   /product="N-acetylglucosamine specific PTS system
FT                   component"
FT                   /function="Phosphotransferase system IIC components,
FT                   glucose/maltose/N-acetylglucosamine-specific"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17022"
FT                   /db_xref="GOA:C4LGR7"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGR7"
FT                   /protein_id="ACR17022.1"
FT                   /translation="MTSTTRSSSRKNSEDPQQPDSLPTTADTSSSLPEASPSMSKRTFH
FT                   RPDFSQLQRLGKSLMLPIALLPAAGILLRLGQDDLLGRIQTPVIGPFFEAMSAAGQALF
FT                   SQLPLLFAVGVAIGFAKKADGSTALAAVAGYLVMGAVFKQMSPLVLNGVKDSAGDQALI
FT                   DYSVFGGIVVGLLTAWLYDKYHDIKLPSYLGFFGGRRFVPIVVSVTTLITGFVLSYIYP
FT                   IFNEGLTAIGRFIGGTGALGAFVYGFANRMLIPVGLHHILNTYVWFIYGDYNGPDGTVS
FT                   GELSRFAAGDHSAGLLTSGFYPILMFGLPAAALAMIHTAKKGQKATAIGILSAAGLTAF
FT                   FTGVTEPLEFAFMFLAFPLYVVHAVLTGLSLAIAELLNIHLGFSFSAGLLDLILYGTAP
FT                   AAHNIPLLIVQGLAFAVLYYVIFRFAIVHWNLHTPGRADATVGTAGNTDQSGSDTGTTT
FT                   SNNAPSKGTPAKTGSTAPQGSATPSSRAEALINAFGGRDNLANVDACITRLRMEVNNPA
FT                   AVDKNKLQALGASGVMEIGTSVQAVFGTESDVLKDEINAALAVAGTAQRLGPTSDAAMP
FT                   EQAATSDATDDAVGDAPTPGANTGGSTGSHPAESHGPLQVRAPIPGTVIPLSQVDDETF
FT                   ASETVGRGLAIRPEDGVLETVAPVSGRIMQLFPHAFAIMTDDRIGVLVHLGIDTVELNG
FT                   QGFTVHAAKGDHVVQGQPIVTYDVPAVAAASRPTTVPVVVMDSRRMEITMASDPTENAS
FT                   VTTMRPLFTVEKPTPRD"
FT   gene            292166..292567
FT                   /locus_tag="ckrop_0232"
FT   CDS_pept        292166..292567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0232"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17023"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGR8"
FT                   /protein_id="ACR17023.1"
FT                   /translation="MARLCRTTSIYIFPMMRKPELATRGYVSASVNYTTNTDDHPSNLD
FT                   KMYTEIKNSVKAVVAQAKQHGYPVNQMAITGKSAGGTLAMTYAFRDGKDSPVPLKFVFR
FT                   KSAPRASNRRSGLAQMVILKATGETKRSS"
FT   gene            292603..292878
FT                   /locus_tag="ckrop_0233"
FT   CDS_pept        292603..292878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0233"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17024"
FT                   /db_xref="GOA:C4LGR9"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGR9"
FT                   /protein_id="ACR17024.1"
FT                   /translation="MEDGSYHELAERVSPYHYVSANSVTMLMAYGKKNKIVPFKVHNRL
FT                   LSALDKNHVPYDYHVFPRSGHGLYSDPGQAKKYVHKLGDYYDKYFD"
FT   gene            293150..295219
FT                   /locus_tag="ckrop_0234"
FT   CDS_pept        293150..295219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0234"
FT                   /product="putative glycosyltransferase"
FT                   /function="Predicted glycosyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17025"
FT                   /db_xref="GOA:C4LGS0"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR040492"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGS0"
FT                   /protein_id="ACR17025.1"
FT                   /translation="MSQAGSQAKSRAVERLQRVILPRRGEPHDVRSLYMIESKANKSRA
FT                   VLHSRTEATFPAGAEVSFETYFNGFPASYWRRWTQLKSAVLKLELQGDARADVYRSKID
FT                   GSRIAVEGKMTDVLADDIHATTAEESTQDTIEGEPSSAESTVSTLEFEVPLDRFEDGGW
FT                   IWFDLTCETDVTLLAAGWYAPEQPGPQTLPDGSTIGPQDKSVTIGIPTFNRPTDAVAAL
FT                   EAIASDPEVDAVIDAVLMPDQGTKHPADEPGFDDAVKHFGDRFHEFRQGNLGGSGGYSR
FT                   IMYEALGGAGSEEERKQRATKAPFILYMDDDIAIEPDSILRALQVARYARQPMLVGGQM
FT                   LNLQERSHLHSMGEVIDRHSFMWTSAPHVHYDHDFYQYPLRDRRDHGRNANVDVITSRD
FT                   LHRRIDVDYNGWWMCMIPRVVAETIGQPLPLFIKWDDGEYGLRAGHAGFPTASWPGIAI
FT                   WHMAWSDKDDAIDWQAYFHLRNRLIVAAIEQDGSILGMLQSMAKATTKHLMCLEYSTVA
FT                   IQNEAIKDFLRGPDQLFDILGTALPRINELRKEYPDAVVLPSASAVPPAKGGPRNLTKI
FT                   PLNPLAKVSTLSKALKKQFSPNDGDPEVPDVNLPPIEARWFSLSRVDGATVTTADGRGV
FT                   VFRKRNRAKAVKLARESMRLQKEIYDRFPEMRQLYRKAHPKLTSREGWSTIFER"
FT   gene            295266..295748
FT                   /locus_tag="ckrop_0235"
FT   CDS_pept        295266..295748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0235"
FT                   /product="putative membrane-associated phospholipid
FT                   phosphatase"
FT                   /function="Membrane-associated phospholipid phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17026"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGS1"
FT                   /protein_id="ACR17026.1"
FT                   /translation="MLELIQGAIADKPGVMPLARGLSHAGEHAAAWLALGVVGMIADEK
FT                   RRPQWGILTGAAFGSHAASVILKRIVRRPRPHGPRVRIGVKTPSKLSFPSSHATSTTAA
FT                   MIELSRITGSRVPLTVIPLMMLSRMTVGVHYPTDVAAGALLGGISAEAIHRAVTHQ"
FT   gene            295801..296868
FT                   /locus_tag="ckrop_0236"
FT   CDS_pept        295801..296868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0236"
FT                   /product="decaprenylphosphoryl-5-phosphoribose synthase"
FT                   /function="4-hydroxybenzoate polyprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17027"
FT                   /db_xref="GOA:C4LGS2"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGS2"
FT                   /protein_id="ACR17027.1"
FT                   /translation="MSPQRSYKDTMAGNEHDPYPSNESNGALIGSEPHTRGLYPEAPKN
FT                   ADDKASAKIRAPKNLPEAMFKAIRPKQWVKNVLVVAAPAAAGSDMFTGRVAIDVFIAFV
FT                   AFCCAASSIYLINDARDVEADRAHPTKRYRPIAAGVLPIGVAYGMATVLILAALAVSFL
FT                   STSAWALAAVIGVYIILQLGYCFGWKHQPVIDIALVSSGFLLRAMGGGVAAGIDLSQWF
FT                   LLVAAFGSLFMAAGKRYSEILLAAKSGAKIRKSLEGYTPTYLRFVWTLSATAVVLTYAL
FT                   WGFEMGQKDSSASALWYEISMVPFTVAILRYAADVDRGDGGAPDELALRDHVLQLLGLL
FT                   WAIAIFIAVYVAPSF"
FT   gene            297128..298321
FT                   /gene="cmtA"
FT                   /locus_tag="ckrop_0238"
FT   CDS_pept        297128..298321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cmtA"
FT                   /locus_tag="ckrop_0238"
FT                   /product="trehalose corynomycolyl transferase"
FT                   /function="Predicted esterase"
FT                   /EC_number="2.3.1.122"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17028"
FT                   /db_xref="GOA:C4LGS3"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGS3"
FT                   /protein_id="ACR17028.1"
FT                   /translation="MMSFSRRVGAMRRPWLMVAVLVSAIALMLGITTALSSNKAHAEGS
FT                   RDTLRPGCTWDAAAYWVQKCTVHSDAMNKDIPVQIQAANGNGNAGLYILGGFAGPTNSS
FT                   GWIDWAHAQNIFVDDNITKVFPLGGKASFYTDWEKPSTSADGTQIYKWDTFLSSELPAY
FT                   LQANFGVSPTNNAVAGMSMGGTGAMNLAAHHPDQFRQVSSFSGYLATSNPIMRMGIASA
FT                   MQGNGGYRIDQMWTGDRIRQNDPTKNAAAYRNTDVFISAATGWWNPQDDFFANPVYSVS
FT                   VMAMEAVSRVTTTQFEGALRAQGINPTIDYPLAGVHNWTNWREELIKVRPRILQATQSA
FT                   AGQGVPEGDKPLTGDPGSRSATVPGVRGDDVSPAAQNDAAATGGDVQRAVENSHQDQ"
FT   gene            298582..300618
FT                   /gene="cmtB"
FT                   /locus_tag="ckrop_0239"
FT   CDS_pept        298582..300618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cmtB"
FT                   /locus_tag="ckrop_0239"
FT                   /product="trehalose corynomycolyl transferase"
FT                   /function="Predicted esterase"
FT                   /EC_number="2.3.1.122"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17029"
FT                   /db_xref="GOA:C4LGS4"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR013207"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGS4"
FT                   /protein_id="ACR17029.1"
FT                   /translation="MRASSKLSHRRTWPTTIAATGFVVMLGAAAIHTGARAEDAPAESQ
FT                   SPGASESAAPQGSENSNAAAPAEHADVPDSVQREAAKNAFPLSIPSEPLPMRTEQQQLD
FT                   NLPDGVSVDHVDWLTDRRVALYINSKAMPGNPIKVEILLARDWYPQPDKKFPTVLGLDG
FT                   IVPNQIENGWTAGTNIVQQFADRNVNVVLPVGGLASFYTDWLNEDSGVLYKWESFLTQE
FT                   LPPILKEGWRANDKTAVFGMSAGATGAMNLAERHPDMFNFVGSYSGYLDTSSPGMSEGI
FT                   GLVMKTVSPFNAENMWGKYGSEGWKEHDPKLNVSKLKNTGVYVSAGSGAAGSYDDESQV
FT                   LPGLPKKGLTFGQEALARMTSETFVSHAKRAGINVTTAFRNSGTHTWPYWQFELGKSWP
FT                   YMADALGLSENDRGANCVPMGEIASTALKDQDKLGGCTSDEYDGANGGKIQDFRNGRTF
FT                   WSPSTGAHNLWGRIGAHYAEMGGPKSFLGYPTSEEITSPDGKGRFVTFEHGSIYWNAET
FT                   GPHALKPEMFDAWGTTGYETGKLGYPTADEKSVAGGAIQEFQNGLVTRSKDGTAHYVQG
FT                   EIAKKFKGIGGVDKLGFAKTDEVPVDGGAFTEFDKGYIYWSPGTGAHVIMKGGIFDAWD
FT                   KNGAQGGKYGFPTSDMKNIPAGGLTIDFQHGTIKEMNGQVQES"
FT   gene            300732..301379
FT                   /locus_tag="ckrop_0241"
FT   CDS_pept        300732..301379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0241"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17030"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGS5"
FT                   /protein_id="ACR17030.1"
FT                   /translation="MTSRGGFTMSSNAAYDADGHEAGQPLAFPRRRNRRSSITRGAALA
FT                   LASVLGAGVLAACGDGSTATQDDSDSATTTQARSSSSSSSSTKSSASSSSASSKKSADS
FT                   NNGVGDNPDAKDDETPVEVSRVPAPNRGQRTDEEKKFLATIQKDKINVDGSAADQVIAS
FT                   AMEYCQAKAEGQESFSVRAMAGQLIEQKLTDQPLDQVERAITESADSDLCGD"
FT   gene            301404..302351
FT                   /locus_tag="ckrop_0242"
FT   CDS_pept        301404..302351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0242"
FT                   /product="putative carbohydrate esterase"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17031"
FT                   /db_xref="GOA:C4LGS6"
FT                   /db_xref="InterPro:IPR000675"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGS6"
FT                   /protein_id="ACR17031.1"
FT                   /translation="MAQKGSRSVFRKLLVIVGVLILLGAIAVGIAQWMGSQGQGPGVPS
FT                   NDGQGSGNSEQPADCPSVEVIAVPGTGESSTSDDPLHPTQFPNALLQGVTGPLTQNNNS
FT                   SSVKVWTANYPAQMKTLATLDQMNYADSVNEGVRIVNAELSATHDHCPATKFVIMGFSQ
FT                   GAAIAGDIASDIGNNRGVVPSDTVAGVTALADPRRMTGEGETVGAQPKGIGSEIALQPF
FT                   AAVLGNVVPGFTPRGPRSGGMGDLNDRVNEICAPGDAVCDMPASLKVEPENVDALFTGN
FT                   SLHIQYGTNPNVIEGTTAIAWMLQWAQGLINNNT"
FT   gene            303046..304470
FT                   /locus_tag="ckrop_0243"
FT   CDS_pept        303046..304470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0243"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17032"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGS7"
FT                   /protein_id="ACR17032.1"
FT                   /translation="MGDNEISSRATHRGYRGKHRDSETRIGDRASFAVPAMSLGIACVG
FT                   ITAAAPAAFAGGFVEPQSVSVKPQQTMNQQVAKPAQAIPKQSQTVISASERGGTQQSIA
FT                   QGIRVQQKQIPRMTPQSTATLPKATAPQRAAVQIDQQTRNDAHTVQVNRQLSQKEISGK
FT                   DLVAGDSARNDHAQRIGVGPCSVGVSKAGAKSEAVSNESAIGVTAVAKLAMDYKNRIAS
FT                   HIAAPGASLAKSADCSCLPDRGALQQKDAQRIAASARHAWKADGSTTNESAVAISGIGK
FT                   SGIVWGVKGSISSTSAEQSVEQQRTSMQKRIVEQNRNSQVSAPVEKGTPIQKGTPIEKG
FT                   TPIQNVSRTVEKGTPIAQRNVISEKDIRAAQETVNQHIANAAATVKANAAAAVNANASN
FT                   LINAGLSIAGNVSAAINSGSGHNVQGNCPVQQQVKQDPCQKPAPEKKPCASAPQGQLGV
FT                   SINAQASLGVNLNLSV"
FT   gene            complement(304603..306104)
FT                   /pseudo
FT                   /locus_tag="ckrop_0244"
FT                   /note="putative transporter"
FT   gene            complement(306165..306656)
FT                   /locus_tag="ckrop_0246"
FT   CDS_pept        complement(306165..306656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0246"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17033"
FT                   /db_xref="GOA:C4LGS8"
FT                   /db_xref="InterPro:IPR021414"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGS8"
FT                   /protein_id="ACR17033.1"
FT                   /translation="MSQSASHGSETTEDRAPGTQVSYVQAAVMDIIAVLLFALLARIAH
FT                   NSPELPFSWGGVLATAWPFLLGAAAGFGVMAILRRPAGTVVPFGITVWIPAVIVGLTIW
FT                   GFHHSKFPHWSFIIVATVTSAIFILGWRGLTRLSASRAHKRRERRQALIDAEEKRKADK
FT                   "
FT   gene            complement(306776..307981)
FT                   /locus_tag="ckrop_0247"
FT   CDS_pept        complement(306776..307981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0247"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17034"
FT                   /db_xref="GOA:C4LGS9"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGS9"
FT                   /protein_id="ACR17034.1"
FT                   /translation="MTIEAGTPGRKTETTASTEDTAEDTVLAYAQSAAETTVAPKEQVS
FT                   RRSRTAGSVKVQPLPWWRRALSLMRHPLVRLVFFLAVVVALTMIGRGSIDFVSEGLGYI
FT                   GSANTTWIIVGIAFIGVSILAMGELMYVLLRSAGVPCKRSSVYALTLTSNSVSATFPGG
FT                   PAISLAMIFREQHKWGASSVIASWYMVISGVIASGVLALYGLTAFYFLGAKVNPWTLVI
FT                   SLTAVVVVLLIVKWLAAHLSHVERVVVKILRKVNHYRGKPLNMGIDKARESIKTLSSVD
FT                   LPLPKLALAAVWSAVNWGADCLCLLVCLWAVGAHPNVASVVLAFVTAKIVGTAQVTPGG
FT                   LGPVEATIVGTLVATGMTSATALAATIIFRMISFILLAAVGWVIFLIQYAGPKRAMMLG
FT                   RS"
FT   gene            complement(308001..308687)
FT                   /locus_tag="ckrop_0248"
FT   CDS_pept        complement(308001..308687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0248"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17035"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGT0"
FT                   /protein_id="ACR17035.1"
FT                   /translation="MTNHANTTSRGHSYSAVPDETPSALLIWDAPNIDMGLGSILGGRP
FT                   SSAYRPRFDSLGQWLINEADQLSASRDEQIEPEATVFTNIMPGSADSIRPWIDALRNLG
FT                   FAVFAKPKLFDDTDVDPDMLAHINRRYDEGVLRSVYVASADGRNFQPRLEELAAEGIDV
FT                   AVLGFYEHATWAVMSEAIRFVDLEDIPDIFTTPLPRVNLDRLPDDGAWLQPYRSLRSVK
FT                   SSHHDG"
FT   gene            complement(308684..309436)
FT                   /locus_tag="ckrop_0249"
FT   CDS_pept        complement(308684..309436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0249"
FT                   /product="putative tRNA (guanine-N7)-methyltransferase"
FT                   /function="Predicted S-adenosylmethionine-dependent
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17036"
FT                   /db_xref="GOA:C4LGT1"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGT1"
FT                   /protein_id="ACR17036.1"
FT                   /translation="MSTNLEGPIGELPHGRPPQTVVNDGRDYPRLGTVSFRRGTLTPRQ
FT                   QELWDDKWPTYGRVLDDAVIDTDSWFGRSAPTILEIGSGTGTSTVAMASREPDFNVIAV
FT                   DLYKPGLAKLLGAFIREDLTNIRMIRGDGVEVLHRMIAPESLLGVRVFFPDPWPKARHH
FT                   KRRIIQSGTLHLIASRLKPGGVLHVATDHADYAEWIDERVDVEPLLEYKGWPWNESPIL
FT                   TDRQLTTKFENRGLSMDHTIREYLWRRK"
FT   gene            309690..309908
FT                   /locus_tag="ckrop_0250"
FT   CDS_pept        309690..309908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17037"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGT2"
FT                   /protein_id="ACR17037.1"
FT                   /translation="MQSGMSVSSLIRFIQMSYPHSNSEARRFFDHAVTHVNSPSEVSDA
FT                   LEQSAAVDPAMRDRIQEIIDVQVGDVA"
FT   gene            309905..311494
FT                   /locus_tag="ckrop_0251"
FT   CDS_pept        309905..311494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0251"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17038"
FT                   /db_xref="GOA:C4LGT3"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGT3"
FT                   /protein_id="ACR17038.1"
FT                   /translation="MSAPAIPQQSSWTGVPASYGSGLSDKRHDEGERHFVVSIIGPDVA
FT                   ALPRVAGVVEAAVRGGFPGDPENVTWEVAIAAGPEVQPDVVVAVVPPAAHAIIPAKDQR
FT                   ILEAVRRAVDHVVILSTPDGALSAGSAGALFFPGDGKQLPRDWEGIPICYSDYELMTVC
FT                   HRCAKELVTSSASSVSSVSSTVASNPAGILARNEPGNRASNPGKSDLASNPVSSDMNRV
FT                   GESADRTPATDDVTEDVEEYYTLPVPSSGVSTPSSATTAVLSDIGVVRVPERKLTYNVS
FT                   PHVLLPSSTLRNWLHTEEKQRRDSMAVTNQNCRAKMDRAVQDAYRSASSAWRSCLDPKE
FT                   LPEIIDAATDQLNDDRPAGTEPVPYIDVPFDPPEASVTERILIISVGISLGLGVARMVV
FT                   MPLVGTAFGVSISLGIAFGLFCAIVVSYMRHQQLQNNFRRVGGADALSLARDQWIDHAR
FT                   RVTSHAEEKRVKRLRSGGLRTVALQEALAHMEMASSSRPGTSRAGAPRSDSLRQGTSRS
FT                   GVPGRSANDAIR"
FT   gene            311514..312194
FT                   /locus_tag="ckrop_0252"
FT   CDS_pept        311514..312194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0252"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17039"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGT4"
FT                   /protein_id="ACR17039.1"
FT                   /translation="MSDAFFLFDDDEMLVDWWGGHSTVGPPSASALCGLTDCETGPPGV
FT                   SGLTLSLEGSFYDLGDARLDADGDGTSDSVTLSDDDGLTVYTDSDGDGMVDRVTTVRFD
FT                   GGYASWAMSSGGELDEGRAAQEHNIGGTQGHNLERRTSARGPHNSSNEISYQVHSLGGA
FT                   VTHLTSHSEKSHSTPGGDEDSSRDGTTRDHGLATGDKRSSRSKQCLDTWTRGRWECIER
FT                   GSWD"
FT   gene            312426..314291
FT                   /gene="pck"
FT                   /locus_tag="ckrop_0253"
FT   CDS_pept        312426..314291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pck"
FT                   /locus_tag="ckrop_0253"
FT                   /product="phosphoenolpyruvate carboxykinase"
FT                   /function="Phosphoenolpyruvate carboxykinase (GTP)"
FT                   /EC_number="4.1.1.32"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17040"
FT                   /db_xref="GOA:C4LGT5"
FT                   /db_xref="InterPro:IPR008209"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR035077"
FT                   /db_xref="InterPro:IPR035078"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4LGT5"
FT                   /protein_id="ACR17040.1"
FT                   /translation="MSAPTIPGLEGNAPTTNQDMLNWIAECAELCQPDKVVFCDGSDEE
FT                   WEAIAKDLVEKGTLIKLNEEKRPNSYLASSDPADVARVESRTFICSKTEDGAGPTNNWR
FT                   DPDEMRAEMSEHFKGSMKGRTMYVVPFCMGPITDPDPKLGIELTDSGYVVMSMRIMTRM
FT                   GKEALDKIGDGPFVKGLHSVGAPLEPGQEDVKWPCNETKYITQFPEDRVIWSYGSGYGG
FT                   NAILAKKCYALRIASVMAKDEGWMAEHMLILKLISPEGKAYHICAAFPSQCGKTNLAMI
FT                   QPTIPGWKAEVIGDDIAWLHFGDDGRLYAVNPENGFFGVAPGTNYKSNPNAMKTMEAGN
FT                   NIFTNVALTDDGDVWWEGLENEPDHLIDWKGKDWTPDEDCLSSHPNSRYCVPIEQCPVA
FT                   APEFNDPKGVPVDAILFGGRRPDTVPLVTEAIDWQHATFIGATLASGQTAAAAEAKVGT
FT                   LRYDPMAMLPFIGYNVGDYLQHWLDIGKKGGDKLPKVFLVNWFRRGDDGRFLWPGFGEN
FT                   SRVLKWIVDRIEGRVDAKKTVVGYTAYSKDIDIDGLDTDPKDVKAALTAPADKWQMDLS
FT                   DTEDWLKSLGPKVPQEIWDEFDFLKTRIKTANKDGNKALDNMKTK"
FT   gene            314351..315106
FT                   /locus_tag="ckrop_0254"
FT   CDS_pept        314351..315106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0254"
FT                   /product="Alpha-acetolactate decarboxylase"
FT                   /EC_number="4.1.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17041"
FT                   /db_xref="GOA:C4LGT6"
FT                   /db_xref="InterPro:IPR005128"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGT6"
FT                   /protein_id="ACR17041.1"
FT                   /translation="MRVILLVMSHDHPVVRHTIFQNSLMTALLDGIYDGEMTIGELLGK
FT                   GNFGLGTFDALDGEMVIIDGVCYQLKHDGTARPAELEQRTPYAVATNFVPRIVREAPSH
FT                   ISRADLSSFIDSMTPSENYMYALRIRGKFTEVRTRTVVRQERPYRPMHKVTEEDAAQVF
FT                   NDVSGVIAGFRTPIYEKGISVPGCHVHFIDDDRTSGGHVLDFELEKGVIELCPGTDLEL
FT                   KLPLTQDFSRANLAPEDLDEKLHTTEVKD"
FT   gene            315187..316674
FT                   /locus_tag="ckrop_0255"
FT   CDS_pept        315187..316674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0255"
FT                   /product="putative glycoside hydrolase"
FT                   /function="Beta-fructosidases (levanase/invertase)"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17042"
FT                   /db_xref="GOA:C4LGT7"
FT                   /db_xref="InterPro:IPR001362"
FT                   /db_xref="InterPro:IPR013148"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGT7"
FT                   /protein_id="ACR17042.1"
FT                   /translation="MAPHGVVTDDGRLHVFFAHDQRFPVQNSRLRWGHASVVVTPAPDG
FT                   HTPRLRSEWRFHPDVLVPNHDYDRDGCLSGSAVRDDEGTVRLVYTGIVAPQGEGRRVHN
FT                   STPAEDPASAHFSADWCDTSVNMAALFDTSGRHGGWCRPSSHNPLLDSAASPDGACGPF
FT                   VFRDPDSPFGGWRMVLGSVQEPSLTLYHSDNLRSWTADGELTLDTTGAVEGDTFDIVPE
FT                   ATSWEYPNLLRMRDCATGEDKDVLVVSMRGVSPNAHHFASSAQCVYWVGRLEGTTFRVE
FT                   RGCSELDLGHEFYAARFAPVTGDDAAVDDAIMIAWAGLPDADNQPTADDGWVHCLTMPR
FT                   RVRLCGGRLVQEFVTTSSAAADVASGVIDSAIIPETNVYGTVVGVRRDIPEPRHRSHLG
FT                   LVSADGVHVDVDMMRNKAGDLLVRIDRAEQSYHDGPDVRGVMILSEAIDNYRNHIGKPE
FT                   LLLSVDGSIMEADVAGYTLTSRLFLNRGDHWAEETWS"
FT   gene            316678..318462
FT                   /locus_tag="ckrop_0256"
FT   CDS_pept        316678..318462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0256"
FT                   /product="putative membrane protein"
FT                   /function="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17043"
FT                   /db_xref="GOA:C4LGT8"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGT8"
FT                   /protein_id="ACR17043.1"
FT                   /translation="MKWWNRFWELSGREVRNFFSLPESPGTGRYTIHGMITGLVTLFTL
FT                   AIVFSPVLAMPGLTGVFIAMSARDMPPLRRLRILVVFGVCFVASQALGVAISGNIMLMV
FT                   VVMALMGCFGSIVYHSLITFPPGAMQYVIACAVATYLPTRGVDGATLVTAGACGFVLAL
FT                   CISMGLQLVDRNKAMRDDITAAEDAVEAMREENLTHTEAARRRVAAHAAVFTALEDVRL
FT                   GYGWGRQLKPFSAFGRYAEKKTRDIHTQFVEAVVWRRWHTLRKMKYRVNADHAPKLSRV
FT                   SPHLGPPSALRRVKWSLSFRSAAVQIGLRMGMSIFLTGALTYGLGFGHPYWAVMTSAMV
FT                   LSLGKDRISTTHRGFDRVVGTLVGIALFGVIHVIDPPTVPLLLICALLYSTTLFTIGRN
FT                   YALGSVWITAMILLILNTAPTNNLTATQIVSQRAGETIIGAIVALFVLWVTGSSRAPTS
FT                   IVRRQARRVLLADGFLLDYVAERTDLTRPGIVARRQVLLELSASRRMEELYARDLPKGL
FT                   AEWEDLSALINEFSYVVLCGCWVENPDEVIDARRARRALNEMIRRLPAIDGVPLDTNNA
FT                   SDLMKRVLVAARPTSLRQ"
FT   gene            complement(318448..320721)
FT                   /gene="fadB1"
FT                   /locus_tag="ckrop_0257"
FT   CDS_pept        complement(318448..320721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadB1"
FT                   /locus_tag="ckrop_0257"
FT                   /product="enoyl-CoA hydratase/3-hydroxyacyl-CoA
FT                   dehydrogenase"
FT                   /function="3-hydroxyacyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17044"
FT                   /db_xref="GOA:C4LGT9"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGT9"
FT                   /protein_id="ACR17044.1"
FT                   /translation="MTNTTIHWDTDDSGIVTLTMDDPASPVNTMNDAFRASLHDTVEKL
FT                   TAAVEDKTVTGVIITSAKKTFFAGGDITSMINTGPDDAQATYDMLTSMKKDLRALETLG
FT                   VPVVAAINGAALGGGLEIALSCHYRIAADAKGSKIGLPEVTLGLLPGGGGVTRTVRMLG
FT                   IQEALMSVLTTGKRMRPEQAKGLGLIDDVVAPDALTDAAREWLASNPEPSQPWDREGYR
FT                   IPGGTPTSPKLASILPSFPATVTKQIKGAPMPAPKAILSAAVEGAQVDFDHALDIETRY
FT                   FVELVTGPIATNMMQAFFFDLQHCNGGGSRPKDVEKKKFRKLGMVGAGMMGAGIAYVAA
FT                   KAGLEVALKDVELANAERGKAYSEGLEKKALDRGRTTAEKSQALLDRITPTADYADLAD
FT                   CDIVIEAVFENTELKHKVWAEIEEAVPDDCLLGSNTSTLPITGLAEGVNRPQNFIGIHF
FT                   FSPVDKMPLIEVIKGDKTDDETLAGALDFAQQIRKTPIVVNDSRGFYTSRVIGFMLDES
FT                   LRMLAEGIDPAVIEAAGRQAGYPAPPLQLTDELNLKLVRKINTENAKAAEAAGIEIDDG
FT                   GVGTIVDAMLDDYDRPGKLEGRGFYTYTDGKRTGLWDGLWTELGAGRVSIGDYETKVSD
FT                   GDHVGRRGDAPNQPSEGAPTFADLRERILFAEALETQKCVDEGVLMDDADANIGSIMGI
FT                   GFPAWTGGTRQFIKNYARPEDADLPENAGDDYPTRGIPGFVARARELAAKYGERFEPME
FT                   SLTQ"
FT   gene            complement(320820..322052)
FT                   /gene="fadA1"
FT                   /locus_tag="ckrop_0258"
FT   CDS_pept        complement(320820..322052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadA1"
FT                   /locus_tag="ckrop_0258"
FT                   /product="acyl-CoA thiolase"
FT                   /function="Acetyl-CoA acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17045"
FT                   /db_xref="GOA:C4LGU0"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGU0"
FT                   /protein_id="ACR17045.1"
FT                   /translation="MAPAAETQPQAFIYETLRTPRGKGKSTGSLHIAKPVTLLTTLIKE
FT                   IRRRNPNIDEQRISDVITGCVTPVGDQGMDIARTAALMANLPYSATGVQVNRYCASGLS
FT                   AVNLAAAKVRSGWDDLVLAGGVESMSRVPMGSDGGALAMDPETAFHTDFVPQGVSADLI
FT                   ATLDGVTRDDADSYAARSHQRAAHAWEEGRFSNSIVPVTDQNGLKLLDKDETIRPDATV
FT                   ESLSGLKPSFDKMGRIGGFDAAALTRYPQVQHINHIHHAGNSSGIVDGAAMTLIGTEQA
FT                   GTDMGLTPRARVVTTATTGVEPTIMLTAPAPAARAALHKAGLTADDIDVWEINEAFAAV
FT                   VLRALRELHIPDEKLNINGGAIAMGHPLGATGAMLIGHAVDELHRSGGRYALITLCVAG
FT                   GMGVATIIERV"
FT   gene            complement(322308..323474)
FT                   /locus_tag="ckrop_0259"
FT   CDS_pept        complement(322308..323474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0259"
FT                   /product="putative oxidoreductase"
FT                   /function="Thioredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17046"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGU1"
FT                   /protein_id="ACR17046.1"
FT                   /translation="MKDHYRAVIIGAGQAGLAGAHELVHRGLTPGDDFLILDSNDGPGG
FT                   AWRNRWDSLTFDAAHGIADLPGLPLGHPDPDIPASRVVAQYYGDYEQKFGLAVERPAKV
FT                   IGVCNSDEKTEALTVVWMKDGTCTSVTCDVVLNATGTWTHPYILYIPGIADFRGTQLHT
FT                   VNFTTADDFAGKKTLVVGGGLSAVQFLLRLAPVTETVWATRRPPNFTDRTFDTRWGRDV
FT                   EQAVRDRTYAGDEPASVVRTTGIPLWGTYLDDVRDGVLVSRGMFTRITSDGVDFEPPTS
FT                   ASADGLGPSSSDHLVVPESWQPYDAHHHETVDIIFWNTGFRHALEHLAPLKLRMPGGGI
FT                   KMRDEVRVERDPRIFLLGYGSTASTVGATRAGHRGGRAAMKYLNDHSS"
FT   gene            complement(323517..324827)
FT                   /locus_tag="ckrop_0260"
FT   CDS_pept        complement(323517..324827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0260"
FT                   /product="Dcu family transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17047"
FT                   /db_xref="GOA:C4LGU2"
FT                   /db_xref="InterPro:IPR004668"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGU2"
FT                   /protein_id="ACR17047.1"
FT                   /translation="MIWFHLLIVLAFIILGARFGGIGIGFAGAAGVLVLTITGVSTSTD
FT                   DIPWAVIGIIMAVICTVAALQVAGSMDYLVHLTERLLRRHPQQIVYLSPLVTFVMSLLC
FT                   GTGHTAYSVIPIIVDVAKERGIRPSRPLSIAVVASQIGVAASPISAAMAALVVALDPFH
FT                   VGYLQCLAIVIPTTFIGCAAGAFVAARQGKELADDTVYQERKKQGLVKPSAAGIENYTP
FT                   AKSAVPSLWVFLFALILVVTYATVTSKELGIVDNPPLSATLAIMAVMLTAAAVICGLAK
FT                   KPFGEITTQETFRSGMTAAICIMGLAWLGNMFVSHYADTISHGLSGALHSQPWLSAVFF
FT                   YFAAPLMFSHAATTSAFMPLFVKLGLPATALVASYPAVSNYYLLPNYPTTVAAMEMDDT
FT                   GSTRVGKTPLSHPFVLPGTVSITVCVLLGFLVAPILL"
FT   gene            complement(325016..326338)
FT                   /locus_tag="ckrop_0261"
FT   CDS_pept        complement(325016..326338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0261"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17048"
FT                   /db_xref="GOA:C4LGU3"
FT                   /db_xref="InterPro:IPR021424"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGU3"
FT                   /protein_id="ACR17048.1"
FT                   /translation="MNANAGGRSVLSRLPGSAFGARHRRAITRSSLCSGAILLVIAIAA
FT                   PTFIVPSLKELPANINYDVSTAPTRGILIDSAAFKAGRPSASHSSDPACVGQVMPTRCY
FT                   IETDVPLRASEKVTTASSSKKTTKLRAVSTLYAGDLDTPERENGSDTKGQVDADNEIGS
FT                   IHDEVVLNRHTAFPSKKPQSSVAMDLSALGMGDDVKVSINDFVRDGYQFRFPFGSERRS
FT                   YRFFDAATGTATPIDFVNAIQQRGKDVYSKGIDVYQFSQDLGPVNLYDAQRRLMDNAGN
FT                   VSEEQRQELDRLRRNIPASSWGLSSGAPIQMDPYYVATRTINVEPATGIITNNSVTLWV
FT                   FYSQNYNEAKTIKENQDKELASPSRTMLHFDAQWDDRTKEARLHDIQRVIKPLNIWSKA
FT                   VPWITGVSGMILILAGLYLYFDARQAGGRPAGKSPETPDSL"
FT   gene            complement(326489..327031)
FT                   /gene="uspA2"
FT                   /locus_tag="ckrop_0262"
FT   CDS_pept        complement(326489..327031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uspA2"
FT                   /locus_tag="ckrop_0262"
FT                   /product="universal stress protein"
FT                   /function="Universal stress protein UspA and related
FT                   nucleotide-binding proteins"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17049"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGU4"
FT                   /protein_id="ACR17049.1"
FT                   /translation="MSDTTSAHTEPTNQASDASNGGHKDTMLIAYDGSVEAKRALEYAG
FT                   RFLSTPRAYILTAWEPLQHQANRGVGASMAGAIYQPADNPEDGDPAHAEALQTCKEGVQ
FT                   IARENGFEAEPFLVESATTIWSAIVDAAEELHADVIVSGTRGLTGFKSLFQASVSDNVL
FT                   RHSGKPVLIVPPLPDSK"
FT   gene            327211..328839
FT                   /locus_tag="ckrop_0263"
FT   CDS_pept        327211..328839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0263"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17050"
FT                   /db_xref="InterPro:IPR007391"
FT                   /db_xref="InterPro:IPR022029"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGU5"
FT                   /protein_id="ACR17050.1"
FT                   /translation="MAGIAYATDLVMSQGQVPRGVKVGGVSIGGMSKASADTMLRNELG
FT                   DKVREPVSINAGDMTSSLDPTMSGLRVDWDQTIENAGHQPKNPWTRIESFWKTREVSIV
FT                   NDVDEGSLDNALQRVDKELTREPVNAELSIGSDGKADVKDPVTGQKINHDELAENVSKH
FT                   WLNTTRVVEIPAEEVEPEIGEKAVKQAERDVLNKVVSGPLIFKGRDDVSGIIAPEDMGQ
FT                   IVTFRADGDHFTADYDDSAAKSILSSQLSSTERTEKDADVLIGDDGSVTVTSPSQDGVS
FT                   INWSKTLDDLQGKLTNTTVRDYDVAYTDDKATFTTEIAEKADFRETMGEFTTGGYAADS
FT                   GVNIRRVAEMVNGAIVSPGQTFSLNGFTGPRGEAQGFVKAGIIKNGHSDEGVGGGISQF
FT                   ATTLYNATYFAGMTDVAHTPHSYYISRYPAGREATVYEGAIDLKFKNPFDTPVMIKAFT
FT                   GDDDITVQIKGIPQVKVDSIPGEKTNFTSPSSQQLSGPDCHPSSGSQGFTVTDTRVVTS
FT                   LSTGQEISRNTTTTKYDPSPKITCS"
FT   gene            328850..329710
FT                   /locus_tag="ckrop_0264"
FT   CDS_pept        328850..329710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0264"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17051"
FT                   /db_xref="GOA:C4LGU6"
FT                   /db_xref="InterPro:IPR026898"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGU6"
FT                   /protein_id="ACR17051.1"
FT                   /translation="MSFSSPGPYSGGPYSGGVSSPSGASRRRGVGWGLVTLVVGVIAYS
FT                   VVMRVMVRTDNLNLFPTLLLIGAVTVPLAVLFVAYAADQRVHGHEGLVALTAVFGGIVG
FT                   TTTAGSLEFDVLHRMPWLGMLAVAVIEETAKLIVPGVIYLWGRRRTAGMGVVLGVASGA
FT                   GFAVLETMGYGLNALIATHGNVDAVSATLLLRGLLSPAGHVAWTGFTVWALWRCADTPK
FT                   PSNGRRVFAWAWVTAVILHAVWDGTSLWILHVGVVFISVLGLLSLIVWSRSTSRQQPTS
FT                   PWEVV"
FT   gene            329707..330957
FT                   /locus_tag="ckrop_0265"
FT   CDS_pept        329707..330957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0265"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17052"
FT                   /db_xref="GOA:C4LGU7"
FT                   /db_xref="InterPro:IPR026841"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGU7"
FT                   /protein_id="ACR17052.1"
FT                   /translation="MTATDIYPDQKNDQARQDRSDGDRSVKERWTDHCRRRFADKGTYR
FT                   YRLPWLRSLSQDQLVTTRRVGMAVWAVVVCAIGVLAGWSEVGSFLIPLLFVGFAIYSLG
FT                   HSRLAYILVDWGPFILFLLAYRGIKTVVGWMGIPVQWNLAPDVDRWLFGGTLPNVWLQE
FT                   HWRYAHAPWWEFILMAVYSSYFFMPYTVAFIEWLRSRAEFRRYIVGLLAVSFIGLGIYV
FT                   FVPAAPPWAAARCTPADVADQPSHTPCMFSAEHAGEGSILGPVNNKNDSPEPWVERLTA
FT                   HAWSQIAPFGLAEGVKDFQDGARREARADGPTLGPVEPVPVGEGPLAKAQASSNLVSAI
FT                   PSLHAGITMYFATFLFSRRRWKWGSVALIYALTMGFALVFFAEHYVFDIILGWTLAAAV
FT                   PLVQTWWMSRRRESINK"
FT   gene            331055..332509
FT                   /locus_tag="ckrop_0267"
FT   CDS_pept        331055..332509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0267"
FT                   /product="permease of the major facilitator superfamily"
FT                   /function="Permeases of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17053"
FT                   /db_xref="GOA:C4LGU8"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGU8"
FT                   /protein_id="ACR17053.1"
FT                   /translation="MRASQTVHSQLPTRSDRLDSLPFGREHRKLLVGSGVGWALDAMDV
FT                   GLISYVMAALVAEWSLSNTQASWLGSIGFVGMMIGASVGGLLADKWGRRNVFALTLLTY
FT                   GIATGAAAFSVGLVMLLILRFIVGVGLGAELPVASTLVSEFAPRKNRGRIVVALESFWA
FT                   VGWIMSALLGYFLVPKEWGGWPGWRWALLVGIVPAVYALVVRHGLPESVRFLESRGRLA
FT                   EAERSVRLFEKGSSRNSTVPFDEAVALTPTSVAKGDAPERTSERDTSLGGTPTGNRPGE
FT                   DAAGTTAGESSIFSAHMRGRTTALWVVWFFVNLAYYGAFTWMPTLLYLQGHSLVKSFEF
FT                   TLMMTLAQLPGYAAAAWLIEKWGRRLTLSVFLCGSAVSAILFGLQSGATGIIITGLLLS
FT                   FFNLGAWGALYAIGPEIYPTAMRGTGTGAAAAVGRVAGVVAPLIVPIILEWGSTPLVFT
FT                   IFGASFFIAVAGAVALPERHNMDMVE"
FT   gene            complement(332575..332648)
FT                   /locus_tag="ckrop_t0008"
FT   tRNA            complement(332575..332648)
FT                   /locus_tag="ckrop_t0008"
FT                   /product="tRNA-Gly"
FT                   /anticodon="(pos:332614..332616,aa:Gly,seq:ccc)"
FT   gene            332846..333409
FT                   /gene="dcd"
FT                   /locus_tag="ckrop_0268"
FT   CDS_pept        332846..333409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcd"
FT                   /locus_tag="ckrop_0268"
FT                   /product="deoxycytidine triphosphate deaminase"
FT                   /function="dUTPase"
FT                   /EC_number="3.5.4.13"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17054"
FT                   /db_xref="GOA:C4LGU9"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4LGU9"
FT                   /protein_id="ACR17054.1"
FT                   /translation="MILSDRDIRSAIDSGHLGISPFDPTMVQPSSIDVRLDRYFRVFNN
FT                   ARYTHIDPKQEQEDLTSLVEVKEGDAFILHPGEFVLGSTLEEFALPADLAGRLEGKSSL
FT                   GRLGLLTHSTAGFIDPGFNGYITFELSNASNLPIALYPEMKVGQLALFMMSSPAETPYG
FT                   SGSLGSKYQGQRGPTASKAYMNFR"
FT   gene            333480..334835
FT                   /locus_tag="ckrop_0269"
FT   CDS_pept        333480..334835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0269"
FT                   /product="UDP-glucose 6-dehydrogenase"
FT                   /function="Predicted UDP-glucose 6-dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17055"
FT                   /db_xref="GOA:C4LGV0"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGV0"
FT                   /protein_id="ACR17055.1"
FT                   /translation="MRMSVIGTGYLGSTHAACMAELGHEVIGVDVDPHKIELLSRGETP
FT                   FFEPGLDGLIRKHISSGRLHFTTSYQDAADFANVHFLGVGTPQQKNSYAADMTFVRSAV
FT                   TNLVPLLRGRHIIFGKSTVPVGTARVLQQLTDRLVASQDADSSATDAWETSVDIAWNPE
FT                   FLREGHAVQDTIHPDRIVLGVENSPSEVEDVARKIYAQPLAEGTPLLVTDFATSELVKV
FT                   SANAFLATKISFINAVSEVCEASGADITVLADAIGADERIGRKFLNAGLGFGGGCLPKD
FT                   IRAFMARAGELGADQALTFLREVDAINLRRREKLISMVKDACGGSLHNARVTVLGAAFK
FT                   PESDDVRDSPALAVAGALSLAGAQVSVYDPQAMKNASKVFPTLMYADTVWDALHNADVV
FT                   VVATEWTQFKELDPSEVRACVASPIIIDGRNCLDVDAWMQAGWSVRALGRSL"
FT   gene            complement(334855..336330)
FT                   /locus_tag="ckrop_0270"
FT   CDS_pept        complement(334855..336330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0270"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17056"
FT                   /db_xref="GOA:C4LGV1"
FT                   /db_xref="InterPro:IPR012507"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGV1"
FT                   /protein_id="ACR17056.1"
FT                   /translation="MGKHSASGDEPYQPRGTHTADSSPQQAPIPTETRRSRLSNARRET
FT                   QPQASAPQVATSQPKPSQPATPQPKASKTTKRFRPHIKDWTLGQRILAGFLLIGFILSA
FT                   ISTVALWPSNTPARVDKSFQETSSLPQNIADGTVAVTTEAACGSPSVGRTFDDTPREPT
FT                   TSTGTCTRAIVDITSGPDKRKRTLIETSHKPGDPDLREGDKIRMTRHATDDGSMGYAFN
FT                   DYQRKVPVIAWLIITAIAMVAIGSWRGARSLVGLVITMAIIGAFMLPALLRGGDPLLLA
FT                   VTSCALIMFVVIYLVHGISWKSSSALAGTIIALGLAAIMAGWGIDGTRLRGLGEEDNLL
FT                   VQLYLPDVTVHGLMLAGFIVGAIGALNDATVAQASTVNELAFIDHKASPWRLFAGGMQV
FT                   GRDHIASMLYTLILSYAGAALPMLLLITASERPLGQVLTSDLIATEIVRSAVGAIALAL
FT                   AVPITTIIAAVTVKPDPDASNAGGRGHVHVHHH"
FT   gene            complement(336526..337833)
FT                   /locus_tag="ckrop_0271"
FT   CDS_pept        complement(336526..337833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0271"
FT                   /product="alanine aminotransferase"
FT                   /function="Aspartate/tyrosine/aromatic aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17057"
FT                   /db_xref="GOA:C4LGV2"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGV2"
FT                   /protein_id="ACR17057.1"
FT                   /translation="MSSSDKNATPAPENTDTSSATPTQVTGRPRLKHLDQSSKLRNVLY
FT                   EIRGPVNAEAERMIADGHRILQLNTGNPAVFGFEAPDVIMRDMIAALPTAQGYSTAKGI
FT                   IPARRAIATRYELVPGFPSADIDDIYLGNGVSELITMTTQALLDDGDEVLIPAPDYPLW
FT                   TAATSLAGGKPVHYFCREDDNWNPDIEDIKAKVTPKTKAIVVINPNNPTGAVYSRETLQ
FT                   KIVDIARENSLLILADEIYDRILYDDAEHISIASLAPDLLCITFNGLSKAYRVAGYRSG
FT                   WMVLTGPKEHAQGFIEGLDLLASTRLCPNVPAQHAIQVALGGKQSIYDLTLPGGRLLEQ
FT                   RNVAYEKLNEIPGVSVVKPMGALYAFPKLDRNVYDIHDDEQFMFDLLRAEKIHLVQGTG
FT                   FNWPEPDHFRVVTLPWARDLADAIERLGNFLSSYHQ"
FT   gene            complement(337896..339416)
FT                   /locus_tag="ckrop_0272"
FT   CDS_pept        complement(337896..339416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0272"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17058"
FT                   /db_xref="GOA:C4LGV3"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGV3"
FT                   /protein_id="ACR17058.1"
FT                   /translation="MSTTPSDPTSQSDSEGYSTQPNDQFSTENRPNSGSSFEQRRAEEQ
FT                   RHGQEQRVEGTQPPREERGQDTTESSSSRSSSTNAPIDAEFSDVPTARDVLPENDSLSE
FT                   DRAFDEPQAHEDQSHETQSHGVDSHNPDTKSGFSTNGAAGFPVITPEMMREANGHTTSS
FT                   ADGSAESDAPAQTNHSAQPDSAQQDSGRHQDGAISSPTTGKSTNGKPSTVTSDAYNPSP
FT                   NTTTHGSRPVGNAFQAQPQNSSAGKSSGQGSVGKEKSNQDRQVPSAPNRSENTADDKTP
FT                   HTAAQGSAAASGSSVSGRSAGSRGASDGSKKAANVQADTGHSNDQTDADQESTENSRKE
FT                   KFKNWIATTPAKALVFVVAVLILAALFGAIWMANNDNFTVGSSEKTSTAPSEDNQADQP
FT                   QQNFPTPGGKTIKGSIGQNIDLDARQVQICGSSTGEYTRSAIPVGWDCSVADTARQVYN
FT                   DTPKDDRGSITIDSPISDSTFKLECQEFKPGLVRCENKDDDIHIYIGN"
FT   gene            339805..340098
FT                   /locus_tag="ckrop_0273"
FT   CDS_pept        339805..340098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0273"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17059"
FT                   /db_xref="GOA:C4LGV4"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGV4"
FT                   /protein_id="ACR17059.1"
FT                   /translation="MNEVILAAASAPPLGIIGWVIIGGLAGWIASKIMGTDAQMGVPLN
FT                   IIVGIIGGFLGGWLLGAVGFDVEGGGKFFSFLTCLLGAVILLWIVGLVTKKK"
FT   gene            340398..341015
FT                   /locus_tag="ckrop_0274"
FT   CDS_pept        340398..341015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0274"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17060"
FT                   /db_xref="GOA:C4LGV5"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGV5"
FT                   /protein_id="ACR17060.1"
FT                   /translation="MNACRVNAMSRARMYRNAGARYLVDYVSSAAKQCSFRSHHASIHH
FT                   QASGVRRRVDSSTIKKWLVSKFAFNKDHDCFSHEKKRHRYLGAGRRADCVLAGILFVMG
FT                   AALIPWMAILLFTMPFPGVLGWIALDCAEIAALWTSAWWVLKRRLHAAAGLWGVCALLL
FT                   VDAIADVTTSFPNIGSAVVTISVELFVSGWAAWCAYAWGKSV"
FT   gene            341127..341552
FT                   /locus_tag="ckrop_0275"
FT   CDS_pept        341127..341552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0275"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17061"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGV6"
FT                   /protein_id="ACR17061.1"
FT                   /translation="MITTEKIHDQPAEGEGTRILVDRLWPRGVKKATAPVDEWLKGLAP
FT                   SPELRKDWGHDPARFSEFADRYRSELDERLAAYKDTDTSGDDGDSSGSDSDSEVSQVGE
FT                   MRDRAASGENIILVFAAKDRVFNHAVVLKAWLDEHTR"
FT   gene            341639..341791
FT                   /locus_tag="ckrop_0276"
FT   CDS_pept        341639..341791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0276"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17062"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGV7"
FT                   /protein_id="ACR17062.1"
FT                   /translation="MFGKGAERRSYTRERAKNVGSERRLYIGYMYRKTHPHIKNATLTS
FT                   VDKKS"
FT   gene            342048..343928
FT                   /locus_tag="ckrop_0278"
FT   CDS_pept        342048..343928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0278"
FT                   /product="molecular chaperone protein"
FT                   /function="Molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17063"
FT                   /db_xref="GOA:C4LGV8"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4LGV8"
FT                   /protein_id="ACR17063.1"
FT                   /translation="MGRAVGIDLGTTNSVVSVLEGGDPTVIANSEGSRTTPSVVAFSKN
FT                   GEVLVGQSAKNQAVTNVDRTIRSVKRHIGDDSWNVDIDDKKYTAQEISARILQKLKRDA
FT                   ESYLGEDVTDAVITVPAYFSDAQRQATKDAGQIAGLNVLRIVNEPTAAALAYGLEKGED
FT                   DQTILVYDLGGGTFDVSLLEIGEGVVEVRATNGDNKLGGDDWDQRIVDWLTDKFKSSHG
FT                   IDLTKDKMAMQRLREAAEKAKIELSSSQQTSINLPYITVDEDKNPLFLDETLSRTEFQR
FT                   ITQDLLDRTRKPFQQVLSDAGISVSDIDHVVLVGGSTRMPAVTDLVKELTGGKEPNKGV
FT                   NPDEVVAVGAALQAGVLRGEVKDVLLLDVTPLSLGIETKGGVMTKLIERNTTIPTKRSE
FT                   TFTTAEDNQPSVQIQVFQGEREMASANKLLGSFELGGIAPAPRGIPQIEVTFDIDANGI
FT                   VHVTAKDKGTGKENTIKIQDGSGLSQDEIDRMVKDAEAHAEEDKKRREEQEVRNSAESM
FT                   VYQTRKFVDDNKEKVSQDIQDKVEEAAKGVDEALKGDDIEAIKSAVEKLSAESQEMGKS
FT                   LYESEAANGGTTGGAAGAAGAAGADAGSDNSDPNVVDAEVVDEDKKDDDK"
FT   gene            343925..344662
FT                   /locus_tag="ckrop_0279"
FT   CDS_pept        343925..344662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0279"
FT                   /product="molecular chaperone protein"
FT                   /function="Molecular chaperone GrpE (heat shock protein)"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17064"
FT                   /db_xref="GOA:C4LGV9"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGV9"
FT                   /protein_id="ACR17064.1"
FT                   /translation="MSLGNDMPDDPGAPANTDPEGASPNEAEAAVDEARLAQETPDGDA
FT                   PEGAVDGENVAEELDDIDAEVDGLQDDPDVAVESAEDDAARDLQDEGQEPVDDGAGAGV
FT                   ASPVEKQLEEMTADLKRVSAEYTNYRRRAERDRAATFELAKAQVASDLLPMADDFDLAE
FT                   KHGDLKEEGPLKVFSDKFTKLIADLGVEKFGQEGDAFDPNFHEAVQDMSSGDEKIVATV
FT                   LRAGYRMGDRVLRTAMVVIGDPA"
FT   gene            345176..346315
FT                   /locus_tag="ckrop_0280"
FT   CDS_pept        345176..346315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0280"
FT                   /product="putative membrane protein"
FT                   /function="Phosphotransferase system, fructose-specific IIC
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17065"
FT                   /db_xref="GOA:C4LGW0"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGW0"
FT                   /protein_id="ACR17065.1"
FT                   /translation="MKEAAAPEQRVQLDESPINNTQTGERYSPRMGLGEFTMNVLNGIS
FT                   VAVVVALVPQALLGELFKALLPVFPQGKEIIGMVSVASSMLPIAIGLLVAMQFKMTHIQ
FT                   TATVAISAVMGSGVVKGINSDEFLQLKGTGLVINTGLTAAFAVIMILLIGDRLKSYTIL
FT                   VLPPTVIVIAGGLGKFVTYPAVLVFTKWLGNLVVGAADLQPIVMGLILGIAFGVMMASP
FT                   ISTVGIATAIFLSGIASGVANVGCCAVAFTMMWAGWKVNGPGGSLVHVVGSAKVQVANM
FT                   MRRPVALLPAIVACGVSGIVAGIFRVQGTPISAGFGISGLVGPLAALNADGWGWSVRNI
FT                   LVVALVYAVVPCVSAFFAVKLFDKKLGVTNENMYALKFH"
FT   gene            347120..348367
FT                   /locus_tag="ckrop_0283"
FT   CDS_pept        347120..348367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0283"
FT                   /product="molecular chaperone protein"
FT                   /function="DnaJ-class molecular chaperone with C-terminal
FT                   Zn finger domain"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17066"
FT                   /db_xref="GOA:C4LGW1"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGW1"
FT                   /protein_id="ACR17066.1"
FT                   /translation="MTAQREWAEKDYYKDLGVSRSASEDEIKKAYRKIARDNHPDSHPG
FT                   DSAAEERFKQASEAYSVVGDAKKRKEYDELKDMLASGGLGGFGGSGFNNGGFNSGGFGG
FT                   QYGSSGGFRTTFSNYDTGSGFSASDLFGGGSGGGIGDILGDLFNGRGSASAAASRGQRN
FT                   LRGADVETEITLDFREATKGATVPIRLTNPSSCQECHGSGAKPGTSPHTCSTCNGKGVV
FT                   SDNRGAFGLSRPCSDCGGTGTKIDDPCPACKGSGVTNRTRTITVRVPSGVVDGQKVRLA
FT                   GQGEAGMRGRPAGDLFVTVHVRPDKLFTRKGDDLRVTVPVSFSELALGGVVTVPTLDNK
FT                   VRVKIPAGTNDGRTLRVRGRGVPKRNQKNGDLLVTVKVAVPPKLDEGAASALRSYVAEE
FT                   KRLGFDPRANWPGKEG"
FT   gene            348371..348988
FT                   /gene="hspR"
FT                   /locus_tag="ckrop_0284"
FT   CDS_pept        348371..348988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hspR"
FT                   /locus_tag="ckrop_0284"
FT                   /product="transcriptional regulator, MerR family"
FT                   /function="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17067"
FT                   /db_xref="GOA:C4LGW2"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGW2"
FT                   /protein_id="ACR17067.1"
FT                   /translation="MASNSDRRRNTTGPSNAGGAAGTRGAGAGATGGAAGTRGGEAGAE
FT                   TRGGENRATPDTSRQTHTRGNRQPLGEVRREEVYVISVAAELTGLHAQTLRTYDRMGLV
FT                   TPERTRGGGRRYSPDDIEMLREIQKLSHEDGVNLAGIRAIIDLKSQVDELQAENHQLRE
FT                   RLARMEAQHGRSRGEIVHVPRSTAVVMWEPGARRRKDRRDRR"
FT   gene            349080..350255
FT                   /locus_tag="ckrop_0285"
FT   CDS_pept        349080..350255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0285"
FT                   /product="putative flavohemoprotein"
FT                   /function="2-polyprenylphenol hydroxylase and related
FT                   flavodoxin oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17068"
FT                   /db_xref="GOA:C4LGW3"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGW3"
FT                   /protein_id="ACR17068.1"
FT                   /translation="MVPVVTVLQTDGSRFVDAVFTHLFARRPSFIRRLPADLSQLKPSF
FT                   RRALVHVYAKQATGNGLDRRTRRFLRHLAEDHRSFGVEAPDYVAMGDAIIDAGREIIAP
FT                   QVTSEEFELFAMATGQIIGLLEEGAAEYSEVPVRWGATVLDVDHRSDAITVVRLAADSP
FT                   IPYRAGQLVPVLAPQSSGKRKWLAPAIPHSDDRLIEFHLEVPRFEGPRQQSLKGSSALV
FT                   FDLARMTRPGDVWEIGAARGSMTVDLLDGSRPVLMVAHGAHLAAIRAIILDLASKPSPP
FT                   QTYLFFGAEYPSDLYELRTLWSFDTAMDWLTVHPSTVHAEEDQFARMSAYAVAPRDFTV
FT                   REGISLADDVMARGPWLGHETLLAGPKTVVGDIKRKLMASGMNPALITMAS"
FT   gene            complement(350314..353715)
FT                   /gene="pyc"
FT                   /locus_tag="ckrop_0286"
FT   CDS_pept        complement(350314..353715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyc"
FT                   /locus_tag="ckrop_0286"
FT                   /product="pyruvate carboxylase"
FT                   /function="Biotin carboxylase"
FT                   /EC_number="6.4.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17069"
FT                   /db_xref="GOA:C4LGW4"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR005930"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGW4"
FT                   /protein_id="ACR17069.1"
FT                   /translation="MPLRQFSKVLVANRGEIAIRAFRAAHELESSTVAVYPWEDRHSSH
FT                   RIKADEAYEIGEEGHPVKAYLNVDEIISVAKDSGAEAIYPGYGFLSENPELARACEREG
FT                   IAFVGPTADVLDMTGNKATAIHNAKEAGLPTLGDTPATDDLNELERLADESDMPYPLFV
FT                   KAVAGGGGRGMRLIPSRDKLRELCETASNEAKTAFGDPTVFLEQAVVNPKHIEVQILAD
FT                   GQGNVVHLFERDCSVQRRHQKVVELAPAPSLTPEQREAICTDAVNFARHINYRGAGTVE
FT                   FLVDEDGNHVFIEMNPRVQVEHTVTEEITDIDIVRAQLQIAAGASLPEIGLTQDTISFH
FT                   GAAMQCRITTEDPANDFRPDTGYITAYRSPGGSGIRLDGGTATGAEVTGHFDSLLVKLT
FT                   CRGRDFDSAVHRARRALDEFRIRGVATNIRFLRGVLDNPDFRAGNFTTSFIADHPDLLT
FT                   TKPYANRADKIMRYLGTVTVNKPNGERATTLNPADKLPTLDTSAPLPEGSRDRLLKLGP
FT                   EKFAQELRQRRGVAVTDTTFRDAHQSLLATRVRTNDLVAAAGHVARTTPQLLSVEAWGG
FT                   ATYDVAMRFLKEDPWARLDRLRQAMPNVCIQMLLRGRNTVGYTPYPETVTKAFVKEAAA
FT                   SGVDIFRIFDALNDVSQMKAAIDAVRETGTAVAEVAMSYAGNVADPNEKLYTLDYYMNL
FT                   AHTIVDAGAHILAIKDMAGLLRPEAARMLVTELRKEFDLPIHIHTHDTAGGSLATYMAA
FT                   WEAGADAIDGASAPMAGTTSQPSLSAIVAATANTKYDTGLDLAAVSALEPYWEGVRSVY
FT                   APFDKGLAAPTGRVYNHEIPGGQLTNLRAQATALGLEHNFEQIEDAYAAADKMLGHLVK
FT                   VTPSSKVVGDLALQLVGAGIDPADFAANPNDYDIPDSVIGFLNGELGTPPGGWPEPFRT
FT                   QALKGREKTPEITPVSAEDEDHLNGSSEDRRNTLNRLLFPGPAADFDTHRNEYGEVSRL
FT                   STNQFFFGLYPNEEQKIQLAKGIDLIVQLQSISEPDARGVRTVMCFLNGELRPVFVRDE
FT                   SVEADVNPAEKADRSNPGHVAAPYAGNVTVTVDEGDTVHAGDKIAVIEAMKMEASITAP
FT                   VDGTIERIISDGTFHVDGGDLVVVIS"
FT   gene            complement(353789..357391)
FT                   /locus_tag="ckrop_0287"
FT   CDS_pept        complement(353789..357391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0287"
FT                   /product="delta-1-pyrroline-5-carboxylate dehydrogenase"
FT                   /function="NAD-dependent aldehyde dehydrogenases"
FT                   /EC_number="1.5.5.2"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17070"
FT                   /db_xref="GOA:C4LGW5"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR025703"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGW5"
FT                   /protein_id="ACR17070.1"
FT                   /translation="MSSKHNKSGKKNKKDKKLNATGDEISATTTTASNVDNPDFLKPPP
FT                   NSHDLDNITDRAIARAHEWLEATNGEQTRKESSSTEQLAALVHDPQGIDFTMGFVDRVA
FT                   RPEDNAVAAKEFASLGSPFGRKESLPDFLGPLNTALVSLGALAGQVLPSIVMPIARGYL
FT                   RKMVGHLVLDANGKALDKLLDDAHANGFRLNINLLGEAVLGEREATRRLDRTIELLRNP
FT                   KVDYVSIKASSVCSQLNPWDIEGNTRRLKERLRPLYREAVKRTPHPFINMDMEEYKDLD
FT                   LTIKLFKELMSEDEFMDLEAGIVLQAYLPDTLDALHELIDFAHERVNKGGAPIKVRIVK
FT                   GANLSMERVDSEIHDWKQTPYLTKAEVDANYLRLLDVALQPEHANAIRIGAASHNLYTV
FT                   ATAHELSVQRGVEDQLDIEMLQGMAPAQARAVRQITGTVILYTPVVHAEDFDVAVSYLV
FT                   RRLEENGAHQNFLYALFAPDVAGDDDMTPMQEQEKRYLNAVNDRWTTFAGPRRQQDRRQ
FT                   ERSAADVSKRVESVPGHFVNEPDTDPSLPANREWALRWLDHDPGPVTSPLITEKSDIDA
FT                   IVARARSRSSAWGNTSGHDRAEVLDAAANALAAHRGELLAAMTHEANKTVAESDPEISE
FT                   AIDFARYYAESARALDGVKGSRFTPYSVVLITPPWNFPLAIPMGGVFAALAAGAAVVIK
FT                   PAPQVVRIAEVAVGILREAGIDEELLQLVNVAENEAGQHLVSHPAVDSIILTGASDTAR
FT                   LFRSWKPQMVINAETSGKNAIIVTPSADPDLAVSDVYKSAFGHAGQKCSASSLVIVVGS
FT                   VGKSKRFMNQLIDAVETLKVGPGTDISTTMNGIIEPPSDKLMRGLTQLESGEKWLVKPR
FT                   KLNKEGTLWSPGLRDNVKPGSWYHTHECFGPVLGIMHAATLEEATEWQNSTGYGLTGGL
FT                   HALDPDEIDWWIDHVEVGNAYVNRGITGAIVQRQSFGGWKASALGSGAKAGGPNYVAQQ
FT                   GTWSEGDVDELPRAGLQRHVARRLRRIKGQLDNTLTPADLYWLRRAAESDAYAWSTEFG
FT                   VEHDNTALIAESNIFRYRPLLAPLRVRVGSPSSSPTLIRDLVRLTLASEISGTPMDVSA
FT                   TAETATELGAMGFSIRRVEDATYAAEVENAESVRVRTLGDVDPALYKAAAHSGSIVIDH
FT                   PVLADGRREILPFLLEQAVSITNHRFGYIKGLTN"
FT   gene            complement(357520..359112)
FT                   /locus_tag="ckrop_0288"
FT   CDS_pept        complement(357520..359112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0288"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17071"
FT                   /db_xref="InterPro:IPR010427"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGW6"
FT                   /protein_id="ACR17071.1"
FT                   /translation="MALNATSTVNKTSAAQASVMRGPLAHGLLGGGPLTHVPQWSPDEL
FT                   NAVAASMAGLIRPLTTRISDSPIPATIIGGINGDAANASLKSINADTRAVTDHITQSVG
FT                   LLRAHSSALCGPLCHAQSLEHTIKELQAQRDATADPFISAGLYIIETAHKADLALLLKF
FT                   LDTIDGVLAHLLVDVWNSPNFKALAHVLADAGITDAFLPTTVPAPDPQRDNSQPWLDGR
FT                   TVEDTDYILRERLDTWLSTAHDDKEKQYLEGILKTLADNDDAYLVHLDHDGVAIALGDP
FT                   TTSPAVATLVGGVGSSEPGRIHGHTDWAREIRQASGNKASVIAWSAYPAPKSLPAAAST
FT                   DNAIRGAQNLRSFQQSLRTRNPSAQLTVTGHSYGSVVVGHAARSSDATSSDATPSDTTP
FT                   PLEADTVVIVGSPGTGANHAHELAPHALDRHAEIVVGRNDADPIMFAAGPDVGAHGPDP
FT                   SYARWGADAWLTPNGLAATPPSDQKIRDLGGLVIPGLRFGELMKNHRYRDYSAALAQVI
FT                   TDGVPADAHTSQG"
FT   gene            complement(359124..359471)
FT                   /locus_tag="ckrop_0289"
FT   CDS_pept        complement(359124..359471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0289"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17072"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGW7"
FT                   /protein_id="ACR17072.1"
FT                   /translation="MWRMTLTITPSALRTLMHDHHDHAEHAEHVGAVCDAAHEQAPSFH
FT                   LSRTHAALLAMADAAYTQAHELSARHTRFAESVDSLRRRVCAADDASSTHLSELSPMHA
FT                   GDTATRADKLG"
FT   gene            complement(359644..360414)
FT                   /locus_tag="ckrop_0290"
FT   CDS_pept        complement(359644..360414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0290"
FT                   /product="putative membrane protein"
FT                   /function="Predicted permeases"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17073"
FT                   /db_xref="GOA:C4LGW8"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGW8"
FT                   /protein_id="ACR17073.1"
FT                   /translation="MSPTVIALMLTTSLFAGWVDAVVGGGGLILLPLIMILNPSFTYSQ
FT                   ALGVNKVAAICGTGSSAITMARRVPAARTAFRYAPLAFGGSALGAVIASSVDKDIMRPI
FT                   VIVLLIAVGAFVLLRPSFGQVTVRRTVTHERWIAALLLITGLGIYDGAFGPGTGLFLIL
FT                   TVTSLLGEDFLNSAAWAKILNTFTNLGALVVFAINGDIWWLLGFGLAVTNIVGAQIGAR
FT                   MVLSKGAGFVRIVLLVVVVLMAGKLALDQFGVTA"
FT   gene            360486..361316
FT                   /locus_tag="ckrop_0291"
FT   CDS_pept        360486..361316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0291"
FT                   /product="hypothetical protein"
FT                   /function="Predicted amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17074"
FT                   /db_xref="GOA:C4LGW9"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGW9"
FT                   /protein_id="ACR17074.1"
FT                   /translation="MRISLAQICSVPDVSRNTDAVCELIMRASSENSDLIVFPEASMYP
FT                   FGQGRLDTIAEPLDGRFATTVRETAEAAGIVAVVGMFAPADSVETEKGTRHRVDNVALA
FT                   VGRDGADGDRVDAAYRKIHCYDAFGYRESDTVRPGNELEYFQCAGMTVGLSTCYDIRFP
FT                   QQFKDLARGGAQVIVVPTSWSDGPGKRDQWRTLTAARALDSTTWIAAAGQARPGGYDKV
FT                   GQSDGPTGIGHSVVVGPDGTRVAELGYTCGYVTATIDTDRLNSVRQSIPVLGDD"
FT   gene            362198..362914
FT                   /locus_tag="ckrop_0292"
FT   CDS_pept        362198..362914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0292"
FT                   /product="hypothetical protein"
FT                   /function="ABC-type spermidine/putrescine transport
FT                   systems, ATPase components"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17075"
FT                   /db_xref="GOA:C4LGX0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGX0"
FT                   /protein_id="ACR17075.1"
FT                   /translation="MRIEVSGLSFSYKKAKSVLDGISCTFSGGINIVLGSNGAGKSTLM
FT                   KILATELEPQSGVIRYDGKTAERKNRPTIVSRLGWVPQHNAVDTSQTVRDLVQTAAWLH
FT                   GYSMSEARSAASEAIALVHLSDNEGDRFSSLSGGMQRRAMVAVGIAHRPDVLILDEPTS
FT                   GLDPNHRASLLNIIRRLSEKTSVIMSTHISSDIEPTDRVLFLDSGHIVADVPSEELERK
FT                   YGSIDAAFGQLTAGVI"
FT   gene            362914..364218
FT                   /locus_tag="ckrop_0293"
FT   CDS_pept        362914..364218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0293"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17076"
FT                   /db_xref="GOA:C4LGX1"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGX1"
FT                   /protein_id="ACR17076.1"
FT                   /translation="MGWRRHLRYFVPVPFVAFLLFSAWRVGYIIGYWPDVNEVHSETLA
FT                   LIGVCLAGCTAYDIARHDVDYLRTISSTSIRLSWYLCGLGALYALIYNIVTIVVLYAVC
FT                   LSGDPGGYPWWSIPIMGLIWSLFSVGLGGVIGRSLHTKPRLAAIVGFIAGMAVVVLTLM
FT                   AGLLRVVPKILFLRPYSSGNYVGYVEQSVQLRPVVVGVVIGIALAAVLIFVTTADWVRG
FT                   KKLLSLALPGIVIVSVVATLVGINGPLVTAREKPSNPSCTHSADGARYCSWPEDESTVR
FT                   EVDKNWSAFLSELDELGFGVDAGEYAPKRVGGDVTLMAADAGRSSTLVFHDVAETVIAQ
FT                   DSDKSGCELSETDGVSTIYIVAEWIADHFGDKPVRDVIGGANGPGTSDAQKWMDKNTEG
FT                   RPFQEQEERIKNITGDLKACIASSEKGNAQDNPGK"
FT   gene            365282..367855
FT                   /gene="clpB"
FT                   /locus_tag="ckrop_0294"
FT   CDS_pept        365282..367855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpB"
FT                   /locus_tag="ckrop_0294"
FT                   /product="ATP-dependent Clp protease"
FT                   /function="ATPases with chaperone activity, ATP-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17077"
FT                   /db_xref="GOA:C4LGX2"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGX2"
FT                   /protein_id="ACR17077.1"
FT                   /translation="MSSFTPTTRTAEALQAALQDASKRGNPDIRPAHLLVALLEQADSI
FT                   ASPVIQAVGADPNQVLTRARSLVGGYPTATGQQMANPQFNRDSLNALTTAQELAGQLGD
FT                   SYVSTEVLLAGIASGDSDAAKLLQEFGVTADALKAAFPSVRGNQKVTTEDPEGQFQALE
FT                   KYSTDLTARARDGKIDPVIGRDAEIRRVVQVLSRRTKNNPVLIGEPGVGKTAIVEGLAR
FT                   RIVAGDVPESLKDKKLVSLDLGSMVAGAKYRGEFEERLKAVLDEIKNADGEIITFIDEL
FT                   HTIVGAGATGESAMDAGNMIKPLLARGELRLVGATTLEEYRKYIEKDAALERRFQQVYV
FT                   GEPSVEDTVGILRGLKERYEVHHGVRIMDSALVSAATLSDRYITARFLPDKAIDLIDEA
FT                   ASRLRMEIDSRPEEIDTAERVVRRLEIEEMALEKETDEASKIRLEHLKEELADERENLK
FT                   ALTARWENEKSAITEVQSVKEELEKARSDSEIAERDGDYERVAKLRYGTIPELEKKLHA
FT                   AEKSVNSTEENAMLSEEVTPETVAEVVSAWTGIPAGKMMQGETEKLLAMEKVLGRRVVG
FT                   QDEAVKAVSDAVRRARAGVADENRPTGSFLFLGPTGVGKTELAKALADFLFDDEKAMVR
FT                   IDMSEYGEKHSVARLVGAPPGYVGYDAGGQLTEAVRRRPYTVVLFDEVEKAHPDVFDVL
FT                   LQVLDEGRLTDGQGRTVDFRNTILILTSNLGAGGTKEQMEAAVKATFKPEFINRLDDVV
FT                   MFDALTSEQLTKIVDIQIDALAKRLESRRLVLDVHDDAKEWLAKRGYDPAYGARPLRRL
FT                   VQQAIGDELAKELLAGDVRDGDVVEVTVAEGGDKLDVHGGGVSTL"
FT   gene            complement(367917..369605)
FT                   /locus_tag="ckrop_0295"
FT   CDS_pept        complement(367917..369605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0295"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17078"
FT                   /db_xref="GOA:C4LGX3"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGX3"
FT                   /protein_id="ACR17078.1"
FT                   /translation="MVLQRKTPGWWLWARFHRLPHDIVIAVVSTLALRMAILLTLESNG
FT                   GTIEIEPLWLSFIASLPLVFIFSHETKPDLCAPRPLIRRRLILLGSAVITGAVVSIACY
FT                   PTNLTDFGFIAVFRNILVFLTLGLLGRELLGQTRIWILPLIATAGSMLFSWPQYPTVWD
FT                   TVYGALRSPGSFYSDGTIDLSIPLCLGSFILLSVIYLRQDTVGRGRFHANQQSNIFSRS
FT                   TVYRAGNIPVAQLRARGWRRITQQIAIGLIITISDSYYLLQDKKNWGGSPAELASTCLN
FT                   GIFVFGSVAMAVGTFVGQTRWRTGIAVWEKLSNYTTIALLKKPALSVTTAVLIPIITVS
FT                   VIALAANSWFLISHDVSSSVVVAGTSSATTTIGAFLIIVAVLALTGVAIGHKRKGIWVP
FT                   SVAFILTLIVLIVGHSQVDHVSTDRRDKLTACASIPELNRQVCSSETNAPFLHAAARTL
FT                   SDLYADAPAKQYLPQTLYLVNNAFAPSDSPMAKFGLYRKRSLAVPQALPSTDISSELGQ
FT                   TIGNSCKDVQASSALYLATPAPGSPDNPPPPEEDLIQLQHCLNGQ"
FT   gene            complement(369609..370343)
FT                   /locus_tag="ckrop_0296"
FT   CDS_pept        complement(369609..370343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0296"
FT                   /product="hypothetical protein"
FT                   /function="ABC-type spermidine/putrescine transport
FT                   systems, ATPase components"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17079"
FT                   /db_xref="GOA:C4LGX4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGX4"
FT                   /protein_id="ACR17079.1"
FT                   /translation="MHLCIDNVTVKYGSTVAVQDANLVLGAGVHALLGPNGAGKSSLLE
FT                   VIATLRKPSSGSFRFTDNDPDSANRNDYTGMDLRHILGYLPQENLPKSRFTVREHLAYM
FT                   CWLKQIPDGNVSAEVDRLINLTELSDKADATIGSLSGGMRRRVGIASALVGSPRLLILD
FT                   EASAGLDMAQRDSLRRIVATVAQDAVVLTSTHIVEDIIDIADTLTVMSRGAFMFSGGWD
FT                   EFCHTRQLPELKAQYLDLVGER"
FT   gene            370523..371365
FT                   /locus_tag="ckrop_0297"
FT   CDS_pept        370523..371365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0297"
FT                   /product="thiosulfate sulfurtransferase"
FT                   /function="Rhodanese-related sulfurtransferase"
FT                   /EC_number="2.8.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17080"
FT                   /db_xref="GOA:C4LGX5"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGX5"
FT                   /protein_id="ACR17080.1"
FT                   /translation="MTVYVSPDILSKAINKSNRISILSTHWSSGSRTAYSRFVSEHIPD
FT                   AQFCPPELALTGLPSREAGRNPLPNKGILQDWVYKWGLDKKTPIIIYGQHHGIFSARAW
FT                   WILKWAGFTDIHILDGGLPAWEDAGHPVIAGPGSLPQRFRTEITVGNMPTIEADEIDQW
FT                   IKDGGFLLDARDERRFNGIAEKLDFRAGHIPGAINMPVQDFYNEDRTVLSPDEIRARFN
FT                   RAGITDGSKVAVYSGSALHSCAMIAVMEHGGIDGATLFTGGWSQWAGNPENPIERSGD"
FT   gene            371863..375000
FT                   /locus_tag="ckrop_0298"
FT   CDS_pept        371863..375000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0298"
FT                   /product="glycine cleavage system P protein"
FT                   /function="Glycine cleavage system protein P (pyridoxal-
FT                   binding) C-terminal domain"
FT                   /EC_number="1.4.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17081"
FT                   /db_xref="GOA:C4LGX6"
FT                   /db_xref="InterPro:IPR003437"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGX6"
FT                   /protein_id="ACR17081.1"
FT                   /translation="MSHPQSQQQSPHQAHPKFDPQNTQGAAPASIKSTADLTAPLSSPR
FT                   VSAAAFPSRHIGPNSSSIRQMLQTLGYSSARELAEAALPDSIKNRDLNLPPRRTEQDVL
FT                   SALQVYADKNVQKKQLIGAGYYDTVTPAVIRRNIVENPGWYTAYTPYQPEISQGRLEAL
FT                   LNFQTAVGDLTGFDVVNASLLDEATAVAEAVQLMIRGGRRRKGGESVVLLDSACHPQVI
FT                   AVVRSRAKAAGISLRVSTITTDTIADEENLAGVVIAQPGTTGEVRDLKPLIDAAKEKKA
FT                   LVTVDCDLLAQTLLASPGELGADIAVGSAQRFGVPLFFGGPHAAFMAVTTSLTRKMPGR
FT                   IVGVSKDEEGTPAYRLALQTREQHIRRDRATSNICTAQALLAVVAGMYAVWHGPDGLKE
FT                   IAGRIHAHAAALADAVVAAGLRIEHETFFDTVTVKHSTDNAARIAVARAHEEGFNLREL
FT                   GGRLVGISIGESTTDTDIRQLAAILISAEGRDSGSGPDSLDEVRELTSGLPGDHRDVAT
FT                   AGTAHLPADLLRLDEILTHPIFHAITSETEMMRYLRMLSDRDLALDRTMIPLGSCTMKL
FT                   NSAVEMEPITWPGFASIHPMAPDDQTAGWRELIHDLQDSLAEMTGYAAVSVQPNAGSQG
FT                   EFAGLLAIRRYHQSRGDNERTICLIPESAHGTNAASAALAGLKVVAVKSRDDGSIDLDD
FT                   LDAKLEKQGDKVAAIMITYPSTHGVYEEHVCDVCEKVHAAGAQVYIDGANLNALVGLAK
FT                   PGQFGGDVSHLNLHKTFTIPHGGGGPGVGPLCVAEHLVPFLPADPMETTTTDAERSGDV
FT                   PSEAHGVPIAGATYGSAGVVPISWAYIALMGGDGLAAASEMALVNANYISHQLADDFPT
FT                   LYTGKNGLVAHECILDLREITKRSGITAEDVSKRLMDFGFHAPTLAFPVPGTLMVEPTE
FT                   SEDKGELDRFIEAMHTIRREIDEVIDGTVAEEDSVIRHAPYTAWSVTRDDFDDAVSHGH
FT                   FTREKAAFPVPGLRRTKYFPPVRRIDNAYGDRHVACSCPPLEDFAITDDEFNSLDK"
FT   gene            375067..376206
FT                   /locus_tag="ckrop_0299"
FT   CDS_pept        375067..376206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0299"
FT                   /product="glycine cleavage system T protein"
FT                   /function="Glycine cleavage system T protein
FT                   (aminomethyltransferase)"
FT                   /EC_number="2.1.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17082"
FT                   /db_xref="GOA:C4LGX7"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR022903"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGX7"
FT                   /protein_id="ACR17082.1"
FT                   /translation="MTDQPATGSGTGSSTPQKTALHDVHEELGARFTDFGGWDMPLKYG
FT                   SELDEHKAVRTDAGIFDLSHMGEVRVSGPQAAEALDHALISRLSAVAVGKAKYSMMCTE
FT                   DGTIIDDLITYRLADDEFLVIPNAGNAPTVASKLVSRAEAFDCTVADESSETSLIAVQG
FT                   PNAERVLASLPGADVRNLAEVKYYAFFRGTVAGHDVIIARTGYTGEDGFEIFVPNSGAH
FT                   DVWAAIMGTDAVTPCGLASRDTLRLEAGMPLYGHELDRSHTPVDAGLGVLAATKSKDAF
FT                   VGRDAIVAAKKNGAAQKLVGLKGDGRRAARAGYTVLTSDDKEVGEVTSGALSPTLGYPV
FT                   AMAYVDADVAEPGTALSVDIRGKHYPYTVVQLPFYKRDR"
FT   gene            376293..376691
FT                   /locus_tag="ckrop_0300"
FT   CDS_pept        376293..376691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0300"
FT                   /product="glycine cleavage system H protein"
FT                   /function="Glycine cleavage system H protein (lipoate-
FT                   binding)"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17083"
FT                   /db_xref="GOA:C4LGX8"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGX8"
FT                   /protein_id="ACR17083.1"
FT                   /translation="MSNVSLPADYLYSSDHEWIDNDAAEPGDTVRVGITHVAADQLGEI
FT                   VYVDLPDVGTEVEAGEAFGEVESTKSVSDIFAPVSGEVVSINEDLGDDAGVINSDPYGD
FT                   GWLYEVRISDLGELLDQSAYAAENDIDV"
FT   gene            376783..378693
FT                   /locus_tag="ckrop_0301"
FT   CDS_pept        376783..378693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0301"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17084"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGX9"
FT                   /protein_id="ACR17084.1"
FT                   /translation="MCGWRHCPRKRIDYLTMNSAVFLILGALLLLAAAALLWAANRPAD
FT                   DREWRRVLSRHAGVHERSTSSMVARGDRSFEGERASGGTRGASDDVPFNDADAGSGDAG
FT                   DAIPPRRRNPRFNPQQTQTADEAFSHFGVHPHVEAEEERADQEWSDAGLPGNDFSMTHA
FT                   DEPVDAQRGTASHDDGEDNASAGTRNDGGERRDTVSPSRSVPAGNAGAASESPADSPEG
FT                   AAANTAPPAESPEDTTEEWFENPTRATRRARRSWAAEHGWQFDRTDPDLAHEWADHVGA
FT                   SPSEAKDVVSGRMRARRAHVADINDNSYLGLRRSGSSDILIDFRDRDRWAPQDQSGEAP
FT                   GHIKPPRPDQEYVGSCGGFAVFSSDPLSVRLMMDSRADRALAHLRGATAAIVIDPWWIL
FT                   VRCNRRPTIDDIPRIFAYIADLDDATRVLPNPTAEYLDMTDGDPGRAYSYDIFTLGDGP
FT                   RMQAVPDAGLAGHSATAGQPSGGQSAADQPATASQSGSNDVGNNDEPTSQEDQSGADAH
FT                   IGWSDRPEFRHEYVDLPRRDRSRREGTTTDDEAWDEVGKSTGDIPVVGSDPDHSGAHER
FT                   SGRVIRVESDYDKSTIFGDPPSEGRHRKSSARRGASHRREDDDVPIVDGELEPENRLDQ
FT                   D"
FT   gene            378748..379347
FT                   /locus_tag="ckrop_0302"
FT   CDS_pept        378748..379347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0302"
FT                   /product="Orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17085"
FT                   /db_xref="GOA:C4LGY0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGY0"
FT                   /protein_id="ACR17085.1"
FT                   /translation="MTDHTNPGAKDAEPTSAAKNLDPERRARLAELVKELAVVMGKVTL
FT                   SSGKEADYYVDLRRATLHHEASPLIGALLRQLTEDWDFDAVGGLTLGADPVADSVLHAS
FT                   GRPIDAFVVRKEAKKHGMQRRIEGPDIKGKRVLVVEDTTTTGNSPLTAVKAAREAGAEV
FT                   VGVATVVDRNTGAADAIHKEGLEYRSILGLKDLGLE"
FT   gene            379340..380059
FT                   /locus_tag="ckrop_0303"
FT   CDS_pept        379340..380059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0303"
FT                   /product="putative rRNA methylase"
FT                   /function="rRNA methylases"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17086"
FT                   /db_xref="GOA:C4LGY1"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGY1"
FT                   /protein_id="ACR17086.1"
FT                   /translation="MSDSPHAADPHASGSGTVKPPAGVGATEWNPHPVGVGPWEVEHPG
FT                   QPRPTDDRYDSTLLDEGDRRNVVDAYRYWKREAIVADLDTRRFPFHVAIENFTSDHNIG
FT                   TVVRTANAFAAEAVHIVGKKRWNRRGAMVTDRYQHLYHHSTVNDVLQWAHEHDLTVIAV
FT                   DNVPGSVPVETAELPERCLLLFGQEGPGVSEEAQRGAVQTVSIAQFGSTRSINAGVAAG
FT                   IAMHAWVRQHADLSRAW"
FT   gene            380176..381531
FT                   /locus_tag="ckrop_0304"
FT   CDS_pept        380176..381531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0304"
FT                   /product="putative glycoside hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17087"
FT                   /db_xref="GOA:C4LGY2"
FT                   /db_xref="InterPro:IPR005198"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR014512"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGY2"
FT                   /protein_id="ACR17087.1"
FT                   /translation="MQDKRHSNQTDAPADVTADATAGDVADNEGSSRINRAEQVNHRGS
FT                   SLRPQRRQQELWEKWDHRADLAEDAIHERHARRVWGLPGTNLAVVSWPALTRDKFFLRW
FT                   HYWWQAHYLDCLVDAASRRPLKSRSRRISRTMRGIRLRNGAPLTKNRYYDDKSWLALAL
FT                   DRAEGLGHGHQARSLKDLQQNIIDGVDSLTGVVPWRVGEAFYNVPTNGPAAIMMARMGR
FT                   VDEAEALTDWMFENLINQDGLLIDGIRMKMDGPEPSTAVYAYNQGVALGACVEIAQRRR
FT                   EEAGITDDPSSAGAHAGSGVAMSSITRVHNLVHAIAVNLATDTGVIKGSGSGDGGLFRG
FT                   ILVRYLALVATDLPDDQKLSRATKRLAAKLVLSTADAVWDQRLEVNGLPVFSADWTRQA
FT                   ELPRSGGRIAGSTGGALAGSEIAERDLSVQLSGWMAIEAAARVVNNERLRGA"
FT   gene            complement(381535..381951)
FT                   /locus_tag="ckrop_0305"
FT   CDS_pept        complement(381535..381951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0305"
FT                   /product="transcriptional regulator, MerR family"
FT                   /function="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17088"
FT                   /db_xref="GOA:C4LGY3"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGY3"
FT                   /protein_id="ACR17088.1"
FT                   /translation="MLYSTREASEASGISVDTVRYYCKIGLVPRVMRDENNYRVFDEHD
FT                   IAWLRGLRCLRECGMGIDQMREYMELCLEGEGSIPQRKDILRDQRRVVEDKISNLRDML
FT                   AFIDSKLSYYDKVRAGEIKYESSLLAPVAPVKDR"
FT   gene            complement(381960..382814)
FT                   /locus_tag="ckrop_0306"
FT   CDS_pept        complement(381960..382814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0306"
FT                   /product="putative oxidoreductase"
FT                   /function="Aldo/keto reductases, related to diketogulonate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17089"
FT                   /db_xref="GOA:C4LGY4"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGY4"
FT                   /protein_id="ACR17089.1"
FT                   /translation="MLKPLTMSDGRTIPVQGFGVYQIPADQTADAVTHAIEAGYRHIDT
FT                   AQAYFNEEAVGEGIRRSGIDRDQLFLTTKVWLDRYGEDATYNSVKVSLDKLGTDYVDLM
FT                   LLHQPFNDVYGAWRGLERAQKEGLIRSIGVSNFTPSRVHDLGSFNSAYPVVNQIEINPF
FT                   NQQTERVAELQKHGVTVEAWAPFGEGRNGLFDNPVLTEIGKQYDKSVAQVVLRWLYQRD
FT                   IVGLAKSVHAERIQQNFDIEDFSLTDEDMAAIAELDTGSSLFFDHEAVETVDFFTDLIN
FT                   QRR"
FT   gene            complement(382962..384119)
FT                   /locus_tag="ckrop_0307"
FT   CDS_pept        complement(382962..384119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0307"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17090"
FT                   /db_xref="InterPro:IPR018306"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGY5"
FT                   /protein_id="ACR17090.1"
FT                   /translation="MSEEFSPELLELLENDTEGLFDEPAKPRKLTSDDRLERAFIEVLE
FT                   FYDQNGREPSPDTLNIAERKLGARLVGIRADDKKRAALAHLDDVGLLDPPEVPDSVDAL
FT                   LEDPEFGDDVLGNILSDGEKESDLYDVSVLPKATRKSADSVAKRKKAKDFDQFRDFFKK
FT                   KHEELRNGTAALAEFSGETSITEGKFYLLKGSLVFVAEVHDPEPNAPLDSGGKPKARLR
FT                   LIFENGTESAMYVQSFAIRLYEEDGKVLARTTPIQTSEIDGEEIASGYIYVLRSLSDDP
FT                   DIKQIKDLYKIGFTTGTVEGRIRGAEKSATYLFAPVEIAATYKLYNVKASAVEAAIHRA
FT                   FSHARLEITAQDPNSLDSSTKATHVTEWFVAPLDSIDKVIGELFS"
FT   gene            complement(384120..386099)
FT                   /locus_tag="ckrop_0308"
FT   CDS_pept        complement(384120..386099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0308"
FT                   /product="hypothetical protein"
FT                   /function="DNA or RNA helicases of superfamily II"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17091"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGY6"
FT                   /protein_id="ACR17091.1"
FT                   /translation="MNIVDVTYQQSGKSVATNELGMREMQARVWEARGAQYLLIKAPPA
FT                   SGKSRALMFVALDKLFNQGRRKVIVAVPERSIGGSFGDTDLQTNGFFANWTVKPENNLC
FT                   RPGSTASMVESFRRFMANKDAILVCTHATLRYAFDALSPEDFNGCVLAIDEFHHVSADL
FT                   DNNRLGGVLRDVMAKSDVHVIAMTGSYFRGDSVPVLTAEDEAKFTPVTFNYYDQLNGYR
FT                   YLHSLGIGHHFYQGRYTDSIGEALDLDLKTIIHIPSVNSGDSTKDKYEEVGRIIDAIGK
FT                   VVETDEHGIHVVRRRDNGKLIRVADLVDDTDQKQRAEVLHYLSTVASKDRDAVDIIIAL
FT                   GMAKEGFDWPYAEHALTIGYRASLTEIIQIIGRVTRDCEGKSHAQFTNLVAQPDADTGD
FT                   VTLAVNNMLKAITASLLMEQVLAPNFTFKAKKTDDSNNETDKGVVKIQGFQEPSTARVK
FT                   QIVDTDLSDLKATILQDVTFAKAAAGGMEPETTNKVLIPRIIRERYPDLTEKEVEEVRQ
FT                   QVVVDSVIKNGEVREVGDDRFIRMADKFVDIEEININLIDSINPFQKAFEIMSKNVDTS
FT                   VLRTIQDAITASKVEVTEAEALQMAPKIKAFVEMHKRRPDSRSDSPQEKRLGEILLWLQ
FT                   AKKRQLNSTKQNTESEQEPQRGEA"
FT   gene            complement(386125..388956)
FT                   /locus_tag="ckrop_0309"
FT   CDS_pept        complement(386125..388956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0309"
FT                   /product="hypothetical protein"
FT                   /function="Type II restriction enzyme, methylase subunits"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17092"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGY7"
FT                   /protein_id="ACR17092.1"
FT                   /translation="MPLLNIKTIEERVKALAGREEYDDELLFELLSAYGRSNSSITRLR
FT                   NGSINVAEDPSQEYAQKNVVYYRNIADTSDATDANRSTKQLSPAERETRLLKAVQELRQ
FT                   HERVVRFTTRFVIVSDNQWLAAVDTKTNENRIFPIAQIDKHYTFFLPWAGMEKAQFAAE
FT                   KHADTKAAEKMGKLFDALVGNNAVSLATDADRHGLNIFFTRLLFCYFAEDTDLFPKGAF
FT                   TKAIASYTHEDGSDVARVITDIFAALDMADKSELAEHLQVFPYVNGHLFSADAPYQVPN
FT                   FDRKSRDLLIELGRLIWKDVNPDIFGSMFQAVVQTGSRSELGQHYTSVPNILKTIEPLF
FT                   LDDLKEQFDSAYNSVPRLEKLLSRIADIKIFDPACGSGNFLVIAYKELRRLEHAILDRL
FT                   AYLSPKHQTLFSDSVVKIDHFYGIEIDDFATEVAILALWIAKHQMNQEYLDKFGFQLPM
FT                   IPLRSMGQITCANACRIDWQEVCPHQTEDEVYLISNPPYLGSSMQTKEQKEDLAATYAG
FT                   RKFSTNQDYISAWFIKGSDYIQESRAQLAFITTNSVSQGDHVALLFPTIFNMGLEIGYA
FT                   YTSFKWSNNAKGNAGVTVAVISLRKSSKSPKYLFSNSVRNEVAEINGYLTPGPIVSLKR
FT                   RPKPLSGFPPMVRGSQPTDGGHLNLDQTEYNALVQAFPETQRFLKKYIGAADYIRGNDR
FT                   YCLWIEDQDVEAASLIPEVADRLDTVARFRSESKAASTREYAAYPNRFRQRAYKPTDSI
FT                   IVPSVSSERREYVPIGFLGPDTVISNLAFATYNAEPWLFALLTSKIHMVWLGAVGGKMK
FT                   TDYRYSNTIVYNNFPVPHLTGPMKEKLTRTALRILDVREYFCELTLAELYDPDTMPDLL
FT                   RQAHAENDALVDSIYRKSGFESDEERLAALFKLYEKMTTEEAEAIEAKKAAKKAAKTTT
FT                   RRRRKPRKRQHNE"
FT   gene            389722..389862
FT                   /locus_tag="ckrop_0311"
FT   CDS_pept        389722..389862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0311"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17093"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGY8"
FT                   /protein_id="ACR17093.1"
FT                   /translation="MMPTSPCETPHLSDAQIAEAFMDAVHMLPTESTSTDKIVEKLFSL
FT                   S"
FT   gene            complement(389977..390231)
FT                   /locus_tag="ckrop_0312"
FT   CDS_pept        complement(389977..390231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0312"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17094"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGY9"
FT                   /protein_id="ACR17094.1"
FT                   /translation="MLSVLPSQNVKVSFPSLPASPWSMNMCSRYGMNSMLAGGECGDFF
FT                   FVVKEGELPVLQVTDLVKKFGVFGEQTDMFGNEFSNYRW"
FT   gene            complement(390268..391527)
FT                   /locus_tag="ckrop_0313"
FT   CDS_pept        complement(390268..391527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0313"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17095"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR038461"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGZ0"
FT                   /protein_id="ACR17095.1"
FT                   /translation="MFTPIHRALGLEASDLSLDLIEQAVEHGVEESNDLDWKKTPYNVK
FT                   HPKWDEEAAKDIAAMANSGGGWIVFGVDEDGTNNAASRINAVEWSADTQQRLLRTAYSK
FT                   IGPPVLGLEFFEFPYRDGTRTGSVVIMRIPDSRDAPHFARKGDNAFVAPRRNGPHTEFM
FT                   SDREIERGFRERFQYADDQERLLQDRFERACTALPPEKGVFLAVAAIPFEPVSERKPAS
FT                   QNDVYQYTLKPLIPELLRKGTGSWWEHGDVKKGTRQWVLRNDRRSSGAFRKYLYDDATV
FT                   LGAYQLGLLRNGEKATSYYPVGLVNHCMSSHLESAVIDFITVLRTHAEERRSNGGFRIR
FT                   AGLVGVDNGPIYIRTNQAMTRLLLDAEYVEPIVKFQPVTTVLDPLGDVHEMMPIVNDLA
FT                   RDLINQGGVQHLKVMAEPDV"
FT   gene            complement(391940..392896)
FT                   /locus_tag="ckrop_0314"
FT   CDS_pept        complement(391940..392896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0314"
FT                   /product="putative membrane protein"
FT                   /function="Uncharacterized membrane-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17096"
FT                   /db_xref="GOA:C4LGZ1"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGZ1"
FT                   /protein_id="ACR17096.1"
FT                   /translation="MDRYQVCCGIMSALTAVDLTVLTQAFTMGGTGVKTFASAALANGT
FT                   NLLADAATSARATLAASADLVPQLRTSILAQASETVTAAPKLLDPMYWLGADSPFGHLI
FT                   LPGLGLIIFVETGLGFPLLPGDSLLFTAGMLANQHNGFAPVWQVLLVAIACAIAGDQSS
FT                   YWIGRKLGDRIRKRPDGRIFKKAYITEGEAFFKKWGALAVILCRFVPIVRTYAPMTIGM
FT                   ARMNYARFFLFDICGGFLWAGGVTVLGVWLGSFTFVRENIELIFLAIVFISILPGIIGA
FT                   IKKSRASKGAATSDDSAAPLAARDAKETLHEREASES"
FT   gene            393038..394204
FT                   /locus_tag="ckrop_0315"
FT   CDS_pept        393038..394204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0315"
FT                   /product="putative membrane protein"
FT                   /function="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17097"
FT                   /db_xref="GOA:C4LGZ2"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGZ2"
FT                   /protein_id="ACR17097.1"
FT                   /translation="MADSPLPCRIFLCVNHFHGVERLSDGKMIVIQGSVAAGIAFWFAH
FT                   HVIGHPQPFFAPMASVIALGTSTVGRLRRSVELVMGVSLGIGIGDIMISHIGTGSWQIA
FT                   ITVACALAAALFLDKSPLAPIQATCSAVLVATIMPPGTMGGITRMIDALVGGLIGIMVI
FT                   ALVPNSAIRPARREVSRVIGHAGHVLDTVSRGLRSNDVGVVSDALVSARGTQARINAMI
FT                   AAVQGGTEVAAVSPFYWGARRDMRKMSQILSPVDNTMRNSRVLARRAATIISDQKDIDE
FT                   RIPVILDALAHACTELESIFAEQGKSGKLHEAQRLPAVIEQLKNTAAVTSGDHGEKSGI
FT                   SGIVVMAQARSIIVDLLQVCGLSRESAVVVLRPEDKKGDGSDLQIWEG"
FT   gene            complement(394251..394592)
FT                   /gene="whiB3"
FT                   /locus_tag="ckrop_0316"
FT   CDS_pept        complement(394251..394592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="whiB3"
FT                   /locus_tag="ckrop_0316"
FT                   /product="putative transcriptional regulator, WhiB family"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17098"
FT                   /db_xref="GOA:C4LGZ3"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGZ3"
FT                   /protein_id="ACR17098.1"
FT                   /translation="MTPHICTTKPTSHPTEENMLPQIHNLPTPTIQSWEWQRHGSCRDT
FT                   DASLFFHPEGERGRARAAREHAAKLVCATCPVINQCREHALSVGETYGIWGGLSESERD
FT                   AIARTHAHV"
FT   gene            394752..395063
FT                   /locus_tag="ckrop_0317"
FT   CDS_pept        394752..395063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0317"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17099"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGZ4"
FT                   /protein_id="ACR17099.1"
FT                   /translation="MLVCECSRGSLQAGKESSQETRGTLREARRENRPPLLAHKLKPTP
FT                   ATPRHPLLRGRRIASSVHLIHKIIFILLYVFRVPHSYVRAHVVWFLRFCSGHPPSMES"
FT   gene            395308..395919
FT                   /gene="sigD"
FT                   /locus_tag="ckrop_0319"
FT   CDS_pept        395308..395919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sigD"
FT                   /locus_tag="ckrop_0319"
FT                   /product="ECF-family sigma factor D"
FT                   /function="DNA-directed RNA polymerase specialized sigma
FT                   subunit sigma24 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17100"
FT                   /db_xref="GOA:C4LGZ5"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGZ5"
FT                   /protein_id="ACR17100.1"
FT                   /translation="MTAAASDGAINGLVAAAASGDRDALQKVMDYIHPKVVMYCRHRLS
FT                   DDSFPGPEDTAQEICMAVLKSLDRFVDRGTPFMSYVYGIASHKVKDGYRSMGRDRSQPT
FT                   DEIPESIHDAAGPEELAIQSDGRNKLLRLLDILGERPREIIILRVLEGYTSEETAKIIG
FT                   STPNAVRVAQFRAIAKLKKAMTDSPDYREAIALANKAKEN"
FT   gene            396088..397197
FT                   /locus_tag="ckrop_0320"
FT   CDS_pept        396088..397197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17101"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGZ6"
FT                   /protein_id="ACR17101.1"
FT                   /translation="MSGFDNWDREGVEHDPESLAAVDRYLDNLSRGTDSDDDLGQLFIQ
FT                   ARQEAERDIPATPQLSDLGFFDSFSDADALDDSPVANAPTTVFRPVNAEGQTTKSGDDA
FT                   ARGSEGDTTVHDFAAWKNQRDASGNYATGKSRSGRPRHRSWRHGDNHHPVPRWMYALGG
FT                   AAASCVLLAGGGAVIHASTPGSPLWGLNQRFFGDHAAAVELASTLDQVREKQEAGDTQG
FT                   AAALLEKAREVAHKAKDSSSKDSKKDESTTTVTVTDQSVVKGPDGKPTTIEKTMSNGES
FT                   KKAEPRKDPTTTNDRDAKGTKTTTETSTVTVTVTTTVTPAPVPGSNSSNSGSNSGSGSS
FT                   SRGSSSSDGSSDDVTESPSSGDSSTSAEE"
FT   gene            complement(397204..397572)
FT                   /locus_tag="ckrop_0321"
FT   CDS_pept        complement(397204..397572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0321"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17102"
FT                   /db_xref="InterPro:IPR035165"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGZ7"
FT                   /protein_id="ACR17102.1"
FT                   /translation="MPPDPFAGDPNDPASFLDPDEPMEPLTDEEKGEVIIELHHVREMQ
FT                   RVLTPLGIRGVQMLCDDCEDKHYYDWGILINNLLALYNHEQPPIHEPSANPNPDEYAPW
FT                   DYCLGFLDGLNHGIAGYR"
FT   gene            397692..399206
FT                   /locus_tag="ckrop_0322"
FT   CDS_pept        397692..399206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0322"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /function="IMP dehydrogenase/GMP reductase"
FT                   /EC_number="1.1.1.205"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17103"
FT                   /db_xref="GOA:C4LGZ8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGZ8"
FT                   /protein_id="ACR17103.1"
FT                   /translation="MERTGGDDPNKVALVGLTFDDVLLIPSASDVIPSEVDTSAQLTRN
FT                   IRLGIPLVSAAMDTVTESRMAIAMARQGGIGILHRNLSIDDQAQNVEVVKRSEAGMVTN
FT                   PITCSPGDTIGHVDELCAKFRVSGLPVVNDEGMLVGICTNRDMRFESDLSRKVADVMTP
FT                   MPLVVAQEGVSAEAALNLLSTHKVEKLPIVDSAGKLTGLITVKDFVKREQYPNASKDKE
FT                   GRLIVGAGIGTGEDSWKRAGALVDAGVDALVVDTAHAHNSGVLNMVARVKKEFGDRVDV
FT                   IGGNLATREAAQAMIDAGADAIKVGIGPGSICTTRVVAGVGAPQITAIMEASVPAHKAG
FT                   VPVIADGGMQYSGDIAKALVAGANTVMLGSLLAGTAEAPGDVVTVNGKQYKMYRGMGSL
FT                   GAMQGRGLKGEQRSYSKDRYFQADVRSEEKLVPEGIEGRIPFRGHIDGIAHQLVGGLRA
FT                   AMGYTGSATIDDLHDAKFVQITAAGLRESHPHDIQMTVEAPNYYQH"
FT   gene            399377..400531
FT                   /gene="guaB2"
FT                   /locus_tag="ckrop_0323"
FT   CDS_pept        399377..400531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaB2"
FT                   /locus_tag="ckrop_0323"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /function="IMP dehydrogenase/GMP reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17104"
FT                   /db_xref="GOA:C4LGZ9"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005992"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C4LGZ9"
FT                   /protein_id="ACR17104.1"
FT                   /translation="MREVVEIGLGREARRTYGLDDITIVPNRRTRSSKDVDTSWTIDAY
FT                   HFGIPVLAQPSDALTSVDFISEMGRLGGAAVINAEGLWGRVTDMDAAVEQIVSTAFDEE
FT                   GYDDGQMTNRAIPLLQKLHGLPLDKDLLSDRIRDVRASGVTTVVRVSPQNARELAPVVA
FT                   AAGAEIVVIQGTLISAEHVSADGTPLNLKEFIGSLDVPVIAGSVLDYTTALHLMRTGAA
FT                   GIIVGGGSTTNADTLGIDAPKATAIADAAAARRDYLDETGGRYVHVIADSELETSGEMA
FT                   KAIACGADAVMLGSPLSQAKEAAATGYYWPSVAAHPRFPRGVIENLLIERDEAPSLEKV
FT                   LLGPATEPFGSLNLIGGVRRSMAKAGYTNLKDFQKVQLSVRSWL"
FT   gene            400599..402173
FT                   /locus_tag="ckrop_0324"
FT   CDS_pept        400599..402173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0324"
FT                   /product="GMP synthase"
FT                   /function="GMP synthase PP-ATPase domain/subunit"
FT                   /EC_number="6.3.5.2"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17105"
FT                   /db_xref="GOA:C4LH00"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH00"
FT                   /protein_id="ACR17105.1"
FT                   /translation="MSEQQQTPSPVLVVDFGAQYAQLIARRVREARIYSEVIPHTASVE
FT                   EIKAKHPAALILSGGPSSVYADDAPVFDPSVLDLGVPVFGICYGFQAMTHALGGVVART
FT                   GDREYGRTTMSIVGDGGLLHDGAVNDVWMSHGDAVSEAPEGFVVTGRSSGAPVAAFEDA
FT                   DRHMAGVQYHPEVMHSPEGQKVLERFLTQIAGLKQTWTPGNIADQLVEQVRQQVGPEGR
FT                   AICGLSGGVDSAVAAALVQRAIGDRLTCVFVDHGLLRKGEREQVENDFVASTGANLVTV
FT                   DETDAFLSALKGVTDPEKKRKAIGNEFIRSFERAVAGVLSDAPEGARVDFLVQGTLYPD
FT                   VVESGGGSGTANIKSHHNVGGLPDDVEFTLVEPLRLLFKDEVRAVGRELGLPSAIVSRQ
FT                   PFPGPGLGIRIIGEVTSDRLATLREADAIVRQELSAAGLDDSIWQCPVVLLADVRSVGV
FT                   QGDGRTYGHPIVLRPVSSEDAMTADWTRIPYDVMEKISTRITNEVAEVNRVVLDCTSKP
FT                   PGTIEWE"
FT   gene            complement(402259..402858)
FT                   /locus_tag="ckrop_0325"
FT   CDS_pept        complement(402259..402858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0325"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17106"
FT                   /db_xref="GOA:C4LH01"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH01"
FT                   /protein_id="ACR17106.1"
FT                   /translation="MFDIKSLEGHTTHPTRPHTQRKRLVSSPDLGALAATDRQTTTLKH
FT                   MTNYDTHRDNNRETSDHELSESEYITTVSTPNLVRTIASLLLGGAVGVMGFAIAPLLKV
FT                   ILLIVLAGAGLLFITIHPYRRDVSAAYMNRYGEYRTTVRRLIPLFPDWLALMILPVIPM
FT                   QGTFLGIIAFVVASVYNYLVFPWIDGTAYTQEPDTP"
FT   gene            403157..404029
FT                   /locus_tag="ckrop_0326"
FT   CDS_pept        403157..404029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0326"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17107"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH02"
FT                   /protein_id="ACR17107.1"
FT                   /translation="MTQAGASAVATDLTALSNDEKVEILRSRMAHLVSVPDYPQVKESD
FT                   SLPHPGERRSYPEEKESFERSMLEVLSLQGPLGELTSLGGLPRGAATSIADCPTALVHI
FT                   IAQVTATGKHVAVIGLSDLLWAAVSDAGGDLSLVAVVDCPDATGDADINAPDPLSVLGV
FT                   LCEGMDLVIYCGQGQANVPPSLARPVMSRVRSSRCALLVCGVRWPGVSLRIDAIVSAFR
FT                   GLGRGRGRIRGMSVDMRVEDRHRPPQRGQWHMGVGSFAQPIRHHRPTQTHHWRKSVKAL
FT                   DLNAVEAAG"
FT   gene            404026..405747
FT                   /locus_tag="ckrop_0327"
FT   CDS_pept        404026..405747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0327"
FT                   /product="putative DNA polymerase involved in DNA repair"
FT                   /function="Nucleotidyltransferase/DNA polymerase involved
FT                   in DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17108"
FT                   /db_xref="GOA:C4LH03"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH03"
FT                   /protein_id="ACR17108.1"
FT                   /translation="MTPDNSIDASQCADDPHREQSGVPMDERTIVLWVPDFPLYAARCD
FT                   NEVPDGPLALVDQHGVYVCDRQARHVGVRRGMKRRQAQSLCPTMHIMPADDDRDARYFE
FT                   DFVADVDSISAGIELLRPGLIAVKSAPLVKYYGSEERAITMVLDAVARPGVDVIAGAAG
FT                   TLPTAVFAARRGMTIPEGHDADFLAGLPVRTLCEDKALGQPQELVDTLEKMGITRMKDW
FT                   AGLSRRDVSSRFGAEGLWWWSIARGAPSRRLTPQENTSDLAITHHCDSPESRSDTVAFI
FT                   GRRLAADLHDQLSDRGQICLRVAIRALIRTPDGDQELERVWRCTDQLTEHAIAQRVRWQ
FT                   LEGWLHRFVSRAAATVGQSDHESGASDNAGVPDSVEVDATPVGVGVCELTLDPIETTSS
FT                   SMRGLWGAKEDHAAHAALARVQTMLGPDRVCTPVLKGGRGPEDRIALVPVGESAPDLPS
FT                   STYSWPGQFPAPIPVTKRVERGPSTAHPASGVSLLDEDGHDIIVTGRSLLSAQPACVAW
FT                   GTKRYDITGWSGPWPVDEQWWAQGRRFARLQVTTNQPSGLLLICRGKKWRIEGVYR"
FT   gene            405800..406882
FT                   /locus_tag="ckrop_0328"
FT   CDS_pept        405800..406882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0328"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17109"
FT                   /db_xref="InterPro:IPR009737"
FT                   /db_xref="InterPro:IPR010350"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH04"
FT                   /protein_id="ACR17109.1"
FT                   /translation="MEEQATQENAAEQISAQRASSARQGVEANQADEAWKTMRCSDFGN
FT                   EALPGTAKSMRLFLAVEYLKGWGRDIMDDDVLGNLTAPLKKVLKDNGASMQFIRKPGRA
FT                   GQFRDERKLYIARTDQGTCFTTRISGVEDLLHLDIQALADGTWGRSELPARPVERVNHP
FT                   IMLVCTHGKRDRCCAIKGRPLAAGMQTCFFGDEVWETSHSKGHRFAPTMILLPWGYSYG
FT                   RIPTGQAIDAVKTSAQGHMYLTGLRGRGCWDAPGQTAEIAVAQKLGAHTVPVGSLVVKE
FT                   TTEQEQERAEKEIAARDRTSSRTNSDDHHPKTAWRTVETSRGDTWVVHLEQVSAGDVMA
FT                   SCGKPPKHGKTWVAHHVTQV"
FT   gene            complement(406899..407669)
FT                   /locus_tag="ckrop_0329"
FT   CDS_pept        complement(406899..407669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0329"
FT                   /product="methionine ABC transport system, permease
FT                   protein"
FT                   /function="ABC-type metal ion transport system permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17110"
FT                   /db_xref="GOA:C4LH05"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH05"
FT                   /protein_id="ACR17110.1"
FT                   /translation="MVSVALHTADALAGVGASIHNAVAHSAVARDLVLAAGTTDWDNLK
FT                   PTMITAFWTTLWMVGWTILLGGLFGLIIGVLLYASRSSGVLANKPLYWTLNILVNIIRP
FT                   IPFIILIAAAGPLTKAVMGTTIGTEAATFVMVIAATFAVARIVEQNLVSVDPGVVEAAR
FT                   AMGASPLKILWSVVIREALGPLILGYTFIFIAIVDMSAMAGYIGGGGLGDFAITYGYRA
FT                   FDWNVTLVATVIIIVLVQFAQLIGNTLARLVMRR"
FT   gene            complement(407669..408811)
FT                   /locus_tag="ckrop_0330"
FT   CDS_pept        complement(407669..408811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0330"
FT                   /product="methionine ABC transport system, ATP-binding
FT                   protein"
FT                   /function="ABC-type metal ion transport system ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17111"
FT                   /db_xref="GOA:C4LH06"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH06"
FT                   /protein_id="ACR17111.1"
FT                   /translation="MASIPTENSTQPTSTGSTSTQPTSGSSTLTFDDRPTDHGTRVEFR
FT                   DVTKTFKQGKRDTHALNGISLTVEPGEILGVIGYSGAGKSTLVRMINGLDRPTSGSVTL
FT                   GSTTITDLPERKLRGLRKNIGMIFQQFNLMNSRTAAANVAYPLALAKVPRSQRSKRVKE
FT                   LLDFVGLGDKGKNYPDQLSGGQKQRVGIARSLATDPSLLLADEATSALDPETTQDVLDL
FT                   LHKVNRELGITIVVITHEMEVVRSIADRVAVMEKGKVVEYGPVHEIFSNPREEVTERFV
FT                   ATALRDTPEGRERDSLLTEVADNPRERLITVRVDDARDLSSAFALATERNVTVGFVHGA
FT                   VNNIQEHSFGRLTVKLTGPEDGVKDVVARLAELTECEEIN"
FT   gene            complement(408811..409701)
FT                   /gene="metQ"
FT                   /locus_tag="ckrop_0331"
FT   CDS_pept        complement(408811..409701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metQ"
FT                   /locus_tag="ckrop_0331"
FT                   /product="methionine ABC transport system,
FT                   substrate-binding protein"
FT                   /function="ABC-type metal ion transport system periplasmic
FT                   component/surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17112"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH07"
FT                   /protein_id="ACR17112.1"
FT                   /translation="MVTSLRRLSALILASGLTLTGVTACHPPGESGGGSNTVTIGTTDS
FT                   SKTAWTAFRQEAEKEGVHLDVQDFSDYNTPNTALSEGVLDVNLFQHIKFLASYNVESNS
FT                   DLVPVGSTEIVPLALFYKGHTDINDLKDGTSIAIPNDSTNQGRAINLLEAQHLVTLKKT
FT                   GLLNPTPADIDQSQSKVSVTPVDAAQTATAWGEGTPAVVNNTYLLRAGIDPKTAIAADD
FT                   PKAENAKPYINVLATRPEKKNDENIKKLVKAWHSDAVQKANAEDTKGTSVSVDLPANQL
FT                   EDILKDTEKKTREES"
FT   gene            410308..413427
FT                   /locus_tag="ckrop_0333"
FT   CDS_pept        410308..413427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0333"
FT                   /product="DNA polymerase III, alpha subunit"
FT                   /function="DNA polymerase III alpha subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17113"
FT                   /db_xref="GOA:C4LH08"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR023073"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH08"
FT                   /protein_id="ACR17113.1"
FT                   /translation="MVSHRDESSRPGVDHRDHIPFAELHACSAYSFLRGASSPAEMVDS
FT                   AAELGLEALALVDRDGVYGAVQFAEAAADSGIATIFGAELTLTPSVSSSQPASSKNERI
FT                   LTVLCRGAEGYRRLSRVISDAHMCTGEKNEVRYPSLDELARRGGDHWIILADYSWTPYL
FT                   DELVEHFPRVVVELDRLLVPDDADRHEEQLEAAEQLGLAAVYSSAATAARPKSGRLAGA
FT                   KTALRYRKDVEDAEPYTHPIGGTYLRSGAEMFDADYPELTANTLAVARDCAFTLTTIAP
FT                   ELPDWPVPEGYTEITWLEHMVEKRGAVRYGSREDNHAAWAQIDHELNVIGGLNFPGYFL
FT                   IVTDLVDFCRRANILAQGRGSSANSAVCFALGITNVDPVAADLLFERFLSPEREGPPDI
FT                   DLDIESGRREEVIQYCYNKYGRENAAQVANVITYRRRGALRDAARALGYSSGRIDAWVR
FT                   GLDDVPNDVVTLADQLRGQPRHLSIHSGGMVICDRPIADVVPVEWARMENRSIIQWDKD
FT                   DAASGGLVKFDLLGLGMLEAIHHAIDQVRDHRGRTVNLWQLGLDDPEVYAMLARADAVG
FT                   VFQVESRAQMSALPRLKPREFYDLVVQVALIRPGPIQGGSVHPYIRRRNGEEAVTFDHP
FT                   CLKDALAKTLGVPLFQEQVMRVAVDAAGFTPVEADALRRAMGAKRSAKKMEQLHERFAR
FT                   GCREKHGMDEATITTLWKKIIAFAAYGFPESHAQSFASIVYFSAWFKRYYPAEFCVALL
FT                   RAQPMGFYSPQSLIADARRHGVEILPIDVNHSDVEANAIDNPDLEPGAPNSLRLGLDAV
FT                   KGLGARGAKAVVQARADGGPFTRIADLSRRAGISVSQVEALATAGALRSMGIDRREGLW
FT                   AAGIAAHERPGMLPGMSEISIPSLPGMSAFELAAADIASTGITADIHPVELLRKHLDNA
FT                   GIISIRQLASCEDSTRVTVAGTVTHRQRPGTAGGVVFLGLEDETGLANITVSPGCWTRY
FT                   RTVAQTSRMVAIRGIVHNAAGAVAVVADRIDSLDTTLGGAALAGPSRDFR"
FT   gene            complement(413465..414052)
FT                   /locus_tag="ckrop_0334"
FT   CDS_pept        complement(413465..414052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0334"
FT                   /product="putative rRNA methylase, SpoU class"
FT                   /function="Predicted rRNA methylase (SpoU class)"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17114"
FT                   /db_xref="GOA:C4LH09"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH09"
FT                   /protein_id="ACR17114.1"
FT                   /translation="MMSEADVNSVRDLKSVHDRAHGIARALGEDTIRNPNPPLHVVFDQ
FT                   PVIPPNTGNAIRMCAGVGAHLHLCEPLGFNLEEKNLRRAGLDYHDLVDVTIHPSLDECL
FT                   TTLGAGAPDGPKVYAFTSHTSVRVDTVPYQWGDVLLFGCEPTGLSAEALADPRITSHVR
FT                   IPMLPGRRSMNLSNAAAVGAYEAWRQLGYQGV"
FT   gene            complement(414128..415192)
FT                   /locus_tag="ckrop_0335"
FT   CDS_pept        complement(414128..415192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0335"
FT                   /product="putative oxidoreductase"
FT                   /function="Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17115"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH10"
FT                   /protein_id="ACR17115.1"
FT                   /translation="MIRKKSASPRPDDSEGLGGSGGAEGTDSSAGTDGSADTDSASTPT
FT                   SSTSETQGSHFDRAEATANTTDTTGARQDQSVTASSLNVKSNAGQSVVETEPHGFISVD
FT                   LSGRTAVVTGGAGGIGAAAAGALAASGAHVIVADLIGQDTDGTVDDIHELGGSAEVWDV
FT                   DLRDHELLAEMTLDCDILVNCAGSQVIAHIEDYEPADWDRIIDTMLTAPFLLTRAALPH
FT                   MYEEEWGRIVNVCSVHGLRGSEGRVAYTSAMHGLEGLTKVTAIEGGPHGVTANCVNPGF
FT                   TRTAQVQKQIRQQAALHWLPEDEVVEKVLLNRNSIKEMATVDEVAAQIIWLCSDYARLI
FT                   TGSSLSIDGGATAS"
FT   gene            415635..418346
FT                   /locus_tag="ckrop_0337"
FT   CDS_pept        415635..418346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0337"
FT                   /product="ATP-dependent Clp protease"
FT                   /function="ATPases with chaperone activity ATP-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17116"
FT                   /db_xref="GOA:C4LH11"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH11"
FT                   /protein_id="ACR17116.1"
FT                   /translation="MFERFTDRARRVVVLAQEEARALNHNYIGTEHILLGLIREGEGVA
FT                   AKALESMGISREAVRSEVEDIIGEGSQPPSGYIPFTPRAKKVLELSLREALQLGHKYIG
FT                   TEHILLGLIREGEGVAAQVLVKLGADLPRVRQQVIQLLSGYEGQGDESQEPGTSEPAGA
FT                   GVGSATLGRSSNNESGRKSNSLVLDQFGRNLTQAAKDGKLDPVVGREKEIERIMQVLSR
FT                   RTKNNPVLIGEPGVGKTAVVEGLALDIVNGKVPEILKDKQLYSLDMGSLVAGSRYRGDF
FT                   EERLKKVLKEINQRGDIILFIDEIHTIVGAGAAEGAIDAASLLKPKLARGELQTIGATT
FT                   LDEYRKHIEKDAALERRFQPVQVPEPSVELSVEILKGLRPKYEAHHHVSITDAALVAAA
FT                   SLSDRYINDRFLPDKAVDLIDEAGARMRIKRMTAPESLRKVDEKIAKIRKQKEAAIDDQ
FT                   DFEKAAGLRDQERKLGEEREEKERQWRSGELEDVAEVGEEQIAEVLANWTGIPVFKLTE
FT                   EESDRLLHMEEELHKRIIGQEDAVKSVSRAIRRTRAGLKDPRRPSGSFIFAGPSGVGKT
FT                   ELSKALAEFLFGEDDALIQIDMSEFHDKFTASRLFGAPPGYVGYEEGGQLTEKVRRKPF
FT                   SVVLFDEIEKANNEIYNTLLQVLEDGRLTDGQGRVVDFKNTVLIFTSNLGTGDISKAVG
FT                   MGFSGVGETDEEGRYERMKSKVNDELKKHFRPEFLNRIDDIVVFHQLTQDQIIQMVDLL
FT                   VNRVGIALRAKDMDIELTDKAKKLLAKRGFDPVLGARPLRRTIQREIEDQLSEKILYGE
FT                   VAAGELVTVDVENWDGEGKGDDAKFTFSTSTKPGAVMGEGESSLEERKEDADDSSDEAD
FT                   QIVPMEYSSNASSGSGPDAGTSGSGAAQPESE"
FT   gene            complement(418353..419396)
FT                   /gene="mutY"
FT                   /locus_tag="ckrop_0338"
FT   CDS_pept        complement(418353..419396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutY"
FT                   /locus_tag="ckrop_0338"
FT                   /product="A/G-specific DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17117"
FT                   /db_xref="GOA:C4LH12"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH12"
FT                   /protein_id="ACR17117.1"
FT                   /translation="MSTGHSEPFLVDELNDWFILAGRHLPWREPGCSAWGVLLSEVMSQ
FT                   QTPVSRVEPAWREWMDRWPTPADFARAGRDEVLRAWGRLGYPRRALRLHECARTIVDKH
FT                   SGAVPATVDELLDLPGIGEYTARAVACFAYGWAVPVVDTNIRRVMARAVHGKYLQGPAR
FT                   RADLDDMRALMPVSEEQAGSSVGAIVQHIREKAGIPEVPVEAGTLFDGPGIGLGHLSNE
FT                   QLTDVERSAVFSASIMELGALVCTSRVARCEQCPLVRTCAWRLAGCPEPTESERSAVAR
FT                   RVQKFEGTDRQVRGAIMKVLRDATGPVERDAIAHASKDEEQLHRALQSLLVDGLVVDTD
FT                   GKLGLPR"
FT   gene            419625..420329
FT                   /locus_tag="ckrop_0339"
FT   CDS_pept        419625..420329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0339"
FT                   /product="beta-type carbonic anhydrase-like protein"
FT                   /function="Carbonic anhydrase"
FT                   /EC_number="4.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17118"
FT                   /db_xref="GOA:C4LH13"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH13"
FT                   /protein_id="ACR17118.1"
FT                   /translation="MTTSAPGSDPQPTPSTNADPGTPANSSARADDRTPQAVLQQLLDG
FT                   NDRFVQGKALRPHQDRDRLSSLTQGQAPKAVVLACSDSRVPVELLFDQGFGDVFVIRTA
FT                   GEIVDMSVLASLEFAVEGLGVSLVVVLGHESCGAVKAASEAMSQGAVPESFQRVLVEKV
FT                   APSVMVARSEGHTTTDDYEKQHVRSIVDHVVGRSPEITAKLADGTVGVVGLRYLLENGQ
FT                   VEAVTARGVAMP"
FT   gene            420445..421158
FT                   /locus_tag="ckrop_0340"
FT   CDS_pept        420445..421158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0340"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17119"
FT                   /db_xref="GOA:C4LH14"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH14"
FT                   /protein_id="ACR17119.1"
FT                   /translation="MSAQGNYNGLPHPPEIYRRRRIAAVVIVVVVIALLWWIISALSGG
FT                   GDSSSTATESSVTTTTTKSTKPTSSSRSSESTRPSSESENPDESESEDPDASEEPSVAP
FT                   DAKDTCDVNDLQIEARTDADSYDPGQMPRFYLIAHNPTKGSCHVDLAKAPMKFEVYNLE
FT                   TNERVWSDVDCNNPAATGALDIGAGQTKNYMLSWSRTTSAPGECSDRVAVPSGSYYLHT
FT                   LIGDQHSEPTTFNLT"
FT   gene            complement(421293..421919)
FT                   /locus_tag="ckrop_0341"
FT   CDS_pept        complement(421293..421919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0341"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17120"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH15"
FT                   /protein_id="ACR17120.1"
FT                   /translation="MSLKSASLRSGIAIVAAGSALALSACGAGQISQTANQVPAVDGGA
FT                   ANAEDNNITLRDVTVQPKTDDHGGAVAFAISNVDPTNTERQLQRISVDGQEVKVDGNKD
FT                   LKPQCQIVGNNEKAIEAMGANDVHTNSSASEGAKADPNGEARINCVSYVHTSFDGTPTP
FT                   GTAVNVTFTLDNGEVSMKAPVAASVPEAGQTYRDKEGVLKDEFSN"
FT   gene            422165..422755
FT                   /locus_tag="ckrop_0342"
FT   CDS_pept        422165..422755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0342"
FT                   /product="putative transcription factor"
FT                   /function="Transcriptional regulators similar to M. xanthus
FT                   CarD"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17121"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR042215"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH16"
FT                   /protein_id="ACR17121.1"
FT                   /translation="MEFNIGDTVVYPHHGAAVIEKKEQRQIKGETVDYLVLKVHQGDLT
FT                   VRVPEKNAESVGVRDVVGEEGLLKVFSVLRETDVEEAGNWSRRYKANQERLASGDVNKV
FT                   AEVVRDLWRRDQDRGLSAGEKRMLAKARQVLVGELALADGTDDAKADAMYQEAQEAIAR
FT                   HRAKLLGEDEDSTKKPGPSDDSDIIDLDEDVED"
FT   gene            422796..424217
FT                   /gene="cysS"
FT                   /locus_tag="ckrop_0343"
FT   CDS_pept        422796..424217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="ckrop_0343"
FT                   /product="Cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17122"
FT                   /db_xref="GOA:C4LH17"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4LH17"
FT                   /protein_id="ACR17122.1"
FT                   /translation="MTLRIFDSASRQLRDFVPLREGRASVYLCGATVQSAPHIGHLRSG
FT                   VAFDILRNWLTYMGLDVAFIRNVTDIDDKILNKAAEHNRPWWEWAATYEREFQWAYDQL
FT                   GVTPPSLEPHATGHVPEMIEYMQRIIDAGHGYAVDGNVYLSPMSLPDYGSLSGQKLDEM
FT                   DQGESAGTGKRDPRDFTLWKAAKPGEPSWDTPWGRGRPGWHLECTTMATKYLGAEFDIH
FT                   AGGLDLKFPHHENEIAQAHAAGDGFARYWMHNGWVTMAGEKMSKSLGNVLSVPNLLQIV
FT                   RPVELRYYLGSAHYRSMLEFSEDALREAAAGYRRLEKFVHAASSVAGKNDRTLGRSEVT
FT                   DAFTDAMNDDIGVPAALAEVHKVVRSSNSRLDAARRGDSDAVESVVSAGEQVRAMLGVL
FT                   GVDPLDEKWQEIAAESGAEHDALDTLVRAELDIRAKARAEKDWATADAVRDRLAAAGIV
FT                   VTDTPSGAEWELSEQ"
FT   gene            424300..425262
FT                   /locus_tag="ckrop_0344"
FT   CDS_pept        424300..425262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0344"
FT                   /product="putative rRNA methylase"
FT                   /function="rRNA methylases"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17123"
FT                   /db_xref="GOA:C4LH18"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH18"
FT                   /protein_id="ACR17123.1"
FT                   /translation="MAGHSRNHGAIRKSNKKGATKGSGGQRRRGLRGKGPTPKAEDRVY
FT                   HKAHKRKVEQQRKASGRHDRRNLHGSELVVGRNPVVECLRAKVSATALYVAEGTDNDDR
FT                   LTEAVRVAGDRAITVLEVPRIELDRMTGNGMHQGLGLLVPEYQYVDVQDLIDRAHASSS
FT                   TGLIVCLDNITDPRNLGAVIRSVAAFGGHGVVIPERRSASVTAVAWRTSAGTAARLPVA
FT                   KATNMTRALKQFQKEGYQVVGLDAGGDHTLDTYDGTTPVVVVVGSEGKGLSRLVSETCD
FT                   TIMSIPMADNVESLNASVAAGVVLSEFARQRRAVKKARG"
FT   gene            complement(425213..426190)
FT                   /locus_tag="ckrop_0345"
FT   CDS_pept        complement(425213..426190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0345"
FT                   /product="ABC-type transport system, permease protein"
FT                   /function="ABC-type Mn2+/Zn2+ transport systems permease
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17124"
FT                   /db_xref="GOA:C4LH19"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH19"
FT                   /protein_id="ACR17124.1"
FT                   /translation="MPNTTITWDTWWSDTTELLHYPFVHHALLAAALLGIISGLIAPLI
FT                   VMRRMSFTVHGTSELALMGASAALLAGINVGAGAVVGSIVAAIALAVLGMRDTDSTVGV
FT                   ILSFGMGLSVLFIYIYPGKASNAFSLLTGQIVGVSGAAVGMLIAITIIVIATLGVLWRP
FT                   LLFASVDPDVAAASGIPLRTISIVFAALVGLVAAQGVQIVGALLVVSLLITPGAAAVHV
FT                   TASPRKAVLLSTIFAEVSAVGGLVLSLAPGLPVSVFVTTISFAIYLFCRLIGWRTQRVI
FT                   VGSETTPRETTPGTSHHDVSSQDISPDNVSPEPSSPHDAAARTR"
FT   gene            complement(426223..426981)
FT                   /locus_tag="ckrop_0346"
FT   CDS_pept        complement(426223..426981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0346"
FT                   /product="ABC-type transport system, ATP-binding protein"
FT                   /function="ABC-type Mn/Zn transport systems ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17125"
FT                   /db_xref="GOA:C4LH20"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH20"
FT                   /protein_id="ACR17125.1"
FT                   /translation="MNNPRTTHRPTGTTDRPTGPVIELSKASIEPLWTDLSLTLNPGEW
FT                   LTVLGPNGVGKSTLLGALTGTRKLTSGQVHVNGTTGFIPQQRMFSPTLPLRARDIVGLS
FT                   GGHGIFRRRRLPAAQIDEALNTVDAAHLANRRIGHLSGGQQQLIRQASAIATHPDILLC
FT                   DEPLLSLDYAAQKQAIRTIDAQRRDHNTAVVFVTHTINPVIDATDRVLYLAPNGHTIGT
FT                   IDDVITTDVLSELYGTHVDVVHVNGRLIIV"
FT   gene            complement(426991..428010)
FT                   /locus_tag="ckrop_0347"
FT   CDS_pept        complement(426991..428010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0347"
FT                   /product="ABC-type transport system, substrate-binding
FT                   protein"
FT                   /function="ABC-type metal ion transport system periplasmic
FT                   component/surface adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17126"
FT                   /db_xref="GOA:C4LH21"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH21"
FT                   /protein_id="ACR17126.1"
FT                   /translation="MRAIKNRRRSALAFIFATGLLTGMGGLTACSDDSSTTSGSSDTVN
FT                   VVASTALWADVVHDIAGDNDHVKITGLIEGDSVDPHDYNPSAKDMAKIKDADVVVGNGA
FT                   GYDNWLTEHASSDATVITALPQEEHDHDGDEHDGHDHDAHDHDADAHEHESEDAHDHDA
FT                   DDHADNGSDLPTNPHVWYDVATVNSFATKIADTLNDKNGDIKASTKDFSDKLHAIDEKI
FT                   KALPAKKVASTESVSGYLLKESPMEDVTPHGYLSASLKESDPSAADVAEFTSLINDKKV
FT                   DILVNNPQTEDSVSKDLVSAAKKAGIPVVDIYETPEKGTHYLDFFSEAVQRLHDASKE"
FT   gene            428244..429437
FT                   /locus_tag="ckrop_0348"
FT   CDS_pept        428244..429437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0348"
FT                   /product="transcriptional regulator, LacI family"
FT                   /function="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17127"
FT                   /db_xref="GOA:C4LH22"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH22"
FT                   /protein_id="ACR17127.1"
FT                   /translation="MSPRRSPKNSHKATLESLAEAVGVSRTTVSNAYNKPDHLSPETRA
FT                   RIFATADKLGYSGPDPAARSLRTRRADAIGVLFTDELTYAFEDRSSVDFLAGLAESCQV
FT                   LDSSLVLIPAAPGRAASGINRVAQAAVDGFVVYSVASDDPTLEVVASRGLPTVVCDQPY
FT                   STPKLKDYAFVGIDDHAAIQSGVQQLIDAGHRKIGVLCIRLDREANAGEVSPQRLRTAH
FT                   MHVQKHRVEGIVDVIRGAHPDSAEDIPIVECYINDADGTREAVRALLDAHPDLTAVACT
FT                   TDSLALAVIQCAADRGLSVPGDLSVTGFDGIDLAVQQQITTVSQPNKDKGRTAGHVLQD
FT                   LISDATRGKGNAGASSSRSVATSTGAGGARGHASATRGSHTLLETTLITGRTVGPPR"
FT   gene            complement(429497..430354)
FT                   /gene="otsB"
FT                   /locus_tag="ckrop_0349"
FT   CDS_pept        complement(429497..430354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="otsB"
FT                   /locus_tag="ckrop_0349"
FT                   /product="Trehalose-6-phosphatase"
FT                   /EC_number="3.1.3.12"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17128"
FT                   /db_xref="GOA:C4LH23"
FT                   /db_xref="InterPro:IPR003337"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH23"
FT                   /protein_id="ACR17128.1"
FT                   /translation="MFTPSDDINRALRTAAHSPTLMLASDFDGCLAPLNKDAMAVTANP
FT                   TAMNAIIDLAHMPHTFGALVSGRDISKLERLARRTGPQGQNIADDGPDDVRDISGIILA
FT                   GSHGAEANDGSGVEPNEEQKKLLERMIREAHAVADSAPHSGMFVEEKPLGVGLHGVAMN
FT                   NDELERQLQQKFADILDSLLDGTTGSYMYGKHILEAQIMKVDKGKWLESARDRYNVDAI
FT                   VYAGDDTTDENAFRVLHGNDVSIKVGDSHTAAALRVPDTDAIADVYQRLATMRREYLTE
FT                   NGVL"
FT   gene            complement(430363..430722)
FT                   /locus_tag="ckrop_0350"
FT   CDS_pept        complement(430363..430722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0350"
FT                   /product="putative ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17129"
FT                   /db_xref="GOA:C4LH24"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH24"
FT                   /protein_id="ACR17129.1"
FT                   /translation="MTNSIPDDNSAGDDSAATPSDAEPSTAHVFMEDTEEDIEWPAGKR
FT                   LLYAMLDAGLDAPYGCTEGECGACQCVVEPHNNATTHMVHNNVLDEYDIADDMTLACQT
FT                   LSDTPGGKFDVSYDF"
FT   gene            complement(430715..432241)
FT                   /gene="otsA"
FT                   /locus_tag="ckrop_0351"
FT   CDS_pept        complement(430715..432241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="otsA"
FT                   /locus_tag="ckrop_0351"
FT                   /product="alpha,alpha-trehalose-phosphate synthase"
FT                   /function="Trehalose-6-phosphate synthase"
FT                   /EC_number="2.4.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17130"
FT                   /db_xref="GOA:C4LH25"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH25"
FT                   /protein_id="ACR17130.1"
FT                   /translation="MSSSDNTTGTDTHADASTDDTVKDTYSFIVVANRLPVDIEIDPDG
FT                   TKHFEPSPGGLVTALKPVLKEHEGAWIGWPGATSEGPTATPVADPFTTDEGITLIPMGL
FT                   TKRDYAEYYEGFSNATLWPLYHDLIVTPIFNRDWWVTYRDVNTRFAMEVARRAAEGATV
FT                   WVQDYQLQLLPGILRQMRPDLKIGFFLHIPFPPAELFRQLPWREELVRGLLGADVIGFH
FT                   SIHNATNFLELSRDVGGFATPSTGQPDSLPVRGKASMREITATITASDGRPVGVGVFPI
FT                   SIDTKSVTAAAKDADAEKVRSELGDPETLILGVDRLDYTKGILQRLEAYEELLETGALD
FT                   PETTTFVQVATPSRERIEHYKVARRQVEEAVGRINGHFSSIGHSAVTYMHRSIPFQDLV
FT                   SYYKAADIMLVTSLKDGMNLVAKEYVACHPDGTGSLVLSEFTGAAAELDGAFLCNPHDI
FT                   DSIKRQVHSAAVAKKEDLHDRMMSMFNEVTEHDVHAWASAFLDCLESDND"
FT   gene            complement(432354..433349)
FT                   /locus_tag="ckrop_0352"
FT   CDS_pept        complement(432354..433349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0352"
FT                   /product="transcriptional regulator, LysR family"
FT                   /function="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17131"
FT                   /db_xref="GOA:C4LH26"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH26"
FT                   /protein_id="ACR17131.1"
FT                   /translation="MSLAHIPDLRTLEILVAIADTGSLGAAARQMGMTQQGVSERVRSA
FT                   ESILGFTLVSRTPRGTHPTPQGREFINHARDVIRSANSLADTVSFDKDPTHHIIRAAAS
FT                   QTITDHYIPRWIAHLTDTHPGVRFAITTGNSQQVAHTIASGDATIGFIESLSLPELKGI
FT                   PTEDYFDSTVITTDYLTLVVRPDHEWAGLGHVSPLTVAQTPLIVREPGSGTRSTIERVL
FT                   PQALQAPFAELESATAIKSTVLATRAPAILPRCVVEQEIADGRLSEITIDDTRLARPIR
FT                   ALWRKGTTLRGSSRTLLEAARASAARASATRSSAARATTTRAATQGRKRH"
FT   gene            433428..434681
FT                   /locus_tag="ckrop_0353"
FT   CDS_pept        433428..434681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0353"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17132"
FT                   /db_xref="GOA:C4LH27"
FT                   /db_xref="InterPro:IPR004695"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH27"
FT                   /protein_id="ACR17132.1"
FT                   /translation="MMMHRLVAMTMTATETASAEPVSSRLRPARPHPGSSGPRRQPAIV
FT                   PPAGPAWFGSIMGTGILANLLVSVALPRFGEGSFLADATLTAAAVVLVIGWIAFVGLTV
FT                   GFVGRCLRQFKVFHQSIVHPEQCTAWGMVSMGILSLGSATPIVLDELTSSGAGSHNSAA
FT                   NPIQWLARAQGLGWSIDLTFWWIGTILGIVTAFGFALVVVRNRWSEPRPVWGLPIVPPM
FT                   VSATTGASQLSHISTMSLRMTMLIVSVGCFFVALTLGAIIFVVAYEHAWRRSPLPLAAS
FT                   ASAWIPLGIVGQSTAAAQAIAHQIDAVITPAGQQWVQAAANLYGQVILACGIPLIAYAA
FT                   FCTIRGFAGRMPFSPSWWALTFPVGTLCLGSHLLSHGTGWEWMNWVSLGFLVLLTLHWL
FT                   TASAGTVKALSGKVFATA"
FT   gene            complement(434870..435337)
FT                   /locus_tag="ckrop_0354"
FT   CDS_pept        complement(434870..435337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0354"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17133"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH28"
FT                   /protein_id="ACR17133.1"
FT                   /translation="MPPKVTDKRATNAESLHAVEEETAIAAQRIVATYAEDFFDYTTLT
FT                   SMLGVEPKGLIYRRVAKELGEPEIPGKKPEKKAAKKSSKKSTGKKSTGKGTKKTSKKST
FT                   KSSAKKSTKKSTKKSTKKTTKKSSGSAAKKSTRKSTAKKSTAKKSTAKKSS"
FT   gene            complement(435439..437277)
FT                   /locus_tag="ckrop_0355"
FT   CDS_pept        complement(435439..437277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0355"
FT                   /product="amino acid export carrier protein"
FT                   /function="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17134"
FT                   /db_xref="GOA:C4LH29"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="InterPro:IPR024528"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH29"
FT                   /protein_id="ACR17134.1"
FT                   /translation="MNTRPGPVNQPRHNTHNCTNNETNTPPPAQTAPIATPLAHTVVSV
FT                   VACDHKTFLTPPIPISEGNDLPMDFVSGFSQAFRRVAGSRAPGTTAGGSNPVATIDAVK
FT                   AAPAPSPLKPIDFTNADEINAVLDLAARIGDVLLASGMSNGDVKAHMHAITETYGIHDV
FT                   HVDITLNTLMLYTTMGPTEGALSAFRVVSKLSMDFARLEEIDVLVRRILTGGFTRAEAA
FT                   DELHEIVTAPPTYNSTFVLIMWGIFTGSVAFMIGGHLPEAVISCLSAIVIMWGSAVLAG
FT                   HGLPLFFQNVFGGLVAPVPAALAYHVGQHYGIEVNPSVCIGAGIVAMLAGLTLVQALQD
FT                   GITGAPVTASARFFEAALSTGAIIAGVAFGLNIASRLGIPLPGFEGSASTNVVQNVVIT
FT                   VSGALAGAFFAVACFARLRSTVITTVTTLIGAAIYYMILIPIGFGTIAASGMAATLIGL
FT                   FGGLLSRRYMIPPLITAVSGITPLLPGFALYRGMYSLLNDRPSIGFSSMATAFAIATSL
FT                   AAGVVLGEWIARRLRRPRIATAYRGVRNIVRRPLAVKARTNGSRVNGPRTNGQRTNGQR
FT                   ANGRGAPRTPNTGSIRARWRNRSYRNTKARSQWRRR"
FT   gene            437304..437379
FT                   /locus_tag="ckrop_t0009"
FT   tRNA            437304..437379
FT                   /locus_tag="ckrop_t0009"
FT                   /product="tRNA-Thr"
FT                   /anticodon="(pos:437337..437339,aa:Thr,seq:tgt)"
FT   gene            437829..438728
FT                   /locus_tag="ckrop_0356"
FT   CDS_pept        437829..438728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0356"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17135"
FT                   /db_xref="InterPro:IPR011664"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH30"
FT                   /protein_id="ACR17135.1"
FT                   /translation="MTYDDQVKLLCARGMHIENQDRAKDILAWLSYYRLSGYWYPMRHF
FT                   DYGTRRRFDSFIEGASFDLVVELYKFDERLRHDVFMELDRVEMAIRTMLGYELGRVHPL
FT                   VYLDAKSLGARAQQRRGKGNRRVHDVWLEKYEGALDNSKEVFVTHHKKKYGGELPVWAA
FT                   VEIMDWGMLSYLFGMSPNIVRNRIAERCALTAPQLESWLKSLNIVRNYAAHHARMFNRV
FT                   YDIKPKLGDDQRLNSVAGKMNRTFGQLSLIQYLHHQLHLSPAKRLPALMNTYPHNPIVP
FT                   LERTGAPRNWSDHPLWEC"
FT   gene            complement(438916..439626)
FT                   /locus_tag="ckrop_0357"
FT   CDS_pept        complement(438916..439626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0357"
FT                   /product="transporter of the Hly III family"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17136"
FT                   /db_xref="GOA:C4LH31"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH31"
FT                   /protein_id="ACR17136.1"
FT                   /translation="MTPVSANSPRHDARATVPYDRGPRPIFRGRLHEIAAIYFAGTCTA
FT                   LVATTAALHNSATFIAAIVLYCVCLLGMLAVSALYHRVPWHTKRAVDIWRRADHSMIAI
FT                   FIAGTYAPVAVYAFNSMSDGLWILPTAWIAAGGAVAINLLWPNHPRWVDVVIYLVLGWL
FT                   VVVKATALVSLVPVAALVLIIVGGVIYSLGAVVYGIQRPNPSERWFGFHEVFHASTIIA
FT                   AALHHIAIWLLAVG"
FT   gene            439736..440734
FT                   /locus_tag="ckrop_0358"
FT   CDS_pept        439736..440734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0358"
FT                   /product="ABC-type transport system, ATP-binding protein"
FT                   /function="ABC-type sugar transport systems, ATPase
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17137"
FT                   /db_xref="GOA:C4LH32"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005894"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH32"
FT                   /protein_id="ACR17137.1"
FT                   /translation="MPNSPGKPMIEAHDLTQTFRGRGRDKKPVKAVDGVSLHVNPGEII
FT                   GFLGPNGAGKTTTLRMLTTLLKPTSGSARVAGFDVATQPVEVRRHIGYVSQVGSAGSNA
FT                   HAGEELMDHGMLYGLRKKDAQRRAHELFEQFSLEGLWDREPKNMSGGQRRRLDIAMGLI
FT                   HSPGLVFLDEPTTGLDPQARSNLWDHIRSLREDQGTTIFLTTHYLDEADALADRIIVID
FT                   HGRIIASDTAENLKSSVSGDHVSLRLDDATRQADAAEIITRVMSGADASTTPDPKLSGD
FT                   LIEADVYNSGHVLPDLIRALDEKSIGIADLNVRRPTLDDVFLSLTGRSLRD"
FT   gene            440762..441526
FT                   /locus_tag="ckrop_0359"
FT   CDS_pept        440762..441526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0359"
FT                   /product="ABC-type transport system, permease protein"
FT                   /function="ABC-type multidrug transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17138"
FT                   /db_xref="GOA:C4LH33"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH33"
FT                   /protein_id="ACR17138.1"
FT                   /translation="MGISNFFRESFIICRRQLRMNLRNPAWIIIGLLQPVMYLVLFGPL
FT                   LKPLTAQFGATNAYTFFVPGLLVQLTVFGAMFVGFGVIAEWRDGVIEAERVTPASRTAL
FT                   LCGRLMRDVTQLGVQSTILIALGYAMGMKAPIAGVILGMIITLFAGAASAAASNALALT
FT                   SKDEDVMGPLTNMLIMPILLLSGIILPMSLAPAWLERLSDFMPTRYIVDAVRAIFAENP
FT                   DAATVTWGILWSLVIFFAGIWWGTCTFRKENS"
FT   gene            441629..442429
FT                   /locus_tag="ckrop_0360"
FT   CDS_pept        441629..442429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0360"
FT                   /product="hypothetical protein"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17139"
FT                   /db_xref="GOA:C4LH34"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016477"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH34"
FT                   /protein_id="ACR17139.1"
FT                   /translation="MAFIDDDTFTKNTHGRAAEWEAVGLNWLREAESSGGARVVKVFGQ
FT                   DDSVPGGGLVLERLDNGRASTRFAREFGAALSHTHEAGAVAFGAGPDGWEGDGLHGPND
FT                   ELMPLSLKHYDHWGEMYAEARIMPTLERINSSQRGASLGEQGNKAVEAVCERLRDGDFD
FT                   DIDTPARIHGDLWAGNVMWTSSGAVLIDPSAHGGHPLTDLAALALFGAPKLDAIYEGYE
FT                   SEGFLNKGWRKLIPLHQLSMLLSHVYLFGSSYVPSTVQAASQYA"
FT   gene            complement(442469..443563)
FT                   /locus_tag="ckrop_0361"
FT   CDS_pept        complement(442469..443563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0361"
FT                   /product="putative membrane protein"
FT                   /function="Putative ammonia monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17140"
FT                   /db_xref="GOA:C4LH35"
FT                   /db_xref="InterPro:IPR007820"
FT                   /db_xref="InterPro:IPR017516"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH35"
FT                   /protein_id="ACR17140.1"
FT                   /translation="MTTHHIKASTRRSLVGWTIAIIATLVAVGLCRVAQLPSPLMLGAM
FT                   VGGLCGAIIASTRIRPPRSTIGPSQGVISLIAAGPLVNSSPDRLASYALPSLIAIGITL
FT                   LLCAACAWAITRFSTIDSPTAVMSTLAGGASAMSVLSEELGADFRYVTVAQYLRVFIVS
FT                   FSLPFLIPLLVGGDVDVGSEPLVNLSSHSIMNWLVVLAVITIPGWLASFTPLPAPRLLA
FT                   PLAIAIVIGEWQPHLISIPGVLEAAAFVLIGWQAGGAFDRQSLVTNAKRLPLAFLCIIV
FT                   LMGGCGVMAGILTALGLGTLTETYLATTPGGRYIVLAIAHDRDAGPIVTVMQVTRMIVM
FT                   LIVTAFVPQLIRALRRIKNTATHH"
FT   gene            443754..444458
FT                   /gene="tcsR1"
FT                   /locus_tag="ckrop_0362"
FT   CDS_pept        443754..444458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tcsR1"
FT                   /locus_tag="ckrop_0362"
FT                   /product="two-component system, response regulator"
FT                   /function="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17141"
FT                   /db_xref="GOA:C4LH36"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH36"
FT                   /protein_id="ACR17141.1"
FT                   /translation="MSSAEAPTRVLVVDDEANIVELLKVSLKFQGFEVATASDGGEALD
FT                   IARSFHPDAFILDVMMPRMDGFTLLSKLRADGHDAPVLFLTAKDAVDDRIHGLTIGADD
FT                   YVTKPFSLEEVVTRLKVILRRVSPPEVDDDQRITYADLTLDDNSHEVTKAGEYVDLSPT
FT                   EFKLLRYLMVNAEVVLSKAKILDHVWNYDFGGDGNVVESYVSYLRRKVDKDEPHLIQTV
FT                   RGVGYVLRTPRA"
FT   gene            444593..446428
FT                   /gene="tcsS1"
FT                   /locus_tag="ckrop_0363"
FT   CDS_pept        444593..446428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tcsS1"
FT                   /locus_tag="ckrop_0363"
FT                   /product="two-component system, sensor kinase"
FT                   /function="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17142"
FT                   /db_xref="GOA:C4LH37"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH37"
FT                   /protein_id="ACR17142.1"
FT                   /translation="MLQRLKKSDAPNDADTSQPVAAQQPSAIDQTNSWALPTTFASDDG
FT                   AIHDADVPHDASANVDEANSSSPTGVSGNDVESSRNDDDSAQKKSVPVAPPGRQTTRPR
FT                   SYSEKRRQEWERKQHTGAAKRGLSRLPLHTSLIIIVMVISAGGMFFTGLAVTSTLREFM
FT                   QSRIDASLESTAHSPFIEQGRLPVQSAYSENPRLPSQYFVQVTHSDGSVVPYDYGFESY
FT                   PNLDSVTHETGPVTVSAARGSKSTAHWRAMALKSQDGDLVVVAVSLDDNERTISRLFLL
FT                   EAGLGMLVLAVLLILTWYVVRRSLRPLSHVERVAGKIADGDLSQRLPEWPPDTEVGALS
FT                   RSLNKMLAQIEQSFVAVERSEAEAQENARVARKAEAQAREAEQTMRRFIGDASHELRTP
FT                   LTSVSGYAELYRTGQTDDLNLVLDSISAEAERMSVLVQDLLDLARMDNSRPLEHKSVDI
FT                   LSVAISVIQNMKVNYPDRDISMTNNCVEPPIVTGDSARLHQVLTNLMTNALKHAGPEAA
FT                   VRIALDDSTLGTSPKKKAVRIRVIDNGVGIPPEDSEHIFERFYRADSSRSRHQGGGSGL
FT                   GLSIVQGLVEQHGGKVTVDSVVDEGTTFTVLLPHE"
FT   gene            complement(446403..447377)
FT                   /locus_tag="ckrop_0364"
FT   CDS_pept        complement(446403..447377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0364"
FT                   /product="hypothetical protein"
FT                   /function="Predicted hydrolases or acyltransferases
FT                   (alpha/beta hydrolase superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17143"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH38"
FT                   /protein_id="ACR17143.1"
FT                   /translation="MLKVSRRLRGAMTAHPLHVKPRMLRPRGHQWAGSSRVHPYTDEDG
FT                   RFHRGERIPAMAHVPDMGRVPEQDFSPIADDENPPLLCVHGMIGAKGNWEVLVRYITDR
FT                   RTFYVDYGEAGTAPVDECVDELAEQIIDLSQKIHARKLILLGHSRGGLIALLAASRPEV
FT                   QSVVTIRRIIGLGGHFSGIPRWKLLPKDVSSYGPVLSVFFRLTHRFAYWAVGASAEDQF
FT                   KDSPDLQRALRGVDRSIEVIPIASSTDYIVRPSAAFDVPTDHVTPVLLQDYFPGAKILH
FT                   NLLPRDGRAIAMVKAAIAKSPIRGESAREDSTRKNSIRGAKEQ"
FT   gene            447548..449185
FT                   /locus_tag="ckrop_0365"
FT   CDS_pept        447548..449185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0365"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /function="Phosphoribosylamine-glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17144"
FT                   /db_xref="GOA:C4LH39"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH39"
FT                   /protein_id="ACR17144.1"
FT                   /translation="MDVSMGNFKSRDQHAGTRRVEGVGNGAANVVGDGRNMRPFVETQV
FT                   RPPVNFLNGDNQGVTVRDGFDGEECGDGVVAVHEPTWDLAVDDFREYGSHKSRVAISEV
FT                   GKKLCMSGGCLRVLGMQILVLGNGSREHALLYSLSKDSQVSGLHVAPGNDGMTAIAQLH
FT                   PDIDINDGSQVVGLATSLGADLVVIGPEAPLVAGVADALRDAHIPVFGPGGQAAQIEGS
FT                   KAFAKDVMKAANVRTAQAESLQPGASADQVDAVLNDFGPTFVVKDDGLAGGKGVVVTQD
FT                   RDEARDHAVAVLESGHPVLVESFLDGPEISLFCLVDSDTVVPLLPAQDHKRVGEGDTGP
FT                   NTGGMGAYAPLPWLPEGAVDRIVDEIVQPVASEMVKRGCPFNGLLYAGLAWGKEGPVVV
FT                   EFNCRFGDPETQAVLELLDTPLAGVLNSVATGHLADVPPLTWKDGYAVTVVLAAQGYPA
FT                   GPRKGDPISGAEPGTEDDGVRHAGVARLGDRLVSSGGRVLSVVGVGKDLDEARAKVYRK
FT                   MEGISLPGGHYRRDIAQKAVEGRIGIAN"
FT   gene            449208..450488
FT                   /gene="aspB"
FT                   /locus_tag="ckrop_0366"
FT   CDS_pept        449208..450488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspB"
FT                   /locus_tag="ckrop_0366"
FT                   /product="aspartate aminotransferase"
FT                   /function="Aspartate/tyrosine/aromatic aminotransferase"
FT                   /EC_number="2.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17145"
FT                   /db_xref="GOA:C4LH40"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH40"
FT                   /protein_id="ACR17145.1"
FT                   /translation="MGRDNSESADYSGMNYSEDQHSNSGSSGKDYGLAIQRGHADPFYT
FT                   MEMVARTAEREAEKHDTVPLCIGQPSTPAPRVVRDVAIEAIQNDKLGYTEALGIQPLRE
FT                   RIARWHSETYGTDTKADNVIVTTGSSGAFVAIFAACLPFGGTVALSSPGYAAYRNVLQA
FT                   LGNSFIDIPTTAETRFHMTRKHLEDLAQAGNKPDMVLITSPNNPTGSIIDPDELRAISQ
FT                   WCDETDTVLVSDEIYHGISYGRPTVTARSLSDRAVVIGSTSKYFSMTGWRLGWLIIPDD
FT                   PTLRETIENILGNISLCAPALSQIAATRVFDDDALAELRVHVERYKENHDILNKELPAV
FT                   GLPRFAPSDGAFYFWVDVSNYTDDSVAFAHELLDATGVSVSPGTDFDGSADKALGKKYV
FT                   RVSYAGTPEEMREACRRLKPFLEARRR"
FT   gene            450577..452100
FT                   /locus_tag="ckrop_0367"
FT   CDS_pept        450577..452100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0367"
FT                   /product="Adenylosuccinate lyase"
FT                   /EC_number="4.3.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17146"
FT                   /db_xref="GOA:C4LH41"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH41"
FT                   /protein_id="ACR17146.1"
FT                   /translation="MAENKTDNSRTNSVDTGKGTSPDQGSTGAPAGTHKKDIANVLAHR
FT                   YASPELVNLWSPEHKIIMERRLWIAVLRAQKELGVDVPDEAIEAYESVIDRIDLDSIAA
FT                   RERVTRHDVKARIEEFNALAGYEHIHMGMTSRDLTENVEQLQVHRSLEHVRDRMVAVLR
FT                   ALADCAVRYRDQVMAGRSHNVAAQATTLGKRFASAANEILVAYERLENLISRYPLRGIK
FT                   GPMGTSQDMLDLVGGDETKLEQLENSVSEYLGISRRFDSVGQVYPRSLDLDVISALVQL
FT                   GAGPSSLSMTIRLMAGNELVTEGFKEGQVGSSAMPHKMNARSCERIGGLQIILRGYQTM
FT                   AADLAGQQWNEGDVFCSVVRRVALPDAFFAFDGMVETLLTVLKEFGAFPAMIDKELERY
FT                   LPFLATTRILMASIRAGLGRETAHEIIKENAVATALDMREKGTEQNLIERLAADDRLPL
FT                   NREQLDAAIADRHAFIGAAGSQVDRVVARVKDIVAEHPDAAAYMPGDIV"
FT   gene            452376..453617
FT                   /locus_tag="ckrop_0368"
FT   CDS_pept        452376..453617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0368"
FT                   /product="putative membrane protein"
FT                   /function="Predicted esterase"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17147"
FT                   /db_xref="GOA:C4LH42"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH42"
FT                   /protein_id="ACR17147.1"
FT                   /translation="MAGPGKTWKPFGGGTAIGVYVAGWALIVLIGLAIGSYCARGQTRL
FT                   VPWFKRMRATGPRSSKPRASFSQRWASIRWKSVARVVGACAAFVCGTVACVNVVNNSFA
FT                   LYPSVDSLVGKEPYTTAQYADVKGTSTSFTPPQGSTIAGAWNGVSPRNKGVLVPFMIPS
FT                   PVSHFQTTESRVYLPPAYFANPRPLLPVVVLMNGLPGSPSQWFEIGNAGQTLHHFERVH
FT                   HGLAPVVVAINTTGNDDEDLGCFDTKKAKVQTYMDTDVPQQIKKYFQVSNDPTQWAIGG
FT                   LSYGGTCALQAIVNNPEPYRYFLDFSGDRTPGTMSAKGNADTYFGGNLNAYLRVNPEDI
FT                   LKRRKFTGIKGVFVAGQSDKSSVRDLKYMNGLAQSAGIDSSSREVPGGHDFGTWRLALV
FT                   LTLPDVARATRLIG"
FT   gene            453690..454625
FT                   /locus_tag="ckrop_0369"
FT   CDS_pept        453690..454625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0369"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamidesynthase"
FT                   /function="Phosphoribosylaminoimidazolesuccinocarboxamide
FT                   (SAICAR) synthase"
FT                   /EC_number="6.3.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17148"
FT                   /db_xref="GOA:C4LH43"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH43"
FT                   /protein_id="ACR17148.1"
FT                   /translation="MNRVFGFRGVTYRAMRPELSSYEHLSAGKVRENYEIDDDTLLMVA
FT                   SDRVSAFDYILDTQIPDKGRILTAMSTFFFEQLDMPNHLVGPVDDERIPEETLGRALVC
FT                   EKLKMIPFECVARGYLTGSGLKEYNETGRVCGIELPEGLVEGSKLPEPIFTPATKAEFG
FT                   SHDENVDYDYVLEHLGERRSETIRDAALSLYSQAAAIAEEGGLILADTKFEFGVDADGN
FT                   VKLADEVLTPDSSRYWPKEGYREGHRQPSFDKQYLRNWLIGPKSGWSRESGVQPPALPG
FT                   SIVEATRDKYVEAYERVSGLKFADWIGPSA"
FT   gene            454731..457028
FT                   /locus_tag="ckrop_0370"
FT   CDS_pept        454731..457028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0370"
FT                   /product="Protease II"
FT                   /EC_number="3.4.21.83"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17149"
FT                   /db_xref="GOA:C4LH44"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR023302"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH44"
FT                   /protein_id="ACR17149.1"
FT                   /translation="MSHVDDAHNATHPPRNVASTDPDEGSLQYSSSGAPIPPTAHIHPT
FT                   TRSHHGHDVVDNYEWLRDKESPETLAYLRAENEYTEARTRDLAPLQDSIFQEIKSRTQE
FT                   TDLSVPVRSGDWWYYGRSLEGKSYGVSCRVPASSTGDKTKDWTPPAIDAESAPENEQII
FT                   LDSNVLAEGAEFFSLGASSVSVDGNYLAYSTDTTGDERFDLRIKDLRTGELLDDAIDGI
FT                   GYGATWVGSEWLFYERVDDSWRPNEVWRHRVGTPTDQDVCIFREDDERFWVGCGTTRSE
FT                   KYLFVEVGSKVTSEVWFLDLGVTGDGESKTVDPERVTGELQCILPRHTGVQYDVDHAVI
FT                   GGDDRWIVLHNAHGADFELGMASATPLTSLDDLDVVIPHKQGRRIEGMDVFAQHMVVGY
FT                   RENAINKLGLFSFADGTVGNLEPIDFDEELYSAGTGGNAEWESPYIRMAYESFVTPGLV
FT                   FDYDLATGERLVRKQRIVKGGYDPSDYVARRMWTTARDGAKVPVSLIYRADLEGKTDSD
FT                   GLPTDGPHPTILYGYGSYEASMDPAFSIARLSLLDRGIVFAIAHVRGGGEMGRSWYDNG
FT                   KTLAKKNTFYDFIDVADDLISRNVTDNKHMVALGGSAGGLLMGAVANMAGDRFSGIEAV
FT                   VPFVDPLTSILMPELPLTVIEWDEWGDPLHDPEVYDYMASYAPYDNVSAENTYPPILAL
FT                   TSLNDTRVLYVEPAKWVAKIRATIPGSDICLKTEMIAGHGGVSGRYEQWKQTAFEYAWM
FT                   IRRAGVAEDAAV"
FT   gene            complement(457034..457654)
FT                   /locus_tag="ckrop_0371"
FT   CDS_pept        complement(457034..457654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0371"
FT                   /product="transcriptional regulator, TetR family"
FT                   /function="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17150"
FT                   /db_xref="GOA:C4LH45"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH45"
FT                   /protein_id="ACR17150.1"
FT                   /translation="MTNTAERDDSRDSSAEQGRPQGHIDRRVAKTQAAIHRALEELVCE
FT                   KPPHRITVAEITRRANIHRKTFYLHYNSVEELFREELESMKQDYAEIIDSIPPTMTIAD
FT                   INRVFFDFATRQGPLFEQLVVSPEYRHYAERFFHMNLIHNRARHNPYAHLSREQQNTIN
FT                   TFLVAGTLDMYRQWIADGKTMPLDELVTLSTQLLSHGAAQFRD"
FT   gene            457794..458624
FT                   /gene="pcaC"
FT                   /locus_tag="ckrop_0372"
FT   CDS_pept        457794..458624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaC"
FT                   /locus_tag="ckrop_0372"
FT                   /product="putative 4-carboxymuconolactone decarboxylase"
FT                   /function="Uncharacterized homolog of gamma-
FT                   carboxymuconolactone decarboxylase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17151"
FT                   /db_xref="GOA:C4LH46"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH46"
FT                   /protein_id="ACR17151.1"
FT                   /translation="MSASQPDADAQPDPRHTHRSIPDVFREVFDHDYSPLGSSARVRDE
FT                   FNQITDRFAFGEMWPASGLDDRRKILVSVACVATSGGDELSALLRAGLHLGVAAEELQE
FT                   VFHQIAPYVGISRARHGLEELDKLVDAPVDIQSTVTEDDRLAKGIAAQKAMFGDGIDTM
FT                   RENAPEDESFIQDALSAYCFGDTYTRKALSLADRELLTWVAIISLGGCDPQARAHVSGN
FT                   LAVGNDRAILLGALAVCVPWIGFPRSLNALAAINSQTKNDVAEDKTAENDDKES"
FT   gene            458627..459067
FT                   /locus_tag="ckrop_0373"
FT   CDS_pept        458627..459067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0373"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17152"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH47"
FT                   /protein_id="ACR17152.1"
FT                   /translation="MEITSKDEFDKVNKFGTGDSNDAFAEYFVGKSFLQPIAQLDEAGL
FT                   GIANVTFEPGCRNNWHIHHARRGGGQILMCTAGEGWYQEEGKTPVSMTEGSTVVIPPNV
FT                   KHWHGAKADSWFSHIAISVPGEETSNEWLEPVSDEDYQSLTS"
FT   gene            459149..460564
FT                   /locus_tag="ckrop_0374"
FT   CDS_pept        459149..460564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0374"
FT                   /product="putative Na+/H+-dicarboxylate symporter"
FT                   /function="Na+/H+-dicarboxylate symporters"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17153"
FT                   /db_xref="GOA:C4LH48"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH48"
FT                   /protein_id="ACR17153.1"
FT                   /translation="MSSSPVRIVEPKKEKKDKSHWLYISVIVAVLAGVILGLVAPDVAV
FT                   KFELLGKLFVALIKMMIAPVIFCTIVLGIGSVRAAASVGRAGAISLVYFIVMSTFALAI
FT                   GLVVGNIVKPGSSLAMPEAGSGMSFVDNNKEAAHGLSGFVMSVIPDTLFSSLTSGSVLQ
FT                   ALFIALLCGFAIQSMGKAGEPLLSAIAQVQKLVFKVLMMVLWTAPIGAFGAISWVVGST
FT                   GFDAVKQLVLLMLCFYVTCVIFIFGVLGLVLYAFTRFNIFKLVKYLAREYLLIFATSSS
FT                   ESALPTLIRKMEHVGVDKSTVGIVVPTGYSFNLDGTAIYLTMASIFISDAMHKPLNLGE
FT                   QIGLLVFMMIASKGAAGVSGAGLATLAGGLQAHRAELLDGVGIIAGIDRFMSEARALTN
FT                   FAGNSVATLVVGVWTHTVDRNRVNAVLSGEIPYVETPEDMESDVNLRNPSVKNPADKLQ
FT                   PTPQVDVDEYQRA"
FT   gene            460619..461107
FT                   /locus_tag="ckrop_0375"
FT   CDS_pept        460619..461107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0375"
FT                   /product="putative glutathione peroxidase"
FT                   /function="Glutathione peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17154"
FT                   /db_xref="GOA:C4LH49"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR029759"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH49"
FT                   /protein_id="ACR17154.1"
FT                   /translation="MSIYDIPVTTIEGKETTLRSWEGHVLLIVNVASECGFTPQYEALE
FT                   HIFEEYAARGFFVIGVPCNQFGEQEPGSNEEIKEFASSKFGVTFPLLSKTDVNGDNEHP
FT                   LYTELKKTADNNGEAGDVKWNFEKFVLSDSGEVLGRFRSDVDPEDDALLDLIEDNLPL"
FT   gene            461192..461485
FT                   /gene="purS"
FT                   /locus_tag="ckrop_0376"
FT   CDS_pept        461192..461485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purS"
FT                   /locus_tag="ckrop_0376"
FT                   /product="phosphoribosylformylglycinamidine synthetase"
FT                   /function="Phosphoribosylformylglycinamidine (FGAM)
FT                   synthase, PurS component"
FT                   /EC_number="6.3.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17155"
FT                   /db_xref="GOA:C4LH50"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH50"
FT                   /protein_id="ACR17155.1"
FT                   /translation="MARVVVNVMPKTEILDPQGQAVLRALGRIGVNGVRDVRQGKRFEL
FT                   DVDGSVSDEELDRLASTLLANTVIEDYDVVAERADDSDATPVTSTSANEGAN"
FT   gene            461485..462153
FT                   /locus_tag="ckrop_0377"
FT   CDS_pept        461485..462153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0377"
FT                   /product="phosphoribosylformylglycinamidine synthase I"
FT                   /function="Phosphoribosylformylglycinamidine (FGAM)
FT                   synthase glutamine amidotransferase domain"
FT                   /EC_number="6.3.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17156"
FT                   /db_xref="GOA:C4LH51"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH51"
FT                   /protein_id="ACR17156.1"
FT                   /translation="MPRIGVVTFPGTLDDGDAARAARLGGAEVVRLWHADADLKGVDAV
FT                   IVPGGFSYGDYLRAGALASLAPVMGEVVRRAHQGLPVLGICNGFQILQEAGLLPGALTR
FT                   NKGLHFHCVDTYLQVERTSTPWTAGFTQGQKILVPAKHGEGRFQAPAETISQLEDEGRV
FT                   VFRYTDNFNGSVNAIAGVSSADGRVVGLMPHPEHAVELLTGPSTDGLGLIHSVLDSVGV
FT                   "
FT   gene            462157..464745
FT                   /locus_tag="ckrop_0378"
FT   CDS_pept        462157..464745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0378"
FT                   /product="phosphoribosylformylglycinamidine synthase II"
FT                   /function="Phosphoribosylformylglycinamidine (FGAM)
FT                   synthase synthetase domain"
FT                   /EC_number="6.3.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17157"
FT                   /db_xref="GOA:C4LH52"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH52"
FT                   /protein_id="ACR17157.1"
FT                   /translation="MVNQANKNQTNKTDMNTEDDQMLKSTETARTDAGADNAAADNAVE
FT                   SFTAAQVNDTVAAAQSDPDASQPYASLGLKDDEYARIKDILGRRPTDAELAMYSVMWSE
FT                   HCSYKSSKVHLRYFGETMTKEMSSKILAGIGENAGVIDIGDGNAVTFRVESHNHPSYVE
FT                   PHQGAATGVGGIVRDIMAMGARPIAVMDQLRFGPADAADTQRVLPGVIDGVGGYGNCLG
FT                   LPNIGGETVFDESYAGNPLVNALCIGTLKVDDLKLAFASGKGNKVMLFGSRTGLDGIGG
FT                   VSVLASDTFEDGAERKLPSVQVGDPFAEKVLIECCLDLYHAGIVVGIQDLGGAGLSCAT
FT                   SELAAAGDGGMEVNLDAVPLRAENMTAAEILSSESQERMCAVVTPENVDRFREICAHWD
FT                   VTCAEIGEVTDGDHLVIRHHGQVVVDAPAHTIAHQGPVYDRPYERPDWQDDLQEPGVET
FT                   KGFARTQGADELRETWLRMVASPALCSRAFITEQYDRYVMGNTVEAQNADAGVLRIDES
FT                   TGRGVAVSADASGRYTKLDPNMGARLALAEAYRNVVVTGARPVAVTNCLNFGSPEDPAV
FT                   MWQFREAVHGLADGARELGIPVSGGNVSFYNQTGSEAILPTPLVGVAGVVTSVDHHINH
FT                   LLGGLTTERSAFPESESDAGDDSSASTSGSANDQFEELYLLGETHDELGGSIWQQVKHN
FT                   ALSGLPPQVDLAATSALADFFCDQADPDTPRVVTAAHDLSEGGLAQALAELAMISGVGM
FT                   DVDVSKVHADPCVALFSESANRVVVACAHGDGDKLVSLAKRCGIPVLRLGSVTSRACGS
FT                   SQETSAQVRVRVSTDEADEIMLPVSELREAWTSTLPKLFAHAAGANSVVE"
FT   gene            464848..465954
FT                   /locus_tag="ckrop_0379"
FT   CDS_pept        464848..465954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0379"
FT                   /product="putative glycolsyltransferase"
FT                   /function="Glycosyltransferases involved in cell wall
FT                   biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17158"
FT                   /db_xref="GOA:C4LH53"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH53"
FT                   /protein_id="ACR17158.1"
FT                   /translation="MTFHALYTSKSKNPTIETSSFAPTAQPSDLSAVAGGASVGDTRSA
FT                   VSTLNSRADSEHSTVASRVSTATQESSSATGENTPAAPGDSAQGKAESYHPTDPRQAIV
FT                   EIVIPVYNEATSLPTSIPHLVESLSSLVPFTTMVTIADNASIDNTWIVAGELERQLPSV
FT                   RRVHLDQKGRGRMLKKVWLESQCDVVAYMDVDLSTDLHALLPLLAPLVSDHSDIAIGSR
FT                   LARSANVIRGSKREFISRTYNHMLRLMMSAHFSDAQCGFKAMRTDVARAILPHVEDPNW
FT                   FFDTEVLLLAEKAGYRIHEVPVDWTDDPDSRVNVVETALQDLRGMWRVRRNIASHRINL
FT                   DSFRRSSRTSEPPVLEGVKGRPEPQQSF"
FT   gene            466160..466372
FT                   /locus_tag="ckrop_0380"
FT   CDS_pept        466160..466372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0380"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17159"
FT                   /db_xref="GOA:C4LH54"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH54"
FT                   /protein_id="ACR17159.1"
FT                   /translation="MVIFLVCWLVTSSSLVGLSWVNPHASATTELIVLTVANVVATIIR
FT                   FVALRAYFYSFRHRHRHRRRAGSRQ"
FT   gene            466582..469143
FT                   /locus_tag="ckrop_0381"
FT   CDS_pept        466582..469143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0381"
FT                   /product="putative membrane protein"
FT                   /function="4-amino-4-deoxy-L-arabinose transferase and
FT                   related glycosyltransferases of PMT family"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17160"
FT                   /db_xref="GOA:C4LH55"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH55"
FT                   /protein_id="ACR17160.1"
FT                   /translation="MTMGIVKGAGGSHSETTHHRQHHTSVPQGPNTRENTTKSGLRAQV
FT                   QGFPRGKELVGFIALLLGSAFLFMWELDNNNYGNDFYAAASQAGSKNWTAFLFGSSDWG
FT                   NTITVDKTPLSLWPSALAIKIFGLNSWSVLVPYALLGVASVAVLWATVRRYAGSTAAFV
FT                   SGIVLAITPVAVLMFRFNNPDAMLVLLMTCSVWAAMRCVETGKWRWAVLTGVFVGLGFL
FT                   AKQGEVLLIIPALVVLLAVVSPRSWKVKLGQSLATVAAMVVSAGWYIVAVALWPSSSRP
FT                   YIGGSTNNSIWELTLGYNGFSRLSGNGSAPGGGSGGGPGGAGGSAGQAGSSASDAAQGA
FT                   AQGAASAATNGMGQAGSSGQMGNMPQGGSPGGGGHGGPTFSGEPSILRLFNEQLGGQAT
FT                   WLFIAALIALVMGIVLCGRAPLKNTKRGLYIGLGVWLLMCAGTFSFMEGTMHQYYTVAM
FT                   VPPMAGLVGMGAADAWQHRDRLWVRAVSAVAILASGVTGFGVLRRASDSFPTWLPWAIL
FT                   AATVIGAVGWFALPWMSAAGARRHADGSASSISARALSFRVGVVGIVAAAMLAGPSAYS
FT                   AYTIAHANTGSMVSAGPKSDSGMGGPGGGGPGGQGADGQGGDEQNTGDGQPDADGQNNT
FT                   DGQSATDGQSSADGQSANGQDGASSPGQASSNGQNGRPDGTPPNGGNGQGMPGGPNSAN
FT                   GTDGTGTTSDNSSNGMPGGSSDGSNGSSAAGGKQGGSSSPGGPAQMTVSDTLKNKLKED
FT                   SDKYKWSAATIGSQGAASYQLATDTDVMPIGGFSGSDDAPTLDQFKKLVSEKKIHYFIA
FT                   DSGQGGAPGGNNEITSWVKEHFSATTIDGVTVYDLTQEKSS"
FT   gene            complement(469208..470266)
FT                   /locus_tag="ckrop_0382"
FT   CDS_pept        complement(469208..470266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0382"
FT                   /product="putative acyl-CoA hydrolase"
FT                   /function="Acyl-CoA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17161"
FT                   /db_xref="GOA:C4LH56"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH56"
FT                   /protein_id="ACR17161.1"
FT                   /translation="MTTKDTGHTTDTAESGATAKKPHATGRRNNSVTLRFLAAPNDILL
FT                   AGAMGVHGGRVLEWIDKAAYACAVGWSGAYCVTAYVGHIHFTRPIPSGHLVEVKSTIAY
FT                   TGRSSMHIVNEVFSADPRDGSFSRACDCLVIFVALDEHGKSIPVPTWTPTTDEEIRVRD
FT                   AALSRVDLRKAIEDEMLKQTYTEDSTAPELVTRFMAKPQDVNWGGKVHGGTAMAWIDEA
FT                   ATACTMEFAGHRTVAVYAGGIRFYRPIQIGDLIEADARIIRTDTRSMQTSVHVYAGDPR
FT                   EGRSGMKLAIHASAAYMGIDEDGNPLAARHFTPTTEEDKRLAEHAETLRNLRAEYSPQP
FT                   LVSQNPISRRIQ"
FT   gene            470367..470741
FT                   /locus_tag="ckrop_0383"
FT   CDS_pept        470367..470741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0383"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17162"
FT                   /db_xref="InterPro:IPR041629"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH57"
FT                   /protein_id="ACR17162.1"
FT                   /translation="MTKRIDAQQLVADLEQVRPWATDPQNVERPPRSVIARAVRTSLKA
FT                   LEADAPGHSVEVRVPPFAAVQCIEGPRHTRGTPPNVVETDGLTWIRLALGIVEWEDCSS
FT                   EVEFSGSRAAEVSRWLPQVR"
FT   gene            470819..472411
FT                   /locus_tag="ckrop_0384"
FT   CDS_pept        470819..472411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0384"
FT                   /product="amidophosphoribosyltransferase"
FT                   /function="Glutamine phosphoribosylpyrophosphate
FT                   amidotransferase"
FT                   /EC_number="2.4.2.14"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17163"
FT                   /db_xref="GOA:C4LH58"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH58"
FT                   /protein_id="ACR17163.1"
FT                   /translation="MSRTDCVDPWCVEANAPTSSEPFTTGPWEADSGVPSGGFAPINLD
FT                   DRGETEPHEECGVFGVYAPGEETAKLTYYGLYALQHRGQEAAGIGVGDGQQILVFKDLG
FT                   LVSQVFDEPTLSALRGHVAIGHTRYSTAGGVRWEHAQPMFRTARSGGDVALGHNGNLIN
FT                   QGELRREAAAYGLIDPASDPTDSDVMCALLAYYHDEDTSLIQSAQELLPRLRGAFCLTF
FT                   TDGEKLYAARDPHGVRPLCLGRLERGWVVASETCALDIVGARFIREIEPGEFLIIDDDG
FT                   VHSHHFARAQHRGCVFEYVYLARPDSTIRGRAVNATRVEIGRRLAEEAPVDGDLVIPVP
FT                   SSGTPAAVGYAQGSGIPFGEGLTKNAYVGRTFIEPSQTIRQLGIRLKLNPLREVIRGKR
FT                   LIVVDDSIVRGNTQRALVKMLRDAGAAEIHVRIASPPVKWPCFYGIDFASPDELVANEF
FT                   DSDDVVEGVRASIGADSLAYVSVENMVAASRQQRSELCCACFDGHYPLGLPDIGRKAGA
FT                   VRDLQEHTAPGGH"
FT   gene            472601..473710
FT                   /locus_tag="ckrop_0385"
FT   CDS_pept        472601..473710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0385"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /function="Phosphoribosylaminoimidazole (AIR) synthetase"
FT                   /EC_number="6.3.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17164"
FT                   /db_xref="GOA:C4LH59"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH59"
FT                   /protein_id="ACR17164.1"
FT                   /translation="MNAHEVGSTGNSDDTSAANEGMSYAQAGVDIEAGDKAVELFAPLA
FT                   KKATRPEVRGGLGGFAGLFALGKYKEPLLAASSDGVGTKLAVAQAMDKHDTIGQDLVAM
FT                   VVDDLVVCGAEPLFLQDYIAIGKVIPEHVAQIVGGIAQGCQMAGCALLGGETAEHPGVM
FT                   EPGEYDISATGVGVVEAADVLGPDKVRDGDVIIGMASSGLHSNGYSLARKVLLEDAGLP
FT                   LDGVVEELDRPLGEELLEPTRIYALDCVELIQECETHTFCHVTGGGLVGNMERVIPDGL
FT                   VAEMDRASWTPNPIFRLIAELGSVSDAEMEKTFNMGVGMVAVVSADEADRAQALLTARH
FT                   VGCWTLGRVRIAGDGEQDRAVLVGDHPQA"
FT   gene            complement(473859..474041)
FT                   /locus_tag="ckrop_0386"
FT   CDS_pept        complement(473859..474041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0386"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17165"
FT                   /db_xref="InterPro:IPR021426"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH60"
FT                   /protein_id="ACR17165.1"
FT                   /translation="MGRGRAKAKQAKVARQLKYNSPEMDLERLQRELTGQREEEDSHDK
FT                   WDRWAEDEPDEDDWR"
FT   gene            complement(474325..475671)
FT                   /locus_tag="ckrop_0387"
FT   CDS_pept        complement(474325..475671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0387"
FT                   /product="putative aminomethyltransferase"
FT                   /function="Predicted aminomethyltransferase related to
FT                   GcvT"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17166"
FT                   /db_xref="GOA:C4LH61"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH61"
FT                   /protein_id="ACR17166.1"
FT                   /translation="MITTTFPATLTLVATRETSNTSKTPGEAPTPTTYQSPLLDAIDGA
FT                   ADAPDGHQQHGVAWHYGNPLGEQRAFERFAGAVDRSHQRVLQISGADTLSWLNSLISQK
FT                   IDALSPGSTTHGLILDAKGHIEHAFTIVRPQASLPDRDEDPSIYLISGPDTFDALQTYL
FT                   TQMVFWSAVSVHEADLALITVIGPDTSTVVAHTLEDHHATSTLAATTPPDTLPEETITF
FT                   TDPLVGTENSVHLLVPRPVLTDAFTTLIKAGAKPTGLMAYEAERIKAVIPEVHADLDDR
FT                   TVPHEIDSFIGTPANAPTQRATADDGPTVSYVHLNKGCYRGQETVSRIQNLGRPPRLLV
FT                   KLQVDGYSARRPEPGEAITSGKRKVGRIGTVVDDCDEGPIALGLVKRSIVEKLIGSGAT
FT                   GGSRSAVGTQTNTLEVEGTTLAIDPDSTHLDEAPKAGRQAVDKLRGKTR"
FT   gene            475794..476666
FT                   /gene="pabC"
FT                   /locus_tag="ckrop_0388"
FT   CDS_pept        475794..476666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabC"
FT                   /locus_tag="ckrop_0388"
FT                   /product="aminotransferase PabC"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17167"
FT                   /db_xref="GOA:C4LH62"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH62"
FT                   /protein_id="ACR17167.1"
FT                   /translation="MLHAGLDSVGREPRVHDSSQPLLFADDLAAVRGDGIFETLMLRGG
FT                   SVRNLDRHAKRFRRSAAMLGLPEPDLDLWGRATDLAVEEWKKQYPELADRDCGLRWVLS
FT                   RGRESTGRPTGWITVAPMSEEVERGRREGVKVMSAERGFRLDLSERSPWALIGAKTLSY
FT                   AANMAALRYAHEHDFDDVIFISDDGAVLEGPTSTVIAVSDRRMMTPKTDAGILAGTTQA
FT                   SMFGIARERGWECEERRLTLDDLKAADGVWLVSSVRVAARVLSLDGFEFDRPDTADEVE
FT                   EIAAEAVRE"
FT   gene            complement(476744..477877)
FT                   /locus_tag="ckrop_0389"
FT   CDS_pept        complement(476744..477877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0389"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17168"
FT                   /db_xref="GOA:C4LH63"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH63"
FT                   /protein_id="ACR17168.1"
FT                   /translation="MQPMWRSHTDHKHWLPVPILSYCLGMRNNQPIHHQPLHSQSLCGH
FT                   LSPEKLLTSGSNSTKSAKAHTRRTHHSADQRGPSLGNKRLGIALGLTLGLAGTFLVHGA
FT                   VSGRNLGSAQASVSDASPVSEASATAQPATPDLATSESTTTHNSGTAELIERNEKYQSN
FT                   HNDGAGKADSVRWVNRTATSPLVLIAPHATTQIRDGKRKPADLYTGGITEIVADRVGAS
FT                   SLTTTGKVSDWNKNWCTRDDEFTRIIDRLPKNAVIVEIHGMKDSSLDEPVSAGTGDEPS
FT                   ESTDAIVGALQDEFDGHVSQDKFEAESGYTVTDYLQKKGHSVLQIELSRSLRDPKSGQA
FT                   GETLDHLTRAFSKAADQFPQLSTTPEANGEERLPHLT"
FT   gene            complement(477995..481009)
FT                   /locus_tag="ckrop_0390"
FT   CDS_pept        complement(477995..481009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0390"
FT                   /product="putative oxidoreductase"
FT                   /function="FAD/FMN-containing dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17169"
FT                   /db_xref="GOA:C4LH64"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH64"
FT                   /protein_id="ACR17169.1"
FT                   /translation="MGVTCHDPCSPVHGFWDCVPRLRIMTTTHMDPTSTPVTEADSPIT
FT                   HPHADEDPQFRRFLNTLQSDGKEHIDYAYDGLSRIAQAHDASHYLLVPKGIMRPDSADQ
FT                   VARIMAAADRCNLQVSFRAGGTSLSGQATTDAVMVDTRRRFQDIEVLDDGRKVRVQPGA
FT                   TIQMVNAYLSLYKRKLGPDPASSSACTIGGVVANNSSGMHCGTQFNTYQTLDSLVFILP
FT                   SGTVINSADHDAEQQFRTQEPELFEALVQMRRQITSSPELVRKIKHQYSMKNTMGYGLN
FT                   SFLDYESPLDIFTHLLIGSEGTLAYIAEATFNTLEVKPRVSTGLLVFSNLIDASSAVPQ
FT                   LVADGFQTAELLDATSLKVAQRTGSVARSIREIDVKDHAALLVEFTGDSDDELHDRYST
FT                   ALPHLEAMPLAVPHEMTSDRKERNLLWATRNNLYAAVAGARPSGTNALLEDVVVPVQDL
FT                   GRACDDLTHLFRNHDYPGSVIFGHAKDGNVHFLLNEQFRDVKKLQRYQRFTEDMVDVIL
FT                   GYNGSLKAEHGTGRIMAPFIERQFGSELYQIMRRIKDAADPKRMLNPGVIITDDPHEYV
FT                   EHLKVADRIEKVADRCVECGYCEPVCPSRNLTLTPRQRIVVRREIAAAKNRGDTKLATE
FT                   LQERWQYDGQDTCAVDGMCLTRCPVGINTGDLIRQLRTESAGSVAQKGWKAAAHGWNLG
FT                   ARAGSLAMTAAHAVPSSLPTAATRVARKVVGDDTMPLYKSALPQGGPLRHDVSTDHADF
FT                   VFFPACVNEMFGGIDGDGKRAMNATKAFEAVARRAGLTWRTPKGIGGMCCGTPWKSKGM
FT                   LEGYEVMRKRVLSGLWEASEEGRLPIVCDAASCTEGIQVMRDTVKKAAACDPKWENVQV
FT                   MDAVEFCVRYLLPHVEANRQLDSLVLHPTCSLTHLGLIDEMCAIGRVVARDVTVPKHWG
FT                   CCAYAGDRGMLHPELTKSATRSEAHEVNERPYSAYASINRTCEQGMTEATGQNYQNLFQ
FT                   LLEWATRQEKAEATA"
FT   gene            481206..481748
FT                   /locus_tag="ckrop_0391"
FT   CDS_pept        481206..481748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0391"
FT                   /product="hypothetical protein"
FT                   /function="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17170"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH65"
FT                   /protein_id="ACR17170.1"
FT                   /translation="MSDLSTINGTYDIDASHSRLGFVVRHAMVTKVRGSFSDFTGEASG
FT                   DASDPSSIKVNVTAQADSFTTGNEDRDKHVKSGDFLDVESNPTLTFTSTSAEIKGNTLE
FT                   LTGDLTIKGTTQSVTIPFEFGGEAKDPFGNVRVGFEGGITISRKDFGLSWNAALETGGV
FT                   LISDAVALELEISAIKK"
FT   gene            481894..482790
FT                   /locus_tag="ckrop_0392"
FT   CDS_pept        481894..482790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0392"
FT                   /product="putative molecular chaperone"
FT                   /function="Putative intracellular protease/amidase"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17171"
FT                   /db_xref="GOA:C4LH66"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR017283"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH66"
FT                   /protein_id="ACR17171.1"
FT                   /translation="MATKVKEFVQRYATKTDENRKPTPDPAEDNAFFPSAYSLEQYTAE
FT                   TTDFSGLVTEDTYTGDRWKILVIATEERYMPMQNGTFFSTGNHPVETLLPLYHMHKAGF
FT                   GVDVATISGSPAKFEWWAFPSKDDAVNDAWDATKSAFKQPKKLSDVVAQGLDDYAAVFI
FT                   PGGHGAMNGVPSDSSVGEALRYFLNNDRLIITLCHGPAALLAAGNGSDENPFAGYSVVA
FT                   FPDALDFGANIEIGYLPGEMPWKLGEKLQEAGLTISNEDMSGATTRDRNLLTGDSPLAA
FT                   NALGKESALALLEKFNG"
FT   gene            482866..483801
FT                   /locus_tag="ckrop_0393"
FT   CDS_pept        482866..483801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0393"
FT                   /product="secreted lipase"
FT                   /function="Predicted acetyltransferases and hydrolases with
FT                   the alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17172"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH67"
FT                   /protein_id="ACR17172.1"
FT                   /translation="MIPMTAPRRTVFSLCVILTAAITLLLSSLPAHAGDAQPPAPAESP
FT                   STDGPLPVIYVSASNESRDSAESYASSLRKHGLDVHVFMTWEPDDPTTSPYVTVKGNSA
FT                   RLATFVDKLKEETGHEKFDVVTWSQGGFVTRYWLKDFGGADFVRKAVILSGMIKGSPHH
FT                   ADALRKGQCPPPNARLYVPQELLKSPSDTCLEMSSEGESIRALNTPSEALPGIKYYAIT
FT                   TKQEINAAPYEINLMDGPGDYTNIITQDLCPNDIVGHGGLTKLPSMQALVSNLLKDDNP
FT                   TMPCMAPDSPDGLPTLGEITPPLTSAPSLG"
FT   gene            complement(483840..484604)
FT                   /locus_tag="ckrop_0394"
FT   CDS_pept        complement(483840..484604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0394"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17173"
FT                   /db_xref="GOA:C4LH68"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR014878"
FT                   /db_xref="InterPro:IPR022939"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH68"
FT                   /protein_id="ACR17173.1"
FT                   /translation="MSYPSGTLGTMAENDKDSAQKFGVPGTGSAGQADHSPSDASAGEG
FT                   TPQEHKLDGNEAVNRAAEQAKTTASRNIPVFGDLPIPDDTANLRQGPSLHDGLLALLPL
FT                   VGVWRGEGQARNLSTGEEYPFGQQITFAHDGQNYLSYESRTWRLNKEGEASGPDERESG
FT                   FWRINDKDEIEFVCAHASGVVEIFYGQPTTERQWDVQSASTMVTASGPSTLGPGKRLYG
FT                   LMPNNHLGWVDERAVDNEMVPRMSAELTRHAG"
FT   gene            complement(484645..485583)
FT                   /locus_tag="ckrop_0395"
FT   CDS_pept        complement(484645..485583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0395"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17174"
FT                   /db_xref="GOA:C4LH69"
FT                   /db_xref="InterPro:IPR021373"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH69"
FT                   /protein_id="ACR17174.1"
FT                   /translation="MNSSMNSRETGKTVGVTHQPSSPAGSVPVVARSRRRRTVRKVGVI
FT                   AAIVLMFLAVCAWVGDSLVAARTESRISRELQHYSNLPVQPDVTAGGFPFLYEAESGKL
FT                   SSLTVDAQDLDVPGFGLVTVHSSATNIEASTHDILHGRIEDAPVETVSTTLSLDGLALG
FT                   ERLGITDLTIRRLANTAPNGGQESDSVFSGSIGGLDKPATVAVRLRIKADVISMDAYEV
FT                   LDGPANRDKDAPVVKGREIPEDIRDEIKKAFSLQLEGKYLPLRARPDFIYCEGGSIFLQ
FT                   ASQQNVTINLSDLAPMAREEPEEAKYENDKE"
FT   gene            485691..486368
FT                   /locus_tag="ckrop_0396"
FT   CDS_pept        485691..486368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0396"
FT                   /product="putative response regulator"
FT                   /function="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17175"
FT                   /db_xref="GOA:C4LH70"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH70"
FT                   /protein_id="ACR17175.1"
FT                   /translation="MRIALLTNATSVADVLPPLALLPHETVILPPDATSSRQLDDVELA
FT                   VIDVTGSDLLGARELCRTVAAAHPDMPVAVAIAETSLIALDSSWAVDEFLLASATPVEI
FT                   DARFRLLLTRRPVPVNEIDDSNVVTVGELVVDDATYTARIHGTPLDLTYKEFELLRFLV
FT                   QHSGRVFTRKQLLQEVWGYDFFGGTRTVDVHVRRLRAKLGTEYEGMIATVRNVGYKAID
FT                   VDA"
FT   gene            486516..487601
FT                   /locus_tag="ckrop_0397"
FT   CDS_pept        486516..487601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0397"
FT                   /product="MshD acetyltransferase"
FT                   /function="Acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17176"
FT                   /db_xref="GOA:C4LH71"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017813"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4LH71"
FT                   /protein_id="ACR17176.1"
FT                   /translation="MADAPTFNAQPCDIITQLVLGPVSPRVRNARQASADRWMEIETIL
FT                   HESTRHDGVAPFSEQFLRGMEEPDLNHWHALVRVDGHVRGIAAVDPSGPAVELAVHPSY
FT                   RRGGLATALQRAVRAHASSLGLGDERDIHTNGIGLTWWAHGDLPPARAAAEHIGATADR
FT                   ELLVMELPGSVVKDESDNNPVAQAAATLPDDVTVLSWTESARRWGKDAVDAAWLAVNNE
FT                   AFDWHPEQGGWDQARLDQARRASWYDPDGVLLLWGSEGDQKDGDTDSLPPLLGFHWTKL
FT                   AREGDDETGRKVGEVYVIGLARKAQGRGLGRASTAKGIQYLASNDAAYVELYVEADNAP
FT                   AVHAYEALGFTVVERHTAWKF"
FT   gene            487778..488893
FT                   /locus_tag="ckrop_0398"
FT   CDS_pept        487778..488893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0398"
FT                   /product="phosphate ABC transport system, solute-binding
FT                   protein"
FT                   /function="ABC-type phosphate transport system periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17177"
FT                   /db_xref="GOA:C4LH72"
FT                   /db_xref="InterPro:IPR005673"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH72"
FT                   /protein_id="ACR17177.1"
FT                   /translation="MNRKQVGRGTALATIAAVSALTLVGCNSDDNSADGGSSSSNGDSN
FT                   LSGTTGQLTAEGSSAQQKAMSVFSAKYSQAVPGAQFSYNSTGSGAGQKQFIAGQVNFGG
FT                   SDSPLDDSQMTEAKDKTCKSDVWQLPMVIGPVAVAYKLDGLDSVALSPEVIAKIFKGEI
FT                   KKWNDDAIKKLNDGVNLPDKDIKVIYRSDESGTSDNFQKFLKASAPGQWDSEGKAFPST
FT                   TGSGANGSSGVVQEVGATDGAITYVEAGFAKEAKLKEAAIDFGQGPVELNKDTVGNALD
FT                   KLTYKGEGNNMVVDTDALFGLKEKDSYPLFLTTYELVCSKYQDSSTGDRVRDFLTVAIN
FT                   DGQDSNLEDQGYIPVTGQLKDKLTSAIKEIK"
FT   gene            488976..490058
FT                   /locus_tag="ckrop_0399"
FT   CDS_pept        488976..490058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0399"
FT                   /product="phosphate ABC transport system, permease protein"
FT                   /function="ABC-type phosphate transport system permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17178"
FT                   /db_xref="GOA:C4LH73"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH73"
FT                   /protein_id="ACR17178.1"
FT                   /translation="MSAETLMTTPSSAGAATFQPAGSHLPSAADQPGLSSPSNGDIPPK
FT                   AQDGHNAPGKVRAGDRIFHGLATGSAMMITVIIAAIGAFLLWRAVPALRNNTENFFTYS
FT                   GDWNTATTSAMHFGIPNLFFVTVTVSLVALVLAMPVALGIAIFLAHYCPQRFVKPIAFV
FT                   VDLLAAVPSIVFGLWGAQVLGPKLGGFYEWIHSWAGQFILFKTFANSPAFATSRNLLTG
FT                   GIVLAIMILPVIAATAREVFVQTPQGHIESALALGATRWEVVRLTVLPFGFSGYISGAM
FT                   LGLGRALGETMALYLVISPSSEFRGSLFDGGTTFATAIANAAQEFNNNIQAGAYISAGL
FT                   VLFLLTFVVNAIARAIVAKR"
FT   gene            490122..491063
FT                   /locus_tag="ckrop_0400"
FT   CDS_pept        490122..491063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0400"
FT                   /product="phosphate ABC transport system, permease protein"
FT                   /function="ABC-type phosphate transport system permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17179"
FT                   /db_xref="GOA:C4LH74"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH74"
FT                   /protein_id="ACR17179.1"
FT                   /translation="MSHAVSSPALQPHISPHQRIETSTTFTAISTRRKVTNNMARVLVF
FT                   ATVIVAFIPLLWVLWELVSRGAAVTLSSTWWMKSQMGIIESQAGGGAYHAIMGTLIQAL
FT                   ITSALSIPIGVLTGTYLVEYAGQSRLGKVTTFMVDILTGVPSIVAALFIYSLWVVLFGF
FT                   ERSGMAVSLALVLLMVPVIIRNTEEMLRVVPQDLREAAYALGVPKWKTIARIVLPTAMS
FT                   GIITGIMLSVGRIMGESAPVLILVGYNVGTNFNPVEGPQTSLPLMMLAMYKAGTTGAAV
FT                   DKMWGAAFTLVVIIAVLTIAARLISRRFSVKS"
FT   gene            491131..491907
FT                   /locus_tag="ckrop_0401"
FT   CDS_pept        491131..491907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0401"
FT                   /product="phosphate ABC transport system, ATP-binding
FT                   protein"
FT                   /function="ABC-type phosphate transport system ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17180"
FT                   /db_xref="GOA:C4LH75"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH75"
FT                   /protein_id="ACR17180.1"
FT                   /translation="MAKRLDLEDVNIYYGDFHAVQDVTMHVPPRSVTAFIGPSGCGKST
FT                   VLRTINRMHEVTPGAYVTGSIKLDGEDIYDAKVDPVAVRNTIGMVFQKANPFPTMSIED
FT                   NVVAGLKLSGVKNKARLKEVAERSLRSANLWDEVKDRLDKPGGGLSGGQQQRLCIARAI
FT                   AVEPEVLLMDEPCSALDPISTLAVEDLIHELKKEFTIVIVTHNMQQAARVSDQTAFFSL
FT                   ESTGKPGRLVETGPTQEIFERPKRKETEDYISGRFG"
FT   gene            492251..492967
FT                   /gene="deoD"
FT                   /locus_tag="ckrop_0402"
FT   CDS_pept        492251..492967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoD"
FT                   /locus_tag="ckrop_0402"
FT                   /product="purine nucleoside phosphorylase"
FT                   /function="Purine-nucleoside phosphorylase"
FT                   /EC_number="2.4.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17181"
FT                   /db_xref="GOA:C4LH76"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR004402"
FT                   /db_xref="InterPro:IPR018016"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH76"
FT                   /protein_id="ACR17181.1"
FT                   /translation="MGRQSTPHINPNGVPIAETILLPGDPLRAKFIAETYLDDAVQFNS
FT                   VRNAFGYTGTYQGKEVSVMGSGMGIPSISLYAWELIHDFGVKKLVRVGSCGSLQKDLNL
FT                   YDVVIGQAACTDSNFLSQYNLPGVYAPIASYRLIEDVRTRAKEAGITTHVGNVLSSDVF
FT                   YNYQDDVNQRWAAMGVLAVEMESAGLYATAAEAGVEALGIFTVSDNIVTGEATTASERE
FT                   KAFTTMMELALPLAAI"
FT   gene            492978..494411
FT                   /locus_tag="ckrop_0403"
FT   CDS_pept        492978..494411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0403"
FT                   /product="permease of the major facilitator superfamily"
FT                   /function="Permeases of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17182"
FT                   /db_xref="GOA:C4LH77"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH77"
FT                   /protein_id="ACR17182.1"
FT                   /translation="MAHTETATLAPEKAGKKVLNPKAAVPVILFTFVFSLVIDNGFKFM
FT                   SKPIADDLHLSATTVSLQATLAGIVIGIGAVVYAALADTFSIKKLLYVGIGLTVIGSII
FT                   GFVFQHSWPMVLTGRIIQTTGLAGAETLYVIYVTKHISAKDQKTYLGFSTAAFQLAMLI
FT                   GVLTSGFVSTYISWTAMFLVSAALILAVPFIAKTVPDDEKVSANLDVIGLFLIGVFATF
FT                   AVIFMQEFQPIYAVFSVIGVVLFAVYIKINNKALVRPEFFLNGRYVWALVVVLILYSVQ
FT                   LGYIFFFPFIVSTLHGLGTDTASMLIAPGYACATAVGAASGAIAKVLKTRPAIIIALSS
FT                   ICGALVIPAIIPDTSLWLLILSMMFFGSGFALMYAPLMASAIKKIPAEKTGVAIGFYNL
FT                   TINIAIPVGIAYTAKLIDIEPTFLSGLTQGSGHTAHAYATVLWILAGITAVAFVVYVAS
FT                   DRYLTRREKRRGETLDGAS"
FT   gene            complement(494408..495142)
FT                   /gene="phoU"
FT                   /locus_tag="ckrop_0404"
FT   CDS_pept        complement(494408..495142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoU"
FT                   /locus_tag="ckrop_0404"
FT                   /product="putative transcriptional regulator, PhoU family"
FT                   /function="Phosphate uptake regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17183"
FT                   /db_xref="GOA:C4LH78"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH78"
FT                   /protein_id="ACR17183.1"
FT                   /translation="MRDDYREHLAEFAHNLIVMCDSIKEMASHASRALLSADLTSAEDV
FT                   LTSVEDVEELRVKCEQQAFQLLALESPVARDLRRVISGTYIVEDLSRMSALMVHIAKVA
FT                   RRRHPDCAVPESMVPYFSEMAKQCLDITATLHDVLVSYDPELALQLARDDDAIDDLHHH
FT                   IFVLTTQREWPYTTTNAVDVTLLSRYYERYSDHAVQIGARVIYLATGMRPEEYVGGKDE
FT                   RDREATFIRHFDEIQQRYGGTF"
FT   gene            complement(495218..496303)
FT                   /locus_tag="ckrop_0405"
FT   CDS_pept        complement(495218..496303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0405"
FT                   /product="hypothetical protein"
FT                   /function="tRNA-dihydrouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17184"
FT                   /db_xref="GOA:C4LH79"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH79"
FT                   /protein_id="ACR17184.1"
FT                   /translation="MAFRLLCRELEIEKTGTTSGLYVCEMVTARALVERNEKTLHMTEF
FT                   APEETPRSMQLYTTDPKWTYEAARMIADDNLADHIDMNFGCPVPKVTRRGGGAALPYKR
FT                   RLFGEIVAAAVRGVEGTTIPVTVKMRTGIDDDHLTFLDAGAIAAAEGAQAVALHARTAA
FT                   QRYSGTADWNRIGELKEHLSGTGVPVLGNGDIFKATDAADMMDQTGCDGVVVGRGCLGR
FT                   PWLFAELSAALRGEPLPAQPTFAEVCDVILRHTRLLAAHSGESTACRDMRKHMGWYLRG
FT                   YPAGSDLRQKVTRITSINELKEILNTVVSDPALASALPDDADGPRGRQGSAKAVTLPEG
FT                   WLDDPDDRTVPAGADIMHSGG"
FT   gene            496645..498159
FT                   /gene="cat1"
FT                   /locus_tag="ckrop_0406"
FT   CDS_pept        496645..498159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cat1"
FT                   /locus_tag="ckrop_0406"
FT                   /product="succinyl-CoA:Coenzyme A transferase"
FT                   /function="Acetyl-CoA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17185"
FT                   /db_xref="GOA:C4LH80"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="InterPro:IPR017821"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR038460"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH80"
FT                   /protein_id="ACR17185.1"
FT                   /translation="MSGRIANPKLQGLIMSADEAAAKINPGDQIGFSGFTGAGYPKEFP
FT                   QALARRIKEAHDRGEEFKVNVMTGASTAPELDGALAEVNGINWRMPYQSDPTLRKRINA
FT                   GDTYYSDIHLSHSGMLLDQGFFGATDVAVVEAVRIKEDGAIIPSSSVGNSTNYLRNANK
FT                   IIIEVNSWQSEDLEGMHDIWSYGQLPNRQPIPIADPGDRIGTPYIDIDVDKVIAVIETD
FT                   AADRNSPFKPIDDDSKKIANYLLDFLDGEIKAGRLTKELLPMQSGVGNIPNAVLAGLLE
FT                   GPYHHITSYTEVIQDGMIDLMDQGTMTVASATAFSLSPEYAHRVNENAAEYAKKIVLRP
FT                   QEISNHPEVIRRLGVIACNGMIEADIYGNVNSTHVTGSKMMNGIGGSGDFTRNAFVSCF
FT                   VSPSRAKGGDISAIVPMVSHVDHNEHDVDVIITEQGLADLRGLAPRQRSRKIIENCAYP
FT                   DYREPLLEYVERAEKNASGLHTPHDLHEAFNFHTRFMETGSMMPEK"
FT   gene            498317..498392
FT                   /locus_tag="ckrop_t0010"
FT   tRNA            498317..498392
FT                   /locus_tag="ckrop_t0010"
FT                   /product="tRNA-Lys"
FT                   /anticodon="(pos:498350..498352,aa:Lys,seq:ttt)"
FT   gene            complement(498434..499501)
FT                   /locus_tag="ckrop_0407"
FT   CDS_pept        complement(498434..499501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0407"
FT                   /product="ABC-type transport system, substrate-binding
FT                   protein"
FT                   /function="Periplasmic glycine betaine/choline-binding
FT                   (lipo)protein of an ABC-type transport system
FT                   (osmoprotectant binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17186"
FT                   /db_xref="GOA:C4LH81"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH81"
FT                   /protein_id="ACR17186.1"
FT                   /translation="MTINWLDYVHTASRRTPLPASNTFLSGIRPKPRSQSRSRSFTIIA
FT                   AIITSCLLILTLSSCARSNPLSSGSADSDTIVIGSQDYYSNEIIAEIYAQALEKNHIKV
FT                   DRQFRIGQREVYIPEIEHQSIDLIPEYSGNLLQYFEKESSHGDNDNATAAKDPDDVYRD
FT                   LVHATPQGLHLLNYSPASDQDTYTVTHDFARRYHLHSVGDLARVPGSVKYGGPSEAESR
FT                   PYGPTGLKAVYSVDVDFTPIEDSGGPLTVKALTDGKIQVANIFSADPAIKKNNLTVLDD
FT                   PQHLLLPSNVVPLASKKLNNFKDGKAEDIINSISKKMTTEDLAELNNESVTDQKRAARI
FT                   AKEWLAHNDISVQKG"
FT   gene            complement(499608..500270)
FT                   /locus_tag="ckrop_0408"
FT   CDS_pept        complement(499608..500270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0408"
FT                   /product="ABC-type transport system, permease protein"
FT                   /function="ABC-type proline/glycine betaine transport
FT                   system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17187"
FT                   /db_xref="GOA:C4LH82"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH82"
FT                   /protein_id="ACR17187.1"
FT                   /translation="MNYFIDALSWAFSADHWSGNGSITQRLVEHLWFTVMIVAISSVLA
FT                   IPTGIVIGHIRRGAGLIGALTGAARAIPTLGLLTLFGLWLGIGLKAPTLALIVLAIPSL
FT                   LAGAYSGVESISPDIPSAAQAIGMTPWQVITSVELPLALPVIMGGIRAATLQVIATATL
FT                   AAYTADIGLGRFLFAGLKSRDYSEMLGSSLIVIALAVVIDAALGRAQRWAGNRFGDH"
FT   gene            complement(500267..500917)
FT                   /locus_tag="ckrop_0409"
FT   CDS_pept        complement(500267..500917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0409"
FT                   /product="ABC-type transport system, permease protein"
FT                   /function="ABC-type proline/glycine betaine transport
FT                   systems, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17188"
FT                   /db_xref="GOA:C4LH83"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH83"
FT                   /protein_id="ACR17188.1"
FT                   /translation="MNWVITNWEDIAELTGQHLRLALPPILFSLLIAIPIGRYAFSHPL
FT                   FGRPLLNAASLMYAVPSLPLIITIPIIIGTPLRSNLTMITALTVYGVALLVRTAADAFA
FT                   SVDAHTRDAALALGHSPRTILWKVDLPLAIPVIASGLRVVASSTIGLVTIGALVGIPSL
FT                   GSLLTDGFQRGITAEVTAGIVATIIVALVIDAIIQGLTWLLTPWSHASGGASS"
FT   gene            complement(500914..501726)
FT                   /locus_tag="ckrop_0410"
FT   CDS_pept        complement(500914..501726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0410"
FT                   /product="ABC-type transport system, ATP-binding protein"
FT                   /function="ABC-type sugar transport systems, ATPase
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17189"
FT                   /db_xref="GOA:C4LH84"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH84"
FT                   /protein_id="ACR17189.1"
FT                   /translation="MITFDHVSKTYPDGSTAVHDFSLVIPSHHIVSLVGTSGSGKTTLI
FT                   RMVNRMTEPTSGQVCIDDHNVMDESAVDLRRRIGYVIQSGGLMPHKTVEANIAVVPTLL
FT                   GTPRREARKNARKIMERVGLDPALAKRYPHQLSGGQQQRVGVARALASNPNILLMDEPF
FT                   GAVDPIVRRELQDELLRLQQELGKTILFVTHDIDEAFRLSDSVVILEKGGVISQHGSPS
FT                   EIMTNPKNDFVASFTGASNTNRKLTTRTVNGQAVAVDSYGRSVGVLTS"
FT   gene            501932..502004
FT                   /locus_tag="ckrop_t0011"
FT   tRNA            501932..502004
FT                   /locus_tag="ckrop_t0011"
FT                   /product="tRNA-Glu"
FT                   /anticodon="(pos:501966..501968,aa:Glu,seq:ttc)"
FT   gene            complement(502215..502640)
FT                   /locus_tag="ckrop_0411"
FT   CDS_pept        complement(502215..502640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0411"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17190"
FT                   /db_xref="GOA:C4LH85"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH85"
FT                   /protein_id="ACR17190.1"
FT                   /translation="MFDYIPEKHDLDSRYVNFKEVKRTKSRAYKFAVWSSCLGGHNFFL
FT                   GQWLVGTLHFLFTAALAPIYVFMDWQTLLATIIIDVMWCYYGIKKIAVSDEDDPIYSGH
FT                   TPKWFFPLMVIHMNTIIWDIDFWARKRKKAEKESSSK"
FT   gene            complement(503098..504180)
FT                   /gene="glpQ"
FT                   /locus_tag="ckrop_0412"
FT   CDS_pept        complement(503098..504180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpQ"
FT                   /locus_tag="ckrop_0412"
FT                   /product="Glycerophosphoryl diester phosphodiesterase"
FT                   /EC_number="3.1.4.46"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17191"
FT                   /db_xref="GOA:C4LH86"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH86"
FT                   /protein_id="ACR17191.1"
FT                   /translation="MRTPRARIYTAALLLTTVGSLAACSTSDNDNDTSSATSASDSTTQ
FT                   SAEKTSGNHVDLASFDLQAHRGGRGENTEESKQAFETAIDEGVNTLEMDIVLTKDGVPA
FT                   VWHDPKIEDEKCSDTHPATPDDPQFPYVGKNVHDLTWDQISTLKCDKKLADFPDQKVAP
FT                   DNHILKLNDVFDLVKEKGADVRYNIETKIEADKREVSATPEEFVSTIMGVVDEYGVRGK
FT                   VTIQSFDWRSLKLLKEHQPDVTLAALYDETTWKKDSPWLADYTYEKYDGDALKAIQALG
FT                   AQITSPGYAQPYDTKVGDKDFHPVADRDYVEKAHGMNIKVLPWTVNDKETIKYFIDNAG
FT                   VDGLITDYPKRGMEVLKELP"
FT   gene            complement(504180..505655)
FT                   /gene="glpT"
FT                   /locus_tag="ckrop_0413"
FT   CDS_pept        complement(504180..505655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpT"
FT                   /locus_tag="ckrop_0413"
FT                   /product="glycerol-3-phosphate transporter"
FT                   /function="Sugar phosphate permease"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17192"
FT                   /db_xref="GOA:C4LH87"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR005267"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR021159"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH87"
FT                   /protein_id="ACR17192.1"
FT                   /translation="MSQEKTARQLSFRALPPQPLLPADEIAHKYPRLRLQVFMGIFIGY
FT                   AGFYLVRNNISPVAALIKNDGILDTVAIGIIANAVYISYGLSKFMMATLSDRANARLFM
FT                   PLGLALSGITNILLGTIPALHATVAIFTLVMFINGWFQGMGWPPSGRALVHWFSTTERG
FT                   WKTAIWNCAHNVGGAGVGISIAWALSITGNQWQSAFWLPGIISLIVALIAFLLIRDTPE
FT                   SEGLPPIEEYRNDPAKTEAIDDSEIANQSTFTIIWRHILTNRVMVLLALANIFIYVLRY
FT                   GILSWTPVYLHDIHGASLNGSIAGFSTFEIAGIIGTLICGWVTDKIFRGYRTSTGILFL
FT                   GAVALCTLAYWLVPHNSPLWIPLLLVSLIGGLIYGPVMLIGLQAIDLAPRNIAGTAAGF
FT                   TGLMGYVVGATLASTGIGFIIKHWGWNVTFIFLLVCAFIAIALIAGVGKDEKLLMEHHS
FT                   KANATPADATDTTDTTEATANSTNAQKNDEGAK"
FT   gene            505977..506050
FT                   /locus_tag="ckrop_t0012"
FT   tRNA            505977..506050
FT                   /locus_tag="ckrop_t0012"
FT                   /product="tRNA-Asp"
FT                   /anticodon="(pos:506011..506013,aa:Asp,seq:gtc)"
FT   gene            506384..507607
FT                   /locus_tag="ckrop_0414"
FT   CDS_pept        506384..507607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0414"
FT                   /product="ABC-type transport system, substrate-binding
FT                   protein"
FT                   /function="ABC-type Fe3+-hydroxamate transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17193"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH88"
FT                   /protein_id="ACR17193.1"
FT                   /translation="MRGFSLFSHSGSDHSWRTPTLASQSPSNRRMTRKRRLSVAILASV
FT                   TMLGVAGCQSGNESSNDAEKSASDSASSKGDQSGDYPVTLKNCGRDLEIKQKPERVVAL
FT                   NQGVTEELLSMGFGDRVVGTATWTDPILDNLKAQNDKIKRLSDNNASMETVLDQNPDFV
FT                   AATFAQTLADSGSGSYESYKKVGVPAYLDHTECTKSDKPGDNGDGGRKEKLRMSDIYTD
FT                   IHDLAEIMGDKAAGDELQKKLEDRIANLSSSSKDIPSGTSVAFWFANSESPYMAGGKGA
FT                   PQIIADQLGLKNVFEDNSEEWPQIGWEAIAAKDPDYLVVGDLTRKQQTAETAKEKIKFL
FT                   KNNPVAKNMKAVKNDHLIVVAGGDLNPGIRTVDGMEKVAHALADGNKNDGQGSSEDNSP
FT                   SEQGNREE"
FT   gene            507604..508641
FT                   /locus_tag="ckrop_0415"
FT   CDS_pept        507604..508641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0415"
FT                   /product="ABC-type transport system, permease protein"
FT                   /function="ABC-type Fe3+-siderophore transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17194"
FT                   /db_xref="GOA:C4LH89"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH89"
FT                   /protein_id="ACR17194.1"
FT                   /translation="MTSTVKLWILVSASLVALFVSILFSITLGPLSVSMTDAWRVVAFK
FT                   LGLSSTPEGVTLLEQNAIWELRMPRALLAAVAGAALSICGAVLQSLLRNGLADPYLLGI
FT                   SSGASAGAVVVVLTASTAASFVMAPGAFAGALAAFSLVLLLAWAAGNGNHNIILAGVAI
FT                   TQLFSALTSFLIMFSADANTTRGVLFWMLGSLASSSWQTVALSTAIFAVSFVVLFCHST
FT                   ALDAFTFGADSAASLGINVKRVRMVVIGVASLLAATIVSSSGAIGFVGLVLPHAARLIV
FT                   GTGHRRVLPVSAALGAILLVWVDALGRTVAAPVEIPVGVITALVGVPLFIALLVKQGRG
FT                   SRTHV"
FT   gene            508634..509446
FT                   /locus_tag="ckrop_0416"
FT   CDS_pept        508634..509446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0416"
FT                   /product="ABC-type transport system, ATP-binding protein"
FT                   /function="ABC-type sugar transport systems, ATPase
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17195"
FT                   /db_xref="GOA:C4LH90"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH90"
FT                   /protein_id="ACR17195.1"
FT                   /translation="MSNNHDAVTQRAANTDRSVSFVVSDVCSRVPPVNNVSFEARSGDT
FT                   VGIVGRNGSGKTTLLRAIAGLAPHSGHVTIDGEDWDTIPRKIRARRMAFVAQHNVASAD
FT                   VTVRDVIALGRTPYLGVLGMRQSDRDMVVASAREVGVHDLLDRRFVHLSGGEQQRVHLA
FT                   RALATQPDVILLDEPTNHLDISAQLQLMGYVSSSILVTVVVLHDLNLAAKFCDYVIVLD
FT                   GGDPVAAGPPRDVFTEDVIERHFDVESRVWETPDGINLEFHSATTNAG"
FT   gene            509605..509677
FT                   /locus_tag="ckrop_t0013"
FT   tRNA            509605..509677
FT                   /locus_tag="ckrop_t0013"
FT                   /product="tRNA-Phe"
FT                   /anticodon="(pos:509638..509640,aa:Phe,seq:gaa)"
FT   gene            510767..511069
FT                   /locus_tag="ckrop_0417"
FT   CDS_pept        510767..511069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0417"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17196"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR031165"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH91"
FT                   /protein_id="ACR17196.1"
FT                   /translation="MSDNDVNAHVKHEVDRHRFIIEVDGEVAGFAEYAPTAAGDVRDFN
FT                   HTVVHPEFRGQGLSSKLIKSALDETREAGMHIIPTCSAVAHFVSKNHDYADLVVD"
FT   gene            complement(511112..511783)
FT                   /locus_tag="ckrop_0418"
FT   CDS_pept        complement(511112..511783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0418"
FT                   /product="Serine acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17197"
FT                   /db_xref="GOA:C4LH92"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH92"
FT                   /protein_id="ACR17197.1"
FT                   /translation="MDTLHPPVLFITGTLLGMLGSIITTLKEDLRNAREHDPAARGDAE
FT                   NALVYSGLHAIWAYRVAHCWWERGWKGPARVLSQFTRFMTGIEIHPGATIGRRFFIDHG
FT                   MGVVIGETAEIGDGVMLYHGVTLGGQVLTQTKRHPTVGDNVTIGAGAKVLGPITIGDNT
FT                   SIGANAVVTKDIPANCIAVGIPATCRRRKECECTKLVDPDKYVTSAHNPLKGGSKKSDA
FT                   S"
FT   gene            complement(511824..512762)
FT                   /locus_tag="ckrop_0419"
FT   CDS_pept        complement(511824..512762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0419"
FT                   /product="Cysteine synthase"
FT                   /EC_number="2.5.1.47"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17198"
FT                   /db_xref="GOA:C4LH93"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH93"
FT                   /protein_id="ACR17198.1"
FT                   /translation="MSNVYDNVSELVGNTPLVRLNSLTKDLDAEVLVKLEYYNPANSVK
FT                   DRIGAAIIDAAEADGSLKPGGTIIEATSGNTGIALAMVGAARGYKVVLTMPESMSKERR
FT                   ALLRALGAELVLTPPPSGMQGAVDKAQELADSTENSILASQFTNPANPKKHYDTTGPEI
FT                   WNDTDGNVDVFVAGVGTGGTITGVGKYLKEQKSDVKVVGVEPSDSPLLSEGRAGSHKIQ
FT                   GIGTNFYPETLDRDILDNVLTVSFEDAVSTAQAAAAKEGILGGISSGGNIWAALQEAKK
FT                   PENKGKTIVTVVCDFGERYISTPLFEGLRDD"
FT   gene            513156..514031
FT                   /gene="echA1"
FT                   /locus_tag="ckrop_0420"
FT   CDS_pept        513156..514031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="echA1"
FT                   /locus_tag="ckrop_0420"
FT                   /product="enoyl-CoA hydratase"
FT                   /function="Enoyl-CoA hydratase/carnithine racemase"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17199"
FT                   /db_xref="GOA:C4LH94"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH94"
FT                   /protein_id="ACR17199.1"
FT                   /translation="MASNASNNAEDPSTMSEKNNENKASESTVQPDSAEYETVLVSQDD
FT                   RVATVTLNRPRALNALNAALVRDLVDAVESLDTDPSVGVIVITGSEKAFAAGADIKEMK
FT                   DRTFPEIRERRMFGELDRLREVDTPIITAVSGYALGGGCELAMTGDIVLASETTSFGQP
FT                   EITLGIIPGLGGTQRLTRAIGKAKAMDLVLTGRPMRADEAERCGLVSRVFPADSFTEDV
FT                   YEVAKTVAGFSATALRAATNAVDRAFETTLSEGLRAERESFYSLFATADQKEGMSAFAE
FT                   KRPAKWQHNQ"
FT   gene            514102..514662
FT                   /locus_tag="ckrop_0421"
FT   CDS_pept        514102..514662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0421"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17200"
FT                   /db_xref="InterPro:IPR019639"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH95"
FT                   /protein_id="ACR17200.1"
FT                   /translation="MSASKTEQRDFAQPIDRVYEICCSEEFLLRSGGTSERPVTIVDSR
FT                   YEHRDDGSVFSEATAEQVMQPPEDAGEDAKPKTLRMTQSSTVFPLENGSFRIESEASLP
FT                   GNTGRMSITFRYSASSGGVEQGETNQVGEKPLGCHVEAKATAKSRIPVVGRKLEKSVVS
FT                   SLGSSLDRTIERINNLATQTRGQ"
FT   gene            515229..516068
FT                   /gene="ramA"
FT                   /locus_tag="ckrop_0422"
FT   CDS_pept        515229..516068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ramA"
FT                   /locus_tag="ckrop_0422"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /function="DNA-binding HTH domain-containing proteins"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17201"
FT                   /db_xref="GOA:C4LH96"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH96"
FT                   /protein_id="ACR17201.1"
FT                   /translation="MDALRYKDDGEAVRRALASLKNATGIPVTMYGAIETDNSLKINAW
FT                   VGLRTPALHNLSIDAGSGVGGRVVTTRRPVGVSDYTRAKVISHEHDRAIQDEGLHSVVA
FT                   VPIIVSRDLRGVLYAGVHSPVRLGDKVLEEVTMTARTLEQDLAVGDAFRRTDPTRGGGK
FT                   SGRLMNGAEWEQVRSTHSKLRMLANRVESDDLRQELEQLCDQMVQPVRVKQTTKLSARE
FT                   LDVLACVALGHTNVEAAEEMGIGAETVKSYLRSVMRKLGAHTRYEAVNAARRIGALP"
FT   gene            complement(516115..516714)
FT                   /locus_tag="ckrop_0423"
FT   CDS_pept        complement(516115..516714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0423"
FT                   /product="hypothetical protein"
FT                   /function="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17202"
FT                   /db_xref="GOA:C4LH97"
FT                   /db_xref="InterPro:IPR016030"
FT                   /db_xref="InterPro:IPR029499"
FT                   /db_xref="InterPro:IPR036451"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH97"
FT                   /protein_id="ACR17202.1"
FT                   /translation="MSVHLTRIYTRTGDDGTTGLSDFSRVSKNDPRLVAYSTCDEANTI
FT                   IGMALAVENSAEKPQLPDAAQSALAIIQNELFDAGADLSTPVVENPKYPPLRIEQRYID
FT                   RLEKWCDEFNENLPKLDSFILPGGTMTSAFLQNARAVVRRAERAAWAAVEAYPDTTSKL
FT                   PAKYLNRLSDLLFILSRVANDGNDVKWVGGGTRDSL"
FT   gene            516902..518179
FT                   /locus_tag="ckrop_0425"
FT   CDS_pept        516902..518179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0425"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /function="UDP-N-acetylglucosamine enolpyruvyl transferase"
FT                   /EC_number="2.5.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17203"
FT                   /db_xref="GOA:C4LH98"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH98"
FT                   /protein_id="ACR17203.1"
FT                   /translation="MKSRNDSFKVTGGARLQGQVRVAGAKNSVLKLMGAALLAEGTTVL
FT                   TNCPEIADVPYMADVLRGLGCRVVLDGPTVYITVPEHVTSDADFDAVRKFRASVCVLGP
FT                   LTARSHRAVVALPGGDAIGSRPLDMHQSGLEKLGATTKIEHGCVVSEAESLHGASIKLD
FT                   FPSVGATENILTAAVLAEGTTVLDNAAREPEIVDLCTMLSEMGAKISGAGSNTITVEGV
FT                   PRLDPVRHEVIGDRIVAGTWAYAAAITQGDITVGGIDPSFLHLVLEKVKGAGAEVETYA
FT                   TGFRVVQNHRPKAVDYQTLPFPGFPTDLQPMAIALCSVSEGTSVITENVFESRFRFVDE
FT                   MTRLGADAYIDGHHVMIRGVEQLSSAPVWSSDIRAGAGLVLAGLCADGMTEVNDVYHID
FT                   RGYPDFVETLTELGATIERAHHDSAE"
FT   gene            518330..518446
FT                   /locus_tag="ckrop_0426"
FT   CDS_pept        518330..518446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0426"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17204"
FT                   /db_xref="GOA:C4LH99"
FT                   /db_xref="UniProtKB/TrEMBL:C4LH99"
FT                   /protein_id="ACR17204.1"
FT                   /translation="MRSLLLFSVGVFCGVVLGVCGVWVGCVVFFVVAETAAG"
FT   gene            518883..520383
FT                   /locus_tag="ckrop_r04"
FT   rRNA            518883..520383
FT                   /locus_tag="ckrop_r04"
FT                   /product="16S ribosomal RNA"
FT   gene            520797..523891
FT                   /locus_tag="ckrop_r05"
FT   rRNA            520797..523891
FT                   /locus_tag="ckrop_r05"
FT                   /product="23S ribosomal RNA"
FT   gene            523975..524094
FT                   /locus_tag="ckrop_r06"
FT   rRNA            523975..524094
FT                   /locus_tag="ckrop_r06"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(524276..525547)
FT                   /locus_tag="ckrop_0427"
FT   CDS_pept        complement(524276..525547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0427"
FT                   /product="putative aminotransferase"
FT                   /function="Aspartate/tyrosine/aromatic aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17205"
FT                   /db_xref="GOA:C4LHA0"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHA0"
FT                   /protein_id="ACR17205.1"
FT                   /translation="MTSPVCGVIRAGVYNGSMTEQSGSLLTSPIVSRLRDIPETIFSRI
FT                   TRLAVENNAINLGQGFPDSDGPRRMLEIASEQILSGNNQYAPGRGIPELRKAISANREQ
FT                   SYGQVFDPDTEVAVTVGATEGIAASILALVEPGSEVVLIEPYYDAYAAAVRLAGGNHVA
FT                   VPLLPTTDEDGTPRWALDVEALRRTVSDETRMIVVNTPHNPTGHVFTTDETLAISEVAE
FT                   AHDCLVLSDEVYEHLVFSGARHVPVASVGSLRERTVTVSSTAKSFNATGWKTEWVMGPA
FT                   PLVDAAITAKQYMSFVGATPFQPAVAYALREEADWVEGLSQRLESNYKKIAKVCGDIGM
FT                   TVYPSDGSYFVVTDISTCEATKNMTADDFCLALPKDAGVAAIPVTAFVDDEEQYRTLVR
FT                   WAFCKKANVIDGAVDKLTAWAKAK"
FT   gene            525758..526786
FT                   /locus_tag="ckrop_0428"
FT   CDS_pept        525758..526786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0428"
FT                   /product="hypothetical protein"
FT                   /function="Esterase/lipase"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17206"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHA1"
FT                   /protein_id="ACR17206.1"
FT                   /translation="MGRSDDVLAGNPILTPEQQLDQIASFISVHYKEVWDIISSPGDFS
FT                   AEREQQAPGEQRQLQEDAEQTVGRLNDIVTHTSQLVLGVGLDHSIPGVAFTSNGPDMHT
FT                   VDGNTAVFVPSTPTGRIAVSLHGGPGWHGSGQELEIFWRPTIAAIAELSGTTIIDVDYQ
FT                   LPLIRRRLSSDAQGNAVYSDHAEGTEGIIRDALAAVDAAEGVLSTIPSDTRESDSTTIT
FT                   HDEARGYDIVAFGSGTSAGLELAAKWNSERIVLQHPRLFQPSPENETWRNHDFSQTQVL
FT                   VQKATRDTIAVDPEAIAHNLQELGATTTVTEHLGYHVLATPAVQRECAQEAANFLQDGS
FT                   VR"
FT   gene            complement(526877..527518)
FT                   /locus_tag="ckrop_0429"
FT   CDS_pept        complement(526877..527518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0429"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17207"
FT                   /db_xref="GOA:C4LHA2"
FT                   /db_xref="InterPro:IPR021632"
FT                   /db_xref="InterPro:IPR023124"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHA2"
FT                   /protein_id="ACR17207.1"
FT                   /translation="MSTFQFTVDEAFNRQHNEFVRDSRRLQVSAGVLGGILVVAAVLIF
FT                   IFAGHDGAFVLFAIVLGLFGLFSLVMVQVIPRMVGSGQSLYDRYELAPAMVARVNPHDV
FT                   EIMALVNTSVNADDEPRWALSARTVARIPGTVREVGERIPSVAVTATRSVQHKDRWDEI
FT                   NPMPIGWATKNQNVVRDAEAAIAPQQWKMLADNLDRIDDVMGAKRNLLPL"
FT   gene            complement(527523..529199)
FT                   /locus_tag="ckrop_0430"
FT   CDS_pept        complement(527523..529199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0430"
FT                   /product="putative helicase"
FT                   /function="DNA or RNA helicases of superfamily II"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17208"
FT                   /db_xref="GOA:C4LHA3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032438"
FT                   /db_xref="InterPro:IPR032830"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHA3"
FT                   /protein_id="ACR17208.1"
FT                   /translation="MAQGTNAFDGPLIVQSDKTVLLEIDHPKAEEARAALAPFAELERA
FT                   PEHIHTYRITPLALWNARAAGHDAEQVVDVLENYSRFPVPQPLLVDIADTMGRYGRLTL
FT                   HKDPIHGLVLHATDKAVLSEVIRHKKIKPMLGSAIADDAWTVHPSERGRLKQELLKVGW
FT                   PADDQAGYVDGEAHAISLSTENVDWQLRDYQKLAADSFWDGGSGVVVLPCGAGKTMVGA
FT                   AAMAKSKTTTLILVTNTVSGRQWRDELIRRTTLTEDEIGEYSGEKKEIRPVTIATYQVV
FT                   TRKTRGEYRALELFDSRDWGLIIYDEVHLLPAPVFRLTSDLQSRRRLGLTATLVREDGR
FT                   EGDVFSLIGPKRYDAPWKDIEAQGWIAPAECIEVRSMMTESERMVYATAEKSDKYRLSA
FT                   CSGTKIRVARKIMAQHPNEPTLIIGAYIDQLEELSEKLNAPLIDGKTRNKKREELFEQF
FT                   RSGEISTLVVSKVANFSIDLPEASLAIQVSGTFGSRQEEAQRLGRLMRPKRDGGSAHFY
FT                   TVVSRDTIDAEYAAHRQRFLAEQGYAYRIVNSADLPDLEDD"
FT   gene            complement(529280..531988)
FT                   /locus_tag="ckrop_0431"
FT   CDS_pept        complement(529280..531988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0431"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17209"
FT                   /db_xref="InterPro:IPR032830"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHA4"
FT                   /protein_id="ACR17209.1"
FT                   /translation="MSSPGSVPDRLSEWLAQISDDQLSLILRERLENLFPMPVGSGQLA
FT                   ARLTSPFTVTQTVEALDMLSSACLRVMADLTDHGRNNGPLTVSDLYDRLTSSLAEVGVD
FT                   ESSMPTEHHVLSALEYLSEHGLVWGLPFPDTADHATVESQFRVVSDAVRSPTSQIAFIE
FT                   PPLPIGEDWTALLDTVTPQERRVLQRLHGAGGRGVHSPAKNSDPSAPVPHLISLGLLEV
FT                   YDTAQSTGRPSSAHKGRTPSGANSSTQQPPADVYVRLPLRVHNYLAGRHDNFVPTSLQP
FT                   PEGFHFPPSPIPMKQTPDDIIDTVSPARAQLSSAAAAEVSLTLFHMRELLRFAARTPFK
FT                   ALRNSEIGVRELRRAEKELSDIGLTRTRLITLLELARGLGFLDWGDPESLYDEADYGWW
FT                   GPTRLAEEWIHADAGTQWALLAMGWFGSLAQTWVVGKDEDGKNINVFDEETVSPGALVL
FT                   RRHLLSAARGFDPSATGKTEDVYSAYGYMYPQHVVYMDPRAVPNMVTNAEAFGLISGRA
FT                   TTGVTDILLPLFRDIPPDRETHSTPMADYVLRLSRTYASQPTSQPTSVGSDSAGNNKDT
FT                   GSSQPDSANSSTADLSLYDAYVVALIRHCQASFPAPSSTLIAQGDMTVLAPSPLDDTTT
FT                   SMMDRIADVESPGLATLYRVSEDSLRRGMASGLTPEDISSFLSLRVLNGVPQGLTFLID
FT                   DVGRFYGSVRGGEASCYLRIDDPQVVDDVLASPAASSAGLRKIAPTVLVGSVPLATALR
FT                   DVAAEGFQVVQEDAGGMAVQSDSVARFDSHFDLSPADESEMLTRYSVNVTPTPEDGIAG
FT                   AIAAVRREDADDVEGRVLTHPQDWVPQLSHYARSGMQVIVTYVEKNGATKRYRMEPLTV
FT                   TSGYFDGFDVHSSEVRRIAFHHVTSITLLDR"
FT   gene            complement(532463..533245)
FT                   /locus_tag="ckrop_0433"
FT   CDS_pept        complement(532463..533245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0433"
FT                   /product="resuscitation-promoting factor RpfA"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17210"
FT                   /db_xref="InterPro:IPR010618"
FT                   /db_xref="InterPro:IPR021630"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHA5"
FT                   /protein_id="ACR17210.1"
FT                   /translation="MGQHSKNTNRISTGAKVALSGLAITASGIAVAPSASAAPDSDWDR
FT                   LAQCESGGNWGINTGNGFQGGLQFAPSTWSAYGGTEYAATANQATREQQITVGERVLAE
FT                   QGWNAWPACSAQLGLSSAPSQRDNAYANGAQAAVQPAAAPVEEAAPAENAAPAAQAPAD
FT                   VADEAPTPQKAVTDLAATQSIASLDQVFDAIQAAFNKAGIPMPAVITDYYHAHHDELVG
FT                   AYNQAIGAAVNGYAEATAQATKIYDAVEKNFHSSRSAA"
FT   gene            533711..534103
FT                   /gene="cspB"
FT                   /locus_tag="ckrop_2200"
FT   CDS_pept        533711..534103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspB"
FT                   /locus_tag="ckrop_2200"
FT                   /product="cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_2200"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17211"
FT                   /db_xref="GOA:C4LHA6"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHA6"
FT                   /protein_id="ACR17211.1"
FT                   /translation="MPIGRVKWFDPDKGFGFVTNPGDDDVFVGTQVLPDGVEELHQGQK
FT                   IEYEFAAGRKGPQVLRITDIQETGRPRRRPSHKYKPDQLQSMIQDLMTLLEGHVQPSLQ
FT                   AGRYPGRKESRQVAEVLRAVARELDA"
FT   gene            complement(534192..534686)
FT                   /locus_tag="ckrop_0435"
FT   CDS_pept        complement(534192..534686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0435"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17212"
FT                   /db_xref="GOA:C4LHA7"
FT                   /db_xref="InterPro:IPR024495"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHA7"
FT                   /protein_id="ACR17212.1"
FT                   /translation="MIIVGSVMAVIVLVAIVGGIAFTYWEQRHNSVDPTTVTLSITDSK
FT                   GKSVTADPYQACALGSTDCTEKSMTKISLPKDGKATIDVPSTVSDTQWSLLTIYEDNAK
FT                   NYESVYKAKDKKSVTIDGSKDGSRLKVAEVHAVLLGDKSHGSDSSDDEDAYTMVWAISP
FT                   E"
FT   gene            complement(534822..536363)
FT                   /locus_tag="ckrop_0436"
FT   CDS_pept        complement(534822..536363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0436"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17213"
FT                   /db_xref="GOA:C4LHA8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHA8"
FT                   /protein_id="ACR17213.1"
FT                   /translation="MPTRRWCKNGFMNNHGEPPTTGELHEPPADDTTPRPSRVRRVLSA
FT                   PGRLVGSWIEADGAKASGLSSLTYTTICNSGVDAALAVALAGTLFFSATTGESREGVAL
FT                   YLLVTIAPFAVIAPLIGPALDRVYAGRRFALSLTFAARIVLTVWLLTNFHSWVLYPAAL
FT                   GMMVMSKSFGVLKSSVTPRLMPPDIDLVRTNARLTILGHIVGSGGVGAIAASVSFLFTP
FT                   REALWVIIVIALMGLYSCVLIPRKAESSPDEWATTSPLSVPGTPLTEDSSLDDDPTADV
FT                   ANANADAATDTAPLPQSPSQPSPRRRAVRQRVTRAAQQLHIVPFPHDAKTCLWSVMTSR
FT                   SGTGFLTIFVAFAAKSTNGLSAWEQLAMLAVAGAAGSVGTFSGNLLGAWIPLGAPRVTV
FT                   LTIAGIAWAGVICAAIWPGLILTAVATFALSLSSSLCKVSLDATIQEGLPEEARSSAFG
FT                   RSETFGQLAWVFGGTMGIVLPPQLGTGFIALSIIIGVGYLRTLFLAVKVPHVRRH"
FT   gene            complement(536373..537194)
FT                   /locus_tag="ckrop_0437"
FT   CDS_pept        complement(536373..537194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0437"
FT                   /product="putative glutamine cyclotransferase"
FT                   /function="Glutamine cyclotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17214"
FT                   /db_xref="GOA:C4LHA9"
FT                   /db_xref="InterPro:IPR007788"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHA9"
FT                   /protein_id="ACR17214.1"
FT                   /translation="MGTVLIAVCGLIIVASWSQRSRTDGASRAPSTSSMSARGAVPTRS
FT                   ITVLDTLPWPQDAFTEGLDRLPQGQSLVSTGRYGRSDIYFLNDDGHRAHVHHLPRKYFS
FT                   EGIAATPTAVWQLTWKAGHAIRRDRQSLAATGSAHYEGEGWGLCYDSHNLLMSDGSNRL
FT                   TRRDSNTFEKRSSLSVTLDSRPVGNINELDCAHNRIVANVWHRDELIVIDPESGRVTSV
FT                   IDASELAPARDATGENVLNGVASDPEDPTILYLTGKLWPHMYRVRVDGLGG"
FT   gene            complement(537212..537574)
FT                   /locus_tag="ckrop_0438"
FT   CDS_pept        complement(537212..537574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0438"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17215"
FT                   /db_xref="GOA:C4LHB0"
FT                   /db_xref="InterPro:IPR019681"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHB0"
FT                   /protein_id="ACR17215.1"
FT                   /translation="MKPHRGGLGTGEIWDGWGGKPHKGKLARVSPKFQFHSEPLQDVTL
FT                   PRLPRALEDPRPALIVGIIVWVLGAVCFGLTRGWTDQLVWTSIIGAVTGVLGYGVYMWQ
FT                   REAVRRGAQWVQDGLD"
FT   gene            537593..539086
FT                   /locus_tag="ckrop_0439"
FT   CDS_pept        537593..539086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0439"
FT                   /product="putative membrane protein"
FT                   /function="Permeases"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17216"
FT                   /db_xref="GOA:C4LHB1"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHB1"
FT                   /protein_id="ACR17216.1"
FT                   /translation="MSNNASSTDTATAPSSKKKRRSALDNYFHISDRGSTLSTEVRAGV
FT                   VTFFAMAYIVLLNPLILGSVPDHTGTELGIPRVAAVTALAAGVMTIVFGLIARYPFGIA
FT                   TGLGINTLVAVTLVSTEGLTWPQAMGLIVIDGIIIVILAVTGFRVAVFNAIPAPMKTAM
FT                   TVGIGLFIAIIGFVDGGFVRRVPDSAHTTVPVELGIGGSIASWPTAVFLVGLLICGVLV
FT                   ARNVRGGLFIGIVANTIIAMIVEALTRSGASVKNGQPNPKGWNLAVPGIPDSWAGAPDL
FT                   SLVGKVDLVGAFTEVGVLTATLLVFTLVLANFFDAMGTMTGLGKQAGLVDETGVLPDMK
FT                   QALVVEGTGAIVGGAVSSSSNTVFVDSAAGIADGARTGMANVVTGVLFLVAMFLTPLYE
FT                   VVPTEAAAPVLVIVGALMVGQIREIDFSRFTTALPAFLTIVVMPFTYSIANGIGIGFIT
FT                   YAVMETAAGRAKKVHPLMWIVAILFVVYFGIDPIRDAVS"
FT   gene            539103..540080
FT                   /locus_tag="ckrop_0440"
FT   CDS_pept        539103..540080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0440"
FT                   /product="putative rRNA methylase"
FT                   /function="rRNA methylases"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17217"
FT                   /db_xref="GOA:C4LHB2"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHB2"
FT                   /protein_id="ACR17217.1"
FT                   /translation="MSGCDSAEVIMNECDVVYIEDPSDPRLDDFRNLNHSDKRPDMPGG
FT                   KGLVIAEGLLVVPRLIRSRFPVRAIMGTEAKLHSLLDDADLAATLAQANIPVWCVSREV
FT                   MAEIVGFDMHRGLLASANRVDVPSISDVLDELDARRDRPDQPPVSGTIAVLEGVGDHEN
FT                   IGALFRNAAGLGVDAVFFGAGCADPLYRRVVRVSMGHVLRVPFAYFDGNRSTWQRGLSE
FT                   LQQRGYRCVALTPSDDAVMLPEALDGAQRAALIVGAEGPGLTEHAMRASDVRARIPMAP
FT                   GTDSLNVATAAAMGFYERARTSIVGCGRPLRPARGGSNTSRRRI"
FT   gene            complement(540077..541171)
FT                   /locus_tag="ckrop_0441"
FT   CDS_pept        complement(540077..541171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0441"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17218"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHB3"
FT                   /protein_id="ACR17218.1"
FT                   /translation="MAHASDSSGSRSSDGFTPHGSVPIVKYPFPSATVTIWCVSTAHPK
FT                   DVFANDPAPDRGFGRKLLAQLNPQWPVTHMGDFPLNRSTSAGHGEIYIGGFDGVAIIQY
FT                   VPASFPGYEFDVSHLSALPMKLIESIPASDIYAFAVDDHSQLGGFAHWHEGKLERSFCS
FT                   NRVSVFEDTGLPESFETPFWAGERSHGAHRGIELPFLPAELAMEALHSWLGLSLTSTSM
FT                   DVPVAAFAIDGRPASRLPLDCASGSSSRRGHSAFRRHTNAADGNASPDNPHSRSADDEE
FT                   WINDGLPADHDSDYDDYAHVPPFSVREWADIDRSDVSAFMKRGAARAGRAALRGGRALA
FT                   SLPHAVGDRVRARARKTGRREPRD"
FT   gene            complement(541246..542778)
FT                   /locus_tag="ckrop_0442"
FT   CDS_pept        complement(541246..542778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0442"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17219"
FT                   /db_xref="InterPro:IPR021421"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHB4"
FT                   /protein_id="ACR17219.1"
FT                   /translation="MQTISLVPEECTDDYLVFAASEPHSPDASAAADSVGVSSSNSPEV
FT                   SSTDSSQEDNTGPTHFRLPLAEDTKSALRRLLGTDAADVTDASSSTGSTGSTSTDTPAE
FT                   TAPQSDDSGSSHTDNVSSVDNDKDSDDEGSSAGSDTATDQSESLTAPSTPTVVLTPREI
FT                   QARIRGGESIEDLARASGMSQGKIEPFAHPILAERERMTTVARQSHPVRQDGPSTLTLD
FT                   DVLATAFTARGMDLSEATWDAYRNDARLWIITLTWTSGMSDVTAEWSYHSDGLSATTVA
FT                   RNEAATELVDPDFGRPSPGRPRSRTRGQGGSARFSSAMSSDDGSQESGQIHGLHTDGDP
FT                   DFDYDETVEDFDDSTSAIPSSPEEEAPRGEGQPGADTDVQPHHPSRAGGGRGRRTQRRR
FT                   TGRMEIVGLDDHRSRRANKSSDTGSSASNDPRDSGPTNTNDGHNGPDHDHASDSHSGSS
FT                   ENEDAFLQHPDTESRPRRRKAVTPHWEDVLLGVRTNRSDPPRNRGNHTRDHD"
FT   gene            complement(543071..544276)
FT                   /locus_tag="ckrop_0443"
FT   CDS_pept        complement(543071..544276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0443"
FT                   /product="Phosphoserine aminotransferase"
FT                   /EC_number="2.6.1.52"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17220"
FT                   /db_xref="GOA:C4LHB5"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR006272"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022278"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHB5"
FT                   /protein_id="ACR17220.1"
FT                   /translation="MIPTNAQSLEIYEPSMTPTASSTPSDAPQLPEDLLPHDGRFGCGP
FT                   SKIRPEQIKAIDQGATTIMGTSHRKPGVKNIVASIQEGLTSLFQLPDGYEIVASLGGAT
FT                   AFWDAATFGLIERRSAHLKYGEFSGKFAAASERAPWLDAPIILESDPGTAPSPSELNNV
FT                   DADVVAWAHNETSTGAMVPVERPSGDALVLIDATSGAGGLPVDIRNADAYYFSPQKCFA
FT                   SDGGLWFAAMSPAALERIERISKSDRFIPAFLDLQTAVNNSRKNQTYNTPAVATLLMMD
FT                   QQVQWMNNNGGLDGMVQRTSASSRVIYDWAEKRPETQPFVADPQGRSLVVTTVDFDDAI
FT                   DAARIAAILRANGVLDTEPYRKLGRNQLRIGTFPAIDTADVEKLVSAIDYILDNELANK
FT                   SA"
FT   gene            544671..545981
FT                   /gene="gltA"
FT                   /locus_tag="ckrop_0444"
FT   CDS_pept        544671..545981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltA"
FT                   /locus_tag="ckrop_0444"
FT                   /product="Citrate synthase"
FT                   /EC_number="2.3.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17221"
FT                   /db_xref="GOA:C4LHB6"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR010953"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHB6"
FT                   /protein_id="ACR17221.1"
FT                   /translation="MADNNAAEAKDKAVLTYPGGSYEMPIVKATDGNDGIALGKLLQET
FT                   GYVTLDPGYVNTGSTLSNITYIDGANGILRYRGYPIEELAEKATFNEVSYLLINGELPN
FT                   QEQLDEFNRNIRRHTLVDEDFKDHFSIFPRSSHPMAVIASALNVLSTYYQDSLDPLDPN
FT                   MQKLNTYRLMAKVPVLAAYSHRARRGQPFMYPDNGLNARQNFMRMMFGYPTEDYEVDPV
FT                   LTKALDQLLILHADHEQNCSTSTVRMVSSAQANMFVSIAAGFNALSGPLHGGANQAVLE
FT                   MLQEIKDNGGDATEFMNKVKNKEDGVKLMGFGHRVYKSYDPRAAIVKKTADRVLNHLGV
FT                   NDDLLEIAVNLEEIALKDDYFIDRKLYPNVDFYTGLIYRAMGFPTNFFTVLFGMGRLPG
FT                   WIAQHLELVNDKSSRINRPRQVYTGYDERHVIPRKER"
FT   gene            546134..546493
FT                   /locus_tag="ckrop_0445"
FT   CDS_pept        546134..546493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0445"
FT                   /product="FKBP-type peptidyl-prolyl cis-trans isomerase"
FT                   /function="FKBP-type peptidyl-prolyl cis-trans isomerases
FT                   1"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17222"
FT                   /db_xref="GOA:C4LHB7"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR023566"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHB7"
FT                   /protein_id="ACR17222.1"
FT                   /translation="MSKPTIEVQSGPAPQDLLIEDITVGDGPEAQAGSNVEVHYVGVDF
FT                   ETGEEFDSSWDRGQTITFPLTGLIAGWQEGIPGMRVGGRRKLTIPPDMAYGPAGTGHPL
FT                   GGRTLVFVIDLVDVK"
FT   gene            546513..546971
FT                   /locus_tag="ckrop_0446"
FT   CDS_pept        546513..546971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0446"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /function="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17223"
FT                   /db_xref="GOA:C4LHB8"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHB8"
FT                   /protein_id="ACR17223.1"
FT                   /translation="MLAPLAPAFLLCHNLRMCEDKKACRFDVNSAYVDLAAEVFRLLSD
FT                   PTRIRIILALRDAGEMSVNHLADVIDKSPTATSQHLAKLRWGRIVDVRQDGTRMFYRLV
FT                   DEHARELVAQAVFQAAHALDIEPAHHRTHKHCPRETGSAEGRDRETEQ"
FT   gene            546968..547204
FT                   /locus_tag="ckrop_0447"
FT   CDS_pept        546968..547204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0447"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17224"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHB9"
FT                   /protein_id="ACR17224.1"
FT                   /translation="MTTDLEPSTNTHIPTQDAVDSSDSPVSPDPRNSAESAAQVREAIR
FT                   PSSWLKTAVALPEVQWAVGSLAFFLLGWGCQAI"
FT   gene            547217..548953
FT                   /locus_tag="ckrop_0448"
FT   CDS_pept        547217..548953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0448"
FT                   /product="putative cadmium-transporting ATPase"
FT                   /function="Cation transport ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17225"
FT                   /db_xref="GOA:C4LHC0"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHC0"
FT                   /protein_id="ACR17225.1"
FT                   /translation="MWWTLFIACYLAGGWNPLISALQAIKNKKLDVDLLMIVAAIVAAA
FT                   IGQILDGALLIVIFAISGALEVIVTQRTAHSISSLLSLAPEQSNLLNDDGTTRVVNSKE
FT                   LQVGQRILIYPGQRIGGDGIVVDGVSEVDQQAVTGESVPVLRKVGDEVLSGTMNGTGTL
FT                   TVEISRPASDTVIARIVSLVEEASNTKARTQVFIEKVEQLYSVGVIIGTLIVLFLPIVL
FT                   LDYSFEQALLRAIVFMIVASPCAVVLSTMPPLLASIANAGRHGVLVKTATVMESIGHSS
FT                   IIAFDKTGTLTQGAPDVTNVVPAEGYDADTVIRFAAAVERFSEHPLGQAIVRAAEARAI
FT                   TITNATNFRAIPGQGVEGVVEGHTVTVRRADEKSATAGTDVIVTKDDAQVGTIMLVDKI
FT                   RPGAARAIDDVNAVAPGGLMLLTGDNASAASTVARHIDLGSIHTELLPENKAHIVAELE
FT                   RDDHRVLFVGDGINDAPGLMAASTGIAMGRRGSNLALEAADAVIVYDDLSAVAPLIKLS
FT                   RRARRYVVANLCIAAAVIITLVTWDLLGTLPLPLAVAGHESSTVIVAVNGIRLLRKSVW
FT                   ED"
FT   gene            complement(548971..550521)
FT                   /gene="accD2"
FT                   /locus_tag="ckrop_0449"
FT   CDS_pept        complement(548971..550521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accD2"
FT                   /locus_tag="ckrop_0449"
FT                   /product="acyl-CoA carboxylase, beta subunit"
FT                   /function="Acetyl-CoA carboxylase, carboxyltransferase
FT                   component (subunits alpha and beta)"
FT                   /EC_number="6.4.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17226"
FT                   /db_xref="GOA:C4LHC1"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHC1"
FT                   /protein_id="ACR17226.1"
FT                   /translation="MVSHSGSSTPTSSSPSTPQPERLSAHDLIHDILDTDSWDSWDTKP
FT                   DYGDISDDYAASLARAREKSGVDEAVITGAGTIDGHRVAVVASEFSFLGGSIGAATSRR
FT                   IIDAIHRATAESLPLLISPASGGTRMQEGTPAFALMISITAAIHRLKDQHLPYLVYLRH
FT                   PTTGGAMASWGSAGHLTFAQPGATLGFLGPRVVELTTGKPLSPGVQTGEYLSRHGVIDG
FT                   VIDPTGLRRQFTKLFDVLIRPDHATEPAEPTSPSGEVRSAWDAITRTRNPQRTGAADLV
FT                   NALSDHWIQLSGTGDGRMSEAVIVGLTRINDQSLVFVGMDRTAQEPLGDCPLSTEAMRF
FT                   ARRGITLAHELGIPLVSVIDTPGGELSDRAERTGMAGSIARTLAEILDIDVPTVSVIIG
FT                   QGCGGAALSMIPADQVLACEDAWLAPLPPEGASAIIYRDVDHAPAMMENQSVAADKLHE
FT                   RGIVDRLIPALNSTDAEADSKVVIDSIARALWEIKLNSTLRRGREQRLAHYERLATIV"
FT   gene            550671..551564
FT                   /locus_tag="ckrop_0450"
FT   CDS_pept        550671..551564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0450"
FT                   /product="putative oxidoreductase"
FT                   /function="Aldo/keto reductases related to diketogulonate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17227"
FT                   /db_xref="GOA:C4LHC2"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHC2"
FT                   /protein_id="ACR17227.1"
FT                   /translation="MARMANNTSKAETTHQNNAGPTATLSDGTVIPRLGFGTWELSQEE
FT                   TYSSVRTAIAAGFRRIDTAMIYKNEESTGKAIRDAIENGDVTREELTVSTKLWNSDQGY
FT                   EPTFEAFNTSMEKLGLDYVDIYFIHWPYPEKNQYKESFRAMIELQNQGRIRSLAVCNFY
FT                   PEAMDELVAENNKTPTINQIELHPGFSQAAMRSFDDQHSILTESWSPLAQGNYFDELVI
FT                   KDLAAKYGKTPAQIVLRWHLDMGLSVLTRSKSKEHVESNFDILDFSLTTDEVEQITALD
FT                   REDGRIGADPSTANFE"
FT   gene            551655..552515
FT                   /gene="echA2"
FT                   /locus_tag="ckrop_0451"
FT   CDS_pept        551655..552515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="echA2"
FT                   /locus_tag="ckrop_0451"
FT                   /product="enoyl-CoA hydratase"
FT                   /function="Enoyl-CoA hydratase/carnithine racemase"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17228"
FT                   /db_xref="GOA:C4LHC3"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHC3"
FT                   /protein_id="ACR17228.1"
FT                   /translation="MTNENNVTSASPDGEVTLDILPVDNDTPTDGEPQPRVAVITIRRD
FT                   HKRNSLNADVCSQIATYVHEAENTDSVRAILLRGEGKAFCAGADLAGGVYTSAFHHNLD
FT                   AMLTSITHSPLPVIADVHGPAVGAGTQLAMACDLRVVGESGWFSVPVVRLGIAVDPWTI
FT                   HRAVELLGGARARSFLYTAERLEPDAAISAGLASSRGNHDDAWQVAVDQATNAPLTLRY
FT                   LKAVFNQVVPTGVAQGGSSEGTGHDDEVLTAVHERLRTECWDSDDAAEARAARSEKRSS
FT                   VFKGK"
FT   gene            552639..555212
FT                   /locus_tag="ckrop_0452"
FT   CDS_pept        552639..555212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0452"
FT                   /product="putative cation-transporting P-type ATPase"
FT                   /function="Cation transport ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17229"
FT                   /db_xref="GOA:C4LHC4"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHC4"
FT                   /protein_id="ACR17229.1"
FT                   /translation="MAQQQSDASSSHDPVASSDSSAADDDRTFHTDPSVGLTSQEVEER
FT                   RRDGKGNTLPERSGRSTWSIIKANVFTRINAMLGVLLVIVLATGSLINAMFGLLIIANS
FT                   GIGIIQELRAKRTLDKLTIVGEARPTVRRDGEDQEISRDEVVLDDLIILKSGVQVVVDG
FT                   VVVESEHVDIDESMLTGESDPVEKSPEDEVLSGSFVQSGHGLYQATKVGADSYAGKLTA
FT                   AANKFELTDSELMTGINKILRIITWLLIPTGILTIWTQLFRSGDSLRDAILAMVAALVP
FT                   MVPEGLVLMTSIAFAVGVVRLGKFKALVNELPAIEGLARVDVVCTDKTGTLTENRMVLN
FT                   DVVEVDSERKSDSDSDSSVDEPLSESDEGWVRVDHDVLAALASLIAADDDKNDTSEAIA
FT                   EGIHDLESDADVEVMDPTDTKAFSSARKWSGASFGETTWVMGAPDVIALPGSDAAEAAD
FT                   EVGRRGLRVLLLAQTSKKLDDITATPKEPGDDDLTPRGLIVLEQKVRDDAPETIEYFDR
FT                   EKMHVKVISGDNAESVGAVASSVGIDSSKTIDARELPDYQSDQDKFDEVVEESTVFGRV
FT                   TPEQKRAMVGALQRNNHTVAMTGDGVNDVLALKDANIGVAMGAGSPATRSVAQLVLLNN
FT                   SFATLPHVVAEGRRVIGNIERVANLFLTKTVYSVLLALIVGIFGMSYPFQPIHVTMTGW
FT                   FTIGIPAFILSLAPNHERAKSGFVGRVLRLAVPSGVLIGAVTVGFWLWVTRGDNFDRSQ
FT                   ASTATLTVMITMALWVLIVVARPYKLWKIVLLVVSALAYVVIFSVPWIAHILLLDPTNL
FT                   GLMTQALIVGAVGCVAIEIAWWISHTKRGDAQLWDHSEAEGVFKY"
FT   gene            555366..556616
FT                   /locus_tag="ckrop_0453"
FT   CDS_pept        555366..556616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0453"
FT                   /product="putative transporter"
FT                   /function="Kef-type K+ transport systems, membrane
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17230"
FT                   /db_xref="GOA:C4LHC5"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHC5"
FT                   /protein_id="ACR17230.1"
FT                   /translation="MTSVPVADTMAVSQMVLASGQANTDTMISLTAILAVALLAPILSF
FT                   MTGKRIPAVVFLIVLGVIIGPSVWGVAEIDSGISILRQLGLGMLFLLAGYELDTDSLRS
FT                   KEGGNAALTWLMCLALAFIGALVFLKGNGALTAVTLAIAVTSTALGTLLPILKQSDLLR
FT                   TNVGKSVMLHGAVGELMPIMAIALLLSARSMGVTFLILLAFFAIAAMVAVVPRTVATLV
FT                   PWVGRAIIDGASATNQSIVRMVVLMLAILMTVAAVFDLDVVLGAFAAGIVLRGLVPERA
FT                   HGLIEERLDVMGYGFFIPVFFVCSGINIDVQTVGANIGQLFAVVGVILVARGVPVFLRE
FT                   MFTKTGSKLTTTNQKFQLACYASTGLPIIVAVTEVATNAHLLEESAASLLVAGGAVTVL
FT                   LFPLIAAALQPKDKRKL"
FT   gene            556740..556815
FT                   /locus_tag="ckrop_t0014"
FT   tRNA            556740..556815
FT                   /locus_tag="ckrop_t0014"
FT                   /product="tRNA-Arg"
FT                   /anticodon="(pos:556773..556775,aa:Arg,seq:cct)"
FT   gene            557001..558284
FT                   /locus_tag="ckrop_0454"
FT   CDS_pept        557001..558284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0454"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17231"
FT                   /db_xref="GOA:C4LHC6"
FT                   /db_xref="InterPro:IPR012429"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHC6"
FT                   /protein_id="ACR17231.1"
FT                   /translation="MKKSIHPIERLRGSVQSPRLPGIDVARVLAIFGMIAAHVASGPSS
FT                   VSIMDPSTYPALVHGRPAVLFALLAGVSISLMTGRGERPTSVNDVRGIRLKLIGRALAI
FT                   FLIGLLLEQLGTGIAVILTFYGVLYFVALPFVWAKTRTLVIVTVCLGLVGPSLLAVIQY
FT                   LLPKGNVSPTIGLVLGGVYPLPVFWGILLLGMALGRLHLQSTRVLAGLVAVGICASAVG
FT                   YGVGSLWGSNEEPKNGWINQDDGNGSSQPDWSTVISKLQKQKSKQVDGLQPGNPAAESS
FT                   GDASSDEGIESRWGQYWEGLGSSKQLKDSIKKSVVDSAPHSGGTAEFVGSGGFALIVVA
FT                   LCQLVVSRARRWFIPLAVTGAMPLTIYTAHVIVVFVLGGPAGTVVSNPLYWSLVIGSVI
FT                   FANGWMAFVGRGPLERFPRWLGNRAAGQ"
FT   gene            complement(558290..559036)
FT                   /locus_tag="ckrop_0455"
FT   CDS_pept        complement(558290..559036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0455"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17232"
FT                   /db_xref="GOA:C4LHC7"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHC7"
FT                   /protein_id="ACR17232.1"
FT                   /translation="MPNRDSDPRYNNANDETEIFPSSYSDRYSGSESQYSAGNSDYRDD
FT                   GYSTGGYTREYNSGGYSAPSNRGYNDSNRGYNDAGYYSDQQYQSYQQAPAQSPAPQQSR
FT                   PQKSGPSISDQFDIPKFIGSVVAVAIVASITAYVVAWILELVMERIATYVNWTYPPIDR
FT                   TYYAIFAALVAIFAALLWWVLNIGTTLPSLFYSWIVGVVLVAAVVLPLLLTTPFYNGII
FT                   ESVMNLVVGLPVVYLIAPIGNSARKN"
FT   gene            complement(559104..559670)
FT                   /locus_tag="ckrop_0456"
FT   CDS_pept        complement(559104..559670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0456"
FT                   /product="hypothetical protein"
FT                   /function="Oligoketide cyclase/lipid transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17233"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHC8"
FT                   /protein_id="ACR17233.1"
FT                   /translation="MTSPHNSDDNTSSDVDTSMFNPDDFRRRVSVTIDATPDEVYNVVS
FT                   DISRTGEWSPVCKATWWKERDDGTTPAEPEVGAWFVGHNETPKRTWETESVVTAAERPK
FT                   VFSWAVNGGVVEWGYEIEPADDGGSTLTETWEVTQEGFRFFINKYGDDAEAELNERRDA
FT                   ALEGIPATVKKIKSIVEKETSHDAS"
FT   gene            559873..560229
FT                   /locus_tag="ckrop_0457"
FT   CDS_pept        559873..560229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0457"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17234"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHC9"
FT                   /protein_id="ACR17234.1"
FT                   /translation="MRAPQTLEDDTTMTEKPSFTDVNGREVYAKIEEGENGPQLIIGTS
FT                   QPDGTVKRSLVLNKYDAKQMAAVCEVYLRQQFSVSFATVDSMLTAEDRMNIYQNEIDAI
FT                   EDPETNPDDDLHKS"
FT   gene            560294..561118
FT                   /gene="cobF"
FT                   /locus_tag="ckrop_0458"
FT   CDS_pept        560294..561118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobF"
FT                   /locus_tag="ckrop_0458"
FT                   /product="tetrapyrrole methylase family protein"
FT                   /function="Precorrin-2 methylase"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17235"
FT                   /db_xref="GOA:C4LHD0"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR012797"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHD0"
FT                   /protein_id="ACR17235.1"
FT                   /translation="MRLLRVIGMGAGSPGHISHDAAAALASSDAVVALDKGDAKADLLE
FT                   LRRHILAAHAPDLPLLTVDDPPRDRHPAGTPEYHREVQRWHQERARLLADTITSSLSDG
FT                   QTAAFLVWGDPSLYDSTLRIIERMQNLGLECRTEVYPGITAVQALTAAHRILINRIGEP
FT                   ITVTTGRQLQKDLDTPDTTSRIKAVANTVVMLDGKTAWTHPGIDRDHTYMWWGAYVSTD
FT                   KQVLRKGWVGDIADEVVHTKAELRAEHGWIMDTYLLRYFDPDGDDQPETLMT"
FT   gene            complement(561147..561434)
FT                   /locus_tag="ckrop_0459"
FT   CDS_pept        complement(561147..561434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0459"
FT                   /product="hypothetical protein"
FT                   /function="Glutaredoxin and related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17236"
FT                   /db_xref="GOA:C4LHD1"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011915"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHD1"
FT                   /protein_id="ACR17236.1"
FT                   /translation="MSEVIQKNNPSGNETAATIYYATWCPFCKKLIENLDRTETPYSLI
FT                   DIDQSEEAGQWVESVNDGNRVVPTVKYSDDTTATNPPAGDVRRKVEELSS"
FT   gene            complement(561476..562141)
FT                   /gene="folA"
FT                   /locus_tag="ckrop_0460"
FT   CDS_pept        complement(561476..562141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folA"
FT                   /locus_tag="ckrop_0460"
FT                   /product="bifunctional dihydrofolate reductase-thymidylate
FT                   synthase"
FT                   /function="Dihydrofolate reductase"
FT                   /EC_number="2.1.1.45"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17237"
FT                   /db_xref="GOA:C4LHD2"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR017925"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHD2"
FT                   /protein_id="ACR17237.1"
FT                   /translation="MSTSSSTGVHSPTSGDASPSPRRTVEPEQPLIGVIWASDRDGVIG
FT                   DGTRMPWHVPEDMAHFKQLTWGVPVIMGSATWSSIPSRFTPLPGRTNIVLSRRWSDEDT
FT                   PDGVILHHSLDAAFKDIPHPVFTRRVAPENVDAWVIGGGEVYREALTRPEVRLAVLTEI
FT                   DAAVGHYFDRPVTARLSSEWVPSSRSEWKTSRNGTIIGDGNDGRDTQPLRYRFCYFSK"
FT   gene            complement(562171..562998)
FT                   /locus_tag="ckrop_0461"
FT   CDS_pept        complement(562171..562998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0461"
FT                   /product="Thymidylate synthase"
FT                   /EC_number="2.1.1.45"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17238"
FT                   /db_xref="GOA:C4LHD3"
FT                   /db_xref="InterPro:IPR000398"
FT                   /db_xref="InterPro:IPR020940"
FT                   /db_xref="InterPro:IPR023451"
FT                   /db_xref="InterPro:IPR036926"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHD3"
FT                   /protein_id="ACR17238.1"
FT                   /translation="MTGMSASESTAIPTPYEDLLREILKDGNHRDDRTGTGTTSLFGKQ
FT                   MRFDLSEYFPLLTTKKVFMRGLSEELFWFLRGESNIHSLLEKNVHIWDEWADEDGNLGP
FT                   IYGVQWRSWPTPDGGTIDQISQALDMIKNNPTSRRIIVSAWNVADVPSMALPPCHLLFQ
FT                   FYVADGKLSCQLYQRSADMFLGVPFNIASYALLTHMMAQQAGLDVGEFIWTGGDCHIYD
FT                   NHRDQIDLQLSRDPRPYPTLSLTKAADLFSYTWDDVDILNYNPHPAIKAPVAV"
FT   gene            complement(563080..563985)
FT                   /gene="cysQ"
FT                   /locus_tag="ckrop_0462"
FT   CDS_pept        complement(563080..563985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysQ"
FT                   /locus_tag="ckrop_0462"
FT                   /product="inositol monophosphatase family protein"
FT                   /function="Archaeal fructose-1,6-bisphosphatase and related
FT                   enzymes of inositol monophosphatase family"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17239"
FT                   /db_xref="GOA:C4LHD4"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHD4"
FT                   /protein_id="ACR17239.1"
FT                   /translation="MTTRCPSDTTCPRRQSSVIHQASPGARLDRDRSRPRGGDKRLTTA
FT                   KVVYVSAYVDDATLALRLATGTSEILKGVRSVGLLEGPGLGAAGDDLAQTWIERVLSRH
FT                   RPDDGFLSEEAADSLERLKKNRVWIVDPLDGTKEFAGGRQDWAIHVALVENGIPTHAAV
FT                   GLPDAGQVFHTGSAKAVMGPRANKIVVSHNRQPEVAQVIADKLDSEVVRMGSAGAKAMH
FT                   VLLGDYDAYVHAGGQYEWDSAAPIGVCTDAGLHCSRLDGSPLRYNNEDVYLPDVVICRP
FT                   ELKDTILEAAAEFKKEHGHY"
FT   gene            564255..565739
FT                   /locus_tag="ckrop_0464"
FT   CDS_pept        564255..565739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0464"
FT                   /product="uncharacterized iron-regulated membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17240"
FT                   /db_xref="GOA:C4LHD5"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHD5"
FT                   /protein_id="ACR17240.1"
FT                   /translation="MIHRIHFYAGVFVGPFILIAAVTGLLYAAAPSIESIVDHDKMYVP
FT                   ASDVHSHQRVDVKDQIRTAAERHPDLTFSGVQIRNDDRATTRVLFNDPSLPSKSYRRVV
FT                   MVNPYTGEVVGDTVQFGSSSSLRFREWTDRAHRNLFLGEPGRIYAETAAAWLGVLTVSG
FT                   LVMWWRKVYDKNKKKRATGSESHSALKSLSGRPKSMRRHAIIGTWACLGMLFLTATGLT
FT                   WSKYAGAQIADWRVQLNWAKPTPDTTVSQSVGSPDASMDHSHHGGHGDHSGHGGMSSDS
FT                   PALTPHDSVLEAQNHVDTVMSSAKQAGIKASFEATAPAAPGEAWTVTDLRVPWYFSHDS
FT                   VSVDGETGRVVDTVWFKDWPFAAKLAEWGIQLHMGILFGIVSQVALGALAIMICIIVVR
FT                   GYMMWWQRRPTRNRNGFRSNFGRAPRRGAWRRSSIIGFAVAAILLIGYGLLAPLFAISA
FT                   LAFLALDIVIGFVMRWKGRRDHDSSSKDTSFAEANA"
FT   gene            565754..566887
FT                   /locus_tag="ckrop_0465"
FT   CDS_pept        565754..566887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0465"
FT                   /product="ferrichrome-binding protein precursor"
FT                   /function="ABC-type Fe3+-hydroxamate transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17241"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHD6"
FT                   /protein_id="ACR17241.1"
FT                   /translation="MVENPREVSSSSPDDRHGDKMPQDQRESSANAGQQHASREEPFSH
FT                   HYSLRRAHHSSSLTPRAHERRLSRRSFLVAGMGAGVALGLAACSSSSGDGENAEAESSK
FT                   KSSDKSAGTHDTSKIIALNTVQIDGLLALGITPVGMGVANAQASSSDSIPQYIKDKFGD
FT                   KYDLDSITIVGQRTQPDMEKIAALHPTLILANDRTSKDVLDQLKSIAPVVTGKGGAENW
FT                   KDDFRTIADAVGKRDDAQRLIDDHEDAVAEWKKDRGTSPTVSLIRNKGTDYLMLGPLSL
FT                   AGQVLKDGGCNRPTSQRFEDKVSHPISSENLDQLDADYLFYGFNAKGEKLTKDALWGNL
FT                   DVVKNGHAVGVDPDPWFLNASVVAANYILDELKKTVK"
FT   gene            complement(566951..567856)
FT                   /locus_tag="ckrop_0466"
FT   CDS_pept        complement(566951..567856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0466"
FT                   /product="iron ABC transport system, ATP-binding protein"
FT                   /function="ABC-type cobalamin/Fe3+-siderophores transport
FT                   systems ATPase components"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17242"
FT                   /db_xref="GOA:C4LHD7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHD7"
FT                   /protein_id="ACR17242.1"
FT                   /translation="MSHTMNSSSSASGSTPAQPAGNSTPRHEAVLHDAAPAGSLTLSGL
FT                   RVSYGDRNVIPNLDASIPGGAVTTIIGPNGCGKSTLLRAAAQLISSSGSIMLDDVDVRS
FT                   LRRKELAQRIGVLPQSPIAPPGVVVSDLVARGRHPHQSWFRQWSSDDEEEVARALELTH
FT                   VADLADRPVSSLSGGQRQRVWISMVLAQDTEVLFLDEPTTYLDLSHSIEVLNLVTELKH
FT                   RLGRTVVMVLHDLNLAARYSDNVIVMADGQVTAAGKPSEVLTEELLESSFGLDARVIED
FT                   PECTEAPLVVPRKPEVLNSA"
FT   gene            complement(567853..568944)
FT                   /locus_tag="ckrop_0467"
FT   CDS_pept        complement(567853..568944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0467"
FT                   /product="iron ABC transport system, permease protein"
FT                   /function="ABC-type enterobactin transport system permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17243"
FT                   /db_xref="GOA:C4LHD8"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHD8"
FT                   /protein_id="ACR17243.1"
FT                   /translation="MTTPQQSKVRLPHHRRAFRWGPVSGVLSPRPLLVCLALAIAGIFL
FT                   FAVAIGIGDFPIAPMDVLSVVFTGGGSRIEQLVVFEWRMPRALSAVIVGAALALSGALT
FT                   QSVTRNALASPDILGVTSGASAAAVTVIVLGSGSGFAGWLAGAGIPAAALMGALGTTVL
FT                   MWLIGFRGRQMDIYRLVLLGIVVTALLNSYIHFLMIRAETSDAAAAKFWLTGSLSSVTW
FT                   NRLRPVMIVLGICIIICVWISFELRASQLGPDLASSLGQPRRLVDAAILVVSVVLAAFA
FT                   VPAGGPIGFIAFVAPQVAMRLAGTSAPPLFTSVLTGSVLLLLADIATQTILPTELPVGL
FT                   LTSAIGGVFLIYLLVRTSRKATV"
FT   gene            complement(568941..570050)
FT                   /locus_tag="ckrop_0468"
FT   CDS_pept        complement(568941..570050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0468"
FT                   /product="iron ABC transport system, permease protein"
FT                   /function="ABC-type Fe3+-siderophore transport system
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17244"
FT                   /db_xref="GOA:C4LHD9"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHD9"
FT                   /protein_id="ACR17244.1"
FT                   /translation="MTVTHSPAASPTPTSADGSPQPPGSSKAGRRLYVRRITGLVVLLV
FT                   LLAVCLCAAMALGSRSIPLPKVWDVLSHFSSSSDSSNSDTDTRVIIDLRIPRALLGVIV
FT                   GMALGCAGALIQGHTRNPLADPGILGVSAGAAFAVVSSFAFFGVTGNVATTLWAFGGAI
FT                   SATALVFGLASVGKATASPLNLVLGGAALAAVLSSLTSGLVLTNNDNLNRMRFWTVGAI
FT                   AGRDMNVVMVSAPVIIVALIAAFATGPTLNLLNLGDDAATSLGVHVGRSRIVGVILIAL
FT                   LAGAATAAAGPIGFVGLVVPHVVRSITGPDYRWILPYSALTGAVLVLVADIVGRLIARP
FT                   GEVEVGIVLAFVGAPFFIYLISRNKVVEV"
FT   gene            complement(570195..571865)
FT                   /gene="pgi"
FT                   /locus_tag="ckrop_0469"
FT   CDS_pept        complement(570195..571865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgi"
FT                   /locus_tag="ckrop_0469"
FT                   /product="Glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17245"
FT                   /db_xref="GOA:C4LHE0"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4LHE0"
FT                   /protein_id="ACR17245.1"
FT                   /translation="MNSPLPDITATDEWSALKDNAKSIESTTLRDLFANDQDRAKNLSF
FT                   SVADLHVDLSKNLINDDTLTALIALAKKADLEDHREAMFSGRHINSTEDRAVLHTALRL
FT                   PAEESLHVDEQNVAADVHDVLARMRDFAHALRSGEWLGVTGHTIKTVVNIGIGGSDLGP
FT                   AMTTQALRSFATAGISGRFVSNVDPADFTSKVADLDPAETLFVVASKTFTTQETLANAH
FT                   AARRWFLDSLHLEDGTDEANDAIAKHFVAVSTNAEKVSEFGIDTNNMFGFWDWVGGRYS
FT                   VDSAIGLSLMAVVGPQNFMSFLEGFHAVDEHFRNTPLEKNVPVLMGLLGVWYDDFLGAQ
FT                   SHAVLPYSQDLARFPAYLQQLTMESNGKSVRIDGTPVTAPTGEIYWGEPGTNGQHAFFQ
FT                   LLHQGTQLVPADFIGFATPNDDLPTADGTGSMHDLLMSNFFAQTKVLAFGKTADEITAE
FT                   GVDPSIVPHKVMPGNRPTTTILAPALTPSVLGQLIALYEHIVFTEGTIWSINSFDQWGV
FT                   ELGKKQAGELLPAVTGEKGVDTGDASTDSLISWYRENRK"
FT   gene            complement(572014..572325)
FT                   /locus_tag="ckrop_0470"
FT   CDS_pept        complement(572014..572325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17246"
FT                   /db_xref="GOA:C4LHE1"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR010958"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHE1"
FT                   /protein_id="ACR17246.1"
FT                   /translation="MTEPRDSLSTSSEVTSGTSDPLSNERIQELRKEINQLDNTIISAI
FT                   KRRTEISHLIGQSRMGSGGTRLVHTREVAIINEFREELGTEGPAIASALLRMGRGRLG"
FT   gene            572464..575076
FT                   /locus_tag="ckrop_0471"
FT   CDS_pept        572464..575076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0471"
FT                   /product="putative ATP-dependent DNA helicase II"
FT                   /function="Superfamily I DNA and RNA helicases"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17247"
FT                   /db_xref="GOA:C4LHE2"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHE2"
FT                   /protein_id="ACR17247.1"
FT                   /translation="MNDSLSTRLPDGGPLTPQQLLEGLNPQQRQAVEHEGSPLLVVAGA
FT                   GSGKTAVLTRRIAYLIGVRGVAPWNIVAITFTNKAATEMKERVADLIGPIAERMWVSTF
FT                   HSMCVRILRAQANLIPGLNTNFTIYDSDDSRRLLTMIARDMNLDLKRFASRTVASAISN
FT                   LKNELRTPDEALADAEEDKNPFNETVAQIFAEYQKRLRASNAVDFDDLIGEVVRIFREY
FT                   PEVALYYRRRFRHVLVDEYQDTNHAQYVLVSTLVGDEGSEGDSIPPSELCVVGDADQSI
FT                   YAFRGATIRNIEEFERDYPHAETILLEQNYRSTQTILSAANAVISQNSGRREKNLWTAL
FT                   GEGERIVGYVADNEHDEARFVAREIDQLVDNSTINYGDIAVFYRTNNASRALEDIFIRN
FT                   GLPYKVVGGTRFYERKEIRDIIAYLKVLDNPDDSVSLRRIINTPRRGIGNRALSLLSLY
FT                   AADHGVSMGAALRAAADGDIPALGSRGNKAVGRFVEMMDGLREDTADNQLVSHDGDDLG
FT                   IPDLGAIVNDVIERSGYLESLEGSNDPQDGARLDNLRELVSVAREFASEAAHQLAYERM
FT                   PSATASESAPGAGAEDGSSVGSDGVDSSGTDSGGGIDTAGDEAFLEEGEPQPGSLQAFL
FT                   ERVSLVSDADQIPDEENGVITLMTLHTAKGLEFPVVFLTGWEDGQFPHMRALGDPSELS
FT                   EERRLAYVGITRAQRRLYISRAVTRGSWGQPVNNPASRFIAEIPEDLIHWEREEPQQSW
FT                   DSGDWSLGWPDKSTSGYRRGNARYRGSQYGGAGSSAHGSGGRRGAGRGVGSSSDRRSGT
FT                   PASALHLEVGDQVNHDKYGLGTVESVSGLGKHTSVVIDFGKEGTVRLMLIGNVPMEKL"
FT   gene            complement(575209..576003)
FT                   /locus_tag="ckrop_0472"
FT   CDS_pept        complement(575209..576003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0472"
FT                   /product="putative secreted metallopeptidase"
FT                   /function="Membrane proteins related to
FT                   metalloendopeptidases"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17248"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHE3"
FT                   /protein_id="ACR17248.1"
FT                   /translation="MRTNRGSHYVGTHRRQTTPKASRVASVAVAAGALGTAGAVGAGAA
FT                   TIGHSDSVRLVAKDADATPSEATASESSPQILQLPQAKPVANLHDQIAKTVEFNKQRLA
FT                   ADAAARTPEPAAQPASAGPVGNAIMNALGIVKPAQGILTTGFEMRWGAFHKGIDIANVL
FT                   GTPEYAVMDSTVISAGPASGFGQWVRLRADDGTVFVYGHMETINVTVGQRVKAGDVIAG
FT                   MGSRGFSTGSHCHFEVHPNGGEAIDPLPWLAAHGINLGPIQR"
FT   gene            576344..578650
FT                   /locus_tag="ckrop_0473"
FT   CDS_pept        576344..578650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0473"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17249"
FT                   /db_xref="GOA:C4LHE4"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHE4"
FT                   /protein_id="ACR17249.1"
FT                   /translation="MCPTRGRCQDRQVRNTTPSNSRRPGDGRSRKNGRRSRGTDAQRLT
FT                   WDSPSSSRQHRPDRSSRQSETGAERSSHQSSRPSFDDVAHRDSSRPRSTAGDSRANQAP
FT                   RASEQYVREQRPQARATRGSRRTDGGRASRVRCAGDLDSAATVGKKNAGARGTRGARAT
FT                   GTGSDDGRRGAGNNRGATDASPRGRRFGLNRWTQWWQKSGSAARSAAGGSFTTRLRKFL
FT                   PGIAATHVSVIGVIIAVALIILLALDLSFVAAPATIASLWLTFNLAPLSMSGADLGLLP
FT                   LLPALGYALWIALRIRSVVRERISVSDVRMLVGCSLAVPILLTLTALAMLWDAQPVLPV
FT                   NVPSVWMSVLSTFALNALAIIFGMGKRLWRALLRFYGMPQWPVDAVRLGMAFLAAMGGI
FT                   GALVVIVSLIAHWSAFTDAYSIASGVGGKIGLTLLWIAYFPNMALASASVLAGAEANFG
FT                   AAQVSLFTATRAELPPVPVLAAMPGDVFPAAWLGLFIPAAVAILVYRRFLSQRRVVVSP
FT                   YGTVGVAAVSAGIVGMVAAWLNSGVVGAYGWSGPNPWLTGAVAAGWMFAVGVITMAVIG
FT                   IRRGRSASPREASASDRGGTREADTTKGDRHSAEPDSAAESRDDDNPAAQRVESAEDKS
FT                   AGDESDADGESNVGNKSGADDESGDSDSVDGEPEDDNDDGDDDGSEDSDEENTADGKAK
FT                   GESSHSGARESEAVDAKETEVESSEAEQSESADNVTTETDNDPEPSAGTSAGDSSQGST
FT                   AHDASSQGGTTDDPR"
FT   gene            578637..579341
FT                   /locus_tag="ckrop_0474"
FT   CDS_pept        578637..579341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0474"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17250"
FT                   /db_xref="GOA:C4LHE5"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHE5"
FT                   /protein_id="ACR17250.1"
FT                   /translation="MIRVDPIFPGRPLRLVVLASGEGTLFQSLLDARRETPSLSVQALV
FT                   TDKPCPAIDRARRADIPVATITPPRKNAPATPEGHPATDHPATCHQDTYAERRRQWNSE
FT                   LAQAVQHYDPDIVVSAGFMRIVGDEFLARFGGRMINTHPALLPAFPGAHAVADAVAYGA
FT                   KITGSTIHLVDSGVDTGPILEQEAVPIHDGDMPDTVHRRIKIVERRLLVSTLDAIARRG
FT                   YISDGRKASFLP"
FT   gene            579338..580996
FT                   /locus_tag="ckrop_0475"
FT   CDS_pept        579338..580996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0475"
FT                   /product="phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase / IMP cyclohydrolase"
FT                   /function="AICAR transformylase/IMP cyclohydrolase PurH
FT                   (only IMP cyclohydrolase domain in Aful)"
FT                   /EC_number="3.5.4.10"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17251"
FT                   /db_xref="GOA:C4LHE6"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHE6"
FT                   /protein_id="ACR17251.1"
FT                   /translation="MTDSQSATPSPATSSTSDSQIPVKRALISVYNKTGLADLASALHA
FT                   DGVEIVSTGSTAAHIADAGIPVTLVEKLTGFPECLDGRVKTLHPKVHAGILADTRNPDH
FT                   VKQLEDMGIEGFQLVVVNLYPFSETVASGADRDECVEKIDIGGPSMVRAAAKNHESVAV
FT                   VVNPDDYADTAKAVHDGGFSFAQRVDLASRAFQHTAAYDVAVATWMSKQSALTQASSNE
FT                   DAGSDNAGSDKTTFGEFVGSTYTLSHPLRYGENPHQAAALYVDQHGHPGLAQAEQLHGK
FT                   EMSYNNYTDGDAAWRAVWDHPGETCVAVIKHANPCGIAISRESVADAHRKAHACDPVSA
FT                   YGGIIAANKPVTLEMAQTVKKIFTEAIIAPSFDDDALELLKTKKNLRILVAPKPERQGL
FT                   QLKEVAGGVLVQERDVLDAPGDDPSTWELVAGDSADDETFNDLAFAWRSVRAVKSNAIL
FT                   LAKDGATVGVGMGQVNRVDSARLSVQRAGEDRARGAVAASDAFFPFADGFEVLADAGVR
FT                   AVVQPGGSIRDEEVIEAARKAGVTMYLTKERHFFH"
FT   gene            581133..582347
FT                   /gene="fadA2"
FT                   /locus_tag="ckrop_0476"
FT   CDS_pept        581133..582347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadA2"
FT                   /locus_tag="ckrop_0476"
FT                   /product="acyl-CoA thiolase"
FT                   /function="Acetyl-CoA acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17252"
FT                   /db_xref="GOA:C4LHE7"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHE7"
FT                   /protein_id="ACR17252.1"
FT                   /translation="MSDSHASCQLRPDDVVIVGAKRTPQGKLLGALASQTSVDLGAAAV
FT                   SSALKDSGVASGDVDYVVMGQVLLAGAGQNPARQVAVKSGIPLDVPAEIVNKVCLSGLD
FT                   AIIHATRMIRVGDASIVVAGGMESMTNAPHIAAGVRQGKTYGDLRLVDAINRDGLHDAV
FT                   SGKTMGEETDRGNQDRGITREEQDHIAALSHQRAEKARDEGLFDDEIVPIEIPQRKGDP
FT                   VVVRADEGIRPGTTEEGLSRLRPAFLEGGTITAASSSQISDGAAAVVLTTREEAEKREL
FT                   RVLAVIGQYGQTAGPDTTQLHSQPSRALKSALDRSGWSIDDLDVIEINEAFAAVVAQSI
FT                   KDLGVDMDRVNVNGGGIALGHPVGASGARLVVHMAHELDRRGGGRAGVSLCGGGGQGDA
FT                   LTLWV"
FT   gene            583062..583982
FT                   /gene="citE"
FT                   /locus_tag="ckrop_0477"
FT   CDS_pept        583062..583982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citE"
FT                   /locus_tag="ckrop_0477"
FT                   /product="putative citrate lyase beta subunit"
FT                   /function="Citrate lyase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17253"
FT                   /db_xref="GOA:C4LHE8"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHE8"
FT                   /protein_id="ACR17253.1"
FT                   /translation="MTQTNQSAPAGGTTSVGHPSPHRRWTPAGPAILFAPADRPERFAK
FT                   AAARSDVVILDLEDGAGRDSFDEARTNIVNSDLDPATTIVRVHSADSELFDGDIDMVTK
FT                   TPYTTVMVPKVDQPLPDTLADYDVIAMLESPSGIMNARDIAHQEFVVGLLWGAEDFTAS
FT                   LGGVYSRLQRDERGWDSDRGSAEGPYRTTVNYLRTQTLLHAAEAGIVALDAVFADIHDA
FT                   DGLRDEALDAARIGFAATACIHPAQVPVIRDAYRPSEEQIKMARRIVRESADHPGALNI
FT                   DGKMVDAPLFRQAEVLAARADALGM"
FT   gene            complement(584027..584989)
FT                   /locus_tag="ckrop_0478"
FT   CDS_pept        complement(584027..584989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0478"
FT                   /product="putative membrane protein"
FT                   /function="Predicted permeases"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17254"
FT                   /db_xref="GOA:C4LHE9"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHE9"
FT                   /protein_id="ACR17254.1"
FT                   /translation="MPQVLSGFATIAIVIAIGFFVGKANLLGKHAQFTLQMYVYFLATP
FT                   ALLLDKLYVTDPLDVLGPQLAVASGSALVIGLIYFLWARIALHRPIHESAVGGLASSYC
FT                   NASNLGIPVAAHVVGDSTVVVPTLLFQIAFYGPVVLAILDVVTAKEAHADGRAGRVNTR
FT                   SLFITPFKNPMLLGALTGLVISILHAHAGVSVPHPIVEPIHLIGQSAVPVALIAFGMSL
FT                   AGQKVLDPSTSPRLEVGVASVTKIIGQPLATFLIAHFVFGMTGHALFAACVVATLPTAQ
FT                   NVYTYATRYGRGLILARDAGVITTAASFVMIMLLALVFT"
FT   gene            complement(585198..585446)
FT                   /locus_tag="ckrop_0479"
FT   CDS_pept        complement(585198..585446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0479"
FT                   /product="30S ribosomal protein S18"
FT                   /function="Ribosomal protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17255"
FT                   /db_xref="GOA:C4LHF0"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4LHF0"
FT                   /protein_id="ACR17255.1"
FT                   /translation="MKRNNSKKVRVEPTRRPKKNPLKARGIEAVDYKDIETLRTFISER
FT                   GKIRSRRVTGLTPQQQRQVATAVKNAREMALLPFTSR"
FT   gene            complement(585458..585763)
FT                   /locus_tag="ckrop_0480"
FT   CDS_pept        complement(585458..585763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0480"
FT                   /product="30S ribosomal protein S14"
FT                   /function="Ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17256"
FT                   /db_xref="GOA:C4LHF1"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHF1"
FT                   /protein_id="ACR17256.1"
FT                   /translation="MAKKSKIAKNEQRKEIVARYAQRRQELKAIIKNPATPDEDRMEAQ
FT                   YELNRQPRDASPVRVRNRDSADGRPRGYLRKFGLSRVRVREMAHRGELPGVRKSSW"
FT   gene            complement(585766..585930)
FT                   /gene="rpmG"
FT                   /locus_tag="ckrop_0481"
FT   CDS_pept        complement(585766..585930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /locus_tag="ckrop_0481"
FT                   /product="50S ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17257"
FT                   /db_xref="GOA:C4LHF2"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4LHF2"
FT                   /protein_id="ACR17257.1"
FT                   /translation="MARNDIRPIIKLKSTAGTGYTYVTRKNKRNNPDRITLKKFDPIAR
FT                   KHVEFREER"
FT   gene            complement(585930..586166)
FT                   /locus_tag="ckrop_0482"
FT   CDS_pept        complement(585930..586166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0482"
FT                   /product="50S ribosomal protein L28"
FT                   /function="Ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17258"
FT                   /db_xref="GOA:C4LHF3"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4LHF3"
FT                   /protein_id="ACR17258.1"
FT                   /translation="MSAYCQVTGRKPSFGKSVSHSHRRTNRRWNPNIQRRSFYLPSEGR
FT                   TITLNVSTKGLKTIDRYGIESVVAKLRARGEKI"
FT   gene            586742..587005
FT                   /locus_tag="ckrop_0483"
FT   CDS_pept        586742..587005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0483"
FT                   /product="50S ribosomal protein L31"
FT                   /function="Ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17259"
FT                   /db_xref="GOA:C4LHF4"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027493"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4LHF4"
FT                   /protein_id="ACR17259.1"
FT                   /translation="MKKNIHPDYHPVVFKDASTGHQFLTRSTATSDRTVEWEDGNEYPL
FT                   IVVDVTSESHPFWTGAQRVMDTAGRVEKFQRRYGNRLRRAKK"
FT   gene            587095..587262
FT                   /gene="rpmF"
FT                   /locus_tag="ckrop_0484"
FT   CDS_pept        587095..587262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmF"
FT                   /locus_tag="ckrop_0484"
FT                   /product="50S ribosomal protein L32"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17260"
FT                   /db_xref="GOA:C4LHF5"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4LHF5"
FT                   /protein_id="ACR17260.1"
FT                   /translation="MAVPKRRMSRANTHTRRSQWKANNAPLQEVRVNGNTTRLPRRLVK
FT                   AAQLGLVETD"
FT   gene            587398..588810
FT                   /locus_tag="ckrop_0485"
FT   CDS_pept        587398..588810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0485"
FT                   /product="putative serine protease"
FT                   /function="Trypsin-like serine proteases typically
FT                   periplasmic contain C-terminal PDZ domain"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17261"
FT                   /db_xref="GOA:C4LHF6"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHF6"
FT                   /protein_id="ACR17261.1"
FT                   /translation="MSDENQRSAWEIDPSSDDSSSNNSVQHDREHEIHAPRSDRESSFE
FT                   STQPGFSSTPSAHATGSDQFGMPGQPSGSNQFVDPNQSAGFGQPTGVMQAPRQSPRKTK
FT                   RFSTPAVAALILAAAVASGAVTGAVVSNRDSGSSSDNSSAVSALKASPAKTKNVDTNGS
FT                   VQSVAQKVLPSVVSITVEAGNSGDTGSGSIISEDGTIITNNHVIAGAANGGKISVTLND
FT                   GTTYPADIVARDPETDIAVIKAQGASGLTPISLGDSSKLEVGQEVVAVGSPLGLDATVT
FT                   SGIISAQNRPVQASSESSDQSTLIDAIQTDAAINPGNSGGALVDMDGNLIGIPSVIASL
FT                   GSSSMSQGSGSIGLGFAIPINQARDIAEQLIKNGKVQHPVIGVQVAKESTAHGAVIVDV
FT                   PSDSDAAKAGLKRGDVVTKVDGRTIDSGLSLIAAIRSHKVGDTVKMEVTNQDGKDAREI
FT                   TMTLSSQETSGE"
FT   gene            589051..589749
FT                   /locus_tag="ckrop_0486"
FT   CDS_pept        589051..589749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0486"
FT                   /product="molybdenum cofactor biosynthesis protein"
FT                   /function="Molybdopterin biosynthesis enzymes"
FT                   /EC_number="4.2.1.96"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17262"
FT                   /db_xref="GOA:C4LHF7"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHF7"
FT                   /protein_id="ACR17262.1"
FT                   /translation="MSDNEPFDSIDPAELARSSSDAREMPESLRGIDHAKVDRLGEVIV
FT                   EPDDAMLMDLERAEEAAHASFAERNHDQGEQVPRALVIIVDDNAGEKSDRIGSLVAELL
FT                   AEDHFGVDAVVRVASRKSKVRGALETAVVGGVDLAVTIGGVGVGPRDKTPEATKAVLDR
FT                   RIPGIAQALRSSGLACGATDAGLSRGIAGISGSTVVVNLASSRAAIRDGMATLTPLVRY
FT                   VINDMDRWNQ"
FT   gene            589759..590103
FT                   /locus_tag="ckrop_0487"
FT   CDS_pept        589759..590103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0487"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17263"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHF8"
FT                   /protein_id="ACR17263.1"
FT                   /translation="MNHSRRQRRHARRVSDTDYDRSGESALANVVDAVRAMEDQPRRGL
FT                   NDDRMADLTPDDENDGATPGDGDIGAGDGRSGRDSEFYGGSDTAYGSEGRDVGAMSRRE
FT                   WQENRPPHWG"
FT   gene            complement(590154..590717)
FT                   /locus_tag="ckrop_0488"
FT   CDS_pept        complement(590154..590717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0488"
FT                   /product="transport protein of the large conductance
FT                   mechanosensitive ion channel family"
FT                   /function="Large-conductance mechanosensitive channel"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17264"
FT                   /db_xref="GOA:C4LHF9"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHF9"
FT                   /protein_id="ACR17264.1"
FT                   /translation="MLKGFRDFIMRGNVIELAMAVVIGSAFTAIVTAFTKYIINPLIAC
FT                   FGGANTDGWGFRLIRGNEKTFLDFGSVLTAVINFLIIAAVVYFILVAPMNKLEEIRKKH
FT                   MGVKEEEVPVTEKDLLLEIRDLLAAQNQVSTPSQTLASTELAETTADSAHSQASSQGIQ
FT                   TSTSQVGTPSSTTSSTTSGKHAKE"
FT   gene            complement(591064..591621)
FT                   /locus_tag="ckrop_0489"
FT   CDS_pept        complement(591064..591621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0489"
FT                   /product="hypothetical protein"
FT                   /function="5-formyltetrahydrofolate cyclo-ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17265"
FT                   /db_xref="GOA:C4LHG0"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHG0"
FT                   /protein_id="ACR17265.1"
FT                   /translation="MAQLITAIDDIAATLQRTDDEPLVIATYLPVGNEPGAHTPGGFIP
FT                   SLLAALDERIPCRIVIPRVEDKRQLSWHPWSPDSLVTTSFGIREPDERSTPIPFDTVDL
FT                   AIVPALAYDVAGYRLGQGGGYYDCALAARRSSRQSSGQSSTFRTIGLVHPHEILPAVTH
FT                   DDWDVQLTTVVTPLGRHRFPGS"
FT   gene            592028..592951
FT                   /gene="galU"
FT                   /locus_tag="ckrop_0491"
FT   CDS_pept        592028..592951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galU"
FT                   /locus_tag="ckrop_0491"
FT                   /product="UTP--glucose-1-phosphate uridylyltransferase"
FT                   /function="UDP-glucose pyrophosphorylase"
FT                   /EC_number="2.7.7.9"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17266"
FT                   /db_xref="GOA:C4LHG1"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHG1"
FT                   /protein_id="ACR17266.1"
FT                   /translation="MAPMNKDDNGGNGQAALRTVIVPAAGLGTRFLPATKTVPKELLPV
FT                   VDRPGIELIAEEAREAGASRLAIVTSPRKSGLMKHFDHDDLLEETLKKRGKEDRLQKVQ
FT                   HSTELIDAVSVTQERPLGLGHAVAQAEEVLDPDEDVVAVMLPDDLVMPYGVMNKMLEVR
FT                   AKYGGSVLCAVDVDKEATSDYGVFEVSGQPDDDVYAVSGMVEKPEPEDAPSTLAATGRY
FT                   LLDRDIFKALGKIEPGKGGELQLTDAIELLIKSDHPVHVVVHRGPRHDLGNPGGFIKAC
FT                   VDFGLRDPEYGDSLRAYMTERLAQDS"
FT   gene            593038..594372
FT                   /gene="moeA"
FT                   /locus_tag="ckrop_0492"
FT   CDS_pept        593038..594372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moeA"
FT                   /locus_tag="ckrop_0492"
FT                   /product="molybdenum cofactor biosynthesis protein"
FT                   /function="Molybdopterin biosynthesis enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17267"
FT                   /db_xref="GOA:C4LHG2"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHG2"
FT                   /protein_id="ACR17267.1"
FT                   /translation="MRSVEEQLAIIADAAVTPEPVRVAISDSLGLRSAEEVRGDRQVPG
FT                   FNQAAIDGYAVRAVDLVPRDAKGAPADDRPEDQRPPEPLPDEDYEPDRRSDREHRKLAE
FT                   LPVVGDVGAGSHRPLRLQPNQAVRVETGAPVPTLSDAIIPEAWVERHGRRIRPLFPVKS
FT                   GDFIHRAGTDVLEGDVIVSEGTVIGPAHIGLLAAVGRSKVLVYPRPRVAVMSIGQELID
FT                   SDRTPGRGQVFDVNSYSLAAAAEEAGADAHRVGVIAGEPRRLQEIMEGQILRSEIIVIA
FT                   GAVGGSAARRMRDIVSNLGDIEYTRVAMHPGSTQGFGLLGPNKVPTFLLPSNPVGSLII
FT                   FETMIRPLIQYEAGRRGGRRRIIQARALHGVSSMPGRRGFIRGQLMRDRGTDEYLVDPL
FT                   GASAGAPQHLLGSFAEANCLIHVPEDVVGIAPGDVVDVLFLSNRA"
FT   gene            594388..595113
FT                   /gene="rimJ"
FT                   /locus_tag="ckrop_0493"
FT   CDS_pept        594388..595113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimJ"
FT                   /locus_tag="ckrop_0493"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /function="Acetyltransferases including N-acetylases of
FT                   ribosomal proteins"
FT                   /EC_number="2.3.1.128"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17268"
FT                   /db_xref="GOA:C4LHG3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHG3"
FT                   /protein_id="ACR17268.1"
FT                   /translation="MGVLTRLLDRVGVGSVKGRDLYRRYGVKPSSAHPGWPEETQVLHV
FT                   PGGAVGLRPVVKDDGPEWARLRRNDESTLRAVEPTANDSWDEVHTVPSWLSVVDSLYES
FT                   AARGASVPFAVECDGKFAGQVTIGGIQHGSLSTCWIGYWIASPFWGRGVGTAAVALGVD
FT                   AAMMSVGVHRVEATVLPENAASISVLENVGFHYEGELVRSINIDGQWRDHFLYALTSEE
FT                   CPGGVVSRLETSGRGRRDS"
FT   gene            595296..596960
FT                   /locus_tag="ckrop_0494"
FT   CDS_pept        595296..596960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0494"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17269"
FT                   /db_xref="GOA:C4LHG4"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHG4"
FT                   /protein_id="ACR17269.1"
FT                   /translation="MSSSLLIVLIVVLWLAVLAPLLLRNQGPVRRTSKALKETRVLYRG
FT                   GSGSVASSGRLTKHVRRRSASPDVETEPTEDEYRLLDEDDVHFRAYDDRDAVYSGDSVH
FT                   HGESDADDASVRDARSEAHSGENAGEYVEGDNTRDDEDVVVGELEPEDSDQSFAASSVV
FT                   ADDVDDAVTEPVDDAEFEEFVDDTDDTEDEASGSAGEAKDDQTASGEKSSVPVGVVDGD
FT                   VIMDSSGAVQGVPELESAEAASSQDRGSRRGSRPVSVDKESADDVLTGEGRTSIVYGRD
FT                   FGSDDAVAKDREKFPDAYDRPEDVVDYRDGDPAFEHAYDFADESDDEREERREAQRRSS
FT                   TMLFEDGLDALSDEELEELARSEYDDIAVTDEDRAYVDRRRGRGVYDPELAERNARRRF
FT                   TQRKRVLFGLAAVTVVLLVLGFAFGGAMWAGAVVGAVATGVYLAFLRKQAIEEQRLAAR
FT                   RLRRMRRARMGVRNAEDDHDDRAVSSRLRRPAGTVIETNDTDPELAELEYVDAADYFGV
FT                   EEPDDMQDDGDYIDRQYDRYETDGNGRASVTHIRRVG"
FT   gene            597104..597754
FT                   /locus_tag="ckrop_0495"
FT   CDS_pept        597104..597754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0495"
FT                   /product="putative reductase"
FT                   /function="Nucleoside-diphosphate-sugar epimerases"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17270"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHG5"
FT                   /protein_id="ACR17270.1"
FT                   /translation="MTSSAAAVFPGRADTHRTIDETFWTDIDDKLVTNYMRSKVVAERT
FT                   AWDIIGKQAGTKLVTILPGAIFGPFMNGRRSSTELLFTSILRGAPSPKATYQAVDVRDL
FT                   ADLHILAMLDDRADGERFIAQPGEITMPQMARLLKDRLGEQGHKISTMTVPDFVIKVGA
FT                   RFNSAMAVMNTLIGMEHHYDTSKAQRLLGWGPRPIEDTVIDAATYTLENRAED"
FT   gene            597848..598033
FT                   /locus_tag="ckrop_0496"
FT   CDS_pept        597848..598033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0496"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17271"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHG6"
FT                   /protein_id="ACR17271.1"
FT                   /translation="MGKRERESRAGFPTRASLEASFPDDVDELKRQLAKLTVEKALVDE
FT                   ELELVKRRQRRVRRAE"
FT   gene            598201..599352
FT                   /locus_tag="ckrop_0497"
FT   CDS_pept        598201..599352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0497"
FT                   /product="permease of the major facilitator superfamily"
FT                   /function="Permeases of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17272"
FT                   /db_xref="GOA:C4LHG7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHG7"
FT                   /protein_id="ACR17272.1"
FT                   /translation="MGHFPSNQLAWAIATPVTRLVVTTITMVAVVGTAAVGESYAAGGL
FT                   ISGSYAAGEAAGAIWLTHKMKQVAIGRELRTICLVGAMLLLAAGAILWFIPSLWLGAAL
FT                   AILVLGAISSPIPGVLRSSATQMTSSSQRILAIDNVVNQICWVLGPILGVVLVHQTNTV
FT                   IAYVSLALLLLGAAVVAPLAIPSNYRHESGEGGKASFRPIAVPVVASGVIMAVTASFDT
FT                   LVPGLLTHWFGSDEKASFVLALLALGSVVASSVFGIKKSWPKPEVLAMISTVFMIALLA
FT                   TVGSVQSYSILLGVAVLIGVVQAPSMVLRQVIVSDLVSHKRRASAFSLLYAAGGIGYSL
FT                   AAAVTPWTADMLSARWGSAVTAGACLAILGWAVCLQRKQTPSE"
FT   gene            complement(599611..599686)
FT                   /locus_tag="ckrop_t0015"
FT   tRNA            complement(599611..599686)
FT                   /locus_tag="ckrop_t0015"
FT                   /product="tRNA-Ala"
FT                   /anticodon="(pos:599651..599653,aa:Ala,seq:cgc)"
FT   gene            complement(599782..600321)
FT                   /locus_tag="ckrop_0498"
FT   CDS_pept        complement(599782..600321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0498"
FT                   /product="putative protease"
FT                   /function="Putative intracellular protease/amidase"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17273"
FT                   /db_xref="GOA:C4LHG8"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHG8"
FT                   /protein_id="ACR17273.1"
FT                   /translation="MAKKAVIIATDFGVEEPEIISPRDALSSAGIDVTIASNSGNDIQT
FT                   VTGDKDWASTVKADTTLDKISADDYDLVVLPGGTVNADTLRIDTEAQRILNEFASAHKP
FT                   VGAICHAPWALIDAGLTEGKTMTSYQSIRTDLKNAGAHWVDEEVFRCPGNDWVLITSRN
FT                   PHDLPAFTKALTDELS"
FT   gene            600613..601131
FT                   /locus_tag="ckrop_0499"
FT   CDS_pept        600613..601131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0499"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17274"
FT                   /db_xref="GOA:C4LHG9"
FT                   /db_xref="InterPro:IPR008523"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHG9"
FT                   /protein_id="ACR17274.1"
FT                   /translation="MQPFPSQNDTQQYGTATPGRYHGPDDAPEYNGEPPLSQPFYGASL
FT                   PAAVKRFVTRVLRFKGRSSRSEYWWVQLVLFLIYAVISAVAISAGVDPDDVTNPVGLAS
FT                   AVFSAIIFVPTLSLTWRRLHDAGFAGPWWFITFTVIAAPVLLIMTIFPSRPEKMKEKWD
FT                   DKENLSSAV"
FT   gene            complement(601252..602673)
FT                   /locus_tag="ckrop_0500"
FT   CDS_pept        complement(601252..602673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0500"
FT                   /product="permease of the major facilitator superfamily"
FT                   /function="Permeases of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17275"
FT                   /db_xref="GOA:C4LHH0"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR042471"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHH0"
FT                   /protein_id="ACR17275.1"
FT                   /translation="MADELTGTTFEQSTTERGRELLARMDRFPAWPLRKRDFFVIGIAY
FT                   FFVFYDISDIGFAMPAIDEQMNLGQDMSLFVALAVGLVGYIIGSLLAGWLSDAKGRKVS
FT                   FIGSLVFSGAGSLLCGFSFTVWDLSLWRFLTGMGVGAALNLASTYVGEIAPANQRGKLS
FT                   VATFMVGIIGQAITPFVALALVPNFHTGWRWLFFIGALVGVFGVLFALALPESPRWLIS
FT                   QWRCDDAEKIIEKMETNFTDEQLRKGQKIREEFRKEVEKEEERQDRSLGLTGTDSAPSL
FT                   TEGKYLRTAIVMALMWFLWYIGNYGFLGDAPDLISSHGENIAGSILYLAIGAIGYPTGA
FT                   LIMIFISDKFERKYLIFVCTLVWAAGMLCIATMASSFMVTLGSFLASMALGSYLQMGYT
FT                   FTAESFPTTLRARGFSIADGCGHLGGAVGSLLLPFVVNKTSFFAGFAMIALTGVAAGLL
FT                   ALTGPKSSSRSLEDI"
FT   gene            complement(602975..604087)
FT                   /locus_tag="ckrop_0502"
FT   CDS_pept        complement(602975..604087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0502"
FT                   /product="putative enterochelin esterase"
FT                   /function="Predicted hydrolase of the alpha/beta
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17276"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHH1"
FT                   /protein_id="ACR17276.1"
FT                   /translation="MTDHHDGWWSFTVTAPSDLCGSYYIMPAEAVPDEIVETPRHDDPH
FT                   QQIDFPARWKALMTLMVVDPRAQIPPLRSRRSSHPAPDTDHPYHVKSSGIVRLDDALPE
FT                   PGWDAVDISDAPADNTTAGFTPYTWHSSSEFFQDRHVWVRTPVGNQSDNYRRRPWLLIL
FT                   LDGQDWYGAHTGFDYALRALETSGSIPEVTAVAVETTDSTERGQNRLRDLGCNPAWRRA
FT                   LQDDLIPAVTRNYDIADPYVIVAGQSLGGLCATDCVIESPEAFHAAIGCSPSFWFPTRQ
FT                   GPRLPGPLGGLIAEKLQHRATVAALAQNDSRFFFDVGTGEGLMESHARAVVEELERAHI
FT                   RCHFDISTHGHDPAAWRGALTRGLSFMAAQ"
FT   gene            complement(604299..605363)
FT                   /locus_tag="ckrop_0503"
FT   CDS_pept        complement(604299..605363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0503"
FT                   /product="putative enterochelin-binding protein"
FT                   /function="ABC-type Fe3+-hydroxamate transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17277"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHH2"
FT                   /protein_id="ACR17277.1"
FT                   /translation="MSRFRSPHRLRSVRAVVASTLAVSLIMGTAACSRNEDSTQSSSDT
FT                   ASSSSSESGQSSSAQANETWPRTVATDHGEVKIPAKPKKVVSAAVTLTGSLLAIGAPVV
FT                   ASAGGQKGTPLTDDNGFFTQWSQVADKEHVKVLDLNPSAESILAEKPDLVVMSSTGQDA
FT                   TPDLYEQISEAVPTVMIDYSDKDWQDIATMLGKATGLEKKTSNVIKKFDDTVTKARDEI
FT                   KKPAQPVTPLVYTPQNKSARVWTKESAQGKLLTKLGFTLADVPESARGANSMGQRSDVY
FT                   VVSAENLPTAATGKTAFLFAADDKAVDAYKSNPVLADTPAVKNKSVYSMGTDTFRMDYY
FT                   SSLAMIDRLEDLFD"
FT   gene            complement(605524..606198)
FT                   /gene="tcsR5"
FT                   /locus_tag="ckrop_0504"
FT   CDS_pept        complement(605524..606198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tcsR5"
FT                   /locus_tag="ckrop_0504"
FT                   /product="two-component system, response regulator"
FT                   /function="Response regulator containing a CheY-like
FT                   receiver domain and an HTH DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17278"
FT                   /db_xref="GOA:C4LHH3"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHH3"
FT                   /protein_id="ACR17278.1"
FT                   /translation="MKIVIADDSALLREGVAGLVEKRGYEVIAKPTTATELLDAVTSLG
FT                   DDHGLPDLLITDVRMPPDMREDGLRAALQLRERFPSLSIMVLSQYVAPAYARELFTPGT
FT                   SHGAGTGYLLKDRIGKVKDFLESITIVAQGGVVIDPDVATALMKSGRSGLRLLTARERE
FT                   VMELMARGKSNAEIAQDLFLSGAAVAKHVSNIFLKLNLEPGEDNRRVRAILEYLTETTG
FT                   LI"
FT   gene            complement(606198..607064)
FT                   /gene="tcsS5"
FT                   /locus_tag="ckrop_0505"
FT   CDS_pept        complement(606198..607064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tcsS5"
FT                   /locus_tag="ckrop_0505"
FT                   /product="two-component system, sensor kinase"
FT                   /function="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17279"
FT                   /db_xref="GOA:C4LHH4"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHH4"
FT                   /protein_id="ACR17279.1"
FT                   /translation="MAHMALSAWQRLSHHLRPRNRFAGSRSHESVAAERINELTASRRA
FT                   IADAYEVERRRIENDLHDGAQQYFVAASLKLGEAELEAENGSAELQRLLEETRSHLDDG
FT                   LHALRRTVHGIHPQVLRDQGLYAAVQEIAESYGSNIAVHCPHPLPELQPSVLASAYFFC
FT                   AECLTNAAKYAPGAPVTVLLVSDQDLRISIVDEGDGGARLGPGLSGMRERLAAFGGSMQ
FT                   LNSPIGGPTTVIASIPVMLNRGQSGYPTADSPSAAAASTTTTVSATSAGSASATSGRNV
FT                   NQVGEDS"
FT   gene            607196..607924
FT                   /locus_tag="ckrop_0506"
FT   CDS_pept        607196..607924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0506"
FT                   /product="putative substrate-binding protein"
FT                   /function="ABC-type spermidine/putrescine transport
FT                   systems, ATPase components"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17280"
FT                   /db_xref="GOA:C4LHH5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHH5"
FT                   /protein_id="ACR17280.1"
FT                   /translation="MKDHNAQQSQRRSSQYSLVVHDITKSFASTPVLTGISLEIGQGES
FT                   VAVMGPSGSGKSTLLHCMSGVLVPDDGEIRYGDTVVSRLNDAKRSALRLREFGFVFQDG
FT                   QLLPELTAQENVALPAILQGTSRRRAYADAADMLKRLGLGKLIRRRPGKMSGGQAQRVA
FT                   IARAIAAKPAIIFADEPTGALDQSTGHEVMQQLIAITEQAGSTLVMVTHDQSVANWCQR
FT                   RIEIRDGIIHDDRMLSGAVS"
FT   gene            607925..609316
FT                   /locus_tag="ckrop_0507"
FT   CDS_pept        607925..609316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0507"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17281"
FT                   /db_xref="GOA:C4LHH6"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHH6"
FT                   /protein_id="ACR17281.1"
FT                   /translation="MAVSLSTLSHLGVQLQKASHRAGTGNKWLSALAVFAFTVSTWMAM
FT                   TVAGGTWMFYERYRQPTVASLHDMSGELRQIYVGLAAVACAFVVPPMMSLVAQSAVLGA
FT                   SGRERRLATLRLLGLSNRDITRLTLVETSALAFAGLALGTVIYVVSAPAWSLVSFQNTR
FT                   IGLWEILLPWWGYPVLWAIILVLAAIAAVVGLKRVMVSPLGVSKRDVPTALKFWRLIIF
FT                   VVIVVTARVVLSHIEADSVNVGWSLVIIAGILYVVVFGINLVVPWLIQFAARISSFLPG
FT                   KLNFLATRRVMTDGRTAWKRANALTFLALLLGYVAVMPGNPGDELGDPTINRDTVTGAV
FT                   VTYGVGLLVSISGTMLNQASSVFEEAELTRALGFMGVPSSLHRRVAMKQTFYPLLMTSG
FT                   LTFLLGLYLGWFSYSRFDKDLSAGPQLTWIIGAFVMSLVLSVVATVCVDPLRQKQIAHH
FT                   VRRND"
FT   gene            complement(609320..610426)
FT                   /gene="lplA1"
FT                   /locus_tag="ckrop_0508"
FT   CDS_pept        complement(609320..610426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lplA1"
FT                   /locus_tag="ckrop_0508"
FT                   /product="putative lipoate-protein ligase A"
FT                   /function="Lipoate-protein ligase A"
FT                   /EC_number="6.3.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17282"
FT                   /db_xref="GOA:C4LHH7"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR019491"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHH7"
FT                   /protein_id="ACR17282.1"
FT                   /translation="MSTDTQTSSGTQPSSPRPIHFELKVPGGKLVVIDTTVENDTITSL
FT                   QISGDFFLEPDEAYDEIAPALVGTKTSASTEALESRLNSALAHFDNLDLEGLTIHDIAV
FT                   TVKRAVSGGKDFTDYEWEILRPGVLPTPVNVALDELLLNQVADGRRGPTLRFWEWDDKA
FT                   VVFGSYQSYSNELSQEGIDKYGITPVRRISGGGVMFMEGGNCITYSLYAPIELVQGYSY
FT                   VASYEYLDQWVLAALAKHGVNAWYVPINDITSDGGKIGGAAQKRRRGAILHHTTMSYNI
FT                   DADKMMAVLRIGKVKVSSKGLASANKRVDPLRRQTGVPRETIIDTMAQEFMTRYGAKPA
FT                   SLTDADIKEAEELVSTKFGNDAWTKRIP"
FT   gene            610540..611040
FT                   /locus_tag="ckrop_0509"
FT   CDS_pept        610540..611040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0509"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17283"
FT                   /db_xref="GOA:C4LHH8"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHH8"
FT                   /protein_id="ACR17283.1"
FT                   /translation="MSTKLDPFFRDAGFFIFRLVLGFLFVMHGWQNAVTKGWGSTRDSF
FT                   AAMNIPATDIAATLASWGELITGVLLILGLLTRLSSLVLVIDMAGAFWFVHKDAGLWSS
FT                   DGGYEYVLVLGACALLLLMAGPGAVSVDKLLFGRKKNSSDAPAARVSSEIAQPRDGVEP
FT                   TVA"
FT   gene            611142..611558
FT                   /locus_tag="ckrop_0510"
FT   CDS_pept        611142..611558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0510"
FT                   /product="putative membrane protein"
FT                   /function="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17284"
FT                   /db_xref="GOA:C4LHH9"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHH9"
FT                   /protein_id="ACR17284.1"
FT                   /translation="MFMNKPEVRDAALLLLRIVVGLIFIAHGWDKAMMTGLSATGGQFD
FT                   QLGIPQPELIAALVSFVEMIGGAMIFVGILAPAASVVLIMDMVGALWFVHLHRGFFVAN
FT                   GGVEFVALLIVTLIVIAIFGAGRASLDYFFQRRS"
FT   gene            611644..612456
FT                   /locus_tag="ckrop_0512"
FT   CDS_pept        611644..612456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0512"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17285"
FT                   /db_xref="GOA:C4LHI0"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHI0"
FT                   /protein_id="ACR17285.1"
FT                   /translation="MECSEVRQALSARIDGERSRATWDDDVIDAHLAECEDCQNWYTQA
FT                   LTLGRTLRVAPADDSESIPDFSEFLVQSVPEDQLPHRRSWRVISLSLSRIALIVLGLIY
FT                   VGWAIYLLSHSTTLTGSPVPSGGDSDGAVGDSHDPDVARLFIDAAAMRLSLGFSLFWCA
FT                   WRPRMTAGMIPLFGALWAFTAGFASRDIVLGLATPQQLMGLVLFIVTVLVMVWCWFSHF
FT                   GVSAGDVVTGSLKSFSARPVKSTFSDARETARLIDEANDDVHRHVGDQ"
FT   gene            complement(612535..614175)
FT                   /locus_tag="ckrop_0513"
FT   CDS_pept        complement(612535..614175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0513"
FT                   /product="putative dolichyl-phosphate-mannose--protein
FT                   O-mannosyl transferase"
FT                   /function="Dolichyl-phosphate-mannose--protein O-mannosyl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17286"
FT                   /db_xref="GOA:C4LHI1"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="InterPro:IPR027005"
FT                   /db_xref="InterPro:IPR032421"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHI1"
FT                   /protein_id="ACR17286.1"
FT                   /translation="MIGILAFLTRFIGLSSPTDKGAPVFDEKHYAPQAWQMVRSWSNPF
FT                   VGGIEDNPAYGLVVHPPVGKQIEMISEWLFGYNAFGWRAASATCGVIIILLIMGTVKRL
FT                   ADSTMIACMAGIIAICDGVLLVTQRTAMLDVFQCIFVVAAAYLLVRDAQQMQDRMKKVR
FT                   HEGRMTDSPWGPRMGYRWWRFAAGISIGLSTGVKWSGLFYIFFFGLLSVMADLARRRRF
FT                   GVQRPVLGTLRRDTFPAIASLAILPLAVYMFSWRAWFADENSVYRHAKESGLIEDGSIL
FT                   KHVPSPLSNWLYYQQQVLQFHATLTNSNGHYHPWESKPWSWLASTRPMIYYDSVHDDGT
FT                   HYAQMLFGTPIIWWISVPVIAWAAWCWIVGKDRRWAVPVVGYAAGFLPWLTDVDRQMYF
FT                   FYATNMIPFLIMAIALCLGQLYSWSIADSRLKNRALGKHLGGYLSRRRQGVSSRRRSGA
FT                   RSGDAGNPGSSGVRPRAVEASGSVAMRAASSSRWSRVKSLWINDTGSILACLYLGAVVA
FT                   MFIYFLPLMVAMPLSGSEWDAHMWLPSWK"
FT   gene            614273..615142
FT                   /locus_tag="ckrop_0514"
FT   CDS_pept        614273..615142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0514"
FT                   /product="hypothetical protein"
FT                   /function="Predicted methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17287"
FT                   /db_xref="GOA:C4LHI2"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHI2"
FT                   /protein_id="ACR17287.1"
FT                   /translation="MSQDNSSYRGGIVVAGTPLGNIDDASPRLRHALATADVVAAEDTR
FT                   RARNLANALGIDISGYLVSNFDHNESSRVDALIKEAQRGRTVLIISDAGMPVISDPGFP
FT                   VVERAHDEGIHVGCIPGPSAVTTALAMSGLHVGTFCFDGFVPRKAGARREWLSSLVTER
FT                   RACVFFESPHRIEETLNAAVEILGGDRRAAVCRELTKLYEEVRRGTLEELASWAAEGIR
FT                   GEITVVLEGARDANTHPPVEDLIDDVEARVRADGLRLKDACKVVADQWGMRKKDLYEAV
FT                   VDARKASE"
FT   gene            615213..616994
FT                   /locus_tag="ckrop_0515"
FT   CDS_pept        615213..616994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0515"
FT                   /product="Choline-glycine betaine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17288"
FT                   /db_xref="GOA:C4LHI3"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHI3"
FT                   /protein_id="ACR17288.1"
FT                   /translation="MDHKNIDPEVILGDYDPEVLTGEGQLGMSDATDDAPTDWRVVGPA
FT                   AALVLAVILWGLIAPNGFAEFASDALSWIVNNLGWMFVLFGTVFVFYILSIAFSRFGSI
FT                   RLGRDDEEPEFSTPSWIAMMFAAGMGIGLMFYGTTEPLTFFREGVPGSEPEDLNSAFAS
FT                   TLFHWTLHPWAIYAIVGLAIAYGTFRMGRKQLLSSAFIPLIGAKRAEGWMGKTIDVLAI
FT                   FATVFGTAASLGLGALQIGSGMDETGIIHNPGTPVLVGVVVILSLFFLASAASGVGKGI
FT                   QYISNANMVMAAVLGIFVLIVGPSVVILNMIPTAFGSYVQQFFEMAARTADTDNGTAGK
FT                   WLGTWTIFYWAWWVSWSPFVGMFIARISRGRTIREFVCVVLLVPSAITVVWFSIFGGTA
FT                   VHLEETGRSIWGDGDSTHQLFSLLKTMPGAQIFSILAMILLATFFITSADSASTVMGSM
FT                   SQNGRIVADVRVTCLWGVLTAAIGVVLLVSGGSDALNNLQSVTIIAASPFLLIIIALMF
FT                   ALVKGFREDPVYLDHREHRRFALKLARERRVEAAHAARQRRRADKIRGKDRRSEQTSEQ
FT                   ATGGSSDGPSTAMTRAD"
FT   gene            complement(617063..617482)
FT                   /locus_tag="ckrop_0516"
FT   CDS_pept        complement(617063..617482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0516"
FT                   /product="transcriptional regulator, Rrf2 family"
FT                   /function="Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17289"
FT                   /db_xref="GOA:C4LHI4"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHI4"
FT                   /protein_id="ACR17289.1"
FT                   /translation="MNLTKFSDLGLRALMHMVGSGNARTTAREVAEAINAPRTHVSKVI
FT                   SRLTEFGIIDATRGRGGGITLVDGAEDYSVGAIVRFLEGPSPVIDCEHPHPCPFNVNCR
FT                   LQHELAQAQEAFFASLDAVAIKDITPVRPQVPHQA"
FT   gene            complement(617582..618847)
FT                   /gene="pabB"
FT                   /locus_tag="ckrop_0517"
FT   CDS_pept        complement(617582..618847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabB"
FT                   /locus_tag="ckrop_0517"
FT                   /product="para-aminobenzoate synthetase component I"
FT                   /function="Anthranilate/para-aminobenzoate synthases
FT                   component I"
FT                   /EC_number="2.6.1.85"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17290"
FT                   /db_xref="GOA:C4LHI5"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHI5"
FT                   /protein_id="ACR17290.1"
FT                   /translation="MLPGIFDAPHDDPASVTRLGYSSLDPVDVGVSLLIDDDLPAMAIG
FT                   AWGELEAVIAPDALCTYCDPDEALAPPPGVFAASASPSDNDDESTETASDPRNGVRFGF
FT                   ISYPDPTVYAAGVTAHQVIWRRDGEWLTNGDPDWAAGILATADHRRHYHSADEVSLPTH
FT                   WSTGDREAHRRGVLSCLDAIRAGEVYQACISAQFRTPMTSRAEAARWWLSTVHRTRPRY
FT                   AMFLATNDRAIASLSPELFLERRGSTVWSSPIKGTIPIDRDPEELARSRKDVAENIMIV
FT                   DLVRNDLSRVCRDVTVPSLLKVVPAPGVWHLVSTVSGQVDDVSPARDSRIIDACFPPAS
FT                   VTGTPKLRAREYLAEWEPVARGIHCGTVGINWGDIVANVAIRTAEWVNGELVLGTGGGI
FT                   TIDSTPDAEWAEIMTKTSTLRW"
FT   gene            618986..620824
FT                   /gene="metS"
FT                   /locus_tag="ckrop_0518"
FT   CDS_pept        618986..620824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metS"
FT                   /locus_tag="ckrop_0518"
FT                   /product="Methionyl-tRNA synthetase"
FT                   /EC_number="6.1.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17291"
FT                   /db_xref="GOA:C4LHI6"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023458"
FT                   /db_xref="InterPro:IPR029038"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4LHI6"
FT                   /protein_id="ACR17291.1"
FT                   /translation="MSAPILTSVAWPYANGPRHIGHVAGFGVPSDVFARYQRMRGRDVL
FT                   MVSGTDEHGTPLLVQAEKEGVSVQQLADTYNKQIVEDLAGLGLSYDLFTRTTTRNHYAI
FT                   VQELFTTLYSNGYMVKQTTLGAISPSTGRTLPDRYIEGTCPICGAPGARGDQCDTCGNQ
FT                   LDPADLIDSVSKINGETPKFVETEHFLLDLPALADALGEWLESRQDWRPNVLKFSLNIL
FT                   KDIKPRAMTRDIDWGVPVPLEGWADNKFKKLYVWFDAVVGYLSASIEWAHRIGDPDAWK
FT                   KWWTNPEAKSYYFMGKDNITFHSQIWPAEMLGYRGLGSRGGTEGKLGDLQLPTEVVSSE
FT                   YLTMSGSKFSSSKGVVIYVQDFLREFGPDPLRYFIAVAGPENNDTDFTWDEFVRRNNNE
FT                   LANSWGNLINRTVSMAAKNFGEVPDISGLELTDDDNALLDLAEKTFDIVADNIEHSRFR
FT                   AGINEAMHVVGEANAYIAAQEPWKLAKDEDQRDRLAVVLHTALQVVSDCNVLLTPYLPH
FT                   AAQKVHETLGRTGEWAAMPRIDEVTDDTPVELMGVGLPEEGRTYHVITGEYSHQQAAWK
FT                   RIPIEAGTTLKKPKPIFAKLDPELAETGPEWAPVVH"
FT   gene            620897..621919
FT                   /gene="qor"
FT                   /locus_tag="ckrop_0519"
FT   CDS_pept        620897..621919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qor"
FT                   /locus_tag="ckrop_0519"
FT                   /product="quinone oxidoreductase"
FT                   /function="Zn-dependent alcohol dehydrogenases"
FT                   /EC_number="1.6.5.5"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17292"
FT                   /db_xref="GOA:C4LHI7"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHI7"
FT                   /protein_id="ACR17292.1"
FT                   /translation="MSSSQTVTIPNTMHAIRVSHTGGADVLEYKDDVPVPQPGPGEVLV
FT                   KIDAAGVNYIDTYFREGIYPTDMPYTPGVEGVGRVVAKGEDNGDASSSGELSVGDRVAF
FT                   YNTNCSYADYAAVPASAAVAIEETIDDPTAASLMTQGITAHYLSDGCYSLGEGDTCVIT
FT                   AGSGGVGLLLTQMAKARGATVISITSTEEKAQLSRDNGADYTINYDDYSPEKIRELTDG
FT                   RGADVVYDGVGKTTFDTSIHSLRPTGTMVLFGAASGPVPPIDPQLLNEAGSVFLTRPSI
FT                   KDWTSRPGELQSRVQAVVGMVANGSVKFRIGGTFPLSEARTAHEQLQARKTTGSLVLIP
FT                   "
FT   gene            complement(621916..622515)
FT                   /locus_tag="ckrop_0520"
FT   CDS_pept        complement(621916..622515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0520"
FT                   /product="hypothetical protein"
FT                   /function="SAM-dependent methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17293"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHI8"
FT                   /protein_id="ACR17293.1"
FT                   /translation="MPTWNDIVAANPDHSHRYAKRWDVFVAQGRDIDGEARLIDALAQR
FT                   GSRMLDAGAGTGRVGAYLLKKGHSVTGVDVDPYLVSVAQNRLPDGDWHVADLGAESPDP
FT                   QDFPEGPFDIIYSAGNVFPFIAPDHRATAVANLSSRLADRGRMVLGFALDRGYTAQQFL
FT                   ADADAAGLTPQHMFSSWNADPYDETSTFLVAVLTRN"
FT   gene            complement(622550..624013)
FT                   /gene="pepC2"
FT                   /locus_tag="ckrop_0521"
FT   CDS_pept        complement(622550..624013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepC2"
FT                   /locus_tag="ckrop_0521"
FT                   /product="aminopeptidase C"
FT                   /EC_number="3.4.22.40"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17294"
FT                   /db_xref="GOA:C4LHI9"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="InterPro:IPR004134"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHI9"
FT                   /protein_id="ACR17294.1"
FT                   /translation="MTSSDNHSTPAPQYSSRNTGVLAPQAVASLSEAVASDSSARIAMN
FT                   AVTTTDVDKVALNRQRVISLDHSVSHKTDTWAVANQKKSGRCWIFSGLNSMRGNVMSET
FT                   GIKDFELSQNYVSFYDKLEKANYFLTAMRELADRPIEDRTIQHLLQAPIDDGGQWNMFV
FT                   ALINKYGVVPQYAMPETQSSSNTRHMNRDLASVLRAGATRIRNAVAEDNEHNTDSDAVK
FT                   AIHDETMTSIYRILTIHLGVPPEKFVWQYRTKDNEFVRKGTMTPQEFAATYLPSDLDDY
FT                   VCVVNDPRSTSPYGDTFTVEYLGNVVGAKPVTYLNAPIEVLKKAAVGALVDGNPVWFGC
FT                   DTLAQSNADQGYWSLDLYDYDTLYGVDLSMPKEDRLLSGDSMMTHAMVFTGVDLVDDSN
FT                   DDFDPTTVTSSDDLPETVNPRRWRVENSWGPDKADKGFWTMDDSWFSENVYEIAVPKAR
FT                   LPKEYQDALSKEPHVLPAWDPMGALAHAH"
FT   gene            complement(624071..625501)
FT                   /gene="pepC1"
FT                   /locus_tag="ckrop_0522"
FT   CDS_pept        complement(624071..625501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepC1"
FT                   /locus_tag="ckrop_0522"
FT                   /product="aminopeptidase C"
FT                   /EC_number="3.4.22.40"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17295"
FT                   /db_xref="GOA:C4LHJ0"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="InterPro:IPR004134"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHJ0"
FT                   /protein_id="ACR17295.1"
FT                   /translation="MTESSSTSPLTALSDTRLSELRANIADDPTHRVAMNAVTTTDVDH
FT                   VALNRDAVVALDESSEIKLDSLKVTDQKQSGRCWMFAALNVFRHEIARSLNLEDFEFSE
FT                   SYLQFFDKFEKANYFLRSVAGLYDGSIISADSPSHTGSAQELRDRAIDTLFTFTVSDGG
FT                   QWSYVVNLVKKYGVVPKYVMPETQSSSSTSHMDRALNTIVRKAALQLRDALDTERDTHT
FT                   EGFDQNGIIASALRDVHRVLSIHLGVPPTEFVWQYRDKDNTFHRGGTYTPQQFAQEFLP
FT                   DDLDNYVNIAHDPRADVPVGHRYTTQFQNDMWGTEDFTYLNVDLDTMKSLAIERLRKDK
FT                   PVFFSCDVNRQFRADLGVWDADLIQLDQLYGITTTTTKADRMLTAESRLTHAMVFTGVD
FT                   FDTDSDTPRRWRVENSWGTKHHKEHKEIAGKGYGTMADSWFNESVFHIVVHRDELADEL
FT                   RAHLDDEPTVLPLWDSMV"
FT   gene            625808..626542
FT                   /gene="tatD"
FT                   /locus_tag="ckrop_0523"
FT   CDS_pept        625808..626542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatD"
FT                   /locus_tag="ckrop_0523"
FT                   /product="deoxyribonuclease"
FT                   /function="Mg-dependent DNase"
FT                   /EC_number="3.1.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17296"
FT                   /db_xref="GOA:C4LHJ1"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHJ1"
FT                   /protein_id="ACR17296.1"
FT                   /translation="MTRAAGSGVEWVCTVGDGLDEAEKALEAAHLHPDVVAACAIHPTR
FT                   AGELTDSVRARIEEMAEDPRCVAVGETGLDYYWLGKLDECADKDTQREALRWHADLARR
FT                   VNKPLMIHNREGDEDLLAILADYGDDLTVMLHCFSSPLDVAEEALSRGYILSFAGNSTF
FT                   KRNDELHEAARRAPVGQITVETDAPYMTPEPFRGAKNESAYVGYAARRLAEVRGETSEE
FT                   FALHTGQTAARIFGVERSSSED"
FT   gene            626792..627958
FT                   /locus_tag="ckrop_0524"
FT   CDS_pept        626792..627958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0524"
FT                   /product="resuscitation-promoting factor RpfB"
FT                   /function="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17297"
FT                   /db_xref="InterPro:IPR007137"
FT                   /db_xref="InterPro:IPR010618"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHJ2"
FT                   /protein_id="ACR17297.1"
FT                   /translation="MSTQKKSRIHRINHTSSTPVRVATGGMLATLVVGGAVAVNAQKNL
FT                   ILNVNGETSHVSAMSGDVKSILASHDVDLKDGDFVSPAANSSVKDKQEITVRTARPVTL
FT                   TVDGVQKTIQSTALTVKDFLNQVGTINPDDYVSAQGSTKIPESGMKLEVVPLKDITLDD
FT                   GGQLGDMKVPAVTVKDFLDRRGIKLGADDKVTPELGKKLVSGDKITIERNKTEDQTVKE
FT                   AVEPTVRYVDDPNSPKGSETVVKPGKAGEREVTYTVKSRNGQEVQRWEKASKILSEATE
FT                   KVISRGTKAAVASTKSSSASAPAVAGGSVWDSIAQCESGGKWNTSTGNGFSGGLQFTDQ
FT                   TWQAFGGGAYAPTAAGATREQQIAVANKVQAAQGWGAWPACTSKLGIR"
FT   gene            627968..628897
FT                   /locus_tag="ckrop_0525"
FT   CDS_pept        627968..628897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0525"
FT                   /product="dimethyladenosine transferase"
FT                   /function="Dimethyladenosine transferase (rRNA
FT                   methylation)"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17298"
FT                   /db_xref="GOA:C4LHJ3"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHJ3"
FT                   /protein_id="ACR17298.1"
FT                   /translation="MNQPPTPPRTADHVSSAVQLLGPKEIRDLARTVGVVPTKKRGQNF
FT                   VVDPNTVRRIVATADLSPDDHVLEVGPGLGSLTLGLLDVVSKVTAVEIDTTLAEQLPHT
FT                   VAEYAATRAENLDVICADALALTGSVAKDLGTNPPTAFVANLPYNVAVPILLHVLEIFP
FT                   TITRVLVMVQAEVADRLAAEPGNRVYGVPSVKARFYGQVQRVGAIGKNVFWPAPNVDSG
FT                   LVKLTRGTRPWPTDSAARSQLWPIIDAAFAQRRKTLRAALKGHYGNAAAAENALREAGI
FT                   DPQRRGETLSIDEFISLAQLSAGTETPY"
FT   gene            628928..630253
FT                   /gene="ispE"
FT                   /locus_tag="ckrop_0526"
FT   CDS_pept        628928..630253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispE"
FT                   /locus_tag="ckrop_0526"
FT                   /product="4-diphosphocytidyl-2-C-methyl-D-erythritolkinase"
FT                   /function="4-diphosphocytidyl-2C-methyl-D-erythritol 2-
FT                   phosphate synthase"
FT                   /EC_number="2.7.1.148"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17299"
FT                   /db_xref="GOA:C4LHJ4"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHJ4"
FT                   /protein_id="ACR17299.1"
FT                   /translation="MTSSNSDRPVFNSDWDQYIDGWDGVTGQAPAVLTVYLQAHSSGFT
FT                   SVAQSVSLENSVTIQPVTDAESGSRRGLREASTVDRSPLTTGRVVHDLSVGGNVPMGQL
FT                   PTGTDNVVWRVIERIAEAYRFVMSPSLALPRVDVKITKRIPLSAGLGSKAADVAAAIVA
FT                   ADRFFGYHFIVRAMGFSAPGGTEASSVGSLASDVLRRIAREECPDEYAAIELALEGGTS
FT                   LINLDHDAQPGSDVTTQRTPLLARGPLWWVITLPVVTSPEMAMPWAAPSPTHEEQAAQS
FT                   HNNPSVQHYDDEDEDADETGAGLCHRVVERLAVQRAEMASGKRSQYRVGNIEDIERALV
FT                   SGDPTDVAKTMGNDLYPAATSVVPSLRRVIQAGTRAGALGTIVAQQGPACAMLCADEDH
FT                   ARDVQAELAGSGVVRTARIAPSHRPGSQSGAHLVSDEDKKSP"
FT   gene            630336..632156
FT                   /locus_tag="ckrop_0527"
FT   CDS_pept        630336..632156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0527"
FT                   /product="ABC-type transport system, ATP-binding protein"
FT                   /function="ATPase components of ABC transporters with
FT                   duplicated ATPase domains"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17300"
FT                   /db_xref="GOA:C4LHJ5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHJ5"
FT                   /protein_id="ACR17300.1"
FT                   /translation="MAAVRPLITTDSVTMTRSITTVLDDVTVAVNEGDRIGVVGLNGGG
FT                   KSTLLGVLTRSIEPDSGRVTHGRSVQIATVAQRTQSSSASVIQTIVGEKAAYEWAADPE
FT                   VRSIIAGLDLSELLDEPTDSISGGQFRRVMLAAALVRKVDVLVLDEPTNHLDIEGVQWL
FT                   ADHLRHRNCAQVIVTHDRWFLDTVATRTWEVHDGSVDTYEGGYNDWMFARAERQRQADA
FT                   AEQRRQNLARKELAWLRRGAPARTSKPRYRVEAAEALIADVPAPRNTVELMAFSKQRQG
FT                   KIVVDLVDATIATPDGRVLVDDLTWRIGPGERIGLVGVNGSGKTTVMWTIAGDYPMVAG
FT                   HRREGKTLRLGCLRQELEDIPEDLTVIDAIKAVAEYVVLGNKEMSASQVAERLGFPVKR
FT                   QRQPVRDLSGGERRRLQLTRILMSEPNLLLLDEPTNDLDIDTLQELESMLDGWPGTLIV
FT                   ISHDRYLIERICDSVFALFGDGDVTHLPGGIDEYLERRRSMADHAASGTGFAAGTEAIA
FT                   TGSQQKQGSLSAAEKHKISKEMNSLERKIAKVQKREEKIQQDMADVASSSNGADTEKLT
FT                   ELDRDLSQAREEREELEMVWMEYGEKLEQQ"
FT   gene            632229..634274
FT                   /locus_tag="ckrop_0528"
FT   CDS_pept        632229..634274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0528"
FT                   /product="putative membrane protein"
FT                   /function="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17301"
FT                   /db_xref="GOA:C4LHJ6"
FT                   /db_xref="InterPro:IPR027787"
FT                   /db_xref="InterPro:IPR027788"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHJ6"
FT                   /protein_id="ACR17301.1"
FT                   /translation="MATANQGQRLSRDVSKPGQQLTFDFGKDFDRDVEFYRRADDAPVF
FT                   LSTAVDSYSDRDAPIRRRLMLAWLWLRPDPVGVVLGTVAFLMAMTPSLLPRTWLFQGVV
FT                   CGVSAVTAYAVGVVIHWIWDLWLDDLIAPRVEDLSLRLPRWRWGSDRRLETAMRRLEAE
FT                   ARKPTFMGGSLRFRWRFALDAALFIAVPIATIIMSLFAVRWQNQIARTMGAEAYTPAKF
FT                   LLVIPVGLGLWAAVVGVVRLLINLVEWLADHGPQRWGDATRTIAAWLVVVVILVFVGDK
FT                   IVPGTTMSVAERVFSVRNNKIRSDLVQPTVPERSGSPQSEASWDGLGAFGTRFTGLGLH
FT                   KDELEELTGQPAKEPIRVYGGLKNEPDDQARANLVVRELERTHAANREVLFVIPTTGTG
FT                   WVNPTAAQAIELMFNGNTAIAADQYSFLPSGLQFVADRQRVKEAGKVLINTVVDWWNTL
FT                   PKDHRPRIYVYGESLGTSAGEGAFSGLRDIVNSVNGVLWVGPQNSNNLWSQFVARRDLG
FT                   TPEVEPTYSDGLTVRFANGPKKIWSWEESHEPATREDSPLWPGPRVLYLQHPSDPVVWW
FT                   SPKLLFHRPDWLKEPPKGDRSPAMTWVPILTFWQVTLDLPVAANVPNGHGHNYGFQLLD
FT                   GLAAVAGNGKFTKDDMPRLKKQLATAMEGQGPEKEVGVDQKKMNGN"
FT   gene            634362..634694
FT                   /locus_tag="ckrop_0529"
FT   CDS_pept        634362..634694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0529"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17302"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHJ7"
FT                   /protein_id="ACR17302.1"
FT                   /translation="MILINVRYRPKTEFVESFREKMDEFTQACRQEPGCLFFEWYRNTD
FT                   DPNEYILIEAYKDAEAGKVHAESEHFAKGIEEMNKVLQSRPKIINTTMEDRSGWDDMSE
FT                   VTIDDE"
FT   gene            634758..636221
FT                   /locus_tag="ckrop_0530"
FT   CDS_pept        634758..636221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0530"
FT                   /product="L-serine dehydratase"
FT                   /function="L-serine deaminase"
FT                   /EC_number="4.3.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17303"
FT                   /db_xref="GOA:C4LHJ8"
FT                   /db_xref="InterPro:IPR004644"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHJ8"
FT                   /protein_id="ACR17303.1"
FT                   /translation="MTVSTFELFRIGVGPSSSHTVGPMRAGLEFARSLREHLTTTSADD
FT                   IPSTADSGLADDEYVELVGGAVTQDPESITVILYGSLAATGAGHGTLGACLLGLDGADP
FT                   ATVDPDFMGPRLEEIRRTRTINLAGDESLQVQCGFEDIVLRPTVVRTIHTNAVTFSAIV
FT                   RGQRYKQTFYSIGGGFIRTKEEVPDQDALTGPWLFTSSKELVAKAEQLGGSVAEVQRKC
FT                   EQSRRSDPQINADLDAIAEAMSDCAKRGVSQEGILPGGLGVRRRAQKWYSDLIIDDPHQ
FT                   TAEFSTDWVNLVALAVNEENAAGGRVVTAPTNGAAGIIPAVGFYALTFTPAGRKDPQGT
FT                   ARRFLLAAAAVGSLYKERASISGAEVGCQGEVGSAASMAAAGLAEVLGGTPQQVENAAE
FT                   IAMEHSLGLTCDPISGLVQVPCIERNAISAGKAINAARMSLRGDGTHRVSLDEVITTMK
FT                   ETGADMSDRYKETAGGGLALHVAVNVPEC"
FT   gene            636285..637205
FT                   /gene="ppk2A"
FT                   /locus_tag="ckrop_0531"
FT   CDS_pept        636285..637205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppk2A"
FT                   /locus_tag="ckrop_0531"
FT                   /product="polyphosphate kinase"
FT                   /function="Uncharacterized conserved protein"
FT                   /EC_number="2.7.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17304"
FT                   /db_xref="GOA:C4LHJ9"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022486"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHJ9"
FT                   /protein_id="ACR17304.1"
FT                   /translation="MSDSPQTTNTQDSGSEESRQKPKKLDRKAYEKELKRLQAELVEMQ
FT                   QWVVSTGARLVIIMEGRDAAGKGSAIKRITQYLNPRTCRIEALPAPNSREQGQWYFQRY
FT                   VEKLPTKGEIVIFDRSWYNRAGVERVMGFATSEEYRRFLHQAPIFERLLVEDGIMLRKY
FT                   WFSVSDEEQLRRFESRRDDPLRRWKLSPMDMQSITRWEDYSKAKDEMFVHTDIPTAPWY
FT                   TVESEDKKRSRINVINHLLSSIPYEHIEQDIPEMPERPARRDYERPPRSDFRYVPDVAS
FT                   NLEKDKVKAKKKAKKKGKKNKDKKK"
FT   gene            637334..638503
FT                   /gene="echA3"
FT                   /locus_tag="ckrop_0533"
FT   CDS_pept        637334..638503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="echA3"
FT                   /locus_tag="ckrop_0533"
FT                   /product="enoyl-CoA hydratase"
FT                   /function="Enoyl-CoA hydratase/carnithine racemase"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17305"
FT                   /db_xref="GOA:C4LHK0"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR032259"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHK0"
FT                   /protein_id="ACR17305.1"
FT                   /translation="MADAQKSDQQHSSDNQHTAAGAGDTASVTSPTDDVHLSVHGSVGH
FT                   IVLDRPKALNSLNTDMCAAIENALTAWSTDPAVDVVVITSSTPKAYCAGGDVRRVRELQ
FT                   LEGTEEGRAAADGFFTNEYRMNALLAEFPKPFVAVMNGIVMGGGLGISLHGSHRVITER
FT                   TWASMPEMAIGFSTDVGVSYAMQHLRQPYGDPDGTTSNGLALFMGLTGYRFTQADMLWS
FT                   GMATHIISSHEVENFVDAIDEHGLDSALDTYARPAAEAGPSYLARHIEEINDIFSEGDW
FT                   FDIEAKLDKGGYDKELIAVIDNLLSSANPSSLVATTLLFRANEKAEDLRQGLKNEYEVG
FT                   KVLRYQENFAEGVRAVLVDKDNRASFDPHVTAEVNPEPFEEALVTAQSE"
FT   gene            complement(638585..639319)
FT                   /locus_tag="ckrop_0534"
FT   CDS_pept        complement(638585..639319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0534"
FT                   /product="riboflavin transporter"
FT                   /function="Nicotinamide mononucleotide transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17306"
FT                   /db_xref="GOA:C4LHK1"
FT                   /db_xref="InterPro:IPR006419"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHK1"
FT                   /protein_id="ACR17306.1"
FT                   /translation="MNPFSHLLDATVVIAGYPILWREIIGNLFGLASAVGGMKRVVWAW
FT                   PVGIVGNILLFTVFLGGVFDTPQNLDLYGQAGRQVMFLIVSAYGWYQWRAARLRGIREC
FT                   QDTDPSRSIVSEPTEAAVEPHWATARQRLTMVGVAVVGTIVCAWLFSALGSWGPWSDAW
FT                   IFVGSMLATYGMAKGWTEFWLIWIGVDLVGIPLLLAAGYYPSAVLYIVYAGFVIWGFVV
FT                   WARLQQNTSLEQVDRQTHSITV"
FT   gene            complement(639662..640306)
FT                   /locus_tag="ckrop_0535"
FT   CDS_pept        complement(639662..640306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0535"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17307"
FT                   /db_xref="GOA:C4LHK2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHK2"
FT                   /protein_id="ACR17307.1"
FT                   /translation="MTGLRESKKAATRQAIGDATLTVITHRGIEGLTVAAVAEEAGVSV
FT                   RTFHNYFSSVNEALQYQCSNLLDSFASIIENAPAEWDTISCFEHAAEELIRTIFDKGWA
FT                   ATNPEAIGLYLLRSDNSEFADQCKANIETMHDAIAARESTRRGTTVSPRSLHVCLLYEL
FT                   SIAAINAVITSFGLRRGKSLAGQGIAKEEFLKTMNESFATIRDRFIDAPVA"
FT   gene            complement(640306..642942)
FT                   /gene="mmpL"
FT                   /locus_tag="ckrop_0536"
FT   CDS_pept        complement(640306..642942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmpL"
FT                   /locus_tag="ckrop_0536"
FT                   /product="putative drug exporter of the RND superfamily"
FT                   /function="Predicted drug exporters of the RND superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17308"
FT                   /db_xref="GOA:C4LHK3"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHK3"
FT                   /protein_id="ACR17308.1"
FT                   /translation="MQYTCVSQPLSNNSVSRGTKSCTHCAIFSTVATSSSYASKSCSPR
FT                   SAPVGGNHPSKKGWLPMARFLYRVGTAAYKHKWRFIAVWLLILIGMGAASAALSTTTSS
FT                   TFSIPGIESEKAQNTMKERFPGAEDQTTAPTGKLVFQAENGKKLTDIDEQQAVNDTLTK
FT                   LKDAGILKSSDSMVDPATAAAGITQQITAVGQQQQLPEEQIAKNIESVSPLSSDQKTGT
FT                   VDITFDADTVSDIPSSDIDKFKDIVDDSRSSNLDIQYEGQAFTMEEPSSGTSELIGIAV
FT                   ALVVLIITFGSLIAAGMPIITALVGVLIGNLGVMALTGLVDSVNDSTPMLASMLGLAVG
FT                   IDYALFITSRYKNELSNSTSNRVHAAGRAVGTAGSSVVFAGLTVIVALCALSVVRIPFL
FT                   TTMALTAAATVAIAVLVALTLLPAVLGLFGKAFFKGNVPFIEAPDPEREKPTMGLRWVR
FT                   IIRKQPWAFLGVGVIALVLVALPMTRMNLALPTDATSDPNESPRQAYEMVDDAFGPGRN
FT                   APLVAVIDAKDVPQDQRQVAFAKAVQEFNTIDGVKNAMLSQVNDSGDTAQVLIVPTTGT
FT                   VDDKTKDTMQKVRDKEDSYTEETGAHYGITGVTAIETDISDRLNNVLVPYIAIVLVLAF
FT                   FILMLVFRSIPVPLIAALGFGLTVCATFGLTVGFFQEGWLGIISDPQPIISFLPIILIG
FT                   IVFGLAMDYEVFLVSRMREGWHHGKTAGNATANGFKHGARVVTAAALIMISVFAAFMLQ
FT                   DMQVIKTMGFALAVAVFIDAFLVRMTLIPATMFILGEKAWWLPKWMAKITPRVDVEGEG
FT                   IKDITPDDDGGQGSEDGAQSGSHESDRSASDDATSNPNISDPVVPEPSSRRSGGGRSTG
FT                   SSKVDAD"
FT   gene            643036..644106
FT                   /gene="pip"
FT                   /locus_tag="ckrop_0537"
FT   CDS_pept        643036..644106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pip"
FT                   /locus_tag="ckrop_0537"
FT                   /product="proline imino-peptidase"
FT                   /function="Predicted hydrolases or acyltransferases
FT                   (alpha/beta hydrolase superfamily)"
FT                   /EC_number="3.4.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17309"
FT                   /db_xref="GOA:C4LHK4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR005944"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHK4"
FT                   /protein_id="ACR17309.1"
FT                   /translation="MNSDDVQIATANKGLYPETTPFNEGTVERPVDPDSPASTQHIAYA
FT                   EYGNPEGIPAVFIHGGPGGGTSAKEARFFNPDKYRIILIDQRGCGKSTPHLADPDTNID
FT                   AELSVNTTSELIGDIEAIRETLGIDKWVVFGGSWGSTLSLAYTQAHPERTLAIVLRGIF
FT                   MLRRTELDWYYNGGAAYMFPDKWERFLSVIPDDKKPEPLNPAGMTHLPDVNLIDVYHEL
FT                   LRSDDHDTAVAAARSWSVWEGSTSYLHDQPTDTHEDEWFALAFARIENHYFVNHGFLEG
FT                   GQLLRDVDKIREIPAVIAQGRYDVVCPPITAWQLHQAWPEATFVWSPTSGHASYEEETT
FT                   STLVSATDRFAETFAS"
FT   gene            complement(644151..645800)
FT                   /locus_tag="ckrop_0538"
FT   CDS_pept        complement(644151..645800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0538"
FT                   /product="Peptide chain release factor RF-3"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17310"
FT                   /db_xref="GOA:C4LHK5"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR032090"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038467"
FT                   /db_xref="InterPro:IPR041732"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHK5"
FT                   /protein_id="ACR17310.1"
FT                   /translation="MSTVAEESARRRTFAVIAHPDAGKSTLTEALALHAHVIAEAGAVH
FT                   GKAGRKSTVSDWMEMEKDRGISIASSALQFEYLPENAPKGTEPYVINLVDTPGHADFSE
FT                   DTYRVLTAVDAAVMLIDGAKGLEPQTLKLFRVCKARGLPIITVINKWDRPGRAPLELMD
FT                   EIVDEIGLQPTPLFWPVGMAGDFHGLARRDADGDVTEYIHFLRTAGGSTIAPEEHYSPD
FT                   EASSKEGDVWDTAVEECELLTMDGAIHDQELFLDCTTSPVVFASAMLNFGVHQILDLLC
FT                   QLAPEPGPRKTDPKVLESAGKATGAIDTERSPEDPFSGVIFKVQAGMDTHHRDKLAFMR
FT                   VVSGEFDRGMQVTHAQSGRSFSTKYALTVFGRTRSTVETAYPGDIVGLVNAGSLAPGDT
FT                   IYEGTKVQFAPMPQFAPENFRTLRARSLGKYKQFRKALEQLSSEGVVQILRNDARGDAA
FT                   PVMAAVGPMQFEVMQARMANEYNVETETSPVPYSVARRTDHESAPELNRQRGVEVFTRD
FT                   DGELIALFGDKWKLQFIEREHPEFTLEPMVAD"
FT   gene            646001..647170
FT                   /locus_tag="ckrop_0539"
FT   CDS_pept        646001..647170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0539"
FT                   /product="hypothetical protein"
FT                   /function="Glutamate synthase domain 2"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17311"
FT                   /db_xref="GOA:C4LHK6"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHK6"
FT                   /protein_id="ACR17311.1"
FT                   /translation="MNETQNTQPKEAAQSTVKSRAYRTIIAAPMAGGPSSPALVDAVAA
FT                   HGVLGFLAAGYKTPEAVEKELDDVAQRARQRGAQPFYGLNLFVPQPSPSGVDRDRAAAY
FT                   RDELANDYERFGVAEPELNWTTDDQWEGKLAVIRRRLAQREQQGEGPADGDNHDEAVSV
FT                   PDVLSFTFGLPSEELVDEFQSRGIEVWATVATTHAAQTAADRGVAAVVVQGPEAGGHRA
FT                   TMTPDEEPGSEPLMSFVQAVSDLFANTDAPTRPAIIAAGGIATPDHVGEALRHGADAVA
FT                   AGTIFAATDEAGTNEPYKQALISATADDTVITRAYSGRPARGRRNAFIDAHPNAPSVYP
FT                   AVNGLTSPIRKAATKQEQTDSMSLWAGQSVEYAHGGTAGSVVDLLLQGR"
FT   gene            complement(647236..648909)
FT                   /gene="mez"
FT                   /locus_tag="ckrop_0541"
FT   CDS_pept        complement(647236..648909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mez"
FT                   /locus_tag="ckrop_0541"
FT                   /product="malate oxidoreductase"
FT                   /function="Malic enzyme"
FT                   /EC_number="1.1.1.38"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17312"
FT                   /db_xref="GOA:C4LHK7"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHK7"
FT                   /protein_id="ACR17312.1"
FT                   /translation="MSIRPNAITDPHMNRGTAYTYEERKKLGLTGRLPSGVETLESQAQ
FT                   RCYQQLSQFENNLNKYHYLDELHGRNETVYFKLLVDHLKELLPIVYDPTIGDAIENWSQ
FT                   DYRRSHAVYLSIDRVDEIRESFETLGLGPDDVDLIVCSDAEEILGIGDWGVNGTDIAIG
FT                   KLAIYTAAAGGDPSRVIAVNLDVGTDNEDLLNSPFYLGNRHARVRGERYDNLISEYLRV
FT                   ASDMFPNALLHFEDFGPSNARRILRDNADSYRIFNDDMQGTGAIVTAAVMAGMKANNTT
FT                   FADQRLVVYGAGTAGTGMADQIRAGMIRDGLSEEEATRRIWLIDVNGLVTDDMDNLPDY
FT                   QQTYARPASEVKDWGGKDGKIGLLDVVRHAQPTILIGTSTDHGAFTEPVIQEMAKHCDR
FT                   PIVLPLSNPTSRIEAMPADVVKWSDGRALVAAGIPVDDFEYNDVTYEFGQGNNALLYPG
FT                   LGLGVIVSRADRVTDGMLLAAASAVAKQVDASQLGAPILPPVENLRASSARVAEAVIRE
FT                   AVESGVAQNEPDNVVEAVRLAMWWPEYPDELATEHEGDKK"
FT   gene            649337..649753
FT                   /locus_tag="ckrop_0542"
FT   CDS_pept        649337..649753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0542"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17313"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHK8"
FT                   /protein_id="ACR17313.1"
FT                   /translation="MGKRKKRTSRQRAVSAYSYSSADVTIRRPCDADSGCDGERKPCPF
FT                   RDAEAAYEAQYYARLEARKKGVLFNETPSAMGATALHKEVAKCLEKGPKKKCCHSSPRC
FT                   MRCPYVFAQLRKVDTAELDDDNLKRTLQKLRNRR"
FT   gene            complement(649773..650441)
FT                   /locus_tag="ckrop_0543"
FT   CDS_pept        complement(649773..650441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0543"
FT                   /product="Peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17314"
FT                   /db_xref="GOA:C4LHK9"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHK9"
FT                   /protein_id="ACR17314.1"
FT                   /translation="MFSTSQSRGGSASRRSSAGSRGTDSQSFLVIGLGNPGSQYEGTRH
FT                   NIGQMALDEVASRALPVPVTLSTHKKTNTDSAEMSLSGPNGSSVSLILGRPRSYMNLSG
FT                   GPTSALARFFHISPQNVIVLHDDLDLDFGTVRLKRGGGEGGHNGLRDITKALGTKDYLR
FT                   VRLGIGRPPGRMSPADFVLKKFSTRESVDVDLMCSTAADAVELLATRGLEYAQNTIHGR
FT                   "
FT   gene            complement(650463..651119)
FT                   /locus_tag="ckrop_0544"
FT   CDS_pept        complement(650463..651119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0544"
FT                   /product="50S ribosomal protein L25"
FT                   /function="Ribosomal protein L25 (general stress protein
FT                   Ctc)"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17315"
FT                   /db_xref="GOA:C4LHL0"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHL0"
FT                   /protein_id="ACR17315.1"
FT                   /translation="MATNITDLEALPRHEFGKGASRRLRRAGRIPAVIYGKELDAPIHI
FT                   SVDSIEFHAVLRNHGANAIVDLNVDGEKHLTMVKAVDQNVLTLDADHADLLAIRRGEKV
FT                   EVEVPVVTEGEVAPGAMLMQDVDVIDVEADVLSIPEEITIDVEGLEVGTQITAGDVQMP
FT                   ANTTLISDPETLIVNVVVPEVADTDSDNEESTEAEEAEGEATEAEGESEEGESEE"
FT   gene            complement(651500..652492)
FT                   /gene="prsA"
FT                   /locus_tag="ckrop_0545"
FT   CDS_pept        complement(651500..652492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prsA"
FT                   /locus_tag="ckrop_0545"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /function="Phosphoribosylpyrophosphate synthetase"
FT                   /EC_number="2.7.6.1"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17316"
FT                   /db_xref="GOA:C4LHL1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHL1"
FT                   /protein_id="ACR17316.1"
FT                   /translation="MVNTERHTVNSHWTENQKNLMLFSGRAHPALGEQVAKELGIELTP
FT                   TTARDFANGEIFVRFEESVRGCDAFVLQSHPQPLNKWLMEQLIMIDALKRGSAKRITAI
FT                   LPFYPYARQDKKHRGREPISARLVADLLKSAGADRIVSVDLHTDQIQGFFDGPVDHMHA
FT                   MPILTDYVKANYDTSNIVVVSPDAGRVKVAEKWAQVLGNAPLAFVHKTRDIDVANKITS
FT                   NRVVGDVSGRTCVLLDDMIDTGGTIAGAVKVLREAGANDVIIATTHGVFSDPARERLSE
FT                   CGAREVITTDTLPQNTDHWDNLTVLSIAPLLAKTIHEIFENGSVTNLFE"
FT   gene            complement(652589..654049)
FT                   /gene="glmU"
FT                   /locus_tag="ckrop_0546"
FT   CDS_pept        complement(652589..654049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmU"
FT                   /locus_tag="ckrop_0546"
FT                   /product="glucosamine-1-phosphate N-acetyltransferase /
FT                   UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /function="N-acetylglucosamine-1-phosphate
FT                   uridyltransferase (contains nucleotidyltransferase and I-
FT                   patch acetyltransferase domains)"
FT                   /EC_number="2.7.7.23"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17317"
FT                   /db_xref="GOA:C4LHL2"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHL2"
FT                   /protein_id="ACR17317.1"
FT                   /translation="MKSDTPKMLHQIGGRSLLSHSLYAAKGLNPDHLVVVVGHQKELVA
FT                   QAVEAWQEETSTTSGVALAHQEQQNGTGHAVMCGMDSDELAGFTGTVVVTNADVPLLSS
FT                   STLDSLVNAHTHAPAAAVTVLTVEAPTPTGYGRIIRNADGEVTAIVEEKDATEDQRRIK
FT                   EVNTGVFAFDADVLRSSLGKLDTNNAQGEMYLTDVLGIARNEGLIARGHMAHDPAELAG
FT                   VNDRVQLAAAGRVLNRHICEQHMRNGATIIDPESTWIDVDVTIGRDVTIHPGTQLHGTT
FT                   HIEDNAEIGPDTTLTNVTVGSGTQVVRSHGSDSTIGSNAHVGPFSYLRPGTHLGDEGKI
FT                   GTYVETKNATIGRGTKVPHLTYVGDATIGEYSNIGCSSVFANYDGVNKHHTTVGSHVRT
FT                   GSDTTFVAPVTVGDGAYSGAGTVITDDVPAGALVVPGARQRVIEGWVAKKRPGTAAARA
FT                   AEAAGTPESTGKAPSNSAPSDNSRTNRT"
FT   gene            complement(654157..654231)
FT                   /locus_tag="ckrop_t0016"
FT   tRNA            complement(654157..654231)
FT                   /locus_tag="ckrop_t0016"
FT                   /product="tRNA-Gln"
FT                   /anticodon="(pos:654196..654198,aa:Gln,seq:ttg)"
FT   gene            654369..655406
FT                   /locus_tag="ckrop_0547"
FT   CDS_pept        654369..655406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0547"
FT                   /product="transcriptional regulator, TetR family"
FT                   /function="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17318"
FT                   /db_xref="GOA:C4LHL3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHL3"
FT                   /protein_id="ACR17318.1"
FT                   /translation="MRLLCSHRSRSASRFLVFYIFLALRQRGVRSRYPEDMTRQRMSAA
FT                   ERRSQLIAMSRPVFAEKGIEGTSVEELAARAGVSKPVIYEHFGGKEGLYQAVIDEDMVA
FT                   LDRTIDEALVQGRSRIRIERAVYAVLDFAEKNEEGFRILARDGAVVGAVGRSSQSKAAS
FT                   HHGKSAEDHSSAEDGVHSTLLGLSVNRASHILADAFKRNGLDERLAELYAQGMMGCVAM
FT                   VAQWWTVNSMGVGSESSANSVGSEKGGAAGSGSDGDSDSDNTHVFPKDAVAAHIVNLMW
FT                   NGLAGMEKDPILHEDVEGEAGQQGVRLGAGKDADPAEVYRQQQRDAEQSSSSTSEGQDS
FT                   DETDD"
FT   gene            655452..659297
FT                   /locus_tag="ckrop_0548"
FT   CDS_pept        655452..659297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0548"
FT                   /product="transcription-repair coupling factor"
FT                   /function="Transcription-repair coupling factor
FT                   (superfamily II helicase)"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17319"
FT                   /db_xref="GOA:C4LHL4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHL4"
FT                   /protein_id="ACR17319.1"
FT                   /translation="MTHTSAQTPMPPSDASASDAARAAVRKPEGKDASEGLGWPPLAGV
FT                   VQLALQSPKLQGVLASVGEPRLHISAIDEARSWVARAIAEKSVVVIVTATSREAQDLTA
FT                   ELRDMMGDAVAMFPAWETLPHERLSPGSETVGARLKVLRRLAHPHDIPGEQPIRIVVAP
FT                   ARSFIQPIMKGLGEREPIILAEDTDVTGIATRLAEMGYQHVDLVGKRGEFAVRGGVVDI
FT                   FPSTAELPVRAELWGDEISDLRAFSVGDQRTIENFDPGAVPVYPCRELRIDDAVRARAE
FT                   KMARTHASNATLADALTKISEGVAVEGMESLIPVLFDGPMVTLPEEVAAADPSVTTTVL
FT                   VMSPEKVQRRADDLIATGKEFVKAGWEAAAMGAESPIDTAALAEAEDGNDDLNVDQSAY
FT                   RSLGAMEKTAEHHGLSWWTCAPPGFLGSAEASSTLELDFSTGPQPKGKPGDVEKAMSEL
FT                   HDHVAHGGRLVFTALTPASAQRMSGRFREAGIGVTPDADPQNPSAPGKATVIRAVLHGG
FT                   LVIPHVDDARPLLVVAETDFTGNRIVAYGDGRRRPWRKRNRVDPLSLNPGDLVVHETHG
FT                   IGRFVKMQERTVGKGADATRREYMVLEYAPSKRGGAADHLYVPMDSLDLLSRYVGGENP
FT                   SLSKMGGSDWKNTKKKARAAVRDIAADLVQLYAKRQAAPGYAFSPDTPWQREMEDNFPF
FT                   TETEDQYNAIEAVKEDMEKPVPMDRVIVGDVGYGKTEVAVRAAFKAVQDGKQVVLLVPT
FT                   TLLAQQHFATFSERMEGFPITIRQLSRFTTPKQAREVLTGLAEGQVDIVIGTHRLLQTG
FT                   VQWKNLGLVIVDEEQRFGVEHKEHIKALRSHVDMLTMSATPIPRTLEMSMAGIRDMSTI
FT                   LTPPEDRHPVLTYVGVQEDKQIAAAIRRELLRDGQVFYVHNRVRSIEQVAQHIRELVPE
FT                   ARVVVAHGQMNEDQLENTVEGFWDREYDVLVCTTIVETGLDISNANTLIVENAHHMGLA
FT                   QLHQLRGRVGRSRERGYAYFLYPPSQTLTETSYDRLSTIAQNNDLGAGMAVAMKDLEMR
FT                   GAGNVLGAEQSGHIAGVGFDLYVRLVGEAVEAFKAMADGKPIDGSDKENKETRIDINVD
FT                   AHIPTSYIASERLRLAAYRDLAQAKNEEALQNVRAELVDRYGQPPQEIDRLLAVARLRM
FT                   VCRECGVTDVVATGANKAAISFSPIELPDSGRVRLGRLYPGAQYRATTHNVVVPAPKKG
FT                   RGIRAQAVKDEELLQWCADVMTSLLGKPHREVASGVQPDTAGGKSHQKNSTKSKVR"
FT   gene            659307..660419
FT                   /locus_tag="ckrop_0549"
FT   CDS_pept        659307..660419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0549"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17320"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHL5"
FT                   /protein_id="ACR17320.1"
FT                   /translation="MSVIVLDPRFPGMLPVDAVSLVGNDVCYTEEVPVRIRWVIADLGG
FT                   HVVDDTDTLITTDPYNEWVRERLHSGDQLLVAPSLYFQRRPDRALASGSSNNALSSGAS
FT                   GELEGIEAENPAAYPDYDFALKAIPQLTDGAETSEEAYAEDSSAEDSSAGESDYPSDQR
FT                   NGGDQDGTGSAGAGVIHGTAVVGDGADGETADDENTGGIDETTESGDASSPSQSEIPEA
FT                   VLNEIEEAIAVMSRALHQGEWEQSQSHQSLLAYLREEVEELAQSIDTWQAGDLASEKRL
FT                   CDELSDIFLQVLFHAEIANRRGAFDIGHVAASFVHKMRTRAPYLFEETERPVGLDEQNR
FT                   LWEEGKRREQSAADESWSAPASHEDPGSSS"
FT   gene            660459..661229
FT                   /locus_tag="ckrop_0550"
FT   CDS_pept        660459..661229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0550"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17321"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031304"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHL6"
FT                   /protein_id="ACR17321.1"
FT                   /translation="MKSARTLIAVFAVLALVIVTIGWLVSHVHTDSSSMRKPIPSDVPP
FT                   PNGVAAPAVDTSKHTRTSEEFRTWAEPISKKTGISVEALSAYANANVVARHSKPGCHLG
FT                   WTTLAGLGWVETRHGTYNGHHFDSVSIDSNGDVKPHIRGVQLDGAPGLENLPDTDNGEL
FT                   DGDKEKDRAMGPLQFIPQSWEKYGVDANADGKADPDNIDDAAVAAVNLLCDFDRDLSTA
FT                   DGWKSAVRSYNNSAQYVEDVRRAAANYSLQQKPA"
FT   gene            661595..662878
FT                   /gene="eno"
FT                   /locus_tag="ckrop_0551"
FT   CDS_pept        661595..662878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eno"
FT                   /locus_tag="ckrop_0551"
FT                   /product="Enolase"
FT                   /EC_number="4.2.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17322"
FT                   /db_xref="GOA:C4LHL7"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4LHL7"
FT                   /protein_id="ACR17322.1"
FT                   /translation="MAQIIDVQAREILDSRGNPTVEVEVLLDDASFGRAGVPSGASTGV
FT                   HEAHELRDGGDRYLGKGVRQAVENVNEKIAPAVTGLEADDQRLVDKVMLDLDGSDNKSN
FT                   LGANAILGVSLATAKAAASSANLELFRYLGGPNAHVLPVPMMNIVNGGAHADSGVDVQE
FT                   FMIAPIGADSFREALRMGAEVYHNLKSVIKSKGLSTGLGDEGGFAPSVDSTKEALDLIA
FT                   EAVKKAGYKLGEDIAFALDAASSEFYDKDKGVYNFEGGEHSAEDMVKVYEELVENYPIV
FT                   SIEDPLQEDDWEGYTKLTAEIGDKVQIVGDDFFVTNPARLKEGIEKKAANALLVKVNQI
FT                   GSLSETADAVQLAQNNNYRCMMSHRSGETEDTTIADLSVAYSCGQIKSGAPARSERVAK
FT                   YNQLLRIEEFLGDAAVYAGRSAFPRFNG"
FT   gene            662890..663693
FT                   /gene="ftsB"
FT                   /locus_tag="ckrop_0552"
FT   CDS_pept        662890..663693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsB"
FT                   /locus_tag="ckrop_0552"
FT                   /product="cell division protein FtsB"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17323"
FT                   /db_xref="GOA:C4LHL8"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHL8"
FT                   /protein_id="ACR17323.1"
FT                   /translation="MARTPESGSPAGSDSLAAGGERDHADSATAASTAADHRMNGRQVG
FT                   KPDEGVTASDSDAGVESDTASERKGTLPKPARQSRRRRAQRRLREFRFGGSRKQWVLTV
FT                   PSQQSAVRLIILACLVVAMTMTVAPPLKSYFQQRSELQQLHIDIAHQEEEKTELQKQLD
FT                   LYNDDDFVKEQARLRLGMVERGETSWRIIDPSITTGAPEESDSKKDEHQDPWYTQLWSS
FT                   VREKPSDKEQHEDEAPSLGVPTVNDPDPNRQAPAPANANQVQPGN"
FT   gene            663752..665338
FT                   /gene="ppx2"
FT                   /locus_tag="ckrop_0553"
FT   CDS_pept        663752..665338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppx2"
FT                   /locus_tag="ckrop_0553"
FT                   /product="Exopolyphosphatase"
FT                   /EC_number="3.6.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17324"
FT                   /db_xref="GOA:C4LHL9"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="InterPro:IPR007511"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHL9"
FT                   /protein_id="ACR17324.1"
FT                   /translation="MDMTSFSGVSDDDMAIMTDQLGRRPRGALEVAYRTPDGQPAVVTT
FT                   APRLDDGTPFPTLYYLTDPRLTAEASRLEVAGVMKWMTERLETDEALAADYRAAHENYL
FT                   SVRNSIEDLGTSFSGGGMPDRVKCLHVLMAYALAEGPDTVRLGTETVALALAQNPELRG
FT                   TALPDQWPTVEELGISLPMATDSTLEAQSAESSNAPNKTPGTLSLAAVDCGTNSIRLLI
FT                   TDVDAQSGSVVREVTRKNTIVRLGEGVDSSGQLSPAAIERTRVALRGYVDMMLDHGVSA
FT                   VRMVATSATRDASNRDDFFAMTKAELGRVAPGAVAEVIEGTEEARLSYLGATMDVDAEG
FT                   RVVVIDVGGGSTEFVVGDKDGDVVGAVSTQMGSVRLSERFLHTDPPTNAECAAAREVVD
FT                   KNLREAAEELPLADVATVVGCAGTFTTVSAVVQDLPEYLPEKIHLSTLDADDILATTAK
FT                   VRAETVEQRKARPQILPGRADVIGGGTLIIDAIVEFFHAKAGIEQITVSEKDILDGIIA
FT                   GLARRQVSFEA"
FT   gene            665429..665502
FT                   /locus_tag="ckrop_t0017"
FT   tRNA            665429..665502
FT                   /locus_tag="ckrop_t0017"
FT                   /product="tRNA-Leu"
FT                   /anticodon="(pos:665463..665465,aa:Leu,seq:taa)"
FT   gene            complement(665757..666395)
FT                   /locus_tag="ckrop_0554"
FT   CDS_pept        complement(665757..666395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0554"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17325"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHM0"
FT                   /protein_id="ACR17325.1"
FT                   /translation="MRKQLVGATLTALVVALPLTACTSQNTAQTAEEAASTATTALPST
FT                   TSPGSDTPTSEQDNPKKETQTSQNKADNVDKHSDSHKQENNKTAQNHAQQPSTGQHATQ
FT                   KKTVETQAAGFHKAPPATQTTDNSGSTYQPEDIEPGETPTMQRHMHLKPEDIDPDLANY
FT                   TGPTYGVTNVTEGAYCTNYGAGSTGTTADEKNLVCIVRVGEENPQWSPY"
FT   gene            complement(666494..666703)
FT                   /locus_tag="ckrop_0555"
FT   CDS_pept        complement(666494..666703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0555"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17326"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHM1"
FT                   /protein_id="ACR17326.1"
FT                   /translation="MFGQKSATIKQLKRQNELLAQQIQGTDNKLNRTGQELINQTEDGQ
FT                   VLYVSSRKHRKLFNVGSTANNHHI"
FT   gene            667146..667325
FT                   /locus_tag="ckrop_0556"
FT   CDS_pept        667146..667325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0556"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17327"
FT                   /db_xref="GOA:C4LHM2"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHM2"
FT                   /protein_id="ACR17327.1"
FT                   /translation="MLIAIPLVIFIGGLVSIVSSSRYTVFGKIIWIVVTFAFPILGPIV
FT                   WFIWGRNAESIVKN"
FT   gene            667780..667977
FT                   /locus_tag="ckrop_0557"
FT   CDS_pept        667780..667977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0557"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17328"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHM3"
FT                   /protein_id="ACR17328.1"
FT                   /translation="MPYPPRGDVAYTVAPNSLFVEKFQSFFWTVVERNVYQAVVSHSTT
FT                   FAVAFRGKFCLSFGDLMRKN"
FT   gene            complement(668601..669407)
FT                   /locus_tag="ckrop_0558"
FT   CDS_pept        complement(668601..669407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0558"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17329"
FT                   /db_xref="GOA:C4LHM4"
FT                   /db_xref="InterPro:IPR011434"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHM4"
FT                   /protein_id="ACR17329.1"
FT                   /translation="MNSTAETPTPTSNPLRKRELLMKIVPTNTKTGKDKAIVVAWWLMA
FT                   LFAIISLFTGGNASSRMGGFLFFAIIAALLSYVAARRIQDQQSGEHTPRNWKVVAPVAA
FT                   IALIAAMAIGGSGSDTNAKDSSTATTGKSASTEPPTQEVANDTADAVAPNPAPQETSTK
FT                   VSAPTTDSGKSSSSAEQKKALAKAKVYTTMAGFSKDKLYEQLTSDYGEKFSPDAAQYAV
FT                   DHVDVDWNEQALKSAKNYEKTMNMSRDAIYDQLTSDYGEKFTPDQA"
FT   gene            complement(670626..671000)
FT                   /locus_tag="ckrop_0559"
FT   CDS_pept        complement(670626..671000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0559"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17330"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHM5"
FT                   /protein_id="ACR17330.1"
FT                   /translation="MKNTKAILGSLALAGALTVGAPAAHAAEAPSTPAAASTQQEESAT
FT                   SSGQQKDVGTDGAEHKAYVAKCTLSTLGGTLTGILTGATAGTVFGPGVGNIVGAVIGGL
FT                   GGGITGGLAGCLPAEDNAAK"
FT   gene            complement(671189..671797)
FT                   /locus_tag="ckrop_0560"
FT   CDS_pept        complement(671189..671797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0560"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17331"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHM6"
FT                   /protein_id="ACR17331.1"
FT                   /translation="MHLSRSTVVLSSAVVAATLVLTSCSHDNSSSSTSTSLVTTSPSSS
FT                   SPSLSPSSESPSSEEPKSAENPDEKDEPTKENDNKDNKDGDKGTENKNKAENKLNNNKI
FT                   DDNKPKDNPAPPAAPAPAPNNDGGNQQAEAQNQQPSQEDTQPSETYHLQPWENFTVKYP
FT                   VVENSPCGPELDRGATGQTEQGKPLRCSDSTNPKWVPWK"
FT   gene            672214..673095
FT                   /locus_tag="ckrop_0561"
FT   CDS_pept        672214..673095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0561"
FT                   /product="putative membrane protein"
FT                   /function="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17332"
FT                   /db_xref="GOA:C4LHM7"
FT                   /db_xref="InterPro:IPR010539"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHM7"
FT                   /protein_id="ACR17332.1"
FT                   /translation="MRSSNPYFSSLTEERKREARSSQGEYVFGQGQDAQQFGQRGASMA
FT                   GAQQFGQQTMQQQAQGTTAERGMTIDDVIVKTSITLGVIIVGAVINYMLSLSNPQVSSL
FT                   LTMVGAIGGLIMVMVSTFGKKFGSPVVTLLYAAFEGLFVGGLTSVFANVMVSGANAGTI
FT                   IGQAVLGTIGVFIGMLIVYRTGAIRVTPKFNRIMLGALVGVLVLALGNMLLAVFTGHNP
FT                   LTDGGPLAIGFSLLCIGLAALSFLQDFDTADQLVRAGAPSKMAWGVALGLAVTLVWLYT
FT                   EILRLLSYANRN"
FT   gene            complement(673314..673820)
FT                   /gene="greA"
FT                   /locus_tag="ckrop_0562"
FT   CDS_pept        complement(673314..673820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="greA"
FT                   /locus_tag="ckrop_0562"
FT                   /product="Transcription elongation factor"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17333"
FT                   /db_xref="GOA:C4LHM8"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHM8"
FT                   /protein_id="ACR17333.1"
FT                   /translation="MAEDTNTRWLTQEAYDRLKKELDDLKANRPVIAAEINERREEGDL
FT                   KENGGYHAAREQQGQEEARIAYLEELLDSATIGEAPSQSGVALVGSVVHVYYDGDEDDT
FT                   ETFLIGTRGVHSSNTDLETYSTDAPLGAAIVGAKEGETREYQTPNGSTVSVTIVKAEPY
FT                   DESKK"
FT   gene            complement(673942..674397)
FT                   /locus_tag="ckrop_0563"
FT   CDS_pept        complement(673942..674397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0563"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17334"
FT                   /db_xref="GOA:C4LHM9"
FT                   /db_xref="InterPro:IPR025443"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHM9"
FT                   /protein_id="ACR17334.1"
FT                   /translation="MTDQDSQSPTSQTIEEQRYGSSRSASISGKVIIIGVVLVLVISGL
FT                   YMWNQWRNESSPDVSISSAGFDRPNDSLLNFTVDVTRDDASRAAYCIVTALDYDKNEVG
FT                   RREFMIPSGGEKTERFKVAIPTRARAVAGKEYGCSTEIPGYLDGSDT"
FT   gene            674752..675690
FT                   /locus_tag="ckrop_0564"
FT   CDS_pept        674752..675690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0564"
FT                   /product="mycothiol conjugate amidase"
FT                   /function="Uncharacterized proteins LmbE homologs"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17335"
FT                   /db_xref="GOA:C4LHN0"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR017811"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHN0"
FT                   /protein_id="ACR17335.1"
FT                   /translation="MTGFRLLAIHAHPDDESSKGAATLARYANEGNEVMVLTCTGGERG
FT                   SILNPAMDRPEVRENMIELRKKEMAKAAEILGIKQRWLGYVDSGLPEGDPLPPLPEGSF
FT                   ALANTEEATADVVEVIRDFRPHVMITYDENGGYPHPDHIKTHAVSVRAWLRAGDPDFHP
FT                   EKGEPWVVSKMYYTHGFVKSRFLALHNDFINRGLPSPYQDRVDKADEWPDLMERVTTQV
FT                   NVADFFHKRDDALRAHATQIDPHSRWFAVSPEDQRRVWPTEEFELAASRVDTSLPENDL
FT                   FAGIDPDHQPDNVPGMVSEAARQEYSQGDDD"
FT   gene            675910..676344
FT                   /locus_tag="ckrop_0565"
FT   CDS_pept        675910..676344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0565"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17336"
FT                   /db_xref="GOA:C4LHN1"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHN1"
FT                   /protein_id="ACR17336.1"
FT                   /translation="MAVIMGYHVAAELVSLGGAKLSTMSTHLAVTTGGILAQQEKGGPL
FT                   GPEFGKASPVGLLILIALLVVVIILGRSATKRIKNLNRRRAFAEKEGIDVFDAEEIDRR
FT                   MAKKGLQDVNANSRFPEVRLKHKSRPTQSRSKKADGTTDK"
FT   gene            676373..677503
FT                   /gene="aroF"
FT                   /locus_tag="ckrop_0566"
FT   CDS_pept        676373..677503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroF"
FT                   /locus_tag="ckrop_0566"
FT                   /product="phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /function="3-deoxy-D-arabino-heptulosonate 7-phosphate
FT                   (DAHP) synthase"
FT                   /EC_number="2.5.1.54"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17337"
FT                   /db_xref="GOA:C4LHN2"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHN2"
FT                   /protein_id="ACR17337.1"
FT                   /translation="MRPISGTSPVASHNAATVTSAPRTDVSPVRLLPSPRELRHDIDLD
FT                   VDARRLVESSRRTIANIIHGRDHRLLVIVGPCSIHDRDAAYDYATRLAEQARRYSDRLF
FT                   IVMRVYGEKPRTTVGWKGLVNDPDLDGSGDITRGLALEREVFRDVLSLGLPTATEFVEP
FT                   LATSYIYDAVSWGAIGARTVESQVHRQLASSLPMPIGFKNATDGSIQQAIDAIRAASAA
FT                   HRFVGADDDGRVGVISSTGNADGHVILRGGESGPNYGTESVLTATDRLTAAGLHPAVTI
FT                   DASHGNSGKDHIRQRAVVTDIAERIAESEPGINGVMMESFLVPGKQTHDEDMIRRHGKE
FT                   ALKYGQSITDACMGWDATVSAFDELARAVHTRGHSR"
FT   gene            677513..678493
FT                   /locus_tag="ckrop_0567"
FT   CDS_pept        677513..678493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0567"
FT                   /product="Undecaprenyl pyrophosphate synthase"
FT                   /EC_number="2.5.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17338"
FT                   /db_xref="GOA:C4LHN3"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHN3"
FT                   /protein_id="ACR17338.1"
FT                   /translation="MSVTIPPNTRCDDGRAPESRLVSSVRQAGKRARAACKRVALMATY
FT                   PLYEASLVRALQGKPVPRHIAVMCDGNRRWAREAGFIDVSHGHRVGAKKISELVQWSGE
FT                   RGVELVTIYLLSTENLHRDKAELELLYRIIGDVSDELAKSKLNARLRVVGHRDILPDAL
FT                   TDRLAANEKATADHTGVCVNMAVGYGGRQEIVDAVRSLLEDRVKEKHEASRESSAKDDE
FT                   GAHQVDSASSSKASELGDDQRFSLDDIAEAITVQGISDHLYTSGQPDPDLVIRTSGEQR
FT                   LSGFLLWQSAYSEIWFTDTYWPAFRRVDFLRALRDFSRRNRRFGR"
FT   gene            complement(678507..679442)
FT                   /locus_tag="ckrop_0568"
FT   CDS_pept        complement(678507..679442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0568"
FT                   /product="pantothenate kinase"
FT                   /function="Panthothenate kinase"
FT                   /EC_number="2.7.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17339"
FT                   /db_xref="GOA:C4LHN4"
FT                   /db_xref="InterPro:IPR004566"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHN4"
FT                   /protein_id="ACR17339.1"
FT                   /translation="MEDMSRATESSPYLEFNRHQWKRLRMSQPQVLTEAEVKELRGVGE
FT                   NIALDEVTEVYLPLSRLIHLQVEAHQRLGQATATFLGEDVPHIPFIIGIAGSVAVGKST
FT                   TARLLQRLLQRWDSHPKVDLVTTDGFLYPTAELTRRGTLDRKGYPESFNRRALLRFITD
FT                   VKAGSRNVRVPVYSHELYDIVPDTFITVDRPDILIIEGLNVLQTGPTLMVSDFFEFSVY
FT                   VDAHPRDIEQWYVDRFLQLRHISFSDPDAHFHHFAELDDDTAIREAREIWQRVNLPNLT
FT                   ENVLPTRPRASLVLMKGEDHSVQRVRMRKV"
FT   gene            679551..680897
FT                   /locus_tag="ckrop_0569"
FT   CDS_pept        679551..680897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0569"
FT                   /product="serine hydroxymethyltransferase"
FT                   /function="Glycine/serine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17340"
FT                   /db_xref="GOA:C4LHN5"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHN5"
FT                   /protein_id="ACR17340.1"
FT                   /translation="MSNSSSRTTPSTANTPDQLLNQPLSQLDPEVADAIAGELSRQRNT
FT                   LEMIASENFVPRAVLQAQGSVLTNKYAEGYPGRRYYGGCENVDIIEDLARDRAKEVFGA
FT                   KYANVQPHSGAQANAAVLMAIAKPGDTILGLSLAHGGHLTHGMKLNFSGKLYNAVAYEV
FT                   DPTTMTIDMKKVRQQALEEKPSVIIAGWSAYPRHEDFAAFREIADEVGATLWVDMAHFA
FT                   GLVAAGLHPSPVPYADVVSTTIHKTLGGPRSGMILTNDLDLFKKINSAVFPGQQGGPLM
FT                   HAIAGKAVAMKIAGSEEFRDRQRRTIAGARILANRLTQDDAGEAGIDVLTGGTDVHLVL
FT                   VDLRHSSLNGQEAEDALHDGGITVNRNAVPFDPRPPMVTSGLRIGTSALATRGFDQEAF
FT                   GEVADIIAETLISGHQGKSDEVRDELRQRVEALAAKFPLYDGLEDWTLM"
FT   gene            680900..681526
FT                   /locus_tag="ckrop_0570"
FT   CDS_pept        680900..681526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0570"
FT                   /product="pyrazinamidase / nicotinamidase"
FT                   /function="Amidases related to nicotinamidase"
FT                   /EC_number="3.5.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17341"
FT                   /db_xref="GOA:C4LHN6"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHN6"
FT                   /protein_id="ACR17341.1"
FT                   /translation="MRDTNSSLRTHRCLVIVDVQNDFCPGGALACEGGDTVATGISEYV
FT                   QRPDVAAKYDFIVGTKDWHIDPGSHFAPPGVEPDFVETWPVHCKVGTSGAESHPNLDVS
FT                   SVDYWFLKGEYEAAYSGFEGYLEGTDEASGGGQPERLGPWLRKQGIESIDVCGIATDFC
FT                   AKATVLDGIAEGFTVTLLPDLCAGVAPESSAKAVEDMKHAGASVR"
FT   gene            682131..683306
FT                   /gene="fadE1"
FT                   /locus_tag="ckrop_0571"
FT   CDS_pept        682131..683306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadE1"
FT                   /locus_tag="ckrop_0571"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /function="Acyl-CoA dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17342"
FT                   /db_xref="GOA:C4LHN7"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHN7"
FT                   /protein_id="ACR17342.1"
FT                   /translation="MKNFLPRTIFDDEHKMFRETARDFVAKEITPHVDQWHEQGYCDRD
FT                   MYKKAGELGLLGITADEKFGGGGMDDWRFNAILSEELAQSDCGSVIVSVQTINDLVVPY
FT                   LERFANDEQKERFLRPLCAGEKIAAIAMTEPGAGADLAGIRTLAKKDADGNYIVNGAKT
FT                   FISNGVQADFTIIVAVTDPEKGRAGVSLLIVEDGMEGYTKTGPLKKVGLKAQDTAELSF
FT                   ENVTVPAENLLGEEGAGFGYLRHNLAQERLSIAVGSVATSRRAFDLVYQHSQDRKTFGK
FT                   RLVDHQAYGWMLAEMATKIQAAQSFVDACIEAKVKGELDETTAAMAKWWTTDLQVEVVN
FT                   NALQMHGGYGFMMEYPIATHYLDTRVQPIYGGPNEIMKEIIARRLAKGAGK"
FT   gene            683372..684199
FT                   /gene="echA4"
FT                   /locus_tag="ckrop_0572"
FT   CDS_pept        683372..684199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="echA4"
FT                   /locus_tag="ckrop_0572"
FT                   /product="enoyl-CoA hydratase"
FT                   /function="Enoyl-CoA hydratase/carnithine racemase"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17343"
FT                   /db_xref="GOA:C4LHN8"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHN8"
FT                   /protein_id="ACR17343.1"
FT                   /translation="MSDERDVVGVDNLDVETGQPTSVAEAASGVVRVITLRRPEGYNAI
FT                   NKALRTRLREEFEAATDPSVRAVLLTAEGKSFCVGQDLKEHLQDLSTGQGMGKVVDEYN
FT                   PMVEALLGIKVPIVAAISGPAAGAGWSLALNCDFRIASRGASFTASFAGVGLASDCGLS
FT                   HTLTSIVGPAKALDLLCRDQQLTAERAYDLGLVTEVTDDDRADEAATTFALALANGPTK
FT                   SFCEIKSLVRDEQAVMSAAAREADAQARLAFTEDHQEAVRSFVEKRKPQFKGR"
FT   gene            complement(684219..684623)
FT                   /locus_tag="ckrop_0573"
FT   CDS_pept        complement(684219..684623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0573"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17344"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHN9"
FT                   /protein_id="ACR17344.1"
FT                   /translation="MNDTHSHSDHTPGAQPSSTRMKPMTAAKKLSIFLPAAPEEFQKTA
FT                   LTHDEFVGLQNNPPQWLKDLRANGPHPRAEVARKLGVTAAALKRNDMDKPLTTAEINDL
FT                   LSDQPEWLQEERKSLAEERERRHAANESHK"
FT   gene            684742..685359
FT                   /locus_tag="ckrop_0574"
FT   CDS_pept        684742..685359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0574"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17345"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHP0"
FT                   /protein_id="ACR17345.1"
FT                   /translation="MTEYLKVAFVPGLLPDKWFRRFDERHGGASRGANRRVRIASAAAD
FT                   DPLPYVLHGKADVAFVRMDSRGREGVVKDAEARGQSIHIIELYEEQPGVAVPKDNPIAL
FT                   FPQVSSQDLEDEKIMWAPQPPDFPVDIADVRAALEVVAANVGVVIAPRPLLRVINKRGV
FT                   KDVALSDGRPTQLAMVWLQSCDNRDIQNLVGIVRGRTARSSR"
FT   gene            685420..685893
FT                   /locus_tag="ckrop_0575"
FT   CDS_pept        685420..685893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0575"
FT                   /product="putative acetyltransferase"
FT                   /function="Acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17346"
FT                   /db_xref="GOA:C4LHP1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHP1"
FT                   /protein_id="ACR17346.1"
FT                   /translation="MTRDDYPDVARIHQAGLNTGNGAYEASPVTWEEFVDKKIPELCFV
FT                   AEDEGTILGWVALMPFYHRPSLTGFLEDSIYIDPAASGRGVGTALLEHSAAKAKEWGAW
FT                   TITGWIFEDNSASQALHAKAGFRKVGTLQRHGWMDYGPWSDRYRQCAIYEKLL"
FT   gene            complement(686012..687697)
FT                   /locus_tag="ckrop_0576"
FT   CDS_pept        complement(686012..687697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0576"
FT                   /product="permease of the major facilitator superfamily"
FT                   /function="Permeases of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17347"
FT                   /db_xref="GOA:C4LHP2"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHP2"
FT                   /protein_id="ACR17347.1"
FT                   /translation="MSKHNGAHSDATSDNAVNTSGQHLSSRVITPESVKDIDSPADQTS
FT                   QTTEGTSSAPKNKSNIPAVMVAIMSAMLLASLDQMLFSTAFPTIVGDLGGVEHMSWVIT
FT                   SYLLCQTIMMPIYGKLGDQIGRKPIFVGAIAIFLIGSIIGGLSQSMAQLIIGRGIQGLG
FT                   GGGLMILSQAIMADVVPPRERGKYAGWMGSVFGVSSVLGPVLGGWFTDGPGWRWAFWIN
FT                   LPVGLLAVAIALFALKLPKRGTGLKLDYFGIIFMATSASCLILFTSWGGNQYSWSSPTI
FT                   IGLEIGTVVAAAIFVFIELHAKDPLIPMSLFKNRNFNLVTLGGLCVGIVMFGVMSYMPT
FT                   YFQMVHNMNPTTSGFMMISMMVGLMGTSIGLGNVVTRTGKYRIYPPIGMLIVVASCVLL
FT                   HRITVDTSLWYLGLCLFIMGVGLGMTMQILILVVQNSFPIQKVGVATGSNNFFRQIGSS
FT                   LGSALVGGIFTNRISELVADRMPAAMAQLPPEVQQKFAQQSSGLDADSLTPELVGSLPG
FT                   PLKDMFMGAYNDALTPVFIVVIPFAVLAFILFALVREEKLRNSV"
FT   gene            complement(687712..688644)
FT                   /locus_tag="ckrop_0577"
FT   CDS_pept        complement(687712..688644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0577"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17348"
FT                   /db_xref="GOA:C4LHP3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHP3"
FT                   /protein_id="ACR17348.1"
FT                   /translation="MQTFTDRNFALSAELGLWLSLVESNRNYLDTEGTHAPRGLRERKR
FT                   LETLCAIEDHATRLVLDKGYDNVTIEDIFDAANISKRTFFNYVDSKEIAVLGHPVVDIP
FT                   DEERKEFLAADPQHVTVALVDLILQTSFASRGRSDEFSALLRSRRKEIIRDNPNIAAPL
FT                   FGLTIQRFHNIVKLVDEFFTLHPERRSLPQTAFPSTENTGGVSEEAVTLTMLCQDAVRI
FT                   GTLRWTRQPDSTNGHRRLRDCCLGAFTLFYDVLGAPPPECLADSTPPRAASERQSSNNT
FT                   NLNITDDHSTNVDKKNKNNNDGDERNDEK"
FT   gene            complement(688798..690201)
FT                   /gene="fum"
FT                   /locus_tag="ckrop_0578"
FT   CDS_pept        complement(688798..690201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fum"
FT                   /locus_tag="ckrop_0578"
FT                   /product="Fumarase"
FT                   /EC_number="4.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17349"
FT                   /db_xref="GOA:C4LHP4"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR005677"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHP4"
FT                   /protein_id="ACR17349.1"
FT                   /translation="MSDQEYRIEHDTMGEVKVPAAALWRAQTQRAVQNFPVSGRGLEHA
FT                   QIRAMGLLKAACAQVNLDRGLLSEEKGKAIIAAATDIADGKHDKEFPIDVFQTGSGTSS
FT                   NMNTNEVIASICKNNGVEVHPNDDVNMGQSSNDTFPTATHVATTEAAVKDLIPALTTLH
FT                   KSLSAKATEWEEVVKSGRTHLMDAVPVTLGQEFSGYARQIEAGIERVKATLPRVGELPI
FT                   GGTAVGTGLNTTEDFGDKVTAELVKLTGVEELRPCINHFEAQANRDGLVEMSGALRSIA
FT                   VSLNKIANDIRWMGSGPLTGLGEIHLPDLQPGSSIMPGKVNPVMCETATQVACQVIGND
FT                   AAIAAGGMQGAFELNVFIPMMARNVLESIRLLSNTAVIFAEKMVDGIEPNAERMRTLAE
FT                   SSPSIVTPLNSAIGYEAAAKVAKTALKEGKTIRQTVIDLGFVDGEKLTEEELDKRLDVL
FT                   AMANTDRDK"
FT   gene            complement(690459..691463)
FT                   /gene="pfkB"
FT                   /locus_tag="ckrop_0579"
FT   CDS_pept        complement(690459..691463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfkB"
FT                   /locus_tag="ckrop_0579"
FT                   /product="fructose-1,6-bisphosphatase II"
FT                   /function="Fructose-16-bisphosphatase/sedoheptulose 17-
FT                   bisphosphatase and related proteins"
FT                   /EC_number="3.1.3.37"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17350"
FT                   /db_xref="GOA:C4LHP5"
FT                   /db_xref="InterPro:IPR004464"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHP5"
FT                   /protein_id="ACR17350.1"
FT                   /translation="MSDHKQTPPDRNLAMELVRVTEAAALASGRWVGRGKKNEGDGAAV
FT                   DAMRQMINTVAMRGVVVIGEGEKDEAPMLFNGEEVGTGEGPDIDIAVDPVDGTTLMAEG
FT                   RQNAISVLAAAERGTMYDPSAVFYMKKIAVGAEARGVVDVNAPVKDNIRAVAHAKGKRA
FT                   SDITVVVLDRPRHEHLIQEIRDAGAKVRLIHDGDVAGAVAAAQDQTQNSIDIMMGVGGT
FT                   PEGIITACAMRCMGGEIQGVLTPRNDEEKQKALDAGHELGKVLTTEDLVHSQNCFFVAT
FT                   GVTNGDMLRGVTYSPRGAITRSLVMRSKSGTVRMIESHHQLTKLEEYAVVDYS"
FT   gene            691758..692375
FT                   /locus_tag="ckrop_0582"
FT   CDS_pept        691758..692375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0582"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17351"
FT                   /db_xref="GOA:C4LHP6"
FT                   /db_xref="InterPro:IPR025339"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHP6"
FT                   /protein_id="ACR17351.1"
FT                   /translation="MRTKKVEKPRIFQDGRDMIISLGVMLIVMFVVIGGTGLCHYQPGN
FT                   PKEGKVTRVDYTTFLQSEAQSADYPVRIPASPEGWIPNSALRINLNGHSGSSVGWVHDK
FT                   DWIRFVQTSASVDDVAQGLDGKAREEKGTKDIDGTTWHVFEGSDDDVRTAWVVDKKDVR
FT                   WAVSGTGSTDEFATMAKAIQEAKPEPSAGESAPSEASSSPSA"
FT   gene            complement(692703..693977)
FT                   /locus_tag="ckrop_0583"
FT   CDS_pept        complement(692703..693977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0583"
FT                   /product="exodeoxyribonuclease large subunit"
FT                   /function="Exonuclease VII large subunit"
FT                   /EC_number="3.1.11.6"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17352"
FT                   /db_xref="GOA:C4LHP7"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHP7"
FT                   /protein_id="ACR17352.1"
FT                   /translation="MTAKQDPTTSGSRTARGGLTSPEAPWPVRILNRKIGDWISKLGSV
FT                   WVEGQLTQMKQTRYWTFLTLRDVEAEMSIELIAKNHVITSLPTPLSHGDRVIVLGKPNY
FT                   SVSRGQLKLSITDIRPVGIGELLARIEQLRKLLAAEGLLAPERKKPLPVLPRRIGLITG
FT                   RGSAAERDVISIAQERWPAVNIRTLNPPVQGASAVPEVKEALTILDRDPTVDVIIVARG
FT                   GGSVEDLLPFSDESLVRHVSTLRTPIISAIGHETDNPVLDDVADLRAATPTDAAKRVVI
FT                   DMATELEGIRDCRQRGQQALFRWLDYERDRLNDLRQRPVMADPMTPINRHAENVARDAS
FT                   SIRRNITLLLERANSEIAHLRGQVSALGPSATLARGYSIVQVQRPGEESEVATSIDQTP
FT                   PGSQLRIRLNDGSIVAATMSTSPAQ"
FT   gene            complement(694096..695001)
FT                   /locus_tag="ckrop_0584"
FT   CDS_pept        complement(694096..695001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0584"
FT                   /product="putative membrane protein"
FT                   /function="Gamma-aminobutyrate permease and related
FT                   permeases"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17353"
FT                   /db_xref="GOA:C4LHP8"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHP8"
FT                   /protein_id="ACR17353.1"
FT                   /translation="MSEYRTPAASPRTSSGRSNSNDNRFWGLLWWAPLAIIAASMATGM
FT                   LISSAGDGTLGRWYFIFFVASSLITTLLVQVQGLLVTVCAQPILFTVLTPICSLLAGKL
FT                   SGHSEGVGVFSKTSLLANFFPVVQHFFVLFWTVVISAIIAVVRCWLYRRQTARVTARRQ
FT                   TASSRAPRNGQQKQRASTSRAHRPQEYRSDSTSTSVDSARTDSRRSSSPSRRHQPRSYE
FT                   TNRSSRVSSRYEDRYEGSEVSRRQHDAPSRPTHQGDRERYRDQSSTYPSKKFTPRTYRP
FT                   DDGTSSLPPRTTRPRHSRRD"
FT   gene            complement(695028..696374)
FT                   /locus_tag="ckrop_0587"
FT   CDS_pept        complement(695028..696374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0587"
FT                   /product="transporter of the putative permease family"
FT                   /function="Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17354"
FT                   /db_xref="GOA:C4LHP9"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHP9"
FT                   /protein_id="ACR17354.1"
FT                   /translation="MSLFNRRTKHGQDAEDSAASKGSRKVAPSTNADNAEGHSHDPSTP
FT                   FRGGEHHPEVDPSDAPKDRLAVIGDVVSITAAWSIRLILLIAGGIVAWRAIGLLWRGVL
FT                   PILIALIICTLLWVPTNWMRKAHFPRWLAALVSVLGALAIIVGLFSLIAPSAVEQSSQL
FT                   ADQSIKGLEKVQNYVQGPPLNLNDQQVNDYLDEGIDKIKSSSDQIIAGVVTGVNKASEL
FT                   AVMLGVILMITFFFLKDGDRFLPWLGKISGKRGEGHIVELLQRSWNTLGGFIRAQAVVS
FT                   LIDAFFIGLGLIILNVPLALPLAVITFMGGFIPIVGAIVAGAVAVLIALVSNGLTTALI
FT                   VLAIIIAVQQLEGNVLSPVLQSKAMNLHPVIVLLSVTVGSNLYGIIGAFLAVPVMATIA
FT                   VWLRYFSELIDKEVTTRKKALSNRQYTENVRRDSETTPTMPVTGLPTNK"
FT   gene            complement(696374..697735)
FT                   /locus_tag="ckrop_0588"
FT   CDS_pept        complement(696374..697735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0588"
FT                   /product="putative membrane protein"
FT                   /function="Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17355"
FT                   /db_xref="GOA:C4LHQ0"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHQ0"
FT                   /protein_id="ACR17355.1"
FT                   /translation="MMKSSSEPEPGRVPGSLAPLSQKHASQLANRDNADDVMGVPYYAH
FT                   APLTEASRSASIAVNIKRLALWCLRFLAIALAAFLLWYGLGLIWSALLPVMISIIVCTL
FT                   LWPPVHWLTKHKVPHALSAIVVILGAAVIVIGTLSLVTTSVIDQSESLAHRASHSLRET
FT                   KEALNGPPLNIKDAQLNQALDQAAAHIQEHSGSLVSSVLSGASAASSVAVTLGIVLMLT
FT                   FFFLNDGHKFLPWIDRQFSGSIGTHLHEIFARSWKTLGGFIRAQAIISFLNSVFIAIGL
FT                   SILHVPLALALAVLNFFCGFIPIFGALVAGAVAVVIAFVANGWISALLTALLILLVHQI
FT                   EGNVLSPILQSRAMNLHPVIILASVAIGGSVYGVVGAFLAVPLAAVGAVLLRYASEQVD
FT                   SHVVDPVQPIVVLDPETSTTTDHSSLTARPGPEPEHSDARGTTSTNDDGTEENK"
FT   gene            complement(697794..697958)
FT                   /gene="metPS"
FT                   /locus_tag="ckrop_0589"
FT   CDS_pept        complement(697794..697958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metPS"
FT                   /locus_tag="ckrop_0589"
FT                   /product="methionine and alanine importer, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17356"
FT                   /db_xref="InterPro:IPR031596"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHQ1"
FT                   /protein_id="ACR17356.1"
FT                   /translation="MSGTAVMMMVLFMLVIWGGLATSTYSLMKHPDETSGKLGDDPEAT
FT                   DEKLYDQGY"
FT   gene            complement(697955..699724)
FT                   /gene="metP"
FT                   /locus_tag="ckrop_0590"
FT   CDS_pept        complement(697955..699724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metP"
FT                   /locus_tag="ckrop_0590"
FT                   /product="methionine and alanine importer, large subunit"
FT                   /function="Na+-dependent transporters of the SNF family"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17357"
FT                   /db_xref="GOA:C4LHQ2"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR037272"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHQ2"
FT                   /protein_id="ACR17357.1"
FT                   /translation="MSHSPSESDASAASRETFSSRSAFLLAAIGSAVGLGNIWRFPYVA
FT                   YSNGGGAFLIPYIIALLTAGIPLLFLDYTLGHRFRGSAPLVFKRISGWTEPIGWIQVGI
FT                   AFFISIYYAAIIGWAGLYTIKSFTRAWGSKPDAYFSDEFLHSEATQTFSTSIVWQIAIA
FT                   LALVWVATIIVLAMGVDEGIGKVSKLFMPLLTVLFLIVVIYALFMDGASKGLDALFTPN
FT                   WSALTNTEVWVAAYGQIFFSLSVGFGIMLTYSSYLKPRTNLTGTGLVTGFANSGFELLA
FT                   GIGVFAALGYMATQEGVPVDKVVSNGIGLAFVAFPTIINSMPGGAVFGVLFFGSLAIAG
FT                   FTSLFSLLEVVVSAVKDKLNLDRKSAAIGTGVVMGIISLALFSTTSGLSTLDIMDKYTN
FT                   NVGIVCVSLITIVCVDWILRRLDEFSLHLNAVSSFQVGNFWRICVTNVTPIILGYTLIQ
FT                   ELQNLFKSNYGDYSDQQIDLYGWGVVGLIVVVAFMMSVVPWRGNPSLSGPPGTDFGVEF
FT                   NVHQRIVTPQSHEARKAGFAAEQRRRQRRGRVEAVSLDAQRGGSSSQPVTSGNTADTTS
FT                   TMSDAKNGKDKDQ"
FT   gene            700021..701133
FT                   /locus_tag="ckrop_0591"
FT   CDS_pept        700021..701133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0591"
FT                   /product="putative GTP-binding protein"
FT                   /function="Predicted GTPase probable translation factor"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17358"
FT                   /db_xref="GOA:C4LHQ3"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHQ3"
FT                   /protein_id="ACR17358.1"
FT                   /translation="MAIFTARRMCGMSLTLGIVGLPNVGKSTLFNALTRNNVLAANYPF
FT                   ATIEPNVGLVELPDARLKRLAEMFDSAEIIPATVSFVDIAGIVKGASEGEGLGNQFLAN
FT                   IREADAICQVVRAFTDDDVVHVDGKVDPSSDIDVIETELILADLQTLEKALPRLEKEAK
FT                   KDKDKAAERDAVGEALKVLEDGHTLFSAKDSVDLSALKELNLLTAKPFLYVFNSDEAVL
FT                   TDEAKKKELTELVAPAQAVFLDAETEAELLELDDDEAAELLASVGQDEPGLNKLARAGF
FT                   ATLGLQTYLTAGPKEARAWTIHQGDTAPQAAGVIHSDFERGFIKAEIVSYDDLNELGSM
FT                   AEARAHGKVRQEGKDYVMQDGDVVEFKFNV"
FT   gene            701134..702088
FT                   /pseudo
FT                   /locus_tag="ckrop_0592"
FT                   /note="alcohol dehydrogenase; putative quinone reductase"
FT   gene            702478..704139
FT                   /gene="alsS"
FT                   /locus_tag="ckrop_0594"
FT   CDS_pept        702478..704139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alsS"
FT                   /locus_tag="ckrop_0594"
FT                   /product="acetolactate synthase, large subunit"
FT                   /function="Thiamine pyrophosphate-requiring enzymes
FT                   [acetolactate synthase, pyruvate dehydrogenase
FT                   (cytochrome), glyoxylate carboligase, phosphonopyruvate
FT                   decarboxylase]"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17359"
FT                   /db_xref="GOA:C4LHQ4"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012782"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHQ4"
FT                   /protein_id="ACR17359.1"
FT                   /translation="MKSAQLIVQTLRAQGVRYIFGVPGAKIDEVYDALVDADDIEVIVC
FT                   RHEQNATFMAQAIGRLTGKPGVVLVTSGPGTTNLATGLVTANTEQDPVVAIAGTVGLPD
FT                   RLKRTHQSLDAVNFLAPITKFTAESTCVDDVSELITNAFREAQQEPRGAAAVMVPADVA
FT                   GSETSAPLLEFPDPAPLGPASQALVDKAKERIENAKLPVLLVGMRGAGESAVRELRQLV
FT                   KTTNLPVVETFQGAGVISRELENNFLGRVGLFKNQPGDVLLNKADLIISVGYDSVEYDP
FT                   RVWNFNGQHDIIHIDSIQADVDTHYRPTLELVGDISGTLHELNSVMDPIDVEETERSFI
FT                   DRRLEALARTQRQGAEQATSDSGVNPARLVLTLRELITDDKTTVAADIGTHSIYLARYF
FT                   RTYEPRTLLFSNGQQTLGVALPWAIAAALVNRDHPVVSVSGDGGFLYSAQELETATRLG
FT                   LHLVHVIMRDNSYDMVKFQQENKFGRPSAVELGDYDAVKYAEAFGAKGYRVHMLEDFST
FT                   AFSQAMDDDGVSIVDVSVDYTDSVSLAQHLDFSVLN"
FT   gene            complement(704162..704518)
FT                   /locus_tag="ckrop_0595"
FT   CDS_pept        complement(704162..704518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0595"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17360"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHQ5"
FT                   /protein_id="ACR17360.1"
FT                   /translation="MPQQAWNKKRERQYEHIKDSLKDKGRSESTAEEIAARTVNKTRAQ
FT                   QGESEQASSTSVNDNSPSERGGQRSHQGPQGRTKAQLYEDAKRLNIEGRSDMDKNELEH
FT                   AVKQAERQKDAKKD"
FT   gene            complement(704593..705489)
FT                   /locus_tag="ckrop_0596"
FT   CDS_pept        complement(704593..705489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0596"
FT                   /product="putative oxidoreductase"
FT                   /function="Aldo/keto reductases, related to diketogulonate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17361"
FT                   /db_xref="GOA:C4LHQ6"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHQ6"
FT                   /protein_id="ACR17361.1"
FT                   /translation="MTNSIPTLTLNNGVELPSLGFGVFQSSPEDTAQAVETALRTGYRH
FT                   IDTAAIYGNEREVGEGLRNSGVSRDEVFLETKVWINDFGYDKTRHAFDKSAGKLGVDTI
FT                   DLLILHQSLPSHFDLTLDAYRGLESLLKEGRVRAIGVSNFLPEHLDKLVEETEVVPAVN
FT                   QVEIHPYFRNTETLEADAKHGVLSQAWSPIGGITFYPGWGEDRTSTLDNPTLKEIGAKY
FT                   GKTAAQVMLRWHIDEGRSAIPKSVHESRIKENFDVFDFSLTKDELATIDALDTGHRTGP
FT                   APTDITIEEYGADIPEA"
FT   gene            705525..705800
FT                   /locus_tag="ckrop_0597"
FT   CDS_pept        705525..705800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0597"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17362"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHQ7"
FT                   /protein_id="ACR17362.1"
FT                   /translation="MCADKHSSEMLAEKINSFYTIATTIKTLWILVELLAKSWGSRVAY
FT                   PTGFHLPLTIVVVGSLLSSVTSTKSLSGVSSVRCLKWMSSIRYHVA"
FT   gene            705911..706603
FT                   /locus_tag="ckrop_0598"
FT   CDS_pept        705911..706603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0598"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17363"
FT                   /db_xref="GOA:C4LHQ8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHQ8"
FT                   /protein_id="ACR17363.1"
FT                   /translation="MAQSKLRKDAAHNRELLLEAGRDLFAQRGLRVTLNDVAHHAGVGV
FT                   GTAYRRFPNKEALLEAIVERQVDELEEILHDALEEDDPWAGIVTYLERSLVLQTHDRAM
FT                   AQLLSGRHMSPESFDRERDRLAPLINSLADRARRAGVIRHDIVGTDLVMIQIAVVSVAL
FT                   TCTDREGVSRRDDVAEVYRRYLWIMLDGLKPARDGVSPLPVDPLTTEQAHALLGSNGVP
FT                   SKLGKDFS"
FT   gene            706769..707626
FT                   /locus_tag="ckrop_0599"
FT   CDS_pept        706769..707626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0599"
FT                   /product="putative oxidoreductase"
FT                   /function="Aldo/keto reductases, related to diketogulonate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17364"
FT                   /db_xref="GOA:C4LHQ9"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHQ9"
FT                   /protein_id="ACR17364.1"
FT                   /translation="MSVIEEKYTLASGVEVPKLGLGTWFIDDDKAAQAVRDAVKIGYRN
FT                   IDTAQAYGNERGVGEGIRTADIPREDLFVSTKLAAEIKNYEEAVKAIDGSLETMGLDYV
FT                   DLMLIHSPQPWDDFRGGDYSEGNRQAWRALEEAYQAGKIRAIGVSNFLESDLNNILDSC
FT                   SVKPLVNQLLVHVGNTPHELLSFCASNDILVEAYSPIAHGEMLKNKDVAEIAEKYGVSI
FT                   PQLCIRYTLQLGTVSLPKTANPDHMQSNADVDFVISDEEMDALKKLDAQDYGESSQFPV
FT                   YSGK"
FT   gene            707710..709158
FT                   /locus_tag="ckrop_0600"
FT   CDS_pept        707710..709158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0600"
FT                   /product="NADP-specific glutamate dehydrogenase"
FT                   /function="Glutamate dehydrogenase/leucine dehydrogenase"
FT                   /EC_number="1.4.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17365"
FT                   /db_xref="GOA:C4LHR0"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHR0"
FT                   /protein_id="ACR17365.1"
FT                   /translation="MVWSALRDKSQLDRRWNFVHYTDRRMFEINPGREIMDVDKTVDEY
FT                   YQQILKRNPGEPEFHQAAQEILSSLKYVLRKDDHYADEGLIQRLAEPERQIIFRVPWID
FT                   DQGNVQVNRGFRVQFNSVLGPYKGGLRLHPSVNLGIIKFLGFEQIFKNSLTGLPIGGGK
FT                   GGSDFDPKGKSEHEVMRFCQSFMLELQRHIGEDIDVPAGDIGVGGREIGYLFGQYRRIT
FT                   GRHESGVLTGKGLTWGGSLVRTEATGYGVVYFMQEMMASNKERLHGAKVIVSGSGNVAI
FT                   YAIEKAQELGATVVAFSDSSGYVSTPEGVDVELLKDVKEVRRGRVSDYANETDKATFHE
FT                   KGNIWEVKADVALPCATQNELGEEDAKMLADNGCKYVAEGANMPCTPEAIDVFNTRHTL
FT                   FAPGKAANAGGVATSALEMQQNASRDSWSFNYTDQRLRDTMHNIFRACNDTANEYEVPG
FT                   DYVVGANIAGFKKVADAMLAQGVI"
FT   gene            709270..710310
FT                   /locus_tag="ckrop_0601"
FT   CDS_pept        709270..710310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0601"
FT                   /product="putative monooxygenase"
FT                   /function="Coenzyme F420-dependent N5N10-methylene
FT                   tetrahydromethanopterin reductase and related flavin-
FT                   dependent oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17366"
FT                   /db_xref="GOA:C4LHR1"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHR1"
FT                   /protein_id="ACR17366.1"
FT                   /translation="MKKFGSLSFGHYSGRATDGNGYTARNALQEAVELAKAADELGVNG
FT                   SYLRVHHYLPQHASPIPLLSAMAAVTKNLEVGTGVIDMRYENPLYLAEEAAALDLLSNG
FT                   RVALGVSRGSPEAADRGWESFGYTGSTDPRGSDIAHQHFDTFLRAVRGEPMATAAEDQY
FT                   PAMYRPGAGLPVMPQSPGLDRRIWWGAGRRETAEWAAEQGVNLMSSTLLTEATGEAFAD
FT                   LQAQQLQHYHDAWKRAGHDWTPRVSVSRTIFPIIDGYDRKLYLGGQSKDGIGVIDGVNA
FT                   TFGKTYAAEPDKLVEQLRNDAAVIDADTLMLTTPSQLGVEANKKILKSFALYVAPELGW
FT                   EPANQD"
FT   gene            complement(710325..710990)
FT                   /locus_tag="ckrop_0602"
FT   CDS_pept        complement(710325..710990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0602"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17367"
FT                   /db_xref="InterPro:IPR011438"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHR2"
FT                   /protein_id="ACR17367.1"
FT                   /translation="MRSLRRRSRIASLLTVGAVSSALVLSGCTVDEDSDQSSEDTTSAT
FT                   TTASQQSSSSETSTSESSQPSDSQDNDAHQGMDHSMDGGAAPEGITVDAHPTYPVGSTV
FT                   TLTADHMKGMKGAKATIAGAFSTYTYEVDYTPTDGGKPVKNHKWVVQQEIKDAGTERIP
FT                   DGTEVTIEADHMKGMKGAKGKIVSSTDQTVYMVNYEADGMKVTNHKWVVEDEIKPANN"
FT   gene            complement(711261..711515)
FT                   /locus_tag="ckrop_0604"
FT   CDS_pept        complement(711261..711515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0604"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17368"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHR3"
FT                   /protein_id="ACR17368.1"
FT                   /translation="MSTSFIYRDPFTHIKHQVSAPDAATYVVVKNNGEKKSDSDVLGFF
FT                   DNYDGAREAVMAELNKELQQPTGDREVLVTHTKLYNPMA"
FT   gene            complement(711673..713502)
FT                   /locus_tag="ckrop_0605"
FT   CDS_pept        complement(711673..713502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0605"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17369"
FT                   /db_xref="GOA:C4LHR4"
FT                   /db_xref="InterPro:IPR000542"
FT                   /db_xref="InterPro:IPR039551"
FT                   /db_xref="InterPro:IPR042231"
FT                   /db_xref="InterPro:IPR042232"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHR4"
FT                   /protein_id="ACR17369.1"
FT                   /translation="MENSRRGLSVGSLGREDKYMTAPEPKTLPLPSLEQTVAALVSAAR
FT                   AVAPADVVDTTRTAGSAFLQHSGPEVQAKLEKFAATEREAGRSWFSAEWLRSYLSTRTS
FT                   LLHSTNVSFQINSGFLPSTPGVGRAAEFIYRAATIHLDQARGTTPQETDARGNPTTMDQ
FT                   WQCFDGGIRHPQPDFDTIHRSELGDRDREIGVFWAGRLFAVPVTNHDGALRDIDSLAES
FT                   ITAIIHPDADKPALREQTAVDLGFAVPSAVGSETLAPILEQALKQPHNQHTYRRLTNFL
FT                   FTVTLTDEARDDADHLRRSAFEPGHSWAYKPISYEISLADSWLSLNVEHSTVDGATLVT
FT                   AVRRMHDVTVPASVSASPEPVAPPEELTWKWSGEDISTLKEAAEGVSQDLTDIATHIVT
FT                   VPHPPADQLPFRISADAAQQLILTIAQLKTYGRARGVYEAVDMREYRAGRTECLRAVTP
FT                   QAVEFASLLLGGEATRQDLDDVLGAHRAWVKACKRGAGVDRHLLGLRFTAAAMEEAGKE
FT                   LTGTGFLTDPGVAATTYDFLSTTSIGGADYFVRYAFVPSVPEGFGISYTPQPESFEYCV
FT                   TWHPSRADQPDDFLRALPQASDLLWSFVTSLHE"
FT   gene            complement(713542..714996)
FT                   /locus_tag="ckrop_0606"
FT   CDS_pept        complement(713542..714996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0606"
FT                   /product="permease of the major facilitator superfamily"
FT                   /function="Permeases of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17370"
FT                   /db_xref="GOA:C4LHR5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHR5"
FT                   /protein_id="ACR17370.1"
FT                   /translation="MTTITAPPREDRKAQSLLEAWPALLGLCLTMLVEMLDNSILNIAL
FT                   PVIGRDLGSTSTGLQWIVSAYSLTFGAFLMVGGTLGDRLGRRRTLLWGLALFGLAGLCV
FT                   MFCHTTGQLIAIRALSGAFAAGIAPLTMSLVFRLFDDDALRGKAIGVIITVSMAGFAIG
FT                   PVLSGLAVENWDWHWLLMLNAPTALIAWLGVYFGLAHDDTQAKKSGPIDFAGAIFSGLA
FT                   VSLLLYALTNGAELGWGAPRTLMSLGGSVLALVAFIWREHTAKDPMLDLSFFRIPTLTG
FT                   SAILQVATQLAMAAVMFASAELYQYAWGWRPWVAGVANLPFVIGMLAAGPVVDKMVEKY
FT                   GQRFTCAVGTAFVLVSLVVWWVGVGTNYAWCATGMLLMTIGMRTVMTTAAVGLIGSLPE
FT                   EHTSIGAALNDTAQELGNSIGVAVIGTVMAIVVGVDLPHGAWSDAVVDTFVHSQRIAFT
FT                   IIAGLLTVTAAIGLRTLSNSHDTEGL"
FT   gene            715196..716023
FT                   /locus_tag="ckrop_0608"
FT   CDS_pept        715196..716023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0608"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17371"
FT                   /db_xref="GOA:C4LHR6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR004111"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHR6"
FT                   /protein_id="ACR17371.1"
FT                   /translation="MPSSEKTTDRKRSPGKKLPPSVQRPSARRSARRAVLSEESIIRVA
FT                   IALLDRDGADKLTLRKIASELDAGVASLYWYASGKDQLLAMVSDELIRRAIAKSEELEQ
FT                   HGLLAPDAFSEVSFAEPHPSTSDVAAEALAQIRRLLLCLFEQMIEHRWLALQLMNNGPD
FT                   QWYALRFWELIGRQIQRLGLHKREELFATNAVVNYASGIGAEASSHTGHKNLDPAEAEE
FT                   DMHAQINEWEQLDPVEFPFVHDIVEEFTEHDDIAEYSYGLELLLGGLERQTWK"
FT   gene            complement(716057..716986)
FT                   /locus_tag="ckrop_0609"
FT   CDS_pept        complement(716057..716986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0609"
FT                   /product="putative phospholipase"
FT                   /function="Predicted esterase of the alpha-beta hydrolase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17372"
FT                   /db_xref="GOA:C4LHR7"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR037483"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHR7"
FT                   /protein_id="ACR17372.1"
FT                   /translation="MTSSAEDPSTTPWGTSDSPLDCPDVAIVFEGGGMRNSYTVGAVQA
FT                   LIDHKVNPGWVGGISAGTTHVVNFLIKNRTRAKASFVDFVEDPRFGGWKTFAKGKGYFN
FT                   TEFIYTESVMPGEIAEMDFDAFMKSSPEFAIGALRADTGDMTWWRRDDVQTLEQLSAYT
FT                   RASSTIPFFMPVTHVDGHDYYDGAMGPTGGFAYDAAIEDGYSKFLFILTRPKSFRREPM
FT                   SQARLIRSYFRKQPAVAEAILQRAEHYNRSKEKIAQWEKEGRAMVFYPDQMPVHNKERN
FT                   VEKLQKSYEMGVDQVVREWPRWEEFLRG"
FT   gene            717183..717797
FT                   /locus_tag="ckrop_0610"
FT   CDS_pept        717183..717797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0610"
FT                   /product="ABC-type transport system, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17373"
FT                   /db_xref="GOA:C4LHR8"
FT                   /db_xref="InterPro:IPR017195"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHR8"
FT                   /protein_id="ACR17373.1"
FT                   /translation="MRKDKNTGNARPARRWRVVDIITAAVLGVATGLIFWVWNGLGGAW
FT                   YSAIESLLPGFGGLVTGVWLLGGVLGGLIIRKPGAAIMVEVIAAIISAVLGNQWGITTV
FT                   YSGLAQGIGAELVFMAFMYARYTLTVAMLSGVGASVIEWCYEWASGNYARSVQYNLIYL
FT                   VSLSVSGAILAGALGFFLVRALARAGALDRFAAGRESTELV"
FT   gene            717797..719410
FT                   /locus_tag="ckrop_0611"
FT   CDS_pept        717797..719410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0611"
FT                   /product="ABC-type transport system, ATP-binding protein"
FT                   /function="ATPase components of various ABC-type transport
FT                   systems, contain duplicated ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17374"
FT                   /db_xref="GOA:C4LHR9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHR9"
FT                   /protein_id="ACR17374.1"
FT                   /translation="MAHVHDDVRTPARVVAESFGWRHAGRRQPALADVNFRIEPGEKVL
FT                   LLGTSGSGKSTLMAGMAGVLGDSDDGDYAGRLLINGVDARSVRGQVGLVLQDPDSQVIS
FT                   SRVGDDIAFGCENLGFPRAEIWERVRWARDLVGLTVPLEHPTEQLSGGQKQRLALAGVL
FT                   AMGAGLILLDEPTANIDPEGVADVRKAVIAAAESTGATVVIVEHRVDVWRDVVDRIMVV
FT                   GDSAIRADGPTDEVIRMMGEQLAHDGVWIPDVPLPLANSWRRKRQDHAGSDQQRAVSDQ
FT                   HRAVSGEAGEGRGASSTNTLLRTHDLAVGWDGRAVNTGISLDVTPEPTVITGPNGAGKT
FT                   TVALTLAGLLAPVEGDIDASALIARETAGKAASVAIHRKRDASKNPMEWSSRALAQRIG
FT                   TVFQDPEHQFVARTVRDELLVGPRVCGIDPDVGERRADELLRRLHLENLAKANPFTLSG
FT                   GQKRRLSVATVLSTHPDVVIADEPTFGQDRTTFIQLIELLREMSDDGVGVLAITHDPLV
FT                   VDLLGVRHVRLASGGMEVQR"
FT   gene            719407..720174
FT                   /locus_tag="ckrop_0612"
FT   CDS_pept        719407..720174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0612"
FT                   /product="ABC-type transport system, permease protein"
FT                   /function="ABC-type cobalt transport system, permease
FT                   component CbiQ and related transporters"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17375"
FT                   /db_xref="GOA:C4LHS0"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHS0"
FT                   /protein_id="ACR17375.1"
FT                   /translation="MTRTTPRGVNFNPTARIAAMALIATPLLISVDIVSAGVALVCELL
FT                   VAPFLGMGWGRIIHRGWPVFLLAPLTGVSMLLYGRPEGKEYLSFAFAHITDNSVSLALA
FT                   IMVRVLAIALPAVILSADTDPTDLGDGLAQIWHLPERFVIGSVAGVRLVSLFERDYSAM
FT                   HRARRARGLADSGRIRRTLTIFFALLVLALRRGGKLATAMEARGFGSDRPRTWARESRL
FT                   GWPDWVLMVGALVVALMALVTAWMTGYLRFLGA"
FT   gene            720188..720907
FT                   /locus_tag="ckrop_0613"
FT   CDS_pept        720188..720907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0613"
FT                   /product="hypothetical protein"
FT                   /function="ATP-dependent Zn proteases"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17376"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHS1"
FT                   /protein_id="ACR17376.1"
FT                   /translation="MTSDITRLFRESGATSSRLASAVGIRVASTDEGPAVLRRLVNQGT
FT                   IPDCFSAGPGSTVLIDGLSGSGKTTLAKYLAEMTGARVIHCDEFYPGWSGLMEASRIVA
FT                   DSVLALADAGYRRWDWTANEPGDWVAVDPAEPLIVEGVGAVTPASMDAARRRLLDQRRL
FT                   RSGQRPRRSGQLPKPQEDADIVAIEVRADAHRRQQRALHRDPGFKEFWAMWAEQEADYE
FT                   ASRGKPTVAIWNDLTAG"
FT   gene            complement(720970..721722)
FT                   /locus_tag="ckrop_0614"
FT   CDS_pept        complement(720970..721722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0614"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17377"
FT                   /db_xref="InterPro:IPR025326"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHS2"
FT                   /protein_id="ACR17377.1"
FT                   /translation="MNHSPKPQRHARSHGSARRCVLARRGAVFAALTVSACVLAACGSG
FT                   TSSTNTGSESTVPSVSSQAQGIPSESSAAPSPSLSGSSTVGPSTKNGSEPNDAAAHNAA
FT                   GAASTGRDDRCHTADIAASLKTESGAAGSSYLTITLTNQSDHSCTFYGYPGVSAVGGND
FT                   GHQIGKPADKDRNATASLVTVAPGEAATVTVKKAQAGNYSPKSCKPQQARGLRIYPPDE
FT                   KAALFVDYPTDACSGDTVDMHVGPITKK"
FT   gene            721916..723085
FT                   /gene="fadE2"
FT                   /locus_tag="ckrop_0615"
FT   CDS_pept        721916..723085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadE2"
FT                   /locus_tag="ckrop_0615"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /function="Acyl-CoA dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17378"
FT                   /db_xref="GOA:C4LHS3"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHS3"
FT                   /protein_id="ACR17378.1"
FT                   /translation="MALNSDFDLYQLPEDYQGVREAIREIAEKSIAPHAADVDENERFP
FT                   QEALDALVETGFNAVHIPEEYGGAGGDSVMACIVIEEVARVCGSSSLIPAVNKLGTMGL
FT                   ILKGSEELKQQVLPDIAGGKMASYALSERGAGSDAGSMKTRARKDGDSWVLNGSKCWIT
FT                   NGGKSTWYTVMAVTDPDKGANGISAFMVHADDEGFVVGPKEKKLGIKGSPTAELYFEDC
FT                   RIPADRIIGDEGTGFKTALETLDHTRPTIGAQALGIAQGAFDQTVKYVKEREQFGRRIA
FT                   DFQNTQFMLADMKMKIDAARLMVYTAASNAERGHAEGGERLGMLAAGSKAFASDVAMQV
FT                   TTDAVQLFGGYGYTRDFPVERMMRDAKITQIYEGTNQICRMVMGRQILK"
FT   gene            complement(723089..723403)
FT                   /locus_tag="ckrop_0616"
FT   CDS_pept        complement(723089..723403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0616"
FT                   /product="putative small multidrug resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17379"
FT                   /db_xref="GOA:C4LHS4"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHS4"
FT                   /protein_id="ACR17379.1"
FT                   /translation="MAWIILIVSGLFETTWAVALHESQGFSRLVPSVIFVIAAALSMVG
FT                   LSLAMRDVPVGTAYAVWVSIGAVGTVVWGMATGQEAVSLLKIMFLCMIIGGVAGLKATG
FT                   "
FT   gene            723448..725220
FT                   /locus_tag="ckrop_0617"
FT   CDS_pept        723448..725220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0617"
FT                   /product="Formyltetrahydrofolate synthetase"
FT                   /EC_number="6.3.4.3"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17380"
FT                   /db_xref="GOA:C4LHS5"
FT                   /db_xref="InterPro:IPR000559"
FT                   /db_xref="InterPro:IPR020628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHS5"
FT                   /protein_id="ACR17380.1"
FT                   /translation="MAVGILGTVSAPEQKPSNPSSSGHENSQPSDVSIAQAHHLEPIAD
FT                   VARRTGIPEEATVPYGTTKAKVTVGKLAQSATKGKVVLVTGMSPTPAGEGKSTVLIGLV
FT                   DGLASAGVKAMAALREPSLGPVLGMKGGAAGGGYSQVVPMEDINLHFTGDLHAITSANN
FT                   ALAALIDNHVQQGNSLNLDPRKIVWRRCLDVNDRVLRNIITGLGGKGGGVPREAGFDIT
FT                   AASEVMAVLCLARDLADLRERLGRMLIGYTRDNDPVFVHDLGVEGSLVALLRDALSPNL
FT                   VQTLGGAPALIHGGPFANIAHGCNSVIATNAARELADVVVTEAGFGADLGAEKFTDIAS
FT                   VAGDFAADVAVIVVTARSLKYNGGVARGGLNEENVEAVRSGLANVERHCASLRRLGMQP
FT                   IVAVNKFLTDTDAELAVIKEWAADHGLRVAVANVWGEGGAGAADLVAQVREALADEPVR
FT                   TGTGQSGAARTRIYDPQDGVKASIATIAHDIYGAEQVEYSQQAGKDLAQLKRHGWDTLP
FT                   VCISKTPYSFSDDPSALGAPKNHTLHVQRLIPKLGPGFVVALTGTVFTMPGLPKHPAAM
FT                   EIDVTDDGTITGLF"
FT   gene            complement(725292..726071)
FT                   /locus_tag="ckrop_0618"
FT   CDS_pept        complement(725292..726071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0618"
FT                   /product="putative phosphatase"
FT                   /function="Predicted phosphatase/phosphohexomutase"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17381"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHS6"
FT                   /protein_id="ACR17381.1"
FT                   /translation="MTLLVCDIAGTTIDEGGVVYRQLRESVEKQGITVTPDQVNQVKGT
FT                   EKRSAIITLLSSGGFTPSEETINTAYNDFLEGLQTEYTNNPPTPIPGVEKLLREFQRKG
FT                   GKVALTTGFQRSIAEIVLSAAGWGAHALSMAPDETTVSSRLIDDADNAPFSVDALVTSD
FT                   TVRAGRPAPYLIHHAMELTGVTNVAEVISAGDTTADLDAATNAGVRGVGVLTGSLSRDV
FT                   LEARPHTIVLESLADLGSSESLSALNAAGEAVTELNG"
FT   gene            726155..727369
FT                   /locus_tag="ckrop_0619"
FT   CDS_pept        726155..727369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0619"
FT                   /product="putative oxidoreductase"
FT                   /function="Glycine/D-amino acid oxidases (deaminating)"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17382"
FT                   /db_xref="GOA:C4LHS7"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR017741"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHS7"
FT                   /protein_id="ACR17382.1"
FT                   /translation="MFRSAEETQSHGNGVGNKTDLIIAGGGIVGLATAWRAHHQGRRVH
FT                   VIDRASRPVGASIQNFGHACFTAQADAIQDVAADSRDGWKAAAAETGLWAAQPGTVVPA
FT                   VSETEMTVLRQFHDHRGSEQVTLLSADDTCERLGLTGSENSGTGDIIGGALLPLDMRVN
FT                   PREAAPRLAEWLAANGVEFSWNTAVHHVGDGQVDTSRGTLSADEVVVCPGHHVGNIFPD
FT                   IAERNGLRTCILTMALIDRPDHIPADLAMLTGTSLARYDGVAAMPGVPDLREELLDTKP
FT                   ELVGCIANLMATALPDGAIPGLNSSGSGIFIGDSHDYAQSPEPFIQQSIADLLMDNASA
FT                   YLGIEHPVVRQRWQGRYADSPDTNLVLERPDDRTTVAVVASGIGMTLSFGIATLITEHR
FT                   DAPDF"
FT   gene            complement(727464..727925)
FT                   /locus_tag="ckrop_0620"
FT   CDS_pept        complement(727464..727925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17383"
FT                   /db_xref="InterPro:IPR007295"
FT                   /db_xref="InterPro:IPR035930"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHS8"
FT                   /protein_id="ACR17383.1"
FT                   /translation="MARGADHPRFGYIEAWLLREPDIRITKFHFRPETKATEPLTGRQE
FT                   FYIDIAHNARDSERPRWTTTDYYADIVLYNRDPGADGRYSMEVLDLDELEDAYTQGFIT
FT                   AAELAHALSVTATVVDGLTTYGDIDSWLEKFNIALTWENPDDISLTPAP"
FT   gene            complement(728023..730020)
FT                   /gene="chlD1"
FT                   /locus_tag="ckrop_0621"
FT   CDS_pept        complement(728023..730020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chlD1"
FT                   /locus_tag="ckrop_0621"
FT                   /product="magnesium-chelatase subunit D"
FT                   /function="Ribonucleases G and E"
FT                   /EC_number="6.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17384"
FT                   /db_xref="GOA:C4LHS9"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHS9"
FT                   /protein_id="ACR17384.1"
FT                   /translation="MAHPDSLAHAIDALQVWVQARPSWLLLTGDSVRINESLDVLGELW
FT                   ADTKHGSVIRVSPSMTPADVTQVSTSFNHDRSDVARGDGSALGDDVPERNAPQRDGLVI
FT                   IHNAHLLEVDTAAAVAQHFSSCHVISAVPDSRQASTLDEVPAVILDHVGPILSAPYATD
FT                   PDMIATLASRDMPAVASRTTTVDEVRVTDEHGDADGSDVGTKNSDTRKDNVQPVNGDDE
FT                   LSQWVARALMTHLGSQATPGLLLDAIYMAHGARTLGHATEHVHEAIVDMFIRPRLPEDV
FT                   DDSDFDDHPRDNDENGGDENHDGNSEEENNKLSKNANPAAARPDDADTTSDEEPGADTA
FT                   PEVSSPSESDSGDTSREERNDPPHNDDASTGAEARNTDPVDKPDDQPLAIPHIPRRGRT
FT                   STTVWPGRHGPRGISHRGRVRRVMPARTHDTDLAILPTLAAAAPWQRFRHRHQDDQRRI
FT                   ILTRDDLRTAQRGSAGGELVIIIVDASGSMGRGAIRTAKSTALEVLQSSYRDRSKVCII
FT                   VARGHEAAIGLPVTRSLSRARRCLTSLPTGGGTPLASARLRAASIARRFPPELVRVIEL
FT                   SDGRANVGLPHSHGNPADDADRAKYELDAMVSSVTCIPVSSRGRSRRRRRARNRNRRNS
FT                   TGTMNKPAELTQDGYAIPNESAPSRSYPRA"
FT   gene            complement(730069..731004)
FT                   /gene="chlI1"
FT                   /locus_tag="ckrop_0622"
FT   CDS_pept        complement(730069..731004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chlI1"
FT                   /locus_tag="ckrop_0622"
FT                   /product="magnesium-chelatase subunit I"
FT                   /function="MoxR-like ATPases"
FT                   /EC_number="6.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17385"
FT                   /db_xref="GOA:C4LHT0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHT0"
FT                   /protein_id="ACR17385.1"
FT                   /translation="MNRVYPFTHIHGQDELKEALILCAINPGIGGVLAFGDRGTGKTTT
FT                   VRALGQLLSQHGEGSSGHTPVIDVPLGVTEDRLIGSLDIDAALTTGEARFRPGLLADAN
FT                   NGFLYIDEINLLDDHLVDVLLDVAASGVNIVERDGISHTHPARFVLVGSGNPEEGDLRP
FT                   QLQDRFGLALRVDTLTDPTERMTIVRERLAFDADPEAFLDDAQEEEQELATSIEQARDR
FT                   VRDIELSEDAVLTAVEVCTETGCVGHRGELVITRAARARAALHGNDTVAREDVGAVALA
FT                   ALRHRVPTEAFEAPGDVDARLTRTIHQVCE"
FT   gene            complement(731025..734795)
FT                   /gene="chlH"
FT                   /locus_tag="ckrop_0623"
FT   CDS_pept        complement(731025..734795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chlH"
FT                   /locus_tag="ckrop_0623"
FT                   /product="magnesium-chelatase subunit H"
FT                   /function="Cobalamin biosynthesis protein CobN and related
FT                   Mg-chelatases"
FT                   /EC_number="6.6.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17386"
FT                   /db_xref="GOA:C4LHT1"
FT                   /db_xref="InterPro:IPR003672"
FT                   /db_xref="InterPro:IPR011771"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHT1"
FT                   /protein_id="ACR17386.1"
FT                   /translation="MRILFLGFGGSIALTMHSAWDEFREKFAADTASPDDESAGAVDLR
FT                   HRPFDAGTLATADDLDAELAAADAVFLQGPMTPEDIDALGAALDTAIEEAHKSGRAFVV
FT                   SASVPCADPIVDRATSPRPGITASLREALRQLTPGGMCHAIRLVQTVLAGAPDPGSLAQ
FT                   SRPHGIISLDDDDLLRACGYAVRAADGETPTGGETSADGDDRPHIVHAPEGVRIGIAAS
FT                   PFQVASHDTLAASYIAKLVEASGATAIVWAGDPTDVPDGVEPPPAVDAWMNLTGFTLAG
FT                   THANPRVDNGVEFLTETGVPMITPVPLLRMALDRWQTSDLPGLTAGQVSMNIAIPEFES
FT                   GLAPWVIGGRGIPAVETDDPDHAADPRLAVERMLPDPYMCALVVNRTIRTVALRRLPAE
FT                   QRKLSITIFGHDADGTIGTAAHLDVFRSLWNFLHHLRAEGYTVDIPQTPEALVDSLFDS
FT                   DAGNRSTCHVAATWPATEYNEALTSSQVSRIDRLWTRTPGMIDTDGRELFVRGVRLGNV
FT                   FIGVQPDFGDVADPLNVLMAPEASPSHSFAAYYLWLEHEFSHDVMLHWGTHGALEFMPG
FT                   RSTGLTRDDWPLLLTGSVPHSYLYAMSNPAEGTIAKRRSFAGLVSYLTPQLIDAGLHGA
FT                   LAAAAEEAFRLLTSAKDGSVELNADTYSELVTLAAEADLTDCPPPNSADAGKVEHGEDD
FT                   GSHNPWHEWVSHVSAIAERIRRTPIPEGLHTLGEPLSQDKTARILSLACTYPLATSDPL
FT                   ADHLDEEHITEAVDAVVNDDFARFTSLVAGAFDNDAKTTSDAKTANGSEPANATPASWF
FT                   RHLRRLHSQLTSSKETDGLLAALSGAYIPPAPGGEPASRPESLPTGRNTHGADPATMPT
FT                   PTAARRGAATADALVEQLRQEEGHYPESIAMVIWGMDNVKTNGEGIAQAFHLIGAEPLT
FT                   DERGRVSRFRIVPLDELGRPRVDVVCTMSGVGRDLLAGPMELLDDAIHAIASLPEEPED
FT                   NPVRAHAMQQAEELGLDLDSAANRIYATAPGNYGTGVNKLVQSSEWDDNSDLAEVYLHR
FT                   MGHAWGKHVKGKENRALLESSLSRVSATFQNVDSTEISLAGVDHYFEFLGGVSSVVETV
FT                   SGARPSAKVSHAWQHETNVESLDDAMRLESRTRLLNPAWYEAQLRHGYQGVANIRSRFE
FT                   NTFGMQATARVVDNWVFDRTASTFITDDDMRDRLAEHNPAAVLSMTERLLEAADRGLWE
FT                   ADDDVLDQLEDISDSLDATVEGVTPMSSARH"
FT   gene            734950..736941
FT                   /locus_tag="ckrop_0624"
FT   CDS_pept        734950..736941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0624"
FT                   /product="putative GTP-binding protein"
FT                   /function="Predicted membrane GTPase involved in stress
FT                   response"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17387"
FT                   /db_xref="GOA:C4LHT2"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHT2"
FT                   /protein_id="ACR17387.1"
FT                   /translation="MPRHARSSPLTYGELFYPRRFCSVSHPEFRNVAIVAHVDHGKTTL
FT                   VDAMLQQSGVFGDHDEVVDRVMDSGDLEKEKGITILAKNTAIHRKGMGKDGTDLIINVI
FT                   DTPGHADFGGEVERGLSMVDGVVLLIDASEGPLPQTRFVLGKALEAKMPVIIVVNKTDR
FT                   PDARIDEVVDEAQDLLLELAASLDDPEAQEAAEKNLELPVLYASGRAGKASTENPGNGN
FT                   VPEAEDLQDLFNVLYDVLPEPSAEIDAPLQAHVTNLDSSSFLGRIGLVRVFRGILKKGQ
FT                   QVAWIHHDSDGNPHTKTAKISELLRQDGVKRVPTDQVIAGDIGAVAGIDEIMIGDTLAD
FT                   PEHPEAMPPITVDEPAISMTIGVNTSPLAGRGGGDKLTARLVKSRLEQELIGNVSLKVL
FT                   PTERPDAWEVQGRGEMALSVLVETMRREGFELTVGKPQVVTRTIDGTLHEPFEHLVIDV
FT                   PSEHQGAVTQLMASRKGTMLSMDNGAGGWIRMEYSVPARGLIGFRTTFMTETRGTGIAN
FT                   SYSDGYKPWAGDIKDRASGSLVADRAGQITAYALQQLADRGQFFVEPGVEAYEGMVVGA
FT                   NNREEDMDVNITKEKKLTNMRSATAETTVTLAKAHTLSLDEAMEFCGGDECVEATPKNI
FT                   RVRKVILDAKERGRAAAHAKQKAKQGKK"
FT   gene            737065..739026
FT                   /locus_tag="ckrop_0625"
FT   CDS_pept        737065..739026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0625"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17388"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHT3"
FT                   /protein_id="ACR17388.1"
FT                   /translation="MATGVAVGVASTSLLAGCSARPGSAPVVNSGDGNKNNADTVSQQS
FT                   EKITFAVSDVSPGFNPHLVSDDTPLVDHMASLVLPSPFVEKDDGELELNQDLLDSADVV
FT                   EGSGTGSSASTPSSESTTPSGAASSQPFTVRYTIASDAQWSDGTPITGADFEYLWKQMI
FT                   SQPGVEDPAGYEAISSVTSTESGHQVDVHFDRPYVAWRSLFTNLLPSHLYRSSSNFQTM
FT                   LRDSVPVSGNRFSVESIDSGRGIVTLVRNDRYWGSNLAKTDKIVLQAQDNAAEAAEMLR
FT                   NGQVQGAALRPKATTQLSLDSVPHSVVQLSPKNRYLMLSLNTAAPHMDDVGERARILNS
FT                   VDRDTVARIAGERMEVSAPHDEATISGTSVPGSGSAFPSLSRPFRIAVDQSDDAAVTAA
FT                   RTVADQLTQAGFPAKALVMPALDIVESVLPLGLADATVAWQSGDTTASALASHYGCTSA
FT                   DRPSKEMDSDKSSELIEPESSTPSSPSSEPQPTSDSAAPSATDTGDARKSMEKKYARAA
FT                   NMSGLCDPEIDTQVREAAEGFADVNDTKQKVIEKVNSQAVSLALLQDTEVFATTPALEA
FT                   PRLPLKSGELPTTERGGIFVTAPLWTRNEDYSVLQPGSSPTTDNKGDTDAEKKNDNDKA
FT                   DDKTDENKDDKEDASSNE"
FT   gene            739046..740212
FT                   /locus_tag="ckrop_0626"
FT   CDS_pept        739046..740212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0626"
FT                   /product="MshB deacetylase"
FT                   /function="Uncharacterized proteins LmbE homologs"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17389"
FT                   /db_xref="GOA:C4LHT4"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR017810"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4LHT4"
FT                   /protein_id="ACR17389.1"
FT                   /translation="MAVHAHPDDEALWTGGLLAHLSRRGADVRVVTCTLGEQGEVIGEP
FT                   MQGLIADEADMLGGFRYRELEDSLRILGVNGVHHRPCVLGGVGCWRDSGMVGTPSADHP
FT                   RAFVKSGQQAVDALKALMSEFCPDIVVTYGPDGGYGHPDHIRAHEITHAAVAELPHTSA
FT                   PELGGDNTDLFSAVLARRHGGRETSADHGIPDPVVLWAVRGETALKQAGRAISRIPDGW
FT                   VAPSGMDFSFVDGAAGAVDSASSEKTPDKITEPDLAFVPDDLVDLAVQLSDADIEAQAN
FT                   AMAAHATQLWIADGRQSWTNPESAWAVSDPTVAPKVFALSNRIAQPLMREEHYVVAYGG
FT                   SGPWAKTTPARYAYDSSVVRARGRSAFSLDQADEGAAHDTSEQSGQRR"
FT   gene            740226..740738
FT                   /locus_tag="ckrop_0627"
FT   CDS_pept        740226..740738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0627"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17390"
FT                   /db_xref="GOA:C4LHT5"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHT5"
FT                   /protein_id="ACR17390.1"
FT                   /translation="MEKHWGDPNHSQPREDVSKGERIAGIAWLTVGSVLSFFLEMVYLG
FT                   SRITIGGHTYPFPYMILIAAGFNYVLGTTSLLWTKKLAWASIPGVTWIVLYFIAVTWPS
FT                   LPGTRGTTWIVPNLVGVLFMIAGVAGAAWPLMRSVVSSMDQVNPPPPTTTTGGKRSKEK
FT                   NNPTKKK"
FT   gene            740983..741300
FT                   /locus_tag="ckrop_0628"
FT   CDS_pept        740983..741300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0628"
FT                   /product="Ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17391"
FT                   /db_xref="GOA:C4LHT6"
FT                   /db_xref="InterPro:IPR000813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHT6"
FT                   /protein_id="ACR17391.1"
FT                   /translation="MAYTIAEPCVDVKDKACVEECPVDCIYEGVRSLYIHPDECVDCGA
FT                   CEPVCPVEAIFYEDDVPDEWIDYNDANAAFFDDLGSPGGAARLGPQDFDAPLIAELPPQ
FT                   A"
FT   gene            741421..742569
FT                   /locus_tag="ckrop_0629"
FT   CDS_pept        741421..742569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0629"
FT                   /product="succinyldiaminopimelate aminotransferase"
FT                   /EC_number="2.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17392"
FT                   /db_xref="GOA:C4LHT7"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019880"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHT7"
FT                   /protein_id="ACR17392.1"
FT                   /translation="MAHPPRIVRSSLLPDFPWDSLADARAKAESHPDGFINLSMGTPVD
FT                   PVSPAAQLGLAENSGAPGYPQTVGTQELRQTIVDAMTRRYGIIPLDPERQVLPVIGTKE
FT                   AIAWLPYLLGLGEGHTVVIPELAYPTYEVGALLAGASIVRADSTFQLGPQAPTLMYINS
FT                   PSNPTGKVLGLEHLRKVVSWARERDVIVVSDECYLGLGWTTNANGVRGERPTQPVSLLH
FT                   PDVCDGDTTNLIAVHSLSKTSNMASYRSGWLAGDEKLIHELLAVRKHAGFMVPQPIQAA
FT                   TVAALKDDGFEQLQREIYRNRREILAAALRDAGFTIDNSEAGLYLWSTRDEPCRDTVDW
FT                   FAERGILVAPGEFYGPKGVKHVRVALTGTDDQITAAAQRIAG"
FT   gene            complement(742578..742778)
FT                   /locus_tag="ckrop_0630"
FT   CDS_pept        complement(742578..742778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0630"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17393"
FT                   /db_xref="GOA:C4LHT8"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHT8"
FT                   /protein_id="ACR17393.1"
FT                   /translation="MAKQTKPPRPTELDRAQTTSLIVVLVVCVACAFVPYTAVKIIAAI
FT                   VMISLVVGLGLRVWRDRSGRW"
FT   gene            complement(742804..743793)
FT                   /locus_tag="ckrop_0631"
FT   CDS_pept        complement(742804..743793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0631"
FT                   /product="2,3,4,5-tetrahydropyridine-2-carboxylate
FT                   N-succinyltransferase"
FT                   /function="Tetrahydrodipicolinate N-succinyltransferase"
FT                   /EC_number="2.3.1.117"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17394"
FT                   /db_xref="GOA:C4LHT9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR019875"
FT                   /db_xref="InterPro:IPR026586"
FT                   /db_xref="InterPro:IPR032784"
FT                   /db_xref="InterPro:IPR038361"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHT9"
FT                   /protein_id="ACR17394.1"
FT                   /translation="MTSFLTTGAIADGLATITDDGIVLDSWFPSPSLSDDISETTTTEL
FT                   GSDAPEELAAAAHSDEDRQVRRVAIRTQIKDLSTPPIDAYDAYLRLHLLSHRIARPHTV
FT                   NVEGIFGKLTNVVWTNYGPCSTENFESTRARLSTRGPVTVFSVDKFPRMVDYVMPSGVR
FT                   IGDADRVRLGAHVAPGTTVMHEGFVNFNAGTLGHSMVEGRISGGVVVDDGTDIGGGASI
FT                   MGTLSGGGKEVISIGQRCLLGANSGVGISLGNDCVVEAGLYITYGTKVVARGPVADAMG
FT                   LKDSSPIKAAQLSGANNILFRRNSLSGSVEAVAWQSSTVTLNDDLHAN"
FT   gene            complement(743860..745263)
FT                   /locus_tag="ckrop_0632"
FT   CDS_pept        complement(743860..745263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0632"
FT                   /product="aromatic amino acid transport protein"
FT                   /function="Gamma-aminobutyrate permease and related
FT                   permeases"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17395"
FT                   /db_xref="GOA:C4LHU0"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHU0"
FT                   /protein_id="ACR17395.1"
FT                   /translation="MTNNASQGDESSDSTSQLGHGLKVRHLTMMGLGSAIGAGLFLGTG
FT                   VGIKAAGPAVLISYIVAGFLVVLVMRMLGELGAARPNTGTFSAYSRQAFGQWAGFSTGW
FT                   LYWFMLVMVMGAEITGAGAFIGNWFGVDGWIPALVCVIIFTFINMAKVRGFGEFEYWFA
FT                   FIKVAVIIFFLVVGVLLIFGLLPGHPMVGFEHVRESGFAPNGVGGIAAGLLAVAFAFGG
FT                   IEIVTIAAAESENPSRAIATAVRSVILRISVFYLGSVLVIIFLLPYSTLGQAEGAADSP
FT                   FTRVLAQADIPGVVGFMEIIITLALLSAFNAQIYATSRVIYAMSKEGDGLTFFTKTNHE
FT                   GVPTRAVCLSMALAYLSVALQVWGPANLIELFFNIVGGSLLVLWFMIAASEIKLRPEME
FT                   AEGTLPVKMWGYPYMSYVALIGLLALTILMLFDNSARPQVIAVGVFFAALVALSAVARR
FT                   RNASAVPAK"
FT   gene            745443..746576
FT                   /locus_tag="ckrop_0633"
FT   CDS_pept        745443..746576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0633"
FT                   /product="succinyl-diaminopimelate desuccinylase"
FT                   /function="Acetylornithine deacetylase/Succinyl-
FT                   diaminopimelate desuccinylase and related deacylases"
FT                   /EC_number="3.5.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17396"
FT                   /db_xref="GOA:C4LHU1"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010174"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHU1"
FT                   /protein_id="ACR17396.1"
FT                   /translation="MIDLTQHPIDLTRALVDIESVSKNEKNIADAVEAALRAVAASADE
FT                   ANDITVERFNNTVMAKTNRGLPSRVVLAGHLDTVPIADNVPSTRGTDKDGRDTLFGCGT
FT                   VDMKSGDGVFLHAFAQLAESPDLTRDMTIIMYEAEEIAATENGLRKLAEHSPEWLQGDI
FT                   AILGEPSGAVIEAGCQGSVRVKVTALGERAHSARSWLGDNAMHKLAPVIARAAGHDGDK
FT                   IVEIDGLEYHEGFNIVMCESGVATNTIPDEAWMFVNYRFAPGKSTQQALDETFAIIGVG
FT                   TPDNPEPGFRLDIDDESPGALPGLHHAAAAELIEVTGGNVRAKYGWTDVARFAAMGIPA
FT                   VNFGPGDPAFAHKKDEQCPVEMITDVSDQIMAYLTSK"
FT   gene            746593..747561
FT                   /locus_tag="ckrop_0634"
FT   CDS_pept        746593..747561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0634"
FT                   /product="hypothetical protein"
FT                   /function="Predicted Rossmann fold nucleotide-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17397"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHU2"
FT                   /protein_id="ACR17397.1"
FT                   /translation="MGRKTSRMMGGKDDDRGHLRFRGPVVFRDRGGKAHDHTHARSTTD
FT                   QRLLDVQKDADWLHTDPWRVLRIQSEFVEGFGALAEIPRAVTVFGSARAEVDSPYYKKG
FT                   VEVGRALHEAGYGVITGGGPGLMEAANRGCAEAGGLSIGLGIELPHEQNLNAWVNLGLN
FT                   FRYFFVRKTMFLKYSQAFVCLPGGFGTMDELFEALVLVQTGKVTRYPIVLIGTEFWSGL
FT                   VEWIRDRLISEKMVSPDDPDLFLVTDDVEEAVGYITTKHEGFVEELGRRLEENSLSHSQ
FT                   RAGILRSVGKLAEDGDASSSEPSTGDASDQDPSDGGSSRDA"
FT   gene            747686..748498
FT                   /gene="folP1"
FT                   /locus_tag="ckrop_0635"
FT   CDS_pept        747686..748498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folP1"
FT                   /locus_tag="ckrop_0635"
FT                   /product="dihydropteroate synthase"
FT                   /function="Dihydropteroate synthase and related enzymes"
FT                   /EC_number="2.5.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17398"
FT                   /db_xref="GOA:C4LHU3"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHU3"
FT                   /protein_id="ACR17398.1"
FT                   /translation="MAIVNRTPDSFYDKGATFTDDAALAWVRSCVDAGAEIIDIGGVKA
FT                   GRGDPVSIAEEIDRVVPFVSAVREEFPSVHISVDTYRAPVGEAAITAGADLINDTWAGA
FT                   DPELVEVAGHYHRGYVCSHTGGMEPRTLPRRVHYDDLVGDVIRSTTQRAKHAVNCGVPE
FT                   DKVLIDPTHDFGKNTFHSLALVRHARDLVSTGWPVLMALSNKDFVGETVGRPVDQRLAG
FT                   TLAATALAAAQGVSVFRVHEVAENLDACRMALAVQGVIPPYATTRGVE"
FT   gene            748531..749106
FT                   /locus_tag="ckrop_0636"
FT   CDS_pept        748531..749106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0636"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17399"
FT                   /db_xref="GOA:C4LHU4"
FT                   /db_xref="InterPro:IPR019933"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHU4"
FT                   /protein_id="ACR17399.1"
FT                   /translation="MHVLYWIVTLIVLIVVSAGLWWVFSSLFGRGEELGPAERPDERKD
FT                   LEPGATVGPDELSTIRFSLSFRGYSPREVDMALQRAKEHMIELEHDRDRYRRRADDAEE
FT                   QLKASGAGTASTNDAGAAEGTANTGSAPVGFQSDGAQSTHGSAEAADHGEASHAGDAHV
FT                   DDRHQNSVAHQHSVKTNRAQGKRKKKRK"
FT   gene            749267..749434
FT                   /locus_tag="ckrop_0637"
FT   CDS_pept        749267..749434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0637"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17400"
FT                   /db_xref="InterPro:IPR021465"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHU5"
FT                   /protein_id="ACR17400.1"
FT                   /translation="MAAMKPRTGDGPMEAVEEGRKIVMRIPTDGGGRLVVELNHEEAGE
FT                   LASVLSEAAG"
FT   gene            749511..750383
FT                   /locus_tag="ckrop_0638"
FT   CDS_pept        749511..750383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0638"
FT                   /product="putative SAM-dependent methyltransferase"
FT                   /function="SAM-dependent methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17401"
FT                   /db_xref="GOA:C4LHU6"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR016718"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHU6"
FT                   /protein_id="ACR17401.1"
FT                   /translation="MLSDVLDVLSDPIDGSSLHDGGNLATLVSDTGHSYDVARQGYVSL
FT                   VGGRGLRYKGDDASMIQAREKFLASGHFGPFVEAVTGNVQDVLDDAGVGDHEHPVVMEV
FT                   GAGTGYYLAHTLDAVPGSRGIGIDVSVPAAKRIAGCHPRAGAVIADAWSRLPVKDKSID
FT                   TITVVFAPRNAEEFARVLTDGGQVVVLTAAPGHLAELREPLGIIDVEKNKVHRMIQQAS
FT                   GHLTPDGEPEEVEFEMNLGRDAIEAQVGMSPSARHIRPEDLKERIATLPDSMTVTARAT
FT                   VTRLKKNHR"
FT   gene            750744..751622
FT                   /locus_tag="ckrop_0639"
FT   CDS_pept        750744..751622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0639"
FT                   /product="transcriptional regulator, MarR family"
FT                   /function="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17402"
FT                   /db_xref="GOA:C4LHU7"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHU7"
FT                   /protein_id="ACR17402.1"
FT                   /translation="MKSVTVTAPQFNGPRHQMSDDPSVDAAETAVVGYPLKDPRGADDG
FT                   KSLSKEAISTALARGTTGCDASFGAAAGSAALDSSVLSTIAESTTLTMNPDNNNSHQMS
FT                   AAGVNGRTDMRRGTASDGFDEPIGHSTVNSSVGSSIYEPGSVVPSDALGTPAFAAEVAM
FT                   MCSRVIRTALYRAGMAPSSATWRVVRFIQNNGPVRISDVARRERSTMATVSTLVNRLVK
FT                   QGLVNKEKDTSDARQSLLTVTPKGRNLCNEWQDRLGEAVAEDFASLSLDELTVLAEALP
FT                   VMRKLVSEGER"
FT   gene            complement(751730..752908)
FT                   /locus_tag="ckrop_0640"
FT   CDS_pept        complement(751730..752908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0640"
FT                   /product="glycogen synthase"
FT                   /function="Predicted glycosyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17403"
FT                   /db_xref="GOA:C4LHU8"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011875"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHU8"
FT                   /protein_id="ACR17403.1"
FT                   /translation="MRVAMMTREYPPEIYGGAGVHVAELTRHLRELCDVDVHCMGGPRD
FT                   EANVYVSNSDDALADANPALKTLSTGLRMANLASASDIDVVHSHTWYAGLGGHLTGLLK
FT                   GIPHVATAHSLEPHRPWKREQLGGGYDVSSWSEKNAMENADGLIAVSRKMKDAILDAYP
FT                   RIDPDRIHVVLNGIDTKLWRPRPTFAEAEHSILAELGVAEDKPIVAFVGRITRQKGVAH
FT                   LVKAAHSFDEDIQLVLCAGAPDTPEIEAEIANLVEELKSTRDGVFWVRNMLPHDLLQEI
FT                   LSAASVFVCPSIYEPLGIVNLEAMACDTAVVASDVGGIPEVVNDGETGELVHYDADDIG
FT                   AFEEGLASAVNRIAGDPDLAGRMAKAGRERAVTTFSWSTIAQRTLDVYRSLM"
FT   gene            753022..754257
FT                   /locus_tag="ckrop_0641"
FT   CDS_pept        753022..754257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0641"
FT                   /product="glucose-1-phosphate adenylyltransferase"
FT                   /function="ADP-glucose pyrophosphorylase"
FT                   /EC_number="2.7.7.27"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17404"
FT                   /db_xref="GOA:C4LHU9"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005836"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR011831"
FT                   /db_xref="InterPro:IPR023049"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4LHU9"
FT                   /protein_id="ACR17404.1"
FT                   /translation="MRSQPHVLSIVLAGGEGKRLFPFTADRAKPAVPFGGSYRLIDFVL
FT                   SNLVNAGYMKVCVLTQYKSHSLDRHISQSWQLSGLAGEYITPVPAQQRLGKRWFTGSAD
FT                   AILQSLNLIYDEDPEYIIVFGADHVYRMDPEQMVKEHIESGAACSVAGIRVPRKEATAF
FT                   GCIQADDDGTITEFLEKPADPPATPDDPDVTFASMGNYVFTTQALIDALKEDSEDENSA
FT                   HDMGGNIIPYFVNRGEAHVHDFSRNVVPGETDRDHGYWRDVGTVDAFYEAHMDLISVYP
FT                   VFNLYNRKWPIHTSDDSNLPPAKFVKGGIAQSSIVAAGCIISAGTVRNSVLGPGVVVEE
FT                   GASVEGCVLMDGVRIGKGAVVRHAILDKNVRVGDNALIGVDRARDSERFTLSQGGVVCV
FT                   PKNYELHGADED"
FT   gene            complement(754267..754923)
FT                   /locus_tag="ckrop_0642"
FT   CDS_pept        complement(754267..754923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0642"
FT                   /product="putative methyltransferase"
FT                   /function="Predicted O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17405"
FT                   /db_xref="GOA:C4LHV0"
FT                   /db_xref="InterPro:IPR002935"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHV0"
FT                   /protein_id="ACR17405.1"
FT                   /translation="MTDSALDLMTDFINATTDESDAMGFARDAADELGLTAPDELTASF
FT                   LTTISSSYCRDKSAVVVSPSACVSGLAILAGMGPNGHVTCIDTEAIHQRVARQAFTAAN
FT                   IRSNQYRFLPSRPLEVMTRLAARSYSLIYAEIAPADASTLVDEALELLEPGGLIILADI
FT                   LLDGTIANPARKDRDTAAARRLDESLREREDIYLSRLPLGAGMVLISRNEDAPTS"
FT   gene            755140..755823
FT                   /gene="sigE"
FT                   /locus_tag="ckrop_0643"
FT   CDS_pept        755140..755823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sigE"
FT                   /locus_tag="ckrop_0643"
FT                   /product="ECF-family sigma factor E"
FT                   /function="DNA-directed RNA polymerase specialized sigma
FT                   subunit sigma24 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17406"
FT                   /db_xref="GOA:C4LHV1"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHV1"
FT                   /protein_id="ACR17406.1"
FT                   /translation="MTPASGAFHRSERNTPTRTTSASTIDPHKGDDVMANHPAGSEPRT
FT                   GTAAFDAGSGEMPSWSELVSEHADGVYRLALRLSGNTHDAEDLTQETFMRVFRSLKRYK
FT                   PGTFEGWLHRITTNLFLDMVRRRQTIRMEALPENYDAVPGTRNDPEQSYIDANIDPELQ
FT                   KALDSLPTDYRVAVVLCDVVGMSYDEIADTLGIKMGTVRSRIHRGRAQLRKSLQSSEGI
FT                   LHYVG"
FT   gene            755941..756495
FT                   /gene="cseE"
FT                   /locus_tag="ckrop_0644"
FT   CDS_pept        755941..756495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cseE"
FT                   /locus_tag="ckrop_0644"
FT                   /product="anti-sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17407"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHV2"
FT                   /protein_id="ACR17407.1"
FT                   /translation="MGRSSKPRQFSSIEHLSEEAVAAFVDGEMPPRAQRRVLRHLVHCE
FT                   ECRRDVKAQRDAAQRMREAANEPVHMSTELLHKLAAIPTNCDPQNPSGSPAKTEHHGQG
FT                   KKAQATGGGHDTDSDRPDVYAAGDELSDLRHDNALSAAKSAAFGVMRTVENGAMSAIDT
FT                   VGEYADQLRCAWKDRSNSPKR"
FT   gene            756577..757200
FT                   /gene="tatB"
FT                   /locus_tag="ckrop_0645"
FT   CDS_pept        756577..757200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatB"
FT                   /locus_tag="ckrop_0645"
FT                   /product="sec-independent protein translocase protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17408"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHV3"
FT                   /protein_id="ACR17408.1"
FT                   /translation="MEVIIIVVVGFLIIGPDRLPGVMKEIRAVRLAIKNAVADARKQID
FT                   GELGEDLREFSEPIKEFSEPLRQFNSYRSMGAKGFIAKALFDDDTTDLDATKDAIDKPL
FT                   QTMRTTTPQRAIQDYFAADKPSSTKNADDASSTTKSAAGSSASVPSVEKHNQGSEGSDA
FT                   VSSHSDSQGRDSGRGTATGEPGKEQSTDAKKPVYGSWSGFDEVL"
FT   gene            complement(757220..758356)
FT                   /locus_tag="ckrop_0646"
FT   CDS_pept        complement(757220..758356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0646"
FT                   /product="putative ATP-binding protein"
FT                   /function="ATPases involved in chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17409"
FT                   /db_xref="GOA:C4LHV4"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHV4"
FT                   /protein_id="ACR17409.1"
FT                   /translation="MASESTITESTVRDALAQVKDPDIGMPLTDLGMVKSVAIDGADVS
FT                   AEIYLTIAGCPMKNKLVDDSRAAIEGIEGVGNVTVTTDVMNDEQRRELRKKARGGVDEP
FT                   EIPFSKPDCHTRVYAVASGKGGVGKSSMTVNIATALAAKGLNVGVLDADIYGHSIPGML
FT                   GSDDRPYQVDDMIMPPQAHGIKMISIGHFIEGNSPIVWRGPMLHRAIQQFLADVFWGDL
FT                   DVLLLDLPPGTGDIAITVAQLIPNAELLIVTTPQMAAAEVAERAGSISQQTQQRIAGVI
FT                   ENMSYFVMPDGSHNEIFGEGGGEIVADRLSRITGTKVPLMGQVPLDPALREGGDGGEPI
FT                   AISSPESETGAALNAIADQLTHRRTSLAGKSLGLGVTP"
FT   gene            complement(758369..758956)
FT                   /locus_tag="ckrop_0647"
FT   CDS_pept        complement(758369..758956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0647"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17410"
FT                   /db_xref="GOA:C4LHV5"
FT                   /db_xref="InterPro:IPR010406"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHV5"
FT                   /protein_id="ACR17410.1"
FT                   /translation="MADSFARTDLDTPVRAKRRSLLSMDGDAVGVAAEKVARFLGTGKY
FT                   LGWQTIIVTAWILLNIGGMWWNWDPYPFILLNLAFSTQAAYAAPLILLAQNRQDDRDRV
FT                   TLNEDRRRAAQTKADTEFLARELAGVRIALGETVTRDYLRHELEDLTTVLQRIEGRLDD
FT                   AAADAPVDLEYMGDDERRAGLDSPSGQHNESS"
FT   gene            complement(758978..760429)
FT                   /locus_tag="ckrop_0648"
FT   CDS_pept        complement(758978..760429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0648"
FT                   /product="conserved hypothetical protein"
FT                   /function="Mg/Co/Ni transporter MgtE (contains CBS domain)"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17411"
FT                   /db_xref="GOA:C4LHV6"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHV6"
FT                   /protein_id="ACR17411.1"
FT                   /translation="MNRVFAGRLAGMVVLGPDGESIGRVRDIVVTIRPRGMASRTIGLV
FT                   VQVAAQNRQIFVPMLRVASIDPREITLVSGSVNLRPYQSRAGELRVMSELVGSKIHIDD
FT                   PEHEDLHGRPVDIADVEIEKSRTRDWIISRVAVSKERNRFGRRPPLSVVEWNHVHGLSV
FT                   SGAGPADATAEILAEFDDMRPADIAQILHDLPSTIRNNVASELEDARLADILQELPEDE
FT                   QMGVLETFDIERAADVLEEMDPDDAADLLGEMPDDKADVLLELMDPEESEPVRRLMSFS
FT                   PETVGGLMTSEPIILTPQATVAEALAHARNPDLSTSLSSMVYVVRPPKATPTGKYLGTV
FT                   HIQKLLREAPSTLVSSILDPDLPPLFADDTHETAARYFATYNLVCGPVLDEDNHLLGAV
FT                   AVDDLLDHLLPEGWREQEIRPEAGSSGHQAGTLGRAAGAHGAPGRSSRAQKAGSVIVKK
FT                   AGERRRDRQQGSTPQGPSAGNSHSN"
FT   gene            760494..761015
FT                   /locus_tag="ckrop_0649"
FT   CDS_pept        760494..761015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0649"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17412"
FT                   /db_xref="GOA:C4LHV7"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHV7"
FT                   /protein_id="ACR17412.1"
FT                   /translation="MTTPSASGFGATLGAQGSQGLPQRPEGWPIGSFEDYESAQHAVDS
FT                   LSDEEDFPVDDITIVGVNLMQVERVTSRLSWGKVLSGGAISGAWMGVFFGLLVGLFTNE
FT                   FLGPLALGAAMGALFGLISVAIPYGAMKGRRDFASTTQIVAGRYDVLSKPRSAQRGREI
FT                   LSRKNWSSRK"
FT   gene            complement(761023..762195)
FT                   /locus_tag="ckrop_0650"
FT   CDS_pept        complement(761023..762195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0650"
FT                   /product="transporter of the CorA metal ion transporter
FT                   family"
FT                   /function="Mg2+ and Co2+ transporters"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17413"
FT                   /db_xref="GOA:C4LHV8"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="InterPro:IPR004488"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHV8"
FT                   /protein_id="ACR17413.1"
FT                   /translation="MPRNDDYPDTGELVRAVEHEAVMNASDWIINTTDATHSPEPSHHP
FT                   VARCAVFVEGRKVDGPFTIASALDRVHQENQHDSSDPHTSHSEEDSTPRAFVWVSLVSP
FT                   TMEHMEPIARLFHLHSLTVEDIVKARQRPKLEILGDYVFIVARTVHYDPSPVDSTNEFI
FT                   ETNELHIIRGKDFVLTIRHGDVPIPDNVRQRLERSPQLTSVGPASVAYAHLDWLVDDYL
FT                   HIAEELEEKVDTMEDQVFIPDSPVHIEPIYMLKRENLEMRHALDPMTAVLKTLTVTKGT
FT                   AGKSVRSLYGDILDHHTIAADRIISYDERLSTLLDSAVAKVSLQQNTDMRKISAWAAMA
FT                   AVPTLIAGIYGMNFDNMPETHWAAGYFIVLIVMLSACVGLWLIFRRNKWL"
FT   gene            762329..762658
FT                   /locus_tag="ckrop_0651"
FT   CDS_pept        762329..762658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0651"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17414"
FT                   /db_xref="GOA:C4LHV9"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHV9"
FT                   /protein_id="ACR17414.1"
FT                   /translation="MVGQYDVAETRQWYQKTRVTPLVSLIRGIAAGLASGMVLATVVLI
FT                   VVQLVPSTDWTTHGGQMVVAHAVSAVVSVLMVHRADRSRSLGAALWSVGALVIIAIVLW
FT                   WMWWS"
FT   gene            762660..763457
FT                   /locus_tag="ckrop_0652"
FT   CDS_pept        762660..763457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0652"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17415"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHW0"
FT                   /protein_id="ACR17415.1"
FT                   /translation="MKKVTKMTKSVTASVVAAFALSGLTSCHVTADFGDDGHSGSSSTA
FT                   VSTVQKLPYTDTDPVLISAAVGKYDDITAALYDQVFDTTNAGRPTPRKAKTQASEDNVQ
FT                   DAIESLRAGKNTLVLVCAGDLLNYLDKNAASTILDQMKKNVRQGKAPGNTIGKVWEKIA
FT                   QSLPSDISVTDASNAQCSTETETRNASSDTPEDEVTLPQNIVPVYLKPTMSTEDRRSLT
FT                   WVSGNLGSTRDLDKLYKKAESAPADRVAKNYLQSQGLAFSKED"
FT   gene            complement(763589..767491)
FT                   /gene="sucA"
FT                   /locus_tag="ckrop_0653"
FT   CDS_pept        complement(763589..767491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucA"
FT                   /locus_tag="ckrop_0653"
FT                   /product="2-oxoglutarate dehydrogenase, E1 component"
FT                   /function="2-oxoglutarate dehydrogenase complex,
FT                   dehydrogenase (E1) component, and related enzymes"
FT                   /EC_number="1.2.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17416"
FT                   /db_xref="GOA:C4LHW1"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR031717"
FT                   /db_xref="InterPro:IPR032106"
FT                   /db_xref="InterPro:IPR042179"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHW1"
FT                   /protein_id="ACR17416.1"
FT                   /translation="MNSDNSFGQNQWLVDDMYQQFTKDPESVDKEWREFFEKNGAPESS
FT                   AGTEPSGAHKATNSNTAAKKSDTSSSASGEAKTIKGKRAEHQAAEKKPSQQNVAEKTAD
FT                   RTKSHIEEPSAHARNTNQASAPAAAKPARHDEPKVHKRAQVQRELRAKKEAPSQKRDHV
FT                   DIPSSLPEAGSKKIRGPQKAIAKNMDISLEIPTATSVRDMPARLMFENRAMINEQLKRT
FT                   RGGKISFTHIIGYALVKAVLAHPSMNNRYEVVDGKPTIVTPEHINLGLAIDMTNKDGSR
FT                   NLVVASIPAAETLSFSEFVDAYQDIVVRARNGKLTMKDFQGVTISLTNPGGIGTRHSIP
FT                   RLTKGQGTIVGVGSMDYPAEFQGASEDRLAELGVGKLVTITSTYDHRIIQGAESGEFLR
FT                   ELGRLLINDEFWDDIFKSLKIPYVPFRWEQDLPNIGVDKNTRVMQLIEAYRSRGHLIAD
FT                   TDPLQWHQPGLPIPDHRDLDFATHGLTLWDLDRRFHVGGFAGQEVMTLREVLSTLRSAY
FT                   TLKVGYEYNHILDRDERLWLEERIEAGQPKPSRAEQKYILQKLNAAEAFENFLQTKYVG
FT                   QKRFSLEGAESLIPLMDAAIDTAAAQGLDEVVIGMAHRGRLNVLANVVGKPFSQIFTEF
FT                   EGNIDPASPGGSGDVKYHLGETGHFISMFNDGEVDVTLTANPSHLEAVNPVAEGIARAK
FT                   QDILDRGNEGFSVMPILVHGDAAMTGLGIMQETVNLSQLRGYTVGGTVHIAVNNQIGFT
FT                   TTPDSGRSSQYATDLAKAFGCPVFHVNGNDPEAVVWVAKLAVEYRRQFGKDVFIDLICY
FT                   RRRGHNEADDPSMTQPEMYQIIDNKPTVRDIYTRSLVGRGDLSEDEVEIVKRDFREQLE
FT                   TVFNDVRAAEKGGKPAEQSGITSAQELPRGLDTSITEEEVAAIGDVFTNPPEGFHLHPR
FT                   VAPLAKKRGEMSRNGKIDWGFGELLALGSLAREGKLVRLAGEDTRRGTFTQRHAVYIDA
FT                   ENSDEYNPLQKLAQDGDNGGRFLVYNSALTEFAGMGFEYGYSVGNPHAVVAWEAQFGDF
FT                   ANGAQTIIDEYVSSGEAKWGQQSSLILLLPHGYEGMGPDHSSMRIERYLQLCAEGSMTV
FT                   AQPSTPANYFHLLRRHALGDLRRPLIVATPKSMLRNKMATSSVEDFTKVKRFHSVINDP
FT                   NFVDADGNVIGDTSKVKKILLVSGKLYWDLEKRRQKDGRDDLAIIRLEMLHPVPFRRLK
FT                   EAFDMYPNATEIRFCQDEPANQGPWPFLALHLPELVPDMLPMRRVSRRAQSSTATGVSK
FT                   VHQIEEKQLIEEAFAD"
FT   gene            complement(767624..771679)
FT                   /locus_tag="ckrop_0655"
FT   CDS_pept        complement(767624..771679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0655"
FT                   /product="ABC-type multidrug transport system"
FT                   /function="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17417"
FT                   /db_xref="GOA:C4LHW2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHW2"
FT                   /protein_id="ACR17417.1"
FT                   /translation="METRNTTTTNTKDTSTGAAASEKTDAEAPRKHDLRGLFRVCMIHP
FT                   YYTWGAMAATLAVTIAEILIPLVTARAVDTATEQARPTALWSWITSSTGWTPLTGVIVV
FT                   MVVIALLRYAFQFSRRYLAGQMSQWAQHELRIRVLGSLVRLGGKDQDDIRTGQVVSRSI
FT                   SDLNMVQGLLAMFPLAAGSVVKFAIILVVMFTLSWQMSLAAVIVTPILVIVGLWSKRSI
FT                   FASTWTAQQQAANVATHVEQTVTGVRVVKGFAQEEHEITTLDKLGRTLYALQMRAAHQQ
FT                   AKFLPTLAELPNLALVANVAIGGWLALNGHITIGIFLAFSTYLTTLTGICRMLSNMAIS
FT                   MQMALSSVSRVFDVVDLEADSDPSSPSRIPDGPLGISFDNVSFSQPQTDAETQTSIDGE
FT                   RLDSRPANSADASKPAGERILNHFSLDIAPGETMVLVGPPGAGKSMLVQLAEGFYPASE
FT                   GTIRLTTSGRPSPAHDGTHKGTGDDSDVGAAVGTHESRVGQSGSDHESVDITDIRKCDL
FT                   RHAVSAVFDEPFLYSRSVRENIALANPRATDEDIISAAKDASAHDFIMELEDGYDTVAG
FT                   ERGLTLSGGQRQRIALARALVSGARVLILDDATSAIDATTEAAIIAALKARKGSVTLLL
FT                   IAHRHSTLALADHIALVEAGTVTAYGTLDELQESSPHFSELMALPRHDADASVVPFDDG
FT                   NEPDLATLWPADQDMDEPGAAATAGDDLSASGAALAGSGLGAGLGQGSSAAGMPATPEV
FT                   LAMVEKLSPATEQPKIDAESFRNDSTPFSLRGLLGTVKWLLVAVIATLCVLVTADVVFP
FT                   ILVRHAIDAGVGNKDTGALVTATVLGLIIVVAAWIASTINTILTSRAGERLLYGLRLRS
FT                   FAHVQRLGLDYFETTQSGRIMTRMTTDIDSLSKFLQEGLAQAIVSGATLIGVSIMLLVT
FT                   APRLALVALTSLPIVIVATVIFRRISSRLYSEARGQISTVNADFQELVNGIRTSQVYNQ
FT                   QDSDVERFTDSALEYRRLRMQAQTVVSIYFPGINALSELASAAVVGVGAVMVLNGTVTA
FT                   GVLVAFMIYMNLLFAPIQQLSQVFDMYQQAEVGLRRISDLLSQSTSVPDSGRETHVPEG
FT                   SLSLDDVTFAYSNGVDVLHEVSETIDEGSTVAVVGATGAGKSTIVKLLARFYDPTAGAV
FT                   RAVDTDIRDVTLAAWRGSLGFVPQESHLFAGTIASNIAYGKPEATPNEVIHAARCIGAL
FT                   RAIAAIPGGFLAPVGEDGRGLSSGQRQLIALARAELVKPQLMLLDEATSTLDPATEKTI
FT                   LSASTRLMSNRTSVIVAHRLATAAQADRILVMDGGRIVETGNHDELLARHGIYADLWKH
FT                   SVSGGSDT"
FT   gene            complement(771700..772590)
FT                   /locus_tag="ckrop_0656"
FT   CDS_pept        complement(771700..772590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0656"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17418"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHW3"
FT                   /protein_id="ACR17418.1"
FT                   /translation="MASLLNVVPSAIKDRFSSKKHSDKQSDDELDGGENVENDNLENKE
FT                   KPSRILSAVERAAEIQVRPIARYVDMVESKHEGDSPTQIQEVINKHFRRLATTTGVGAG
FT                   ASAAVPGVGTLASLGVSTGDAFLFLELTTWYTLSSAYLRGIDISRHKDRTALVLLAING
FT                   SSANEAIATVLGSGSVFRLRSLSQPAVGQVNNQLASMALKRIRKRAATSMVAKALPLGI
FT                   GAIMGGTLNRKIASKAIEHVSATLGDPPLVWPDTTRALEQGDAGTSDAATALETAWEKM
FT                   AQSGDDKSNDKSSSD"
FT   gene            772794..774176
FT                   /gene="glyS"
FT                   /locus_tag="ckrop_0657"
FT   CDS_pept        772794..774176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="ckrop_0657"
FT                   /product="glycyl-tRNA synthetase"
FT                   /function="Glycyl-tRNA synthetase (class II)"
FT                   /EC_number="6.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17419"
FT                   /db_xref="GOA:C4LHW4"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002315"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR022961"
FT                   /db_xref="InterPro:IPR027031"
FT                   /db_xref="InterPro:IPR033731"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHW4"
FT                   /protein_id="ACR17419.1"
FT                   /translation="MAASVIDTVVNLCKRRGLVYPSGEIYGGTRSAWDYGPLGVELKEN
FT                   IKKQWWRTFVQSRGDMVGLDSSIILPREVWVSSGHVKTFTDPLVESLHTHKRYRADHLI
FT                   EAYEAKHGHPPANGLADVPDPETGQPGEWTEPQMFSGLMKTYLGPVDNEEGLHYLRPET
FT                   AQGIFVNFKNVQTTSRKKPPFGIGQLGKAFRNEITPGNFIFRTREFEQMEIEYFVPPAD
FT                   APQHFDRWVEDCWNWFVDLGIDPDHLRKFDVPEDERAHYSDRTIDLEYQFGFAGSGWGE
FT                   LMGIANRTDFDLQSHIKGSGEDLSFFAQPTGERYVPYVIEPSFGLTRSLMAFLIDAYHE
FT                   DEAPNAKGGVDKRTVLRLDRRLAPVKVAVLPLSKKDTLTPTAEKVAQDLRGLWNVDYDI
FT                   SGAIGRRYRRQDEIGTPFCVTVDFDTLDDHAVTVRERDTMEQERVSIDKLQGYLAERLA
FT                   GC"
FT   gene            774177..774869
FT                   /locus_tag="ckrop_0658"
FT   CDS_pept        774177..774869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0658"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17420"
FT                   /db_xref="GOA:C4LHW5"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHW5"
FT                   /protein_id="ACR17420.1"
FT                   /translation="MKLSWGPRKEDGGVAHLDLFRDDELIARFSQSRELTSARVKPGAA
FT                   VAGGDQPSSEPSADPESWPEWTFVPHTKGRLSASGPDGQNFHADPQSQREGKEGQIGRA
FT                   KRVALDMGSAETPSADPASDSAEVSKSSGASEGVPAVNIVNCGKLDFVFETPDETKLGQ
FT                   FTGGNRGVRHVVVELEPGQESAMTTDQQVFLAWVARMQLESQLVTSTWMWTVLLIVLLP
FT                   FMLLVFLL"
FT   gene            complement(774988..777258)
FT                   /locus_tag="ckrop_0660"
FT   CDS_pept        complement(774988..777258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0660"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17421"
FT                   /db_xref="GOA:C4LHW6"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHW6"
FT                   /protein_id="ACR17421.1"
FT                   /translation="MAVIRNDHYITEHTTHVAHSANTARRRGVRLTATAAALTLTGGVL
FT                   LGSTTMPEASAQAAHTAQTGVVAQSDSTGSSTDTSGSSVATRERINDSVGALTDSQKKD
FT                   LTEKIKKLQVDDDIAMTVDIANSFGSMSGKEWAHERFQENPQSNVLIVAFDVTKRTQGV
FT                   YGGRNVGNAVTKKTYEAAKEPLAEDNPDWNTVITDKIDAAKDANDNSAALFWLGGGAIA
FT                   IIAAGGGVWYMNRRRTKKQQETMVKDAQTINPDDTTSLNELPYSVLEERAQEELTSTDA
FT                   SIRTADDELRLAIAEFGEDRARPFIRAMDHSKRTLERAFQLRSKIDSGTVRSEEERKAM
FT                   LVDIVSSCGQADRGLDKQSDEFSRLRGLLIDSDRRLDELTQRIVSLRARLPQASSTLSQ
FT                   LRTKYASDALASIADNVDIATEHLDNAERAVDKGRALTHQPAGEQGGLVEYIRTAEMTT
FT                   GQADDLLTDIEQADERIAEARSNIHSLIDEITEELTEAGKLRARASAQGAQFDFDKMDA
FT                   IATEAWDAVEDARAIDAPTGTSATALTTGGDQDESGSTNAKGGELTRAGADPLAMYKRL
FT                   LEADEKLDALLEQARDSDRDRNRALRVFDRTRDDAAAQIEAADSLISTRGQAVGSQART
FT                   LLSDAQRQLSQAQSLRTTDTRRAISEARHAGELGRRAEQAARNDIDDFTRRNQSYFGGG
FT                   GNGGAFIAGMLISSLFHGGGHYGGYGNYGGGFGDGFGDDFGGFGGFGDGGFSDGGSGFD
FT                   GAF"
FT   gene            777357..778007
FT                   /locus_tag="ckrop_0661"
FT   CDS_pept        777357..778007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0661"
FT                   /product="putative secreted protein"
FT                   /function="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17422"
FT                   /db_xref="GOA:C4LHW7"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHW7"
FT                   /protein_id="ACR17422.1"
FT                   /translation="MGRWLGRTLWRVVVGAVLITAVLVCGTALRIWQFARHDDDTPSDV
FT                   IVVMGAAQYNGTPSEWFAARLDKAATMYQEGTAPVIATLGGKQEGDQYTEAEAGKMYLE
FT                   KLGVPSSAIVPISDGSDTLTSARALAEYSHNENRHWSSAVVVTDPWHALRARTMVRDQG
FT                   FTTHSVSTRHGPSVWSRDAQFSGILHETGGLIFYQATHRSNVMSEQDVEDLLK"
FT   gene            778053..779378
FT                   /gene="dgt"
FT                   /locus_tag="ckrop_0662"
FT   CDS_pept        778053..779378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dgt"
FT                   /locus_tag="ckrop_0662"
FT                   /product="dGTP triphosphohydrolase"
FT                   /EC_number="3.1.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17423"
FT                   /db_xref="GOA:C4LHW8"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR023023"
FT                   /db_xref="InterPro:IPR026875"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHW8"
FT                   /protein_id="ACR17423.1"
FT                   /translation="MKLRKVYPYSERDHERRVVEGPKDAQLAGATPEMRDDFDRDRARV
FT                   LHSAALRRLADKTQVVTPQTGDTPRTRLTHSLEVAQISRGIAAGLGVDTDLAELAGLSH
FT                   DIGHPPYGHNGERALDELAQDCGGFEGNAQTLRILSRLEAKVCDVRDGHPVSVGLNLTR
FT                   ASLDATCKYPWTASSPQGVARKKYSAYDEDAPLLEWIRRGAPEGRKCLEAQIMDVSDDI
FT                   AYSVHDVEDAVLSGRVSLNVLWDLVEIAQLAQEGAGVFGGDPDALVDASDRLRQLPVIA
FT                   EAADYDGTLGASVSLKAMTSQLVGRYISATVAATRRAMTNGDESAWTEEMAAGRFSNDL
FT                   VVPPDIVAEITLLKSVAVLYVMDQSLHQKNQERQRDRLFRVKDYLYAGAPTSLDPLYQG
FT                   WWNEASTDAERLRVVIDQLASMTESRLERLDRSARDWSAGWS"
FT   gene            complement(779400..779840)
FT                   /locus_tag="ckrop_0663"
FT   CDS_pept        complement(779400..779840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0663"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17424"
FT                   /db_xref="GOA:C4LHW9"
FT                   /db_xref="InterPro:IPR000026"
FT                   /db_xref="InterPro:IPR016191"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHW9"
FT                   /protein_id="ACR17424.1"
FT                   /translation="MRSACGDGIPSTTRATTDRRAAGHQPSHREDRAAARRVARIRGAS
FT                   GSIPACNANQLPDQARVVVDDIKSGGPFDYPQKDGSHFGNYENALPHKKSNYYREYTVD
FT                   EDKTDHSRGPARIITGGSTATHPDVWYYTSDHYSSFCEMQEN"
FT   gene            780028..781965
FT                   /locus_tag="ckrop_0664"
FT   CDS_pept        780028..781965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0664"
FT                   /product="DNA primase"
FT                   /function="DNA primase (bacterial type)"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17425"
FT                   /db_xref="GOA:C4LHX0"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013173"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR019475"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHX0"
FT                   /protein_id="ACR17425.1"
FT                   /translation="MARGRIPESDIDAIRERTPIEEVVGEYVQLKPAGSDSLKGLSPFK
FT                   DEKTPSFHVRPNKGYYHCFSTGKGGDVFSFLMEMEQVSFPEAVEQCAERIGYTINYQGG
FT                   GPGRREEPGTRQRLVAINKATQEFYREHLDTDEAAPARQFLLDRGFSQDHAEQFGCGYA
FT                   PGGWDTLTKFLLRKGFDVKELEAAGVTSQGRRGPIDRFHRRLTWPIRNTANDVIGFGAR
FT                   KLFDDDKLGKYMNTPETLLYKKSKVLFGIDQAKKNIAERHQAVIVEGYTDVMAMHAAGV
FT                   TTAVAACGTAFGADHLQMVRRLMLDDSHFRGEMIYTFDGDEAGQKAAMRAFEGNQEFLG
FT                   KSFVSVAPNGQDPCDLRLSGGDAAVRDLVMSRIPMVEFVVRTTLASFDLHTTEGRLQAM
FT                   EAVAPAVASVKDTTLQKAYARKLSGWLGWDDVSDVEAAVRRAARKPQSSGLKRGRVRQQ
FT                   RDTWSVKSPAASGPQGSTQPRFTRPNPRNGELAGEREALKIALQEPAAAAELFDVLPAE
FT                   SFRHPTYREVSEGIRRAGGCAAAADVESGGNSWVTKVIENLPQPMGESMVTELMVEPIH
FT                   YEGEDMEWFVRSTMVRLQAVWVGNQIAELKSTLERLRPSDDEYNNLFGDLVALEQYRTG
FT                   LIKQATQRPL"
FT   gene            complement(782077..782340)
FT                   /locus_tag="ckrop_0665"
FT   CDS_pept        complement(782077..782340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0665"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17426"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHX1"
FT                   /protein_id="ACR17426.1"
FT                   /translation="MRLTTFIAGATAGYVMGTKAGRKRYDQIRRGYEAAINSPVAKSAL
FT                   HAGRKALANALDPEPRMRELRARNIRTRHQDDGTTIYVPDED"
FT   gene            complement(782374..783357)
FT                   /locus_tag="ckrop_0666"
FT   CDS_pept        complement(782374..783357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0666"
FT                   /product="putative oxidoreductase"
FT                   /function="Aldo/keto reductases related to diketogulonate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17427"
FT                   /db_xref="GOA:C4LHX2"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHX2"
FT                   /protein_id="ACR17427.1"
FT                   /translation="MLNEHRAGCGAVYVTDADAESHSFSWPVVGERGYTSPMTDSSKTT
FT                   NQQSIPTLSTDRYTAPALGFGTYRLWGQSGAKSVETALTMGYRLIDSAYNYENEGTVGA
FT                   GIRAAIDKGIVSRDDVTVTSKLPGRYQEHDQALSAIEESLYRTGLDYIDLYLIHWPNPK
FT                   QGKYVEAWKALMEARDRGLIRNIGVCNFTPEHLDTLGRETGELPVINQVELHPYFNQAE
FT                   TRAYDNEHGIITEAWSPLARGAVFEEDTIVSIAKNHDASVGQVVLAWHRAIGSLAIPKS
FT                   ASEKRQKENLDSLHVTLTSDEVEAINALTKPDGREKDQDPDEYEEF"
FT   gene            783593..786007
FT                   /locus_tag="ckrop_0667"
FT   CDS_pept        783593..786007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ckrop_0667"
FT                   /product="permease of the major facilitator superfamily"
FT                   /function="Permeases of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ckrop_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ACR17428"
FT                   /db_xref="GOA:C4LHX3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4LHX3"
FT                   /protein_id="ACR17428.1"
FT                   /translation="MDSKEPSSASDSQFAGRASSADSAYDPWKGDPSGVDDASAPEERN
FT                   APAFPFLTFDPSLKELTSSGGRHRRREVDVLRPEDEVSFMGYPLTGGGQRHRQDESESS
FT                   GSGYPGFPSSPTGVSGYDGEILEGEILGTDDGADAAPGREDDTSHDQGLYAQPLEDSFD
FT                   RPEVGDADSRPDDPLSGDADSGGVPAADVTGPQSSAVKTKPATKTAKNSGAKTKPAKPG
FT                   KKPTGRRYPHAKFWSTVAGSVASLMMTLDMTIVLVALPDIGESLKLSLSGSQWIVNAYT
FT                   LAFAALLLGVGSLSDLVGRRGIFIVGQLVFVAASVGCMTADAENWMIVARAIQGAGGAM
FT                   VFGSSLPLLSDVFGPGEEKQRTSAVAVFMAAGAAAVALGPLVGGAIVEFFDWRWIFAIN
FT                   IPIGLLIIMGTLIGVPKDAQQWRWQALEDRKARLLAEGRFDEAEQLEDQQVEETVPPIS
FT                   WLTLIVASVFLFALNYALLTGPDDGWTDGKVFIGFGVSLAGLVLLVWMQLAKGDKAMID
FT                   VRMFAIPSFSAVTIVAFAARLFSFGMMPYIVLWLSGAVGLSSLEVGYVTTALAIPIILF
FT                   SPVAIQLGKKIKVSAIQALGMIIIAAGLLLGLKLNSNSGWVDIIPMYIVVGIGTGLMLP
FT                   HLMDVAVSVVAPRKTGTATGIANTAFPLGTSFGVAIYGAILTAATSSGLKAVSFPTASV
FT