(data stored in SCRATCH zone)

EMBL: CP001622

ID   CP001622; SV 1; circular; genomic DNA; STD; PRO; 4767043 BP.
XX
AC   CP001622; ABJS01000000-ABJS01000529;
XX
PR   Project:PRJNA20097;
XX
DT   24-JUN-2009 (Rel. 101, Created)
DT   11-SEP-2019 (Rel. 142, Last updated, Version 6)
XX
DE   Rhizobium leguminosarum bv. trifolii WSM1325 chromosome, complete genome.
XX
KW   .
XX
OS   Rhizobium leguminosarum bv. trifolii WSM1325
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Rhizobiaceae;
OC   Rhizobium/Agrobacterium group; Rhizobium.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-4767043
RX   PUBMED; 21304718.
RA   Reeve W., O'Hara G., Chain P., Ardley J., Brau L., Nandesena K., Tiwari R.,
RA   Copeland A., Nolan M., Han C., Brettin T., Land M., Ovchinikova G.,
RA   Ivanova N., Mavromatis K., Markowitz V., Kyrpides N., Melino V., Denton M.,
RA   Yates R., Howieson J.;
RT   "Complete genome sequence of Rhizobium leguminosarum bv. trifolii strain
RT   WSM1325, an effective microsymbiont of annual Mediterranean clovers";
RL   Stand Genomic Sci 2(3):347-356(2010).
XX
RN   [2]
RP   1-4767043
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kiss H., Brettin T., Detter J.C., Han C.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Ovchinnikova H., Reeve W.G.;
RT   "Complete sequence of chromosome of Rhizobium leguminosarum bv. trifolii
RT   WSM1325";
RL   Unpublished.
XX
RN   [3]
RP   1-4767043
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Last F.I., Brettin T., Detter J.C.,
RA   Han C., Larimer F., Land M., Hauser L., Kyrpides N., Ovchinnikova G.,
RA   Reeve W.G.;
RT   ;
RL   Submitted (20-MAY-2009) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B310, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; ebb09b659b3af3e42310c52ff083e530.
DR   BioSample; SAMN00000703.
DR   EnsemblGenomes-Gn; EBG00001458800.
DR   EnsemblGenomes-Gn; EBG00001458801.
DR   EnsemblGenomes-Gn; EBG00001458802.
DR   EnsemblGenomes-Gn; EBG00001458803.
DR   EnsemblGenomes-Gn; EBG00001458804.
DR   EnsemblGenomes-Gn; EBG00001458805.
DR   EnsemblGenomes-Gn; EBG00001458806.
DR   EnsemblGenomes-Gn; EBG00001458807.
DR   EnsemblGenomes-Gn; EBG00001458808.
DR   EnsemblGenomes-Gn; EBG00001458809.
DR   EnsemblGenomes-Gn; EBG00001458810.
DR   EnsemblGenomes-Gn; EBG00001458811.
DR   EnsemblGenomes-Gn; EBG00001458812.
DR   EnsemblGenomes-Gn; EBG00001458813.
DR   EnsemblGenomes-Gn; EBG00001458814.
DR   EnsemblGenomes-Gn; EBG00001458815.
DR   EnsemblGenomes-Gn; EBG00001458816.
DR   EnsemblGenomes-Gn; EBG00001458817.
DR   EnsemblGenomes-Gn; EBG00001458818.
DR   EnsemblGenomes-Gn; EBG00001458819.
DR   EnsemblGenomes-Gn; EBG00001458820.
DR   EnsemblGenomes-Gn; EBG00001458821.
DR   EnsemblGenomes-Gn; EBG00001458822.
DR   EnsemblGenomes-Gn; EBG00001458823.
DR   EnsemblGenomes-Gn; EBG00001458824.
DR   EnsemblGenomes-Gn; EBG00001458825.
DR   EnsemblGenomes-Gn; EBG00001458826.
DR   EnsemblGenomes-Gn; EBG00001458827.
DR   EnsemblGenomes-Gn; EBG00001458828.
DR   EnsemblGenomes-Gn; EBG00001458829.
DR   EnsemblGenomes-Gn; EBG00001458830.
DR   EnsemblGenomes-Gn; EBG00001458831.
DR   EnsemblGenomes-Gn; EBG00001458832.
DR   EnsemblGenomes-Gn; EBG00001458833.
DR   EnsemblGenomes-Gn; EBG00001458834.
DR   EnsemblGenomes-Gn; EBG00001458835.
DR   EnsemblGenomes-Gn; EBG00001458836.
DR   EnsemblGenomes-Gn; EBG00001458837.
DR   EnsemblGenomes-Gn; EBG00001458838.
DR   EnsemblGenomes-Gn; EBG00001458839.
DR   EnsemblGenomes-Gn; EBG00001458840.
DR   EnsemblGenomes-Gn; EBG00001458841.
DR   EnsemblGenomes-Gn; EBG00001458842.
DR   EnsemblGenomes-Gn; EBG00001458843.
DR   EnsemblGenomes-Gn; EBG00001458844.
DR   EnsemblGenomes-Gn; EBG00001458845.
DR   EnsemblGenomes-Gn; EBG00001458846.
DR   EnsemblGenomes-Gn; EBG00001458847.
DR   EnsemblGenomes-Gn; EBG00001458848.
DR   EnsemblGenomes-Gn; EBG00001458849.
DR   EnsemblGenomes-Gn; EBG00001458850.
DR   EnsemblGenomes-Gn; EBG00001458851.
DR   EnsemblGenomes-Gn; EBG00001458852.
DR   EnsemblGenomes-Gn; EBG00001458853.
DR   EnsemblGenomes-Gn; EBG00001458854.
DR   EnsemblGenomes-Gn; EBG00001458855.
DR   EnsemblGenomes-Gn; EBG00001458856.
DR   EnsemblGenomes-Gn; EBG00001458857.
DR   EnsemblGenomes-Gn; EBG00001458858.
DR   EnsemblGenomes-Gn; EBG00001458859.
DR   EnsemblGenomes-Gn; EBG00001458860.
DR   EnsemblGenomes-Gn; EBG00001458862.
DR   EnsemblGenomes-Gn; EBG00001458863.
DR   EnsemblGenomes-Gn; EBG00001458864.
DR   EnsemblGenomes-Gn; EBG00001458866.
DR   EnsemblGenomes-Gn; EBG00001458868.
DR   EnsemblGenomes-Gn; EBG00001458870.
DR   EnsemblGenomes-Gn; EBG00001458872.
DR   EnsemblGenomes-Gn; EBG00001458874.
DR   EnsemblGenomes-Gn; EBG00001458876.
DR   EnsemblGenomes-Gn; EBG00001458878.
DR   EnsemblGenomes-Gn; EBG00001458880.
DR   EnsemblGenomes-Gn; EBG00001458882.
DR   EnsemblGenomes-Gn; EBG00001458884.
DR   EnsemblGenomes-Gn; EBG00001458886.
DR   EnsemblGenomes-Gn; EBG00001458888.
DR   EnsemblGenomes-Gn; EBG00001458890.
DR   EnsemblGenomes-Gn; EBG00001458892.
DR   EnsemblGenomes-Gn; EBG00001458894.
DR   EnsemblGenomes-Gn; EBG00001458897.
DR   EnsemblGenomes-Gn; EBG00001458898.
DR   EnsemblGenomes-Gn; EBG00001458900.
DR   EnsemblGenomes-Gn; EBG00001458902.
DR   EnsemblGenomes-Gn; EBG00001458906.
DR   EnsemblGenomes-Gn; EBG00001458908.
DR   EnsemblGenomes-Gn; EBG00001458910.
DR   EnsemblGenomes-Gn; EBG00001458912.
DR   EnsemblGenomes-Gn; EBG00001458914.
DR   EnsemblGenomes-Gn; EBG00001458915.
DR   EnsemblGenomes-Gn; EBG00001458918.
DR   EnsemblGenomes-Gn; Rleg_R0001.
DR   EnsemblGenomes-Gn; Rleg_R0002.
DR   EnsemblGenomes-Gn; Rleg_R0003.
DR   EnsemblGenomes-Gn; Rleg_R0004.
DR   EnsemblGenomes-Gn; Rleg_R0005.
DR   EnsemblGenomes-Gn; Rleg_R0006.
DR   EnsemblGenomes-Gn; Rleg_R0007.
DR   EnsemblGenomes-Gn; Rleg_R0008.
DR   EnsemblGenomes-Gn; Rleg_R0009.
DR   EnsemblGenomes-Gn; Rleg_R0010.
DR   EnsemblGenomes-Gn; Rleg_R0011.
DR   EnsemblGenomes-Gn; Rleg_R0012.
DR   EnsemblGenomes-Gn; Rleg_R0013.
DR   EnsemblGenomes-Gn; Rleg_R0014.
DR   EnsemblGenomes-Gn; Rleg_R0015.
DR   EnsemblGenomes-Gn; Rleg_R0016.
DR   EnsemblGenomes-Gn; Rleg_R0017.
DR   EnsemblGenomes-Gn; Rleg_R0018.
DR   EnsemblGenomes-Gn; Rleg_R0019.
DR   EnsemblGenomes-Gn; Rleg_R0020.
DR   EnsemblGenomes-Gn; Rleg_R0021.
DR   EnsemblGenomes-Gn; Rleg_R0022.
DR   EnsemblGenomes-Gn; Rleg_R0023.
DR   EnsemblGenomes-Gn; Rleg_R0024.
DR   EnsemblGenomes-Gn; Rleg_R0025.
DR   EnsemblGenomes-Gn; Rleg_R0026.
DR   EnsemblGenomes-Gn; Rleg_R0027.
DR   EnsemblGenomes-Gn; Rleg_R0028.
DR   EnsemblGenomes-Gn; Rleg_R0029.
DR   EnsemblGenomes-Gn; Rleg_R0030.
DR   EnsemblGenomes-Gn; Rleg_R0031.
DR   EnsemblGenomes-Gn; Rleg_R0032.
DR   EnsemblGenomes-Gn; Rleg_R0033.
DR   EnsemblGenomes-Gn; Rleg_R0034.
DR   EnsemblGenomes-Gn; Rleg_R0035.
DR   EnsemblGenomes-Gn; Rleg_R0036.
DR   EnsemblGenomes-Gn; Rleg_R0037.
DR   EnsemblGenomes-Gn; Rleg_R0038.
DR   EnsemblGenomes-Gn; Rleg_R0039.
DR   EnsemblGenomes-Gn; Rleg_R0040.
DR   EnsemblGenomes-Gn; Rleg_R0041.
DR   EnsemblGenomes-Gn; Rleg_R0042.
DR   EnsemblGenomes-Gn; Rleg_R0043.
DR   EnsemblGenomes-Gn; Rleg_R0044.
DR   EnsemblGenomes-Gn; Rleg_R0045.
DR   EnsemblGenomes-Gn; Rleg_R0046.
DR   EnsemblGenomes-Gn; Rleg_R0047.
DR   EnsemblGenomes-Gn; Rleg_R0048.
DR   EnsemblGenomes-Gn; Rleg_R0049.
DR   EnsemblGenomes-Gn; Rleg_R0050.
DR   EnsemblGenomes-Gn; Rleg_R0051.
DR   EnsemblGenomes-Gn; Rleg_R0052.
DR   EnsemblGenomes-Gn; Rleg_R0053.
DR   EnsemblGenomes-Gn; Rleg_R0054.
DR   EnsemblGenomes-Gn; Rleg_R0055.
DR   EnsemblGenomes-Gn; Rleg_R0056.
DR   EnsemblGenomes-Gn; Rleg_R0057.
DR   EnsemblGenomes-Gn; Rleg_R0058.
DR   EnsemblGenomes-Gn; Rleg_R0059.
DR   EnsemblGenomes-Gn; Rleg_R0060.
DR   EnsemblGenomes-Gn; Rleg_R0061.
DR   EnsemblGenomes-Gn; Rleg_R0062.
DR   EnsemblGenomes-Gn; Rleg_R0063.
DR   EnsemblGenomes-Tr; EBT00001612911.
DR   EnsemblGenomes-Tr; EBT00001612912.
DR   EnsemblGenomes-Tr; EBT00001612913.
DR   EnsemblGenomes-Tr; EBT00001612914.
DR   EnsemblGenomes-Tr; EBT00001612915.
DR   EnsemblGenomes-Tr; EBT00001612916.
DR   EnsemblGenomes-Tr; EBT00001612917.
DR   EnsemblGenomes-Tr; EBT00001612918.
DR   EnsemblGenomes-Tr; EBT00001612919.
DR   EnsemblGenomes-Tr; EBT00001612920.
DR   EnsemblGenomes-Tr; EBT00001612921.
DR   EnsemblGenomes-Tr; EBT00001612922.
DR   EnsemblGenomes-Tr; EBT00001612923.
DR   EnsemblGenomes-Tr; EBT00001612924.
DR   EnsemblGenomes-Tr; EBT00001612925.
DR   EnsemblGenomes-Tr; EBT00001612926.
DR   EnsemblGenomes-Tr; EBT00001612927.
DR   EnsemblGenomes-Tr; EBT00001612928.
DR   EnsemblGenomes-Tr; EBT00001612929.
DR   EnsemblGenomes-Tr; EBT00001612930.
DR   EnsemblGenomes-Tr; EBT00001612931.
DR   EnsemblGenomes-Tr; EBT00001612932.
DR   EnsemblGenomes-Tr; EBT00001612933.
DR   EnsemblGenomes-Tr; EBT00001612934.
DR   EnsemblGenomes-Tr; EBT00001612935.
DR   EnsemblGenomes-Tr; EBT00001612936.
DR   EnsemblGenomes-Tr; EBT00001612937.
DR   EnsemblGenomes-Tr; EBT00001612938.
DR   EnsemblGenomes-Tr; EBT00001612939.
DR   EnsemblGenomes-Tr; EBT00001612940.
DR   EnsemblGenomes-Tr; EBT00001612941.
DR   EnsemblGenomes-Tr; EBT00001612942.
DR   EnsemblGenomes-Tr; EBT00001612943.
DR   EnsemblGenomes-Tr; EBT00001612944.
DR   EnsemblGenomes-Tr; EBT00001612945.
DR   EnsemblGenomes-Tr; EBT00001612946.
DR   EnsemblGenomes-Tr; EBT00001612947.
DR   EnsemblGenomes-Tr; EBT00001612948.
DR   EnsemblGenomes-Tr; EBT00001612949.
DR   EnsemblGenomes-Tr; EBT00001612950.
DR   EnsemblGenomes-Tr; EBT00001612951.
DR   EnsemblGenomes-Tr; EBT00001612952.
DR   EnsemblGenomes-Tr; EBT00001612953.
DR   EnsemblGenomes-Tr; EBT00001612954.
DR   EnsemblGenomes-Tr; EBT00001612955.
DR   EnsemblGenomes-Tr; EBT00001612956.
DR   EnsemblGenomes-Tr; EBT00001612957.
DR   EnsemblGenomes-Tr; EBT00001612958.
DR   EnsemblGenomes-Tr; EBT00001612959.
DR   EnsemblGenomes-Tr; EBT00001612960.
DR   EnsemblGenomes-Tr; EBT00001612961.
DR   EnsemblGenomes-Tr; EBT00001612962.
DR   EnsemblGenomes-Tr; EBT00001612963.
DR   EnsemblGenomes-Tr; EBT00001612964.
DR   EnsemblGenomes-Tr; EBT00001612965.
DR   EnsemblGenomes-Tr; EBT00001612966.
DR   EnsemblGenomes-Tr; EBT00001612967.
DR   EnsemblGenomes-Tr; EBT00001612968.
DR   EnsemblGenomes-Tr; EBT00001612969.
DR   EnsemblGenomes-Tr; EBT00001612970.
DR   EnsemblGenomes-Tr; EBT00001612971.
DR   EnsemblGenomes-Tr; EBT00001612972.
DR   EnsemblGenomes-Tr; EBT00001612973.
DR   EnsemblGenomes-Tr; EBT00001612974.
DR   EnsemblGenomes-Tr; EBT00001612975.
DR   EnsemblGenomes-Tr; EBT00001612976.
DR   EnsemblGenomes-Tr; EBT00001612977.
DR   EnsemblGenomes-Tr; EBT00001612978.
DR   EnsemblGenomes-Tr; EBT00001612979.
DR   EnsemblGenomes-Tr; EBT00001612980.
DR   EnsemblGenomes-Tr; EBT00001612981.
DR   EnsemblGenomes-Tr; EBT00001612982.
DR   EnsemblGenomes-Tr; EBT00001612983.
DR   EnsemblGenomes-Tr; EBT00001612984.
DR   EnsemblGenomes-Tr; EBT00001612985.
DR   EnsemblGenomes-Tr; EBT00001612986.
DR   EnsemblGenomes-Tr; EBT00001612987.
DR   EnsemblGenomes-Tr; EBT00001612988.
DR   EnsemblGenomes-Tr; EBT00001612989.
DR   EnsemblGenomes-Tr; EBT00001612990.
DR   EnsemblGenomes-Tr; EBT00001612991.
DR   EnsemblGenomes-Tr; EBT00001612992.
DR   EnsemblGenomes-Tr; EBT00001612993.
DR   EnsemblGenomes-Tr; EBT00001612994.
DR   EnsemblGenomes-Tr; EBT00001612995.
DR   EnsemblGenomes-Tr; EBT00001612996.
DR   EnsemblGenomes-Tr; EBT00001612997.
DR   EnsemblGenomes-Tr; EBT00001612998.
DR   EnsemblGenomes-Tr; EBT00001612999.
DR   EnsemblGenomes-Tr; EBT00001613000.
DR   EnsemblGenomes-Tr; Rleg_R0001-1.
DR   EnsemblGenomes-Tr; Rleg_R0002-1.
DR   EnsemblGenomes-Tr; Rleg_R0003-1.
DR   EnsemblGenomes-Tr; Rleg_R0004-1.
DR   EnsemblGenomes-Tr; Rleg_R0005-1.
DR   EnsemblGenomes-Tr; Rleg_R0006-1.
DR   EnsemblGenomes-Tr; Rleg_R0007-1.
DR   EnsemblGenomes-Tr; Rleg_R0008-1.
DR   EnsemblGenomes-Tr; Rleg_R0009-1.
DR   EnsemblGenomes-Tr; Rleg_R0010-1.
DR   EnsemblGenomes-Tr; Rleg_R0011-1.
DR   EnsemblGenomes-Tr; Rleg_R0012-1.
DR   EnsemblGenomes-Tr; Rleg_R0013-1.
DR   EnsemblGenomes-Tr; Rleg_R0014-1.
DR   EnsemblGenomes-Tr; Rleg_R0015-1.
DR   EnsemblGenomes-Tr; Rleg_R0016-1.
DR   EnsemblGenomes-Tr; Rleg_R0017-1.
DR   EnsemblGenomes-Tr; Rleg_R0018-1.
DR   EnsemblGenomes-Tr; Rleg_R0019-1.
DR   EnsemblGenomes-Tr; Rleg_R0020-1.
DR   EnsemblGenomes-Tr; Rleg_R0021-1.
DR   EnsemblGenomes-Tr; Rleg_R0022-1.
DR   EnsemblGenomes-Tr; Rleg_R0023-1.
DR   EnsemblGenomes-Tr; Rleg_R0024-1.
DR   EnsemblGenomes-Tr; Rleg_R0025-1.
DR   EnsemblGenomes-Tr; Rleg_R0026-1.
DR   EnsemblGenomes-Tr; Rleg_R0027-1.
DR   EnsemblGenomes-Tr; Rleg_R0028-1.
DR   EnsemblGenomes-Tr; Rleg_R0029-1.
DR   EnsemblGenomes-Tr; Rleg_R0030-1.
DR   EnsemblGenomes-Tr; Rleg_R0031-1.
DR   EnsemblGenomes-Tr; Rleg_R0032-1.
DR   EnsemblGenomes-Tr; Rleg_R0033-1.
DR   EnsemblGenomes-Tr; Rleg_R0034-1.
DR   EnsemblGenomes-Tr; Rleg_R0035-1.
DR   EnsemblGenomes-Tr; Rleg_R0036-1.
DR   EnsemblGenomes-Tr; Rleg_R0037-1.
DR   EnsemblGenomes-Tr; Rleg_R0038-1.
DR   EnsemblGenomes-Tr; Rleg_R0039-1.
DR   EnsemblGenomes-Tr; Rleg_R0040-1.
DR   EnsemblGenomes-Tr; Rleg_R0041-1.
DR   EnsemblGenomes-Tr; Rleg_R0042-1.
DR   EnsemblGenomes-Tr; Rleg_R0043-1.
DR   EnsemblGenomes-Tr; Rleg_R0044-1.
DR   EnsemblGenomes-Tr; Rleg_R0045-1.
DR   EnsemblGenomes-Tr; Rleg_R0046-1.
DR   EnsemblGenomes-Tr; Rleg_R0047-1.
DR   EnsemblGenomes-Tr; Rleg_R0048-1.
DR   EnsemblGenomes-Tr; Rleg_R0049-1.
DR   EnsemblGenomes-Tr; Rleg_R0050-1.
DR   EnsemblGenomes-Tr; Rleg_R0051-1.
DR   EnsemblGenomes-Tr; Rleg_R0052-1.
DR   EnsemblGenomes-Tr; Rleg_R0053-1.
DR   EnsemblGenomes-Tr; Rleg_R0054-1.
DR   EnsemblGenomes-Tr; Rleg_R0055-1.
DR   EnsemblGenomes-Tr; Rleg_R0056-1.
DR   EnsemblGenomes-Tr; Rleg_R0057-1.
DR   EnsemblGenomes-Tr; Rleg_R0058-1.
DR   EnsemblGenomes-Tr; Rleg_R0059-1.
DR   EnsemblGenomes-Tr; Rleg_R0060-1.
DR   EnsemblGenomes-Tr; Rleg_R0061-1.
DR   EnsemblGenomes-Tr; Rleg_R0062-1.
DR   EnsemblGenomes-Tr; Rleg_R0063-1.
DR   EuropePMC; PMC3256650; 22037403.
DR   EuropePMC; PMC3957732; 24600043.
DR   EuropePMC; PMC5637928; 29104370.
DR   EuropePMC; PMC5739047; 29220487.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00435; ROSE.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00517; serC.
DR   RFAM; RF00518; speF.
DR   RFAM; RF00519; suhB.
DR   RFAM; RF00520; ybhL.
DR   RFAM; RF00521; SAM_alpha.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01793; ffh.
DR   RFAM; RF01849; alpha_tmRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001622.
DR   SILVA-SSU; CP001622.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4024173
CC   Source DNA and bacteria available from Wayne G. Reeve
CC   (W.Reeve@murdoch.edu.au)
CC   Contacts: Wayne G. Reeve (W.Reeve@murdoch.edu.au)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name  :: Rhizobium leguminosarum trifolii WSM1325
CC   GOLD Stamp ID          :: Gi01547
CC   Greengenes ID          :: 267555
CC   Oxygen Requirement     :: Aerobe
CC   Cell Shape             :: Rod-shaped
CC   Motility               :: Motile
CC   Sporulation            :: Nonsporulating
CC   Temperature Range      :: Mesophile
CC   Biotic Relationship    :: Symbiotic
CC   Symbiotic Relationship :: Mutualistic
CC   Diseases               :: None
CC   Habitat                :: Host, Root nodule
CC   Phenotypes             :: Nitrogen fixation, Non-Pathogen
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4767043
FT                   /organism="Rhizobium leguminosarum bv. trifolii WSM1325"
FT                   /strain="WSM1325"
FT                   /mol_type="genomic DNA"
FT                   /note="biovar: trifolii"
FT                   /db_xref="taxon:395491"
FT   gene            55..1605
FT                   /locus_tag="Rleg_0001"
FT   CDS_pept        55..1605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: rec:RHECIAT_CH0000397 chromosomal replication
FT                   initiator protein; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA; Chromosomal replication initiator DnaA
FT                   domain; SMART: Chromosomal replication initiator DnaA
FT                   domain; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54313"
FT                   /db_xref="GOA:C6AY89"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:C6AY89"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ACS54313.1"
FT                   /translation="MQMNTMTTSGLDNGDAAPQAFGSIRLEAAEVKADMKQNVLFERVT
FT                   ARLKAQVGQDVYASWFARLKLHSVSKSVVRLSVPTTFLKSWINNRYLDLITGLFQAEDP
FT                   EILKIEVLVRTATRHGTKALDEAVAPEPAAPTQMRRPASAQPAGQAVQQAVSAVAAARP
FT                   ASFGSPLFGSPLDSRFTFDTFVEGSSNRVALAAAKTIAEAGQGAVRFNPLFIHSTVGLG
FT                   KTHLLQAVANAAVQNPRALRVVYLTAEYFMWRFATAIRDNDALTLKDSLRNIDLLIIDD
FT                   MQFLQGKMIQHEFCHLLNMLLDSAKQVVVAADRAPWELESLDPRVRSRLQGGVAIEFDA
FT                   PDYEMRLEILKRRLAVARLEDPSLEIPAELLQHVARNVTASGRELEGAFNQLVFRRSFE
FT                   PNLSIERVDELLAHLVGSGEPRRVRIEDIQRIVARHYNVSRQELVSNRRTRVIVKPRQI
FT                   AMYLSKTLTPRSFPEIGRRFGGRDHTTVLHAVRKIEELISGDTKLSHEVELLKRLINE"
FT   gene            1743..2825
FT                   /locus_tag="Rleg_0002"
FT   CDS_pept        1743..2825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0002"
FT                   /product="Saccharopine dehydrogenase"
FT                   /note="PFAM: Saccharopine dehydrogenase; KEGG:
FT                   rec:RHECIAT_CH0000398 probable saccharopine dehydrogenase
FT                   protein (NAD(+), L-lysine-forming)"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54314"
FT                   /db_xref="GOA:C6AY90"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR032095"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6AY90"
FT                   /inference="protein motif:PFAM:PF03435"
FT                   /protein_id="ACS54314.1"
FT                   /translation="MSFEKIAVLGLGKVGRLAATLLHEGGFEVIGVDAQLPLSDVPFKC
FT                   RIGDISDPQVIGELLSNVEAVLSCLPYHLNIELARAAHLAGIHYFDLTEDVPTTNFIIE
FT                   LSKTARGLMAPQCGLAPGFVGIIGASLADGFDRCRSIRMRVGALPQHPTGLLGYAFNWS
FT                   PEGVVNEYLNDCEVIEGGVRKLVSPMEWHETVYVGGVKLEAFTTSGGLGTMCDTMLGKI
FT                   DNLDYKTMRYPGHMELMNFFFHELLMRDKRKLAGEILTNAKPPVEDDVVYVHVAAEGTE
FT                   NGSLRRKEFVRAYYPIEIAGARRTAIAWTTSASVVAVIEMVRDGLLPTTGFLHQEHIPL
FT                   EMFLKTPTGSLFKAGATSHG"
FT   gene            complement(2893..4095)
FT                   /locus_tag="Rleg_0003"
FT   CDS_pept        complement(2893..4095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0003"
FT                   /product="oxygen-independent coproporphyrinogen III
FT                   oxidase"
FT                   /EC_number="1.3.98.3"
FT                   /note="KEGG: rec:RHECIAT_CH0000399 oxygen-independent
FT                   coprophorphyrinogen III oxidase protein; TIGRFAM:
FT                   oxygen-independent coproporphyrinogen III oxidase; PFAM:
FT                   Radical SAM domain protein; HemN domain protein; SMART:
FT                   Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54315"
FT                   /db_xref="GOA:C6AY91"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:C6AY91"
FT                   /inference="protein motif:TFAM:TIGR00539"
FT                   /protein_id="ACS54315.1"
FT                   /translation="MDNFDTPSTSRDAALLPDTGEPGFGVYVHWPFCAAKCPYCDFNSH
FT                   VRHQPVDQERFTSAFLTEMAAVRAMSGPKTVTSIFLGGGTPSLMKPEAVSAILDGIARH
FT                   WHVPDGIEITMEANPSSVEAERFRGYRAAGVNRVSLGVQALNDRDLKFLGRLHDVADAL
FT                   KAIRLARDIFPRMSFDLIYARPDQTVEEWEKELKEAISYAVDHLSLYQLTIEEGTPFYG
FT                   LHKAGKLIVPDGEQSAVLYEATQEITAREGMPAYEVSNHARPGAESRHNLTYWRYGDYA
FT                   GIGPGAHGRLTRGPEKLATATERKPETWLDMVERDGHGILDEERLGFEEQSDELLLMGL
FT                   RLREGVDLARWQQLSGRDLDPKREEFLLEHKFIERIGNSRLRCTPSGMLILDSVVADLA
FT                   C"
FT   gene            complement(4105..4749)
FT                   /locus_tag="Rleg_0004"
FT   CDS_pept        complement(4105..4749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0004"
FT                   /product="non-canonical purine NTP pyrophosphatase,
FT                   rdgB/HAM1 family"
FT                   /note="TIGRFAM: non-canonical purine NTP pyrophosphatase,
FT                   rdgB/HAM1 family; PFAM: Ham1 family protein; KEGG:
FT                   rec:RHECIAT_CH0000400 probable nucleoside-triphosphatase
FT                   protein, HAM1-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54316"
FT                   /db_xref="GOA:C6AY92"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:C6AY92"
FT                   /inference="protein motif:TFAM:TIGR00042"
FT                   /protein_id="ACS54316.1"
FT                   /translation="MRKLETKTIVVASHNAGKIREIQELIGPLGFTAKSAAELNFVEPD
FT                   ETGTSFEENATIKAVASANASGMPALSDDSGLVVDALGGDPGVYTANWAEKADGTRDFD
FT                   MAMAKVEKALQDAGATKPEQRTARFISVLCLAWPDGHTELFRGEVEGSVVWPPRGTQGF
FT                   GYDPVFQPEGYDITFGEMSGEEKHGWNVGKPQALSHRARAFKLFVETCLEA"
FT   gene            complement(4750..5166)
FT                   /locus_tag="Rleg_0005"
FT   CDS_pept        complement(4750..5166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0005"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: ret:RHE_CH00362
FT                   lactoylglutathione lyase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54317"
FT                   /db_xref="GOA:C6AY93"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C6AY93"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACS54317.1"
FT                   /translation="MLEGMLETALYARDLDQAETFYEDVLGLEKIARAANRHVFFRCGP
FT                   GVLLIFNPEETVKPPAPEALQVPPHGTTGQGHACFRVSGRNIDAMAERLTAAGVAIESE
FT                   VRWPKGGRSIYFRDPAGNSLECAEAKIWGIEQDI"
FT   gene            complement(5172..5891)
FT                   /locus_tag="Rleg_0006"
FT   CDS_pept        complement(5172..5891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0006"
FT                   /product="ribonuclease PH"
FT                   /EC_number="2.7.7.56"
FT                   /note="KEGG: rec:RHECIAT_CH0000402 ribonuclease PH protein;
FT                   TIGRFAM: ribonuclease PH; PFAM: 3' exoribonuclease;
FT                   Exoribonuclease, phosphorolytic domain 2"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54318"
FT                   /db_xref="GOA:C6AY94"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/TrEMBL:C6AY94"
FT                   /inference="protein motif:TFAM:TIGR01966"
FT                   /protein_id="ACS54318.1"
FT                   /translation="MRPSGRKIDQMRKVSFERNFSKHAEGSCLVKFGDTHVLCTASLEE
FT                   KTPPWLRNTGKGWVTAEYGMLPRATGERMKREAAAGKQGGRTQEIQRLIGRSLRAVVDL
FT                   QALGERQITLDCDVIQADGGTRTASITGGWIALYDCLKWMESRNMIKVERVLKDHVAAI
FT                   SCGIFASQPVIDLDYIEDSSAETDANFVMTGTGGIVEIQGTAEGTPFSEGEFTSLMQLA
FT                   RNGIGELVALQKQAVEG"
FT   gene            6020..7108
FT                   /locus_tag="Rleg_0007"
FT   CDS_pept        6020..7108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0007"
FT                   /product="heat-inducible transcription repressor HrcA"
FT                   /note="TIGRFAM: heat-inducible transcription repressor
FT                   HrcA; PFAM: Negative regulator of class I heat shock
FT                   protein; KEGG: ret:RHE_CH00364 heat-inducible transcription
FT                   repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54319"
FT                   /db_xref="GOA:C6AY95"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR023120"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6AY95"
FT                   /inference="protein motif:TFAM:TIGR00331"
FT                   /protein_id="ACS54319.1"
FT                   /translation="MGIRSTSVSDAVAALDERSREIFRRIVEGYLESGEPLGSRNLSRI
FT                   LPMSLSPASVRNVMSDLEELGLIYSPHVSAGRLPTQIGLRFFVDAFMQVGDLSAEERAS
FT                   IDRQVRAESGGNPVESMMNEASRMLSGISRGAGLVITSKSDPVLKHVEFIRLEPTKALA
FT                   VLVGDHDQVENRIIELPAGVTSSQLTEAANFLNAHMSGQTLPELRKQLSRLKDDVRHEL
FT                   DALSRDLVERGIAVWAGSPDEGKPTQLIIRGRANLLEGLAGAEDLDRLRLLFDDLEKKD
FT                   SLIEILNLAESGSGVRIFIGSENKLFSLSGSSLIVAPYRDDDDRIVGAVGVIGPTRLNY
FT                   SRIVPMVDYTAQLVSRLSRNQL"
FT   gene            7220..7852
FT                   /locus_tag="Rleg_0008"
FT   CDS_pept        7220..7852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0008"
FT                   /product="GrpE protein"
FT                   /note="PFAM: GrpE protein; KEGG: rec:RHECIAT_CH0000404
FT                   molecular chaperone heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54320"
FT                   /db_xref="GOA:C6AY96"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:C6AY96"
FT                   /inference="protein motif:PFAM:PF01025"
FT                   /protein_id="ACS54320.1"
FT                   /translation="MTDDTTKNGPDATAADAAADATAYVENETAQEEAAQPDALELLKA
FT                   ENGELRDRYLRLAAEMDNLRRRTEREVKDAKSYSVAGFARDMLAVSDNLRRALDAIPPE
FT                   TRAAADAGLSTLIEGVEMTERAMLSALERHGVRKLEPVGQKFDPNFHQAMFEVPNPDVP
FT                   NNTVVQVVQAGFSIGERVLRPAMVGVAKGGPKPAEAETNSVFDEKDA"
FT   gene            complement(7917..8861)
FT                   /locus_tag="Rleg_0009"
FT   CDS_pept        complement(7917..8861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0009"
FT                   /product="Inosine/uridine-preferring nucleoside hydrolase"
FT                   /note="PFAM: Inosine/uridine-preferring nucleoside
FT                   hydrolase; KEGG: rec:RHECIAT_CH0000405
FT                   inosine-adenosine-guanosine preferring nucleoside hydrolase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54321"
FT                   /db_xref="GOA:C6AY97"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:C6AY97"
FT                   /inference="protein motif:PFAM:PF01156"
FT                   /protein_id="ACS54321.1"
FT                   /translation="MASARKIIIDTDPGQDDAAAIMLAFGSPDELEVLGITTVAGNVPL
FT                   SLTSRNARIVCELCERTETKVFAGADAPIARKLVTAEHVHGKTGLDGPELNEPTMALQP
FT                   GHAVDFIIETLRHEPEGTVTLCTLGPLTNIGMAFQKAPDIIPRIRELVMMGGGFFEGGN
FT                   ITPAAEFNIYVDPEAADIVFRSGVPIVMMPLDVTHQLLTRKDRVKRMAEIGTAPAKAMV
FT                   EMLEFFERFDIEKYGSDGGPLHDPTVVAYLLKPELFQGRDCNVEIEVQSELTVGMTVVD
FT                   WWHVTERKRNAKVMRHVDADGFFDLLIERFARI"
FT   gene            9139..9564
FT                   /locus_tag="Rleg_0010"
FT   CDS_pept        9139..9564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0010"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG:
FT                   ret:RHE_CH00367 molecular chaperone small heat shock
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54322"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/TrEMBL:C6AY98"
FT                   /inference="protein motif:PFAM:PF00011"
FT                   /protein_id="ACS54322.1"
FT                   /translation="MSRITPFASPLLLGFDAMEKTLERISKASDGYPPYNIERIGADSG
FT                   APERLRITLAVAGFSEEELDVSIEENQLLIRGRQVEQGERDYLYRGIAARQFQRTFVLA
FT                   DGMQVLGAALKNGLLSVDLIRPEPARMVKKINISVSQ"
FT   gene            9612..9869
FT                   /locus_tag="Rleg_0011"
FT   CDS_pept        9612..9869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0011"
FT                   /product="protein of unknown function DUF1150"
FT                   /note="PFAM: protein of unknown function DUF1150; KEGG:
FT                   rec:RHECIAT_CH0000407 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54323"
FT                   /db_xref="InterPro:IPR009531"
FT                   /db_xref="UniProtKB/TrEMBL:C6AY99"
FT                   /inference="protein motif:PFAM:PF06620"
FT                   /protein_id="ACS54323.1"
FT                   /translation="MLMKEATSHLTKSELAHIGNGEVAYIRKMRTDEVAKCFPEAPDID
FT                   PTVDLWALFGADGTPILLTDNRSSTFFKAAEDELKTVSLH"
FT   gene            complement(10030..10296)
FT                   /locus_tag="Rleg_0012"
FT   CDS_pept        complement(10030..10296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0012"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH02662 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54324"
FT                   /db_xref="InterPro:IPR018735"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYA0"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH02662"
FT                   /protein_id="ACS54324.1"
FT                   /translation="MCRNIKPLFNFDPPATDEEIHDAALQFVRKVSGATKPSKRDELAF
FT                   EHAVSSIAACARELLDSLETSQPPRDREEVAAKARARTAVRFA"
FT   gene            10650..11054
FT                   /locus_tag="Rleg_0013"
FT   CDS_pept        10650..11054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54325"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYA1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS54325.1"
FT                   /translation="MNQSHRFLFHTQRPRDDGCGVLVLQMLTGMSYDEVAAMIDWGDKS
FT                   AHYTTWNDLCGVLAEIGVPIEAPIKTSRWSDIQGVAIVHVQRDHFMLYDAENGLFYDPA
FT                   EMEGPGVASDRIPTSYLTVDPSALTTAKIG"
FT   gene            complement(11244..11945)
FT                   /locus_tag="Rleg_0014"
FT   CDS_pept        complement(11244..11945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0014"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /note="PFAM: putative methyltransferase; KEGG:
FT                   rec:RHECIAT_CH0000409 probable tRNA
FT                   (guanine-N(7)-)-methyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54326"
FT                   /db_xref="GOA:C6AYA2"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYA2"
FT                   /inference="protein motif:PRIAM:2.1.1.33"
FT                   /protein_id="ACS54326.1"
FT                   /translation="MTDMERRGRATEAFFGRRKGKALREQQAETLNSLLPAFLIDLTAA
FT                   PPEPLTSLFPVPVERLRLEIGFGGGEHLIHRALNTPSTGFIGVEPFVNSMQKLLSRIGE
FT                   TGASNIRVYNDDATQLLDWLPDGSLDQVDLLYPDPWPKRKHWKRRFVSKTNLDRFHRVL
FT                   KPGGLFCFASDIDTYVNWTLIKCRDHGGFDWMADNAADWLTPYEGWPSTRYEAKARREG
FT                   RSSAYLTFRKI"
FT   gene            complement(11954..13192)
FT                   /locus_tag="Rleg_0015"
FT   CDS_pept        complement(11954..13192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0015"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /note="KEGG: ret:RHE_CH00370 S-adenosylmethionine
FT                   synthetase; TIGRFAM: S-adenosylmethionine synthetase; PFAM:
FT                   S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54327"
FT                   /db_xref="GOA:C6AYA3"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYA3"
FT                   /inference="protein motif:TFAM:TIGR01034"
FT                   /protein_id="ACS54327.1"
FT                   /translation="MRANYLFTSESVAEGHPDKVCDRISDEIVDLVYREAAKTGVNPWG
FT                   VRIACETLATTNRVVIAGEVRLPPSLMKKDKDGKDVINPSKFKAAARRAIKDIGYEQDG
FT                   FHWKKAKIDVLLHSQSADIAQGVDSAADQQGDEGAGDQGIMFGYACRETPDLMPAPIYY
FT                   SHKILQLLAVARKKGDGEVAKLGPDAKSQVTVRYVDGKPSEATSIVLSTQHLDESWVSK
FT                   KVRAVVEPYIREALGGLKIADDCKWYINPTGKFVIGGPDGDAGLTGRKIIVDTYGGAAP
FT                   HGGGAFSGKDTTKVDRSAAYAARYLAKNVVAAGLADRCTIQISYAIGVAQPLSIYVDLH
FT                   GTGKVTEDQIEAAIRKNMDLSPTGIRRHLDLNKPIYAKTSAYGHFGRKAGRDGSFSWER
FT                   TDLVKALKESVKT"
FT   gene            complement(13371..13787)
FT                   /locus_tag="Rleg_0016"
FT   CDS_pept        complement(13371..13787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0016"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: ret:RHE_CH00371
FT                   transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54328"
FT                   /db_xref="GOA:C6AYA4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYA4"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACS54328.1"
FT                   /translation="MIENKKKPNPIDIHVGSRIRLRRTMLGMSQEKLGESLGITFQQIQ
FT                   KYEKGTNRVGASRLQNISNILNVPVSFFFEDAPGEHSNAGGGMETSSSNYVVDFLSSSE
FT                   GLQLNRAFVKISDPKVRRKVVELVKALAAEADAD"
FT   gene            complement(13939..15543)
FT                   /locus_tag="Rleg_0017"
FT   CDS_pept        complement(13939..15543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0017"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /note="TIGRFAM: apolipoprotein N-acyltransferase; PFAM:
FT                   Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: rec:RHECIAT_CH0000412
FT                   apolipoprotein N-acyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54329"
FT                   /db_xref="GOA:C6AYA5"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYA5"
FT                   /inference="protein motif:TFAM:TIGR00546"
FT                   /protein_id="ACS54329.1"
FT                   /translation="MERLADRVILVWGFKRSLLAIAAGAFAVLALPPIGFFAAMFVSFT
FT                   LLVWLIDGAAASPESGLIGRLWPAFATGWLFGFGYFVAGLWWVGHALLVDQEEFAWALP
FT                   LAILGLPACLAIFYGLAAALARIFWSDGMGRIAALAAGFGLMEWLRSVILTGFPWNAIG
FT                   YGMMPVPLMMQSAHLIGAMGVTALAVFVFSAPALAGTRQGARPGIALAVLLFAAHLGYG
FT                   AYALHLAPRPDILPEDKRPVVRLVQPAIDQTEKMDNDVDRATIFETHLKLSAEAPKNGG
FT                   RKPDIIVWPETSIPFILTDNQDALTRIADTLDDNQILIAGAVRAEEMGPGTPPRYYNSI
FT                   YVIDGRGQIIAASDKVHLVPFGEYLPFEDVLTEFGIQNVVEVPGGFSAAASRHLLALPG
FT                   GLNLYPLICYEIIFPGEMTGDIKDANAILNITNDAWFGLTPGPYQHFQQARVRAVETGL
FT                   PLIRDANNGISALVNAHGEIIAGLDLGETGFVDATLDSIGAGLGTTIPRQTYFWLTEAL
FT                   LILIALISRRGFISGLN"
FT   sig_peptide     complement(15451..15543)
FT                   /locus_tag="Rleg_0017"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.815) with cleavage site probability 0.598 at
FT                   residue 31"
FT   gene            15910..17172
FT                   /locus_tag="Rleg_0018"
FT   CDS_pept        15910..17172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0018"
FT                   /product="adenylate/guanylate cyclase"
FT                   /note="PFAM: adenylyl cyclase class-3/4/guanylyl cyclase;
FT                   SMART: adenylyl cyclase class-3/4/guanylyl cyclase; KEGG:
FT                   rec:RHECIAT_CH0001286 probable adenylate cyclase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54330"
FT                   /db_xref="GOA:C6AYA6"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYA6"
FT                   /inference="protein motif:PFAM:PF00211"
FT                   /protein_id="ACS54330.1"
FT                   /translation="MLLPVENNTVAARGTDKLVHGAEVASASPIIDWLAGDECHALDEA
FT                   GVISGLGRRLRAIGVPVDRLALYLITLHPEYFGRSIAWTEEEPVDIEDRQHGTISLAFM
FT                   DSAISHAMRTRRTVVVGRSGVGASWQCLRTLADRNLEQLIVSPLCNSDGPVSTASFATR
FT                   KPTGFTDIERQIIQRVSPALRNVCELLTLRKVGNTMLDTYIGPYTAQRVRAGHIRQGEV
FT                   ESIDAALLLCDLRGFTKLSNRLPPQEVMQFVNCYYDKVVPSITGNGGEVAKFMGDAVLA
FT                   FFPAYSAEWAAASAYNAAIEISTRTAEATGIKMDVGIALHYGIVNYGNIGSGGRLDFTL
FT                   IGPDVNLVNRIQHVCSEESRQLLMSRSFVEAHIGCERLPIGHRQLKGFERPVELFQGPE
FT                   LDRKLTIDVPHSGSISKQACS"
FT   gene            complement(17871..18377)
FT                   /locus_tag="Rleg_0019"
FT   CDS_pept        complement(17871..18377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0019"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: msl:Msil_1919 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54331"
FT                   /db_xref="InterPro:IPR005180"
FT                   /db_xref="InterPro:IPR035923"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYA7"
FT                   /inference="similar to AA sequence:KEGG:Msil_1919"
FT                   /protein_id="ACS54331.1"
FT                   /translation="MTDSNGISVVRTPVWIEHIRIVSKRSFDQVKTKIEKLPHFDNGIR
FT                   KILRDGDFVRVKKELERLQGSAGLIIFSVATHGDWLAIRGGSRHALQYVIGNVLISSEM
FT                   TKHQLPAGLYAPLRIMLYENEEGTATLEYDRPSDLFGQFNDDRVTSVAEHLDQQIYDCL
FT                   VAAAA"
FT   gene            complement(18450..19442)
FT                   /locus_tag="Rleg_0020"
FT   CDS_pept        complement(18450..19442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0020"
FT                   /product="Nitrilase"
FT                   /EC_number="3.5.5.1"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: bpy:Bphyt_4729 nitrilase/cyanide
FT                   hydratase and apolipoprotein N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54332"
FT                   /db_xref="GOA:C6AYA8"
FT                   /db_xref="InterPro:IPR000132"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYA8"
FT                   /inference="protein motif:PRIAM:3.5.5.1"
FT                   /protein_id="ACS54332.1"
FT                   /translation="MTIVKAAAVQISPSLYSREETVDKVVTKIADLGDKGVQFATFPET
FT                   VVPYYPYFSFVQSAYDLRTGKEHLRLLDQSVTIPSDTTRTIAEACKRARVVVSIGVNER
FT                   DGGTIYNTQLLFDADGTLLQRRRKISPTFHERMIWGYGDGSGLRAVDSAVGRIGQLACW
FT                   EHYNPLARFALMADGEQIHSAMYPGSFGGDLFSEQMAVNIRQHALESGCFVVNATAWLD
FT                   PQQQAQVMEDTGCSIGPISSGCFTAIVAPDGSLIEEPLRSGEGVVIADLDFTLIDKRKQ
FT                   LMDSRGHYSRPELLSLLIDRTPTIHVHERITPSVPTNTAEVTEGGPALV"
FT   gene            complement(19503..20096)
FT                   /locus_tag="Rleg_0021"
FT   CDS_pept        complement(19503..20096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0021"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54333"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYA9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS54333.1"
FT                   /translation="MQRRTLLTLGTGLAVSVLTGFRPAATTTETHHRPAGLWFADMEPD
FT                   GLTRTYRRYRLLLVGQRDDAVASDLSESAVEVLERFLPASRARLIRAADTRRVGVLIGT
FT                   RQQDIAIMTRESAEALFAAGPPFADIRNLPLRLIVSFDSHVLVSRTDFPDSHAYAVAQT
FT                   LTEHKNLLPRPAVAPDGLIPVHRGAHAYFTGETI"
FT   sig_peptide     complement(20016..20096)
FT                   /locus_tag="Rleg_0021"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.425 at
FT                   residue 27"
FT   gene            complement(20099..21478)
FT                   /locus_tag="Rleg_0022"
FT   CDS_pept        complement(20099..21478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0022"
FT                   /product="Formamidase"
FT                   /EC_number="3.5.1.49"
FT                   /note="PFAM: Acetamidase/Formamidase; KEGG: swi:Swit_0965
FT                   formamidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54334"
FT                   /db_xref="GOA:C6AYB0"
FT                   /db_xref="InterPro:IPR004304"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYB0"
FT                   /inference="protein motif:PRIAM:3.5.1.49"
FT                   /protein_id="ACS54334.1"
FT                   /translation="MNSRIDYRKTSAAVSRNFNGFQEPLQKISKWAAVPRIPAHCVRSK
FT                   FACAAPAVAMFLVGSGAFADTSDVKGPRPVIVAKSGEHCKDDPNCFNRVHYAVKPVARV
FT                   KPGQKFILETRDGLDSDLDFSSTAEDVAAVDLNRCHPLTGPVYIEGAKKGDSIAVTVVD
FT                   IEPDEFGTTTVVPGFGFLRDLFTDPYIVHWDLNRLEARSKDMPGISVPNNSFMGTIGVL
FT                   PDKEELQKWLKREQELADAGGAVLTPQPVEALPADLCGVDGTAKSECLRTVPPRENGGN
FT                   VDARETIVGTTILLPCFIDGCGLFAGDVHFAMGGGEVAGTAIETGGRVTLEAQVRPGGA
FT                   KLQTTMHFEGGSQLKQLAPSSFYAISGLPVKSEGELPVFETYLGGEKIAPLANLSEDLT
FT                   LAARNATLNMIDFLVKTKGLTREQAYVLTSVAVDLNIAQVVDYPNVGVTAILNRDVFKE
FT                   Q"
FT   sig_peptide     complement(21284..21478)
FT                   /locus_tag="Rleg_0022"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.840) with cleavage site probability 0.839 at
FT                   residue 65"
FT   gene            complement(22088..22723)
FT                   /locus_tag="Rleg_0023"
FT   CDS_pept        complement(22088..22723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0023"
FT                   /product="NAD(P)H dehydrogenase (quinone)"
FT                   /note="PFAM: NAD(P)H dehydrogenase (quinone); KEGG:
FT                   sbl:Sbal_4073 (acyl-carrier-protein) phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54335"
FT                   /db_xref="GOA:C6AYB1"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023048"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYB1"
FT                   /inference="protein motif:PFAM:PF02525"
FT                   /protein_id="ACS54335.1"
FT                   /translation="MRVLHVSCSPRGEASESYRLSQQIISQLRQSDPDTTVIDRVIGQG
FT                   VIPPIDEDYAVSQGSSKDVSQLGSMAKSEELILELETADVVVISTPMHNLTLPATLKLW
FT                   IDHIVRTRRTFNISKFGKVGTLQDRPVFVAISSGGRFSGEHPQQPDFLTPYLTAILGMI
FT                   GLHNVAIFSVQGTGSHVNELASIRRNTDQLVREHFASFHPDLIAVPTY"
FT   gene            22950..24371
FT                   /locus_tag="Rleg_0024"
FT   CDS_pept        22950..24371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0024"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain"
FT                   /note="PFAM: regulatory protein GntR HTH; aminotransferase
FT                   class I and II; SMART: regulatory protein GntR HTH; KEGG:
FT                   eca:ECA2654 GntR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54336"
FT                   /db_xref="GOA:C6AYB2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYB2"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ACS54336.1"
FT                   /translation="MTVAKSNDFPPLDPNAGVPFYRQIYDRFRAAIASGLLKPGDRIPS
FT                   ARALTKELGLARGTIESAYSLLAAEGYIESHGQAGTVVTPGLSTLTPVPVPALQQISNA
FT                   AEVSFRPDSILPFQMGLPALDAFPRKIWARLGAGCVRAMQPSDMVHPPIYGLPALRTEI
FT                   ATYLQVSRGIGCSPSQVFITSGYRHTIELIADTLLKAGDHVWLEDPGYPPTREIFRHMQ
FT                   ITTVPVRVDQDGMVISDGLKAAHGAVAAVVTPAHQSPLGMSLILPRRLALLDWAAKSKS
FT                   WIIEDDYDGEYRYVSRPLPALKSLDRNGRVLYSGTFSKVLFPGLRLAYLVVPEDLVERF
FT                   EHISQTLAGGSPELTQAIVTAFIKEGHFARHIQRMRKLYAQRRKATAIGLETVLGKHMS
FT                   IASQPGGMHLILQLKNQHSDRLLSARMRESGLYAEALADWTMLSEAPAALLVNFTNIGS
FT                   QSVAEHLAKRILQLM"
FT   gene            24569..25030
FT                   /locus_tag="Rleg_0025"
FT   CDS_pept        24569..25030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0025"
FT                   /product="alkylhydroperoxidase like protein, AhpD family"
FT                   /note="TIGRFAM: alkylhydroperoxidase like protein, AhpD
FT                   family; PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   bph:Bphy_6989 alkylhydroperoxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54337"
FT                   /db_xref="GOA:C6AYB3"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYB3"
FT                   /inference="protein motif:TFAM:TIGR00778"
FT                   /protein_id="ACS54337.1"
FT                   /translation="MDFFMADRIDCASASPDGFNAFAGVRAAVEKSDLPKQLFDLVYLR
FT                   VSQMNRSALYVDVHSRSLLELGLTVEKLGQVPIWRNAGHLFNARERSALAWAETVTRVA
FT                   ETGVPDSDYEAAAVEFNNKELADLTYAIALMNALNRIGMAFRSTLSGKA"
FT   gene            25147..25437
FT                   /locus_tag="Rleg_0026"
FT   CDS_pept        25147..25437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0026"
FT                   /product="chorismate mutase"
FT                   /note="TIGRFAM: chorismate mutase; PFAM: Chorismate mutase;
FT                   KEGG: oan:Oant_1078 chorismate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54338"
FT                   /db_xref="GOA:C6AYB4"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR010951"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYB4"
FT                   /inference="protein motif:TFAM:TIGR01795"
FT                   /protein_id="ACS54338.1"
FT                   /translation="MTSTFPHELLALRASIDNIDAALMHMLAERFRCTKAIGALKARQG
FT                   LPASDPEREQSQIQRLRSLASTSGLDPDFAEKFLTFTIDEVIRHHRAAAAR"
FT   gene            complement(25468..25773)
FT                   /pseudo
FT                   /locus_tag="Rleg_0027"
FT   gene            complement(25777..26910)
FT                   /locus_tag="Rleg_0028"
FT   CDS_pept        complement(25777..26910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0028"
FT                   /product="CBS domain containing protein"
FT                   /note="PFAM: CBS domain containing protein;
FT                   transporter-associated region; KEGG: rec:RHECIAT_CH0000413
FT                   putative hemolysin protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54339"
FT                   /db_xref="GOA:C6AYB5"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYB5"
FT                   /inference="protein motif:PFAM:PF00571"
FT                   /protein_id="ACS54339.1"
FT                   /translation="MSDFTTKPAADAKDSEPSSSSDEAGSSSRPSGRSQSFWSRAARIL
FT                   RPQQGSRLREDLADALMTDAAGDDAFSPDERAMLNNILRFREVRVADVMVPRADIEAVD
FT                   QNITIGELMILFEESGRSRMPVYADTLDDPRGMVHIRDLLSYVAKQARNKRRGPAKPAA
FT                   AVPAIEVAPENIHKATRSAKPNFDLARVDLQKTLAEAGIVRKILFVPPSMLASDLLRRM
FT                   QVNRTQMALVIDEYGGTDGLASHEDIVEMVVGDIDDEHDDEEVMFKRVAEDMFIADARV
FT                   ELEEIAQAIGPDFDISEQVDEVDTLGGLIFSALGRIPVRGEVVQALPGFEFHILDADPR
FT                   RIKRLRITRKRHAIRRRAKADGDAAPGDDRPAESTAN"
FT   gene            complement(26907..27422)
FT                   /locus_tag="Rleg_0029"
FT   CDS_pept        complement(26907..27422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0029"
FT                   /product="protein of unknown function UPF0054"
FT                   /note="PFAM: protein of unknown function UPF0054; KEGG:
FT                   rec:RHECIAT_CH0000414 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54340"
FT                   /db_xref="GOA:C6AYB6"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYB6"
FT                   /inference="protein motif:PFAM:PF02130"
FT                   /protein_id="ACS54340.1"
FT                   /translation="MAELDIQISVEDIGWPGEETLLSFCERVLGAAVVYLSDSEKQPFP
FT                   TLPPEVSLVFTDDASIQDINAEWRGKDKATNVLSFPAFPVQPGKMPGPMLGDIIIARET
FT                   LEREAAELEKSFDDHLTHLLVHGFLHLLGYDHMNSAEAEIMEGLETRILAQLGLSDPYE
FT                   GQDLKMEP"
FT   gene            complement(27422..28471)
FT                   /locus_tag="Rleg_0030"
FT   CDS_pept        complement(27422..28471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0030"
FT                   /product="PhoH family protein"
FT                   /note="PFAM: PhoH family protein; KEGG:
FT                   rec:RHECIAT_CH0000415 phosphate starvation inducible
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54341"
FT                   /db_xref="GOA:C6AYB7"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYB7"
FT                   /inference="protein motif:PFAM:PF02562"
FT                   /protein_id="ACS54341.1"
FT                   /translation="MNGQELVSSSPRHPRTPSDTNHFVLTFENNRFASELFGQFDQNLK
FT                   LLEQRLNIDARARGNSVVITGDVVTTNQARRTLDYLYEKLQKGGSVEQSDVEGAIRMAV
FT                   AADDQLSLPTMERKAKLTMAQVSTRKKTIIARTPTQDAYIRALERAELVFGVGPAGTGK
FT                   TYLAVAHAAQLLERGAVEKIILSRPAVEAGERLGFLPGDMKEKVDPYLRPLYDALYDMI
FT                   PADKVDRAITAGVIEIAPLAFMRGRTLANAAIILDEAQNTTSMQMKMFLTRLGENARMI
FT                   VTGDPSQIDLPRGVKSGLVEALQLLNGVEGISIVRFTDTDVVRHPLVGRIVRAYDSTYA
FT                   VAEDVSRQG"
FT   gene            complement(28490..29911)
FT                   /locus_tag="Rleg_0031"
FT   CDS_pept        complement(28490..29911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0031"
FT                   /product="RNA modification enzyme, MiaB family"
FT                   /note="KEGG: rec:RHECIAT_CH0000416 putative
FT                   2-methylthioadenine synthetase (MiaB-like) protein;
FT                   TIGRFAM: RNA modification enzyme, MiaB family; tRNA-i(6)A37
FT                   thiotransferase enzyme MiaB; PFAM: Protein of unknown
FT                   function UPF0004; Radical SAM domain protein;
FT                   deoxyribonuclease/rho motif-related TRAM; SMART: Elongator
FT                   protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54342"
FT                   /db_xref="GOA:C6AYB8"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYB8"
FT                   /inference="protein motif:TFAM:TIGR00089"
FT                   /protein_id="ACS54342.1"
FT                   /translation="MTQDSALLQAPEAIPSDSLHDGSNSRKVFIKTYGCQMNVYDSMRM
FT                   SDALARDGYEPTDDMEEADLVLLNTCHIREKAAEKVYSALGRLRDMKKKKAADGREMMI
FT                   GVAGCVAQAEGEEILRRAPAVDVVIGPQTYHRLPEALRLAKQGQRVVDTEYAIEDKFEH
FT                   LPIAESRRIRARGVTAFLTVQEGCDKFCTFCVVPYTRGSEVSRPVSQIVEEAEKLADSG
FT                   VREITLLGQNVNAWHGAGPQGEAWSLGDLLYRLAEIPGLARLRYTTSHPRDMDDRLINA
FT                   HRDLSALMPYLHLPVQSGSDRILKAMNRRHTAAEYLTLIERIRTVRPDIALSGDFITGF
FT                   PGETDEDFKDTLRLVEEVRYAQAFSFKYSTRPGTPGAELKDQVPEEIKAERLERLQMLL
FT                   LKQQQEFAESCIGKEIDLLLEKPGRMPEQLIGRSPWLQSVNVDAKASQIGDIIKVRITG
FT                   TGTNSLFAERAEAAV"
FT   gene            complement(30232..31029)
FT                   /locus_tag="Rleg_0032"
FT   CDS_pept        complement(30232..31029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0032"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; SMART:
FT                   phospholipid/glycerol acyltransferase; KEGG:
FT                   rec:RHECIAT_CH0000417 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferase (phospholipid/glycerol acyltransferase)
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54343"
FT                   /db_xref="GOA:C6AYB9"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYB9"
FT                   /inference="protein motif:PFAM:PF01553"
FT                   /protein_id="ACS54343.1"
FT                   /translation="MIAWLRIAFAAVVILAVSIVLMPLQVLALRFDWRLRRRLPGTWHR
FT                   IVCYCLGIRVRVTGKLEDRRPLMLCSNHSSWLDIMVMSAVADVVFIAKIEVRDWPIFGT
FT                   LAKLQKSVFVVREERRKTGHQATEIAGRMADGEIVVLFPEGTTSDGNRLLEVKSSLFGA
FT                   AAMAVPTSPTGTVVVQPVAVAYTRVHGIAMGRYHRRLAAWPGDLDLLPHLIDIVRCGAI
FT                   DAEVSFGEAVDYRAETSRKEVSATIALRIRNLLNSRLRGREIS"
FT   sig_peptide     complement(30943..31029)
FT                   /locus_tag="Rleg_0032"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.989 at
FT                   residue 29"
FT   gene            complement(31057..31485)
FT                   /locus_tag="Rleg_0033"
FT   CDS_pept        complement(31057..31485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0033"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG:
FT                   rec:RHECIAT_CH0000418 ferric uptake regulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54344"
FT                   /db_xref="GOA:C6AYC0"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYC0"
FT                   /inference="protein motif:PFAM:PF01475"
FT                   /protein_id="ACS54344.1"
FT                   /translation="MTDVAKTLEELCTERGMRMTEQRRVIARILEDSEDHPDVEELYRR
FT                   SVKVDAKISISTVYRTVKLFEDAGIIARHDFRDGRSRYETVPEEHHDHLIDLKTGTVIE
FT                   FRSPEIEALQERIAREHGFRLVDHRLELYGVPLKKEDL"
FT   gene            complement(31568..32062)
FT                   /locus_tag="Rleg_0034"
FT   CDS_pept        complement(31568..32062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0034"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   rec:RHECIAT_CH0000419 ribosomal-protein-alanine
FT                   N-acetyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54345"
FT                   /db_xref="GOA:C6AYC1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYC1"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACS54345.1"
FT                   /translation="MLEAYLTLKPEFEIIAMEREDCRDVAILHGERFARPWGDGEFHGL
FT                   LMQDTVFGFVARQTNAILKKPLPGFILARHVAGEAEILTIAVQAKVARAGLGWRLMQAA
FT                   MREARSRGGESMFLEVDNGNTAALGLYRKLGFEKVGERQGYYKQENGALSTALVMKRVL
FT                   R"
FT   gene            complement(32065..32727)
FT                   /locus_tag="Rleg_0035"
FT   CDS_pept        complement(32065..32727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0035"
FT                   /product="peptidase M22 glycoprotease"
FT                   /note="PFAM: peptidase M22 glycoprotease; KEGG:
FT                   ret:RHE_CH00380 O-sialoglycoprotein endopeptidase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54346"
FT                   /db_xref="GOA:C6AYC2"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYC2"
FT                   /inference="protein motif:PFAM:PF00814"
FT                   /protein_id="ACS54346.1"
FT                   /translation="MIILALDTAGVDCAAAVFDSGRNTVLGEASDMIGKGHAEHLIGIV
FT                   DRALDQAGLALSDVDRLAVTIGPGSFTGIRVGVAAARGFALSLNVPAVGITTLEVMASA
FT                   QRDKTPHRAVLAAMDAKRDEIYLQSFAADGSPLDAPRAVSVAQAQAFAAGFDGEITGSA
FT                   TPLLKADAGGDHTNRFPISIVARLGAAASPDSGKPKPLYLRGPDAKPQAGYAIARRV"
FT   gene            complement(32816..33382)
FT                   /locus_tag="Rleg_0036"
FT   CDS_pept        complement(32816..33382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0036"
FT                   /product="Scaffold protein Nfu/NifU"
FT                   /note="PFAM: Scaffold protein Nfu/NifU; nitrogen-fixing
FT                   NifU domain protein; KEGG: rec:RHECIAT_CH0000421 nitrogen
FT                   fixation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54347"
FT                   /db_xref="GOA:C6AYC3"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR014824"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035433"
FT                   /db_xref="InterPro:IPR036498"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYC3"
FT                   /inference="protein motif:PFAM:PF08712"
FT                   /protein_id="ACS54347.1"
FT                   /translation="MFIQTEATPNPATQKFLPGKVVMENGTAEFRSTEEAQASPLAARL
FT                   FEISGVTGVYFGYDFISVSKDNADWQHLKPAILGSIMEHFMSGKPVMGDASILSEDADA
FT                   GDEFFDEGDESIVLTIKELLETRVRPAVAQDGGDITFRGFKDGKVYLNMKGSCAGCPSS
FT                   TATLKHGVQNLLRHFVPEVQEVIAA"
FT   gene            complement(33593..34084)
FT                   /locus_tag="Rleg_0037"
FT   CDS_pept        complement(33593..34084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0037"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: ret:RHE_CH00382
FT                   putative universal stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54348"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYC4"
FT                   /inference="protein motif:PFAM:PF00582"
FT                   /protein_id="ACS54348.1"
FT                   /translation="MVSKRLSRLEGHRRKFMAVIDGTPECQRAVHYAGRRAKNSNGGLV
FT                   LLYVIPDGDFQQWLGVEEIMRAEAREEAEAVVAKIAQIVRETIGIEPEVVIREGGAAEQ
FT                   INAVIEEDRDVAILVLAAGSAKEGPGPLVSSVAGRAAAFPIPVTVLPDTLTNEEIDALC
FT                   "
FT   gene            complement(34214..35278)
FT                   /locus_tag="Rleg_0038"
FT   CDS_pept        complement(34214..35278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0038"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="KEGG: rec:RHECIAT_CH0000423 tryptophanyl-tRNA
FT                   synthetase protein; TIGRFAM: tryptophanyl-tRNA synthetase;
FT                   PFAM: aminoacyl-tRNA synthetase class Ib"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54349"
FT                   /db_xref="GOA:C6AYC5"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYC5"
FT                   /inference="protein motif:TFAM:TIGR00233"
FT                   /protein_id="ACS54349.1"
FT                   /translation="MSEFKKLVFSGVQPTGNLHLGNYLGAIRRFVALQEGNDCIYCVVD
FT                   MHALTAQLVHEDMPSQTRSIAAAFIAAGIDPEKHIVFNQSAVPQHAELAWIFNCVARIG
FT                   WMNRMTQFKDKAGKDREQASLGLYAYPSLMAADILVYRATHVPVGEDQKQHLELARDIA
FT                   MKFNLDYAEHISRTGYGVDITVGNEPVHAYFPMVEPLIGGPAPRVMSLRDGTKKMSKSD
FT                   PSDLSRINLMDDEDAISKKIRKAKTDPDGLPSEIDGLQGRPEADNLVAIYAALADKSKA
FT                   DVLAEFGGQQFSVFKPALVDLAINVLAPITGEMRRLMDDTSHIDAILRKGGERARARAE
FT                   VTMRQVRDVIGFLY"
FT   gene            complement(35409..35807)
FT                   /locus_tag="Rleg_0039"
FT   CDS_pept        complement(35409..35807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0039"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: ret:RHE_CH00384 putative
FT                   glyoxalase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54350"
FT                   /db_xref="GOA:C6AYC6"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYC6"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACS54350.1"
FT                   /translation="MTIQSLFLVTLVVDDYDRAKAFYCDGLGFDCLQDELQPKGKRWVV
FT                   VKPRGGDGAAFLLAQAADETQRAAIGNQTGGRVGFFLKTDDFARDHAAMRAVGVRFLEE
FT                   PRHEVYGTVAVFADPYGNTFDLIQHTAA"
FT   gene            35996..36424
FT                   /locus_tag="Rleg_0040"
FT   CDS_pept        35996..36424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0040"
FT                   /product="Peptidase M15A"
FT                   /note="PFAM: Peptidase M15A; protein of unknown function
FT                   DUF882; KEGG: rec:RHECIAT_CH0000425 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54351"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR010275"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYC7"
FT                   /inference="protein motif:PFAM:PF08291"
FT                   /protein_id="ACS54351.1"
FT                   /translation="MQNAILLAIAGLFAFQSATGAVGQDMKRHAVHLAKHQARLAYTVQ
FT                   TVSVRAGCFPGRLRAVLSHIAAKTGRRPVITSGHRPHPRRHGSLHGKCLAADFRMPGLS
FT                   ERTIIAAARSAPGIGGIGSYCNGIIHVDVGPQRRWVDC"
FT   sig_peptide     35996..36058
FT                   /locus_tag="Rleg_0040"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.560 at
FT                   residue 21"
FT   gene            complement(36507..37127)
FT                   /locus_tag="Rleg_0041"
FT   CDS_pept        complement(36507..37127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0041"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: mes:Meso_3334
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54352"
FT                   /db_xref="GOA:C6AYC8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYC8"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACS54352.1"
FT                   /translation="MVTKCQSVQMTQNDRKIAQILDAALPVFVRFGFRKTSMADIARAA
FT                   GISRASLYLSFNSKEELFRAGSMRAHTLALDEVGAALAGQGNALDRMEMAIAVFQRELI
FT                   APFGGSSDAEELFAANMALAADITLDARTRLSTMLTQTLNAAAETKEIDLGPLQASPLQ
FT                   LANIMMAAMDGIKHAQWNGSSLDDDTKLFMRLLRVAVTPRSGQ"
FT   gene            37209..38207
FT                   /locus_tag="Rleg_0042"
FT   CDS_pept        37209..38207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0042"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; Male sterility
FT                   domain; short-chain dehydrogenase/reductase SDR; KEGG:
FT                   hne:HNE_3360 NAD-dependent epimerase/dehydratase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54353"
FT                   /db_xref="GOA:C6AYC9"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYC9"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACS54353.1"
FT                   /translation="MSITSDNSNGATVLVTGIGGFLAGHIALQLLKQGYRVRGSLRSIG
FT                   TSAATVGQLGAHTDGQLQNLGLVQADLDSDSGWAAAVEGCDYVIHTASPFPPGYPENEN
FT                   ALIQTARDGALRVLREAHRARVKRVVLTSSIAATNHGDGRAPFTEENWTDPESPRATPY
FT                   YKSKTLDLAVINPSVILGPLLGPNFGTSVGLIHHLMTGRFNGIPRFGFSVVDVRDTADA
FT                   HIRAMTDPAAGGQRFIIGGRFFWLKDLVAILAHSFPDHASRLPSGEVSDEIVRVMAQSD
FT                   PDARTIVHELNRDLSVSAAKAHRVLGWRSRPEEQCIRASAQSLIDLGLVPA"
FT   gene            38256..38660
FT                   /locus_tag="Rleg_0043"
FT   CDS_pept        38256..38660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0043"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reh:H16_A1246 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54354"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYD0"
FT                   /inference="similar to AA sequence:KEGG:H16_A1246"
FT                   /protein_id="ACS54354.1"
FT                   /translation="MTIPTVDAFSPANEANLLRETEHARLRALINADIVRAQQLHAPDF
FT                   QLITPIGATLSKEEYLGAIASGQINYLIWEPADIAVRLYDGVAVLRYRAQLEVVFGGHK
FT                   VALNDYWHTDTYERHDGRWMVVWSQATAIN"
FT   gene            complement(38688..40268)
FT                   /locus_tag="Rleg_0044"
FT   CDS_pept        complement(38688..40268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0044"
FT                   /product="integral membrane protein MviN"
FT                   /note="TIGRFAM: integral membrane protein MviN; PFAM:
FT                   virulence factor MVIN family protein; polysaccharide
FT                   biosynthesis protein; multi antimicrobial extrusion protein
FT                   MatE; KEGG: rec:RHECIAT_CH0000426 virulence factor
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54355"
FT                   /db_xref="GOA:C6AYD1"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYD1"
FT                   /inference="protein motif:TFAM:TIGR01695"
FT                   /protein_id="ACS54355.1"
FT                   /translation="MSLVKKFATVGGATLGSRIFGFARETLMAAALGTGPMADVFYAAF
FT                   RFPNLFRRLFAEGAFNAAFVPLFAKEIEANGTDGAKRFSEEVFGVLFSVLLLITIVMEL
FT                   AMPLLVRFVIAPGFADDPEKFSITIRMAAVMFPYLMCMSLTAMMSGMLNSLHHFFAAAI
FT                   APVFLNVVMIGALFYALYTGADPLATAWYLSWGVLAAGVLQLAVVYVGVLAAGMSIGFR
FT                   FPKMTPNVKRLLILAVPAAVTGGITQINQLIGQAIASSRDGAIAALQYADRIYQLPLGV
FT                   VGVAVGVVLLPELARALKGGNLREAGNLQNRSIEFVLFLTIPAAFALWILSDEIIRVLY
FT                   ERGAFHQENTAVVGSILAIYGIGLPAFVLIKALQPGFYAREDTKTPMRFSAIAVATNCA
FT                   TALTLFPYMGAPGIAVAEATAGWISTVLLFATLLRRGHLTWEWALAKRTALLIVAAAVM
FT                   GAAIVFLKQYWAPSLASGAPLLTKIGTLGLLIAIAMLIYFAAAFLVGGANLGMIRRNLN
FT                   RKPAPAKDG"
FT   sig_peptide     complement(40179..40268)
FT                   /locus_tag="Rleg_0044"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.766) with cleavage site probability 0.384 at
FT                   residue 30"
FT   gene            complement(40307..43213)
FT                   /locus_tag="Rleg_0045"
FT   CDS_pept        complement(40307..43213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0045"
FT                   /product="UTP-GlnB uridylyltransferase, GlnD"
FT                   /EC_number="2.7.7.59"
FT                   /note="KEGG: rec:RHECIAT_CH0000427 [protein-PII]
FT                   uridylyltransferase protein; TIGRFAM: protein-P-II
FT                   uridylyltransferase; PFAM: GlnD PII-uridylyltransferase;
FT                   metal-dependent phosphohydrolase HD sub domain; amino
FT                   acid-binding ACT domain protein; DNA polymerase beta domain
FT                   protein region; SMART: metal-dependent phosphohydrolase HD
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54356"
FT                   /db_xref="GOA:C6AYD2"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYD2"
FT                   /inference="protein motif:TFAM:TIGR01693"
FT                   /protein_id="ACS54356.1"
FT                   /translation="MQTKQAAGREPAVRHEQETAPAIAMRDLDFSNILDVELLQKQCDA
FT                   VAEANRNRPDVLRADLLAVLKKASTEGRQKAREALMADGGGLNCAYRISWLQDQITTVL
FT                   YNFATAHIFPQQKDKFAVTAVGGYGRDTLAPGSDIDLLFLFLPRPAEETHKAVEFMLYV
FT                   LWDMGFKVGHATRTVEECIALSKSDMTIRTAILEMRYICGLQRLETELESRFDKEIVTG
FT                   TGPEFIAAKLAERDERHRKAGDTRYLVEPNVKEGKGGLRDLHTLFWISKYYYHVRDQAE
FT                   LIKLGVLSKHEYRLLEKADDFLWAVRCHMHFLTGKAEERLSFDIQREIAEAFGYHTRPG
FT                   LSAVERFMKHYFLVAKDVGDLTRILCAALEDQQAKSIPGLTGVISRFTHRNRKIAGSVE
FT                   FVEDRGRIALADPEVFKRDPVNIIRLFHVADINGLEFHPDALKRVTRSLALIDTSLREN
FT                   DEANRLFMSILTSKRDPALILRRMNEAGVLGRFIPEFGKIVAMMQFNMYHHYTVDEHLI
FT                   RTVDILSEIDKGRAEDLHPLANKLMPGIEDREALYVAVLLHDIAKGRQEDHSIAGARVA
FT                   RKLCARFGLSQKQTEIVVWLIEEHLTMSMVAQTRDLTDRKTITDFADRVQSLDRLKMLL
FT                   ILTICDIRAVGPGVWNGWKGQLLRTLYYETELLLAGGFSEVSRKERANAAAEALHSALA
FT                   DWSQKDRNTYTKLHYQPYLLSVPLEDQIRHAHFIRQSDKAGQALATTVRTDSFHAITEI
FT                   TVLSPDHPRLLAVIAGACAAAGANIVDAQIFTTSDGRALDTIHVSREFTDDADELRRAA
FT                   TIGRMIEDVLSGRKRLPEVIATRARNRKKSKAFVIPPSVNITNSLSNKFTVIEVECLDR
FT                   PGLLSEITAVLSDLSLDIQSARITTFGEKVIDTFYVTDLVGQKISGDSKRANITARMKA
FT                   VMAEEEDELRERMPSGIIAPAATARTPPAAEKKAGSPI"
FT   gene            complement(43368..43643)
FT                   /locus_tag="Rleg_0046"
FT   CDS_pept        complement(43368..43643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0046"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000428 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54357"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYD3"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000428"
FT                   /protein_id="ACS54357.1"
FT                   /translation="MFMEKLVRETERLSLICSMLDTMRRADKDRNARGWTSPIGMLKIT
FT                   RCCAVISELGTSIAKAGYRECDRQALEEIMRETRQVLHLLNARAAG"
FT   gene            complement(43656..46382)
FT                   /locus_tag="Rleg_0047"
FT   CDS_pept        complement(43656..46382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0047"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /note="KEGG: ret:RHE_CH00388 DNA mismatch repair protein;
FT                   TIGRFAM: DNA mismatch repair protein MutS; PFAM: DNA
FT                   mismatch repair protein MutS domain protein; MutS II domain
FT                   protein; MutS IV domain protein; MutS III domain protein;
FT                   SMART: DNA mismatch repair protein MutS domain protein;
FT                   MutS III domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54358"
FT                   /db_xref="GOA:C6AYD4"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYD4"
FT                   /inference="protein motif:TFAM:TIGR01070"
FT                   /protein_id="ACS54358.1"
FT                   /translation="MNARIDTGNEAFSAAELATAESRASATPMMEQFIEIKANNPGSLL
FT                   FYRMGDFYELFFEDALEASRALGITLTKRGQHMGQDIPMCGVPVHAADDYLQKLISLGF
FT                   RVAVCEQIEDPAEAKKRGAKSVVKRDVVRLVTPGTITEEKLLSPSESNYLMALTRIRAS
FT                   GEALLALAWIDISTGVFRLAETEASRLLADILRIDPRELILPDTIFHDPELKPVFDVLG
FT                   RTAVPQPSVLFDSASAEGRIARYFGVATLDGFGTFSRAELAAAAAAVAYVEKTQIAERP
FT                   PLGKPERESAASTLFIDPATRANLELARTLSGDRNGSLLKAIDRTVTGGGARLLAERLM
FT                   SPLTDPARINARLDSIGFLIDEPLLCGNLRDTLKHVPDMPRALSRLALDRGGPRDLWAI
FT                   RQGLEAAGGIAAMLGKAMLPEELGQALSGLQALPAAVEKLLAETLADELPLLKRDGGFL
FT                   RDGASAELDEVRALRDQSRRVIAGLQLQYAEETGIRSLKIKHNNVLGYFIEVTAGNASP
FT                   MTETAEAKARFIHRQTMANAMRFTTTELADLESRIANAADQALTIELEAFDRMTAAVVA
FT                   EAEAIKSGARALAVIDVAAGLALLAEEQAYCRPQVDGSKMFAIEGGRHPVVEQALRRQA
FT                   GGPFVANHCDLSPRTGDRDGAIWLLTGPNMGGKSTFLRQNALISILAQMGSFVPATSAH
FT                   IGIVDRLFSRVGASDDLARGRSTFMVEMVETAAILNQASDRSLVILDEIGRGTATFDGL
FT                   SIAWAAVEHLHEANRCRGLFATHFHELTVLSEKLGRLSNATMRVKEWDGDVIFLHEVGP
FT                   GAADRSYGIQVARLAGLPASVVARARDVLTRLEDADRKNPASQLIDDLPLFQVAVRREE
FT                   TARGTSKVEEALKAMSLDDMTPREAMDALYDLKKKLK"
FT   gene            46496..48781
FT                   /locus_tag="Rleg_0048"
FT   CDS_pept        46496..48781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0048"
FT                   /product="Malate dehydrogenase
FT                   (oxaloacetate-decarboxylating) (NADP(+))., Phosphate
FT                   acetyltransferase"
FT                   /EC_number="1.1.1.40"
FT                   /EC_number="2.3.1.8"
FT                   /note="PFAM: phosphate acetyl/butaryl transferase; malic
FT                   protein NAD-binding; malic protein domain protein; KEGG:
FT                   rec:RHECIAT_CH0000430 malate dehydrogenase
FT                   (oxaloacetate-decarboxylating) (NADP(+)) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54359"
FT                   /db_xref="GOA:C6AYD5"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012188"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYD5"
FT                   /inference="protein motif:PRIAM:1.1.1.40"
FT                   /inference="protein motif:PRIAM:2.3.1.8"
FT                   /protein_id="ACS54359.1"
FT                   /translation="MPDIDKKDRPVTSVTDQEALDFHAMGRPGKLEINPTKPMATQRDL
FT                   SLAYSPGVAVPVKAIAADPQTAYDYTARGNMVAVISNGTAILGLGNLGALASKPVMEGK
FT                   AVLFKRFADVDSIDLEIDTENVDEFINCVRFLGPSFGGINLEDIKAPDCFVIESRLREL
FT                   MDIPVFHDDQHGTAIIAAAGLINALELTGRDLKTTKLVCNGAGAAAIACVELIKAMGFA
FT                   PENVILCDTKGVIYQGRTEGMNQWKSAHAAKTDTRTLEEAMKGADVVFGLSQQGAFSAK
FT                   MIRSMAERPIIFAMANPDPEITPEEVARIRDDAIMATGRSDYPNQVNNVLGFPYIFRGA
FT                   LDVRASTINDAMKIAAVNALANLAREDVPDDVVAAYQGNRPRFGSQYIIPVPFDPRLIS
FT                   AIPVAVAQAAIESGVARKVITDMAGYARELSARRDPIASTLASLYERVRRRPKRIVFAE
FT                   AEEEQVLRAAMSYANQQLGTAILLGREDLIRATAERAGIDLNRPGLEIVNARLSTRVEA
FT                   YIDYLYARLQRHGYLHRDAQRLIHNDRNHFAATMVALGDADGMVTGITRNYSTALEDVR
FT                   RCIDEKPGHRVIGVSLALCRGRTVFVADTAVHDMPTAEELADIAEEAAGLARRMGYPPR
FT                   VALLAYSTFGHPSGERSERVREAVKILDKRRVDFEYDGEMAADVALNRKVMEQYPFCRL
FT                   SGPANVLVMPAFHSASISTKMLQELGGSTVIGPILVGLDKPVQITSMGAKDSDIVNMAA
FT                   IAAYGAGS"
FT   gene            49014..50003
FT                   /locus_tag="Rleg_0049"
FT   CDS_pept        49014..50003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0049"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; SMART: helix-turn-helix- domain containing
FT                   protein AraC type; KEGG: rec:RHECIAT_CH0000431 putative
FT                   transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54360"
FT                   /db_xref="GOA:C6AYD6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYD6"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ACS54360.1"
FT                   /translation="MPENASANFTPRFQGATFDDMVGALTKGFGSFDAWRDGRDKPLDW
FT                   KVGFWGDESLSLVSNQDSGGWGARTAHGTPETLAIIVPRTGALDVTLGRSVIEGTPGRL
FT                   LLANNLEPERISVRAAPHRSDTLSLSWTIIAQTVASVLETPLIGAMDLAPVIDLSTAAG
FT                   RLIGSLAQTIIIGMRNNGPLLASPIAMLNLTQAFADLLVRSVPHRLSHLLDRKIHLIAP
FT                   RHVRRAIEFMHANIAEPLTMQSVAEAAGISIRALESGFRAFKGTTPAAYLRTIRLQAVR
FT                   EDLRDPSNRQPLRDICLKWGFFHFGRFAATYRAAYGENPSDTRRRSDH"
FT   gene            complement(50340..51215)
FT                   /locus_tag="Rleg_0050"
FT   CDS_pept        complement(50340..51215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0050"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000432 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54361"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYD7"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000432"
FT                   /protein_id="ACS54361.1"
FT                   /translation="MSAIDILNRDTTAEAAPPSTAVQKDGDILGRIGNLETRLARTARE
FT                   IDAAQAVRYRVFVDEMKAQLPLDAMRRQRDVDAYDAVCDHLLVLDRSIEGDPEDQIVGT
FT                   YRLLRQDVAIANGGFYSASEFEIEGLIAKHPDKRFMELGRSCVLPEYRTKRTVELLWQG
FT                   NWAYALKHGVSAMFGCASFPGVYLESHALALSFLYHNVLAKNEWAIGALPHLARNMDLM
FT                   PVEAINPKRALMALPPLIKGYLRLGAMVGSSAVIDHAFNTTDVLIVLPISSISDRYLNY
FT                   YGADAGRFAS"
FT   gene            complement(51324..53606)
FT                   /locus_tag="Rleg_0051"
FT   CDS_pept        complement(51324..53606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0051"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   response regulator receiver; histidine kinase A domain
FT                   protein; SMART: ATP-binding region ATPase domain protein;
FT                   response regulator receiver; histidine kinase A domain
FT                   protein; KEGG: rec:RHECIAT_CH0000433 putative two-component
FT                   sensor histidine kinase/response regulator hybrid protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54362"
FT                   /db_xref="GOA:C6AYD8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYD8"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACS54362.1"
FT                   /translation="MQNLGQLQERLSAAFGGPAAKPHEKRMEAVFARPNAPAPRGADDR
FT                   QDGPAPTRRLLFYWLGGAGLLAATILMLLAHAGDPLLLSGGLVVLGLAVIASYALLMVR
FT                   SRKAGQRPGQSMPDENGGAKLFADVHDVLGDITVSRTMDRRIISANDTFRRLTGRLRPE
FT                   GKTCEEIGLAFRPGPIPHCYDVEISTPEGQRIFLWRDVVTRDPANGRLLLQSVARDVTD
FT                   ERLIAQGREEARQKAEYNSAAKSRLLATVSHEVRTPLSGILGMTHLIAETRLTQEQQNY
FT                   LANIRQSGHALTQLVEDLLDFSTIEVGRFALHPRSESLRKLLESVVEMLAHRAHEKGIE
FT                   IGATVSSDVPENMSFDPARLRQVLFNVIGNAVKFTQVGGVFIRVSLDDDDLSITVTDSG
FT                   PGMTTEEQARVFGEFEQGGSVVDKSSGTGLGLAISARIMREFNGALTVASEKGRGSEFT
FT                   ICFPVDIDSERPDRRNTLLSGNSVVLLAPAGAARTAIAETITTLGGLCHLVGDGETARA
FT                   TLLELAKGGRRPTDIIIDHRMSAEFSAHLADRAEIAALGLRKVLLVNPEERSAHPLDLF
FT                   DAWLIRPLREQSLIDVLRGRMRGMEKRDALNDNQPGFGLSVAETLVAASGLSILLGEDD
FT                   PINAMLVRVVLEKGGHKVRHVEDFETLLDYALCEANARPDIIISDLSMPGGNGIDMLGR
FT                   LRGHERRLDLASVPVIVLTADKSDESRRQVLLNGANRVMVKPVDPVRLLTEVQAVAALS
FT                   ARRAEAR"
FT   gene            complement(53662..54165)
FT                   /locus_tag="Rleg_0052"
FT   CDS_pept        complement(53662..54165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0052"
FT                   /product="lipoprotein signal peptidase"
FT                   /note="TIGRFAM: lipoprotein signal peptidase; PFAM:
FT                   peptidase A8 signal peptidase II; KEGG: ret:RHE_CH00392
FT                   lipoprotein signal peptidase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54363"
FT                   /db_xref="GOA:C6AYD9"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYD9"
FT                   /inference="protein motif:TFAM:TIGR00077"
FT                   /protein_id="ACS54363.1"
FT                   /translation="MTEQTHARPALFSRPAPILFFIVVAVLIDQAVKIAVDHYLPLQEA
FT                   VPVVPMLALYRTYNLGVAFSMLSGMDGWFIVGMRLIIVAFVIWLWYRTAKDRWIAHLGY
FT                   ALIIAGAIGNLVDRFAYGHVIDYILFYTESWSFAVFNLADSFITIGAGCVILDELLLPK
FT                   KASR"
FT   gene            complement(54162..55022)
FT                   /locus_tag="Rleg_0053"
FT   CDS_pept        complement(54162..55022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0053"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="PFAM: tRNA/rRNA methyltransferase (SpoU); RNA 2-O
FT                   ribose methyltransferase substrate binding; KEGG:
FT                   ret:RHE_CH00393 rRNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54364"
FT                   /db_xref="GOA:C6AYE0"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYE0"
FT                   /inference="protein motif:PFAM:PF00588"
FT                   /protein_id="ACS54364.1"
FT                   /translation="MSKDFHDQGPRRVGQVKEVTSLANPIIKDIKALTNKKSREESGTF
FT                   LAEGLKLIIDAIELGWAIRTLVYAKAAKGKPLVEQMAAKTVASGGLVLEVSEKVIASIT
FT                   RRDNPQMVVGIFEQRWTPLKGIRLSDGETWVALDRVRDPGNLGTIIRTADAAGASGIIL
FT                   LGETTDPFSLETVRATMGSVFAVPVARATPEEFIAWRKSAGVSVVATHLAGAVDYRTID
FT                   YRKKPVVLLMGNEQSGLPEQLAREADALARIPQQGRADSLNLAVATAVMLFEARRHLLS
FT                   LAEGK"
FT   gene            complement(55019..56116)
FT                   /locus_tag="Rleg_0054"
FT   CDS_pept        complement(55019..56116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0054"
FT                   /product="putative SAM-dependent methyltransferase protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000436 probable SAM-dependent
FT                   methyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54365"
FT                   /db_xref="GOA:C6AYE1"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYE1"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000436"
FT                   /protein_id="ACS54365.1"
FT                   /translation="MKQREGRPGQKKTSGPSGENRRDDRAGRPPKPVAQPAATREAVRE
FT                   AAVPAAVVRPLMTRSGERPTERVPVILESLGAGDFHLIDSGNGEKLEQYGPYRIIRPEA
FT                   QALWRPSLAPQVWEKVDAAFTGDTDEEGAGRWRFPKEALGETWPLNLLGVDFLGRFTSF
FT                   RHVGVFPEQIVHWSWMKEQVEKAGRPLKVLNLFGYTGVASLVAAAAGAEVTHVDASKKA
FT                   IGWARENQALGRMEKLPIRWICEDAMKFILREERRGSQYDIILTDPPKFGRGPNGEVWH
FT                   LFEHLPLMLDVCREILSPKAVGLVLTAYSIRASFYSIHELMRETMRGAGGVVESGELVI
FT                   REAGTDGKTQGRALSTSLFSRWVPK"
FT   gene            complement(56302..56892)
FT                   /locus_tag="Rleg_0055"
FT   CDS_pept        complement(56302..56892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0055"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: rec:RHECIAT_CH0000437
FT                   putative hydrolase protein, MutT/NUDIX family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54366"
FT                   /db_xref="GOA:C6AYE2"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYE2"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ACS54366.1"
FT                   /translation="MNDELKPWSVTASRITYEDRWIRVRSDDCVTADGTVVAPFHVLDY
FT                   PDWINVIPVMPDGRVLLTREYRHGRGEIVLGLVAGSLEPGDSETGDAAMAAARRELREE
FT                   TGYEASTFVKLLTSYPNAASHSNVVTSWLALGLSRAGEPSFDPGEKVELLFTDLAAILG
FT                   DLQSGAVIMQSMHVAALYAAESWLRTQASEGVK"
FT   gene            57016..57471
FT                   /locus_tag="Rleg_0056"
FT   CDS_pept        57016..57471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0056"
FT                   /product="carbon monoxide dehydrogenase subunit G"
FT                   /note="PFAM: carbon monoxide dehydrogenase subunit G; KEGG:
FT                   rec:RHECIAT_CH0000438 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54367"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYE3"
FT                   /inference="protein motif:PFAM:PF06240"
FT                   /protein_id="ACS54367.1"
FT                   /translation="MDFTGEERIAAPRDIVWAALNDPEIMRGCIPGCQSIERLSPDVFE
FT                   ATIKVKFSLLSATFHGLLTLSNVDAPKSYTLSAEGKGGLAGFARGSADIVLEERGAETI
FT                   LHYRSKAELGGRLAQLGARLLDSTSQKLAEGFFSDFNAAVVAKMAAG"
FT   gene            57506..57943
FT                   /locus_tag="Rleg_0057"
FT   CDS_pept        57506..57943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0057"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   rec:RHECIAT_CH0000439 putative acetyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54368"
FT                   /db_xref="GOA:C6AYE4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYE4"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACS54368.1"
FT                   /translation="MMTWTIRPPRAEDQEILAEIYLSVRRETFVWVDPGKFHREDFAAH
FT                   TNGETVFVCAHENGRVAGFLSLWPADDFIHMLYISPEFQGQGAGKALLQALPEWPQHRY
FT                   RLKCLVKNRRAKAFYLSHGFHVTGNGTSPEGDYEELSFFPA"
FT   gene            complement(57996..58328)
FT                   /locus_tag="Rleg_0058"
FT   CDS_pept        complement(57996..58328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0058"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00398 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54369"
FT                   /db_xref="GOA:C6AYE5"
FT                   /db_xref="InterPro:IPR010445"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYE5"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00398"
FT                   /protein_id="ACS54369.1"
FT                   /translation="MAKKIVNLLILLPLGVILIVFCVANRQSVTLAFNPFRPDDQVLAV
FT                   SAPFFVFLVVVLIAGMLIGAAATWFSQGKHRRRARTEAKEAIRWQSEADRHKNRAEEIA
FT                   GQLPAR"
FT   sig_peptide     complement(58242..58328)
FT                   /locus_tag="Rleg_0058"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.913) with cleavage site probability 0.464 at
FT                   residue 29"
FT   gene            complement(58490..58789)
FT                   /locus_tag="Rleg_0059"
FT   CDS_pept        complement(58490..58789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0059"
FT                   /product="integration host factor, beta subunit"
FT                   /note="KEGG: rec:RHECIAT_CH0000441 integration host factor
FT                   beta-subunit protein; TIGRFAM: integration host factor,
FT                   beta subunit; PFAM: histone family protein DNA-binding
FT                   protein; SMART: histone family protein DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54370"
FT                   /db_xref="GOA:C6AYE6"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR005685"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYE6"
FT                   /inference="protein motif:TFAM:TIGR00988"
FT                   /protein_id="ACS54370.1"
FT                   /translation="MIKSELVQIVAARNPHLYHRDVENIVNAVLDEITDALAAGNRVEL
FT                   RGFGAFSVKNRPSRSGRNPRTGDTVFVEEKWVPFFKTGKELRERLNPGQADEED"
FT   gene            complement(58819..59769)
FT                   /locus_tag="Rleg_0060"
FT   CDS_pept        complement(58819..59769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0060"
FT                   /product="signal peptide peptidase SppA, 36K type"
FT                   /note="TIGRFAM: signal peptide peptidase SppA, 36K type;
FT                   PFAM: peptidase S49; KEGG: rec:RHECIAT_CH0000442 proteinase
FT                   IV protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54371"
FT                   /db_xref="GOA:C6AYE7"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004635"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYE7"
FT                   /inference="protein motif:TFAM:TIGR00706"
FT                   /protein_id="ACS54371.1"
FT                   /translation="MDSSIIADRRRLRRKLGFWRVIAVALIVALGFAFYRFALGDAGTE
FT                   RPHIAHVTISGLIVDDDELLERLKKVEISDQVKAVVISISSPGGTTYGGEKIFKAIRAI
FT                   SAKKPVVSDVRTLAASAGYMIATAGDTIIAGDSSITGSIGVIFQYPQIQPLLDKIGVSL
FT                   QEIKSSPLKAEPSPFHEASEEAKAMIRNMVVDSYNWFVDLVADRRKLPRDEVLKLADGT
FT                   IYTGRQALKVKLVDAIGGEAEIRAYLTSRGVDSDLPMVDWDKKSNTPFLLAGAVSRLIT
FT                   IFGYDDLMKTQDINGILPPKLLLDGLLSVWQVGHD"
FT   sig_peptide     complement(59653..59769)
FT                   /locus_tag="Rleg_0060"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.626 at
FT                   residue 39"
FT   gene            59995..60660
FT                   /locus_tag="Rleg_0061"
FT   CDS_pept        59995..60660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0061"
FT                   /product="protein of unknown function DUF1239"
FT                   /note="PFAM: protein of unknown function DUF1239; KEGG:
FT                   rec:RHECIAT_CH0000443 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54372"
FT                   /db_xref="GOA:C6AYE8"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYE8"
FT                   /inference="protein motif:PFAM:PF06835"
FT                   /protein_id="ACS54372.1"
FT                   /translation="MLDTLKNNGHAAYSGSGKNAYGDALFHSARVRRLKILLPVAALIV
FT                   AASLTAVALVSIYLPENIKMEGAKIENGKVVMEKPAISGRNSDGINYSMLAERALQDIR
FT                   NPDLITLETIKAAVPMNDGLIARVVASTADYNRATDNLHMTAPFTLVLSSGLNANFQSA
FT                   QLDIKGGNMRSDDPVTITKDNASIVAKTLQITDKGRVITFEGNVRMNVDPSTIHKQGT"
FT   gene            60715..61329
FT                   /locus_tag="Rleg_0062"
FT   CDS_pept        60715..61329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0062"
FT                   /product="OstA family protein"
FT                   /note="PFAM: OstA family protein; KEGG:
FT                   rec:RHECIAT_CH0000444 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54373"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYE9"
FT                   /inference="protein motif:PFAM:PF03968"
FT                   /protein_id="ACS54373.1"
FT                   /translation="MAFIAGAFALILTASGAGAQQATATMPGMKLSNDQPIQIESDKLE
FT                   IHDQEHTALFTGNVKVVQGATTMQSGKMTVYYKDKAAKPATDGTQPAAQPAAQPQQSAS
FT                   LASGSADIDKILVTDKVFLTSGTQTATADDGNFDMASQTFILTADEGKKVILSDGPNVF
FT                   TGCKLTVHMQTGQAELESCGGRVQIQLDPKSKPNTPQQKQN"
FT   sig_peptide     60715..60774
FT                   /locus_tag="Rleg_0062"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.813 at
FT                   residue 20"
FT   gene            61370..62146
FT                   /locus_tag="Rleg_0063"
FT   CDS_pept        61370..62146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0063"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rec:RHECIAT_CH0000445 probable amino acid ABC
FT                   transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54374"
FT                   /db_xref="GOA:C6AYF0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYF0"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS54374.1"
FT                   /translation="MFGKPGPQAAGAADKSRYQGTLIARGLTKTYATRRVVNGVSLVVR
FT                   RGEAVGLLGPNGAGKTTCFYMITGLVPVDEGTIEIDGNDVTTMPMYRRSRLGVGYLPQE
FT                   ASIFRGLTVEENIRAVLEVHVKDKAEREQKLNELLEEFHIQKLRKSAAVALSGGERRRL
FT                   EIARALATDPTFMLLDEPFAGVDPISVADIQNLVHHLTARGIGVLITDHNVRETLGLID
FT                   RAYIIHAGEVLTHGRANDIVNNPEVRRLYLGDNFSL"
FT   gene            62320..63879
FT                   /locus_tag="Rleg_0064"
FT   CDS_pept        62320..63879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0064"
FT                   /product="RNA polymerase, sigma 54 subunit, RpoN"
FT                   /note="TIGRFAM: RNA polymerase sigma-54 factor, RpoN; PFAM:
FT                   sigma-54 factor core-binding region; sigma-54 factor;
FT                   sigma-54 DNA-binding domain protein; KEGG: ret:RHE_CH00404
FT                   RNA polymerase factor sigma-54"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54375"
FT                   /db_xref="GOA:C6AYF1"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYF1"
FT                   /inference="protein motif:TFAM:TIGR02395"
FT                   /protein_id="ACS54375.1"
FT                   /translation="MALSANLFLRQTQSLVMTPQLMQSIQLLQMTHFELNQFIALEVEK
FT                   NPLLEFPSNDGEAGGERGEAEDGEYAHQPEDAGSDDGYDNRTEALSSDWYDNGGSASTS
FT                   RLNDELDANYTNVFPDDGAPQRLDAPELVSQWKSMPGSGEGADYDLDDFVAGQVSLRDH
FT                   LAQQIPFVLPDMADRLIAQNFVDQLDDCGYLQADIVEAGERLGTSLAQAERVLATLQSL
FT                   DPPGVFARSLAECLAIQLKQKDRYDPAMQALVENLELLARRDFATLKRLCGVDEEDLLD
FT                   MLGEIRQLNPKPGSGFEAGISEAIMPDVVVRASSDGGWLVELNPDTLPRVLVNQSYFSR
FT                   VTKNGEDHAFLSDCLQTANWLTRSLDQRAKTIMKVASEIVRQQDAFLLHGVDYLRPLNL
FT                   KTVAEAIKMHESTVSRVTSNKYMLTPRGLFELKYFFTVSISAVAGGDSHSAEAVRHKIR
FT                   ALILQESPEAVLSDDDIVDMLKKGGVDLARRTVAKYREAMNIASSVQRRREKRALAKVA
FT                   GF"
FT   gene            64007..64930
FT                   /locus_tag="Rleg_0065"
FT   CDS_pept        64007..64930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0065"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: rec:RHECIAT_CH0000447 putative
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54376"
FT                   /db_xref="GOA:C6AYF2"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYF2"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACS54376.1"
FT                   /translation="MPTMMRQNSNLARELFLLLVLATLWGSSYSFIKIGVETIPPITLI
FT                   AARTLIAGGILLAVLRHRRVRLPRDLATWRRFFVQACLNSVVPFTLIAWAEQSVDAGLA
FT                   VILNSATPIFTFLLTVLITRHEQVTLRRLFGVMAGLAGICLVIGVEALGGLGESLMAQL
FT                   AIILATICYAGAAIFSKNFKGLDPAVPAAGSLISGAVVLLPMSLVVDRPWEIDPSPASM
FT                   LALLALSAFSTALAFVIYFRLVQTLGSVGTTAQAYLRVPIGVAIGIVFLGERLSPTAWI
FT                   GLVCVIAGVAAMTIPARRGTTQARNA"
FT   sig_peptide     64007..64099
FT                   /locus_tag="Rleg_0065"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.696) with cleavage site probability 0.687 at
FT                   residue 31"
FT   gene            65223..65798
FT                   /locus_tag="Rleg_0066"
FT   CDS_pept        65223..65798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0066"
FT                   /product="sigma 54 modulation protein/ribosomal protein
FT                   S30EA"
FT                   /note="TIGRFAM: ribosomal subunit interface protein; PFAM:
FT                   sigma 54 modulation protein/ribosomal protein S30EA; KEGG:
FT                   rec:RHECIAT_CH0000448 probable sigma 54 modulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54377"
FT                   /db_xref="GOA:C6AYF3"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYF3"
FT                   /inference="protein motif:TFAM:TIGR00741"
FT                   /protein_id="ACS54377.1"
FT                   /translation="MSVRVSGKHMEIGESFRQRIEDQIGMAITKYFDGGYSGQVTVEKA
FT                   SSRYSADCKLHLDSGVVLHAAGEATDPQLAFDAASQRIEKRLRRYKRKLKDHHAGNHLN
FT                   GFAEVSYTVMDSVPDHDDEIADDFAPAIVAESTKQLKTMSVATAVMALDMTDEPLLLFR
FT                   SPGKEHLNIVYRRHDGNIGWIDSASIKG"
FT   gene            65869..66333
FT                   /locus_tag="Rleg_0067"
FT   CDS_pept        65869..66333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0067"
FT                   /product="PTS IIA-like nitrogen-regulatory protein PtsN"
FT                   /note="TIGRFAM: PTS IIA-like nitrogen-regulatory protein
FT                   PtsN; PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; KEGG:
FT                   rec:RHECIAT_CH0000449 protein-N(pi)-phosphohistidine-sugar
FT                   phosphotransferase protein (enzyme II of the
FT                   phosphotransferase system)"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54378"
FT                   /db_xref="GOA:C6AYF4"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR006320"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYF4"
FT                   /inference="protein motif:TFAM:TIGR01419"
FT                   /protein_id="ACS54378.1"
FT                   /translation="MALADLLHQDAIIPALRVNSKKQLLQELAARASRITGLSEREVFD
FT                   VILQRERLGSTGVGNGIAIPHGKLGNIHSIVGIFARLEQPVDFEALDDQPVDLVFLLLA
FT                   PEGAGADHLKALSRIARVLRDHDLVAKLRATESASAIYAFLNEEQTSNAA"
FT   gene            66479..66673
FT                   /locus_tag="Rleg_0068"
FT   CDS_pept        66479..66673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0068"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54379"
FT                   /db_xref="GOA:C6AZ53"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ53"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS54379.1"
FT                   /translation="MPEPETLKRVASAFSVCASSLSATLAAVASSTIAAFCCAPWPICI
FT                   MAWLIFFKPTTMKSLSGTC"
FT   sig_peptide     66479..66568
FT                   /locus_tag="Rleg_0068"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.707 at
FT                   residue 30"
FT   gene            complement(66833..67732)
FT                   /locus_tag="Rleg_0069"
FT   CDS_pept        complement(66833..67732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0069"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: ret:RHE_CH00409
FT                   ribose kinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54380"
FT                   /db_xref="GOA:C6AZ54"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ54"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ACS54380.1"
FT                   /translation="MITVFGSINMDLIATTERLPKPGETVAGNGFATAAGGKGANQALA
FT                   ARRAGRYVHMAGAVGKDAFAAEALALLDDAGTDLSLIKHVDGPTGTALILVGGDGENMI
FT                   AVVPGANGQVTPADAETAIGRMDEGDVLMLQLEVPAAAVEGALSAARAKGVTSILNLAP
FT                   LIPDAPRLGRLADIVIANETEFERLAGQEGMDAQAREAALVRLHAETGQTLIVTLGADG
FT                   VIAIRDGSISRAQGLKIQPVDTVGAGDTFCGYFAASLDDGLDFVSALRRAAVAGSLACL
FT                   KAGAQPSIPLSEEVADRI"
FT   gene            complement(67813..69036)
FT                   /locus_tag="Rleg_0070"
FT   CDS_pept        complement(67813..69036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0070"
FT                   /product="protein of unknown function DUF195"
FT                   /note="PFAM: protein of unknown function DUF195; KEGG:
FT                   rec:RHECIAT_CH0000452 putative DNA recombination protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54381"
FT                   /db_xref="GOA:C6AZ55"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ55"
FT                   /inference="protein motif:PFAM:PF02646"
FT                   /protein_id="ACS54381.1"
FT                   /translation="MTVHSESLALSLASISPAMLALVGGGLAVLVLLVIVLLLRGSGLR
FT                   REQAEEANFRAEENEARMGELLKIQAEMQGRIAAMTEVFGARQSELNQTISQRLDGMSQ
FT                   RVSSTITEQTKSTHENLQRLQERLAVIDAAQNNIQTLAKDVVGLQAILSNKQTRGAFGQ
FT                   SRMETIVADGLPMGAYAFQQTLSNGSRPDCTIRMPNGAPPLVIDAKFPLEAWNAIRDAG
FT                   SPEAGKIAGQQFRRDMEVHIRDISEKYLIQGETQDTAFLFVPSESIFAEIHEHFEPVVQ
FT                   KAHRARIVIVSPSLLMLSIQVIQAVLKDQRMRAQAHLIQGEVAILMDDLSRLDERVRKL
FT                   QGHFAMAQKDIDMVVTSADKLTRRGARIEALEFEAGGDAKPARDSEAAAKSVESRTGLL
FT                   KLRVVDEE"
FT   sig_peptide     complement(68950..69036)
FT                   /locus_tag="Rleg_0070"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.933) with cleavage site probability 0.296 at
FT                   residue 29"
FT   gene            69243..70727
FT                   /locus_tag="Rleg_0071"
FT   CDS_pept        69243..70727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0071"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; SMART:
FT                   chemotaxis sensory transducer; KEGG: rec:RHECIAT_CH0000453
FT                   probable methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54382"
FT                   /db_xref="GOA:C6AZ56"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR039379"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ56"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACS54382.1"
FT                   /translation="MTAQQTDNALRQRLDFIELDEAARKSMRDLRPVISELIGGALDKF
FT                   YAKIAKTPAVADKSQLGHAKKRQQDHWVNLTGGTFDESYVDGVTAVGRMHERMGLEPRW
FT                   SIGGYAIVMSELVKGIMEKQWPSIFARQQGKLLAEKLSAVVKSGMLDMDYSISVYLETL
FT                   EAKRRALEEQRAEAQSDQAIALEQLRRGLEALSNGDLEATLPSDLPGNFRQMAEDYNRA
FT                   VSALRQSFASVRETSGHIKTGADVISNATNDLALRTAQQAAGVEESSAALQQLSVSVGQ
FT                   TAANAEKASDAVRETQQKAKNSGELVTSAVSAMAGIEKSSTGISKIIGVIDEIAFQTNL
FT                   LALNAGVEAARAGDAGKGFAVVAQEVRQLAQRTVEAAKEIKNLISQSSTQVNQGVGIVS
FT                   STGEALNDMISRIDIINRFVADIAAAARDQATGVNEVSLAVRNMGAITQQNSDMVEHSS
FT                   AETRRLKDEVETLIELLQHFRARPEGRSAGAARRAA"
FT   gene            70825..71340
FT                   /locus_tag="Rleg_0072"
FT   CDS_pept        70825..71340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0072"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="KEGG: rec:RHECIAT_CH0000454 peptide deformylase
FT                   protein; TIGRFAM: peptide deformylase; PFAM:
FT                   formylmethionine deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54383"
FT                   /db_xref="GOA:C6AZ57"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ57"
FT                   /inference="protein motif:TFAM:TIGR00079"
FT                   /protein_id="ACS54383.1"
FT                   /translation="MTIKPLIILPDPVLRQLSKPIERVDSDLQRLADDMLETMYDAPGI
FT                   GLAAIQIGVPRRMLVIDIAREGEEKQPQVFINPEVVKSSDERSVYEEGCLSIPDYYAEV
FT                   ERPAVVSVKYLDRNGKEQTVEADGLLATCLQHEIDHLNGVLFIDYISRLKREMVIKKFT
FT                   KAAKSKAL"
FT   gene            71406..71666
FT                   /locus_tag="Rleg_0073"
FT   CDS_pept        71406..71666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0073"
FT                   /product="putative plasmid stabilization protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000455 probable plasmid
FT                   stabilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54384"
FT                   /db_xref="GOA:C6AZ58"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ58"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000455"
FT                   /protein_id="ACS54384.1"
FT                   /translation="MGDLLIRDVPDAMKRQLQESAQRNGRSLSEEAIEIMRRQIAVERS
FT                   RDSAGQRLRSLMSEERLSEDEVEAIAASRHERDREPPRFDT"
FT   gene            71663..72082
FT                   /locus_tag="Rleg_0074"
FT   CDS_pept        71663..72082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0074"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; KEGG:
FT                   ret:RHE_CH00413 plasmid stability protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54385"
FT                   /db_xref="GOA:C6AZ59"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ59"
FT                   /inference="protein motif:PFAM:PF01850"
FT                   /protein_id="ACS54385.1"
FT                   /translation="MIVLDTNVISEMQGRIHSDRILNWLDAYDVETLFLTTIAVAEMRY
FT                   GLELLDDGRRKTALVSDFNRIESEFAGRILGFALSAAHRYGLLAAERRKAGRPMETKDA
FT                   MIAAICLANGATLATRNTRDFEGLDLKLVNPFEDG"
FT   gene            72103..73038
FT                   /locus_tag="Rleg_0075"
FT   CDS_pept        72103..73038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0075"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /note="KEGG: ret:RHE_CH00414 methionyl-tRNA
FT                   formyltransferase; TIGRFAM: methionyl-tRNA
FT                   formyltransferase; PFAM: formyl transferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54386"
FT                   /db_xref="GOA:C6AZ60"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ60"
FT                   /inference="protein motif:TFAM:TIGR00460"
FT                   /protein_id="ACS54386.1"
FT                   /translation="MSLRIIFMGTPEFSVPTLRLLVDAGHRIVAVYTQPPRPGGRRGLD
FT                   LQKSPVHQAAELLGLPVFTPVNFKDPEERERFRGLNADVGVVVAYGLLLPEAILNGTRD
FT                   GCYNGHASLLPRWRGAAPIQRAIMAGDAKTGMMVMKMDKGLDTGAVALTREVEIGPNMT
FT                   AGELHDRLMLVGAKAMAEAMVKLEMNDLPLTPQPEDGVLYAAKIDKAETRIDFSRNAGD
FT                   VHNHIRGLAPFPGAWFELEIGGKPERVKVLASELAEGQGAAGLLLTDDLVIACGSGALR
FT                   LTRLQKAGGKPLAAADFLRGTPLAAGTRLT"
FT   gene            73038..73856
FT                   /locus_tag="Rleg_0076"
FT   CDS_pept        73038..73856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0076"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="5.4.99.12"
FT                   /note="KEGG: rec:RHECIAT_CH0000458 tRNA-pseudouridine
FT                   synthase I protein; TIGRFAM: tRNA pseudouridine synthase A;
FT                   PFAM: tRNA pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54387"
FT                   /db_xref="GOA:C6AZ61"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ61"
FT                   /inference="protein motif:TFAM:TIGR00071"
FT                   /protein_id="ACS54387.1"
FT                   /translation="MPRFRMTVEYDGGPYVGWQRQENGHSVQGAIEAAVLSLTGETVLV
FT                   RGAGRTDSGVHAMGQVIHADLSKEWSPYQLQNALNAHLRLAGERVSILEVEAAPEFFDA
FT                   RFSALRRHYLYRIVSRRAPLALEAGKAWWVPKVLDHEVMHAAAQRLVGKHDFSTFRAAH
FT                   CQANSPVRTLDRLDVTRNGELIEIRATAQSFLHNQIRSFAGTLKLAGEGKWTPDDVEAA
FT                   LEARDRKACGPVAPPDGLYFMQVDYPDVIPDRRRPVTDTDANDGDADDPS"
FT   gene            complement(73863..74459)
FT                   /locus_tag="Rleg_0077"
FT   CDS_pept        complement(73863..74459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0077"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00416 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54388"
FT                   /db_xref="GOA:C6AZ62"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ62"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00416"
FT                   /protein_id="ACS54388.1"
FT                   /translation="MPGFREVQYYLAGLWLLIRLDPRGFRYLDMSERGVNRSFWAMLWC
FT                   LPPMGISWLWWRQAFLRSMPPEADVDFPFYIRLGLVEVANWFVPLVFAGVLLLAFRMGE
FT                   RFAPVVVSVNWLGVPLSYINGLLLALVFFLPGSIGLVSLLLLAFMLAQVFVLARIIRMI
FT                   CHGHALMTGALTLVLLVPSMILSEYLQHFLGIYPV"
FT   gene            complement(74446..75639)
FT                   /locus_tag="Rleg_0078"
FT   CDS_pept        complement(74446..75639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0078"
FT                   /product="succinyl-diaminopimelate desuccinylase"
FT                   /note="TIGRFAM: succinyl-diaminopimelate desuccinylase;
FT                   PFAM: peptidase M20; peptidase dimerisation domain protein;
FT                   KEGG: ret:RHE_CH00417 succinyl-diaminopimelate
FT                   desuccinylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54389"
FT                   /db_xref="GOA:C6AZ63"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR005941"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ63"
FT                   /inference="protein motif:TFAM:TIGR01246"
FT                   /protein_id="ACS54389.1"
FT                   /translation="MTATDPVANLQTLIRCPSVTPAEGGALTALEAMLAPLGFALDRVK
FT                   ASEEGTPEIENLYARLGKDGPHLMFAGHTDVVPVGDEAAWTHPPFEAQISKGELFGRGA
FT                   VDMKGGIACFVAAVARHIEKNGPPNGSISFLITGDEEGPAINGTIKLLQWAAERGERWD
FT                   ACLVGEPTNPDRLGDMIKIGRRGSLSGKITVHGVQGHAAYPHLADNPVRGMLQLTQALM
FT                   DPPFDAGTGDFQPSNLEVTTVDVGNPATNVIPAKASASFNIRFNDSWTVETLRAEILRR
FT                   LEAAAGNGALRPGRDPVAYDIVWADRPSHVFLTRNNALIASLSSAVESVAGQSPRLSTT
FT                   GGTSDARFIKDYCPVVEFGLVGQTMHMVDERVAVADLETLTAIYETFIARWFANAGL"
FT   gene            complement(75741..76601)
FT                   /locus_tag="Rleg_0079"
FT   CDS_pept        complement(75741..76601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0079"
FT                   /product="2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
FT                   N-succinyltransferase"
FT                   /EC_number="2.3.1.117"
FT                   /note="TIGRFAM:
FT                   2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
FT                   N-succinyltransferase; KEGG: ret:RHE_CH00418
FT                   2,3,4,5-tetrahydropyridine-2-carboxylate
FT                   N-succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54390"
FT                   /db_xref="GOA:C6AZ64"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005664"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR023180"
FT                   /db_xref="InterPro:IPR037133"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ64"
FT                   /inference="protein motif:TFAM:TIGR00965"
FT                   /protein_id="ACS54390.1"
FT                   /translation="MSATDLASLEKIIESAFDNRDNVNTSTKGEVRDAVEAALDLLDAG
FT                   KARVAERSADGAWTVNQWLKKAVLLSFRLNDMDVVEGGSGNSTWWDKVPSKFENWGENH
FT                   FRAAGFRAVPNCVVRRSAYIAPNAILMPSFVNLGAYVGEGTMVDTWATVGSCAQIGKHV
FT                   HLSGGVGIGGVLEPMQAGPTIIEDNCFIGARSEVVEGCIIREGSVLGMGVFIGKSTKIV
FT                   DRATGEVSYGEVPPYSVVVAGSMPSGNATMGNGQPAPHLYCAVIVKRVDEKTRSKTGIN
FT                   ELLRD"
FT   gene            76794..77660
FT                   /locus_tag="Rleg_0080"
FT   CDS_pept        76794..77660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0080"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   rec:RHECIAT_CH0000462 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54391"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ65"
FT                   /inference="protein motif:PFAM:PF03641"
FT                   /protein_id="ACS54391.1"
FT                   /translation="MAKGRNGGSRRKDGVWDPLKSSSTDKQRAEAVPKTPQTMSPAYRL
FT                   AYVDQDFLCREELRPIRLQLELLKTEMMLTERGIKSTVVMFGGARIPAPGQSAWAARND
FT                   IQRVNLEAASVYYDEARKFARLCSKYSATFNFHEYVIVTGGGPGVMEAGNRGAADEGAP
FT                   SIGLNIVLPHEQAPNAYVTPELSFNFHYFAIRKMHFMVRAKAIAVFPGGFGTLDEFFEC
FT                   LTLIQTGRMERLPLILFGETFWRSIINFEALAEFGTIAPDDVKLISFVDTAEAAWKIVQ
FT                   DFYEHRE"
FT   gene            complement(77747..78385)
FT                   /locus_tag="Rleg_0081"
FT   CDS_pept        complement(77747..78385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0081"
FT                   /product="Calcium-binding EF-hand-containing protein"
FT                   /note="SMART: Calcium-binding EF-hand-containing protein;
FT                   KEGG: ret:RHE_CH00420 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54392"
FT                   /db_xref="GOA:C6AZ66"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ66"
FT                   /inference="protein motif:SMART:SM00054"
FT                   /protein_id="ACS54392.1"
FT                   /translation="MYRNKLILAALSSTLIFGAAAGAGYAAPGDGPRQHPGRHGPMHGP
FT                   GPAAFREITYVRMLKQFDTNKDGQISKDEATAGIDKIFAAIDTNKDGSLTPGEIGAYQK
FT                   AQMQAMRDQRKQDASNNKDAKTADATPDNNDQGRPPQGGHEGRDGHRWMRHGGNIMRAS
FT                   IMMHRVDTDQNGRISKQEAEAGMDKLFTRMDRNKDGVISIDDMPDRPLL"
FT   sig_peptide     complement(78305..78385)
FT                   /locus_tag="Rleg_0081"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.930 at
FT                   residue 27"
FT   gene            complement(78490..79197)
FT                   /locus_tag="Rleg_0082"
FT   CDS_pept        complement(78490..79197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0082"
FT                   /product="pyrimidine 5'-nucleotidase"
FT                   /note="TIGRFAM: pyrimidine 5'-nucleotidase; HAD-superfamily
FT                   hydrolase, subfamily IA, variant 3; PFAM: Haloacid
FT                   dehalogenase domain protein hydrolase; KEGG:
FT                   rec:RHECIAT_CH0000464 putative hydrolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54393"
FT                   /db_xref="GOA:C6AZ67"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010237"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ67"
FT                   /inference="protein motif:TFAM:TIGR01993"
FT                   /protein_id="ACS54393.1"
FT                   /translation="MTKIDRTPDKADFEHVTDWVFDLDNTLYPHHVNLFAQIDKNMTAY
FT                   VAALLQMEREEARKLQKQYYLEHGTTLQGLMIHHGIDPNDFLEKAHAIDYTALTPQPEL
FT                   GEAIKALPGRKFIFTNGSVKHAEMTAEALGILEHFDDIFDIVAADYVPKPAQATYDKFM
FT                   ALKRVETTKAAMFEDLPRNLTVPKALGMQTVLLVPRNLEETVVEWWEKTSGDEDHIDFV
FT                   TDDLAAFLGKITG"
FT   gene            79300..80376
FT                   /locus_tag="Rleg_0083"
FT   CDS_pept        79300..80376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0083"
FT                   /product="methylated-DNA/protein-cysteine
FT                   methyltransferase"
FT                   /note="KEGG: ret:RHE_CH00423
FT                   methylated-DNA-[protein]-cysteine S-methyltransferase
FT                   protein; TIGRFAM: methylated-DNA/protein-cysteine
FT                   methyltransferase; PFAM: Ada metal-binding domain protein;
FT                   Methylated-DNA-[protein]-cysteine S-methyltransferase DNA
FT                   binding; SMART: helix-turn-helix- domain containing protein
FT                   AraC type"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54394"
FT                   /db_xref="GOA:C6AZ68"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR004026"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR016221"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR035451"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ68"
FT                   /inference="protein motif:TFAM:TIGR00589"
FT                   /protein_id="ACS54394.1"
FT                   /translation="MLFERPNDDTLYDALIARSADYEGQAYVCVKTTGIFCRLTCPARK
FT                   PKRENTLFFDTIAACMHSGFRPCQRCRPLEQPGREPIVDELLAALDREPQLRWSEDELV
FT                   RRGHDPSTVRRAFKRGLGMTFHDIVRYRRLGEAARQLADGARVIDAQLEAGYDSPSGFR
FT                   TAFQRLVGKAPALSQNRELLFADWFETPLGPMVAVADRTHLHLLEFHDRKALPTELEAL
FT                   QKRVRSSVAIGRTPAIDQIEAEIRDYFEGRLTVFKTPLALGGTPFEKHVWAKLMDITAG
FT                   QTRAYGDLAREMERPEVVRAVGRANGANQLAIIVPCHRILGADGSLTGYGGGLWRKQWL
FT                   LRHEEKIRAQAPNVEETA"
FT   gene            80373..81143
FT                   /locus_tag="Rleg_0084"
FT   CDS_pept        80373..81143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0084"
FT                   /product="putative carboxyphosphonoenolpyruvate
FT                   phosphonomutase protein"
FT                   /note="KEGG: ret:RHE_CH00424 putative
FT                   carboxyphosphonoenolpyruvate phosphonomutase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54395"
FT                   /db_xref="GOA:C6AZ69"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ69"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00424"
FT                   /protein_id="ACS54395.1"
FT                   /translation="MNQSEKAKAFGALHRKGDPVVLYNIWDAGTAKAVTDAGAKALATG
FT                   SWSVAAAHGYADGEKLPMSVLVETAKSITAVVNLPLSVDFEGAYSAEPEGAAANVAKLV
FT                   EVGAIGINFEDQVVGGGGLYPAERQAARIRAIRAMAEGEGIPFFINARTDLFLAESDLS
FT                   KHAGLVEEAIERGKAYAAAGGSGFFVPGLIDPALIEKICAASPLPVNIMMRTGAPDVKT
FT                   LAKLGVGRISYGPGPYRSMMEKLKQEAAAIYSPL"
FT   gene            complement(81209..82357)
FT                   /locus_tag="Rleg_0085"
FT   CDS_pept        complement(81209..82357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0085"
FT                   /product="FMN-dependent alpha-hydroxy acid dehydrogenase"
FT                   /note="PFAM: FMN-dependent alpha-hydroxy acid
FT                   dehydrogenase; KEGG: ret:RHE_CH00425 L-lactate
FT                   dehydrogenase (cytochrome) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54396"
FT                   /db_xref="GOA:C6AZ70"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR008259"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR037396"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ70"
FT                   /inference="protein motif:PFAM:PF01070"
FT                   /protein_id="ACS54396.1"
FT                   /translation="MRLTDCYNFHDFRRMAKRRLPGPIFDYIDGGADDEVTYRRNTAAF
FT                   EACDLVPDVLRGVADVDMSVTVMGQKLAMPVYCSPTALQRLFHHQGERAVAAAAAKHGT
FT                   MFGVSSLGTISLEEARQISNGPQVYQFYFHKDRGLNREMMARAKNAGVQAMMLTVDSIT
FT                   GGNRERDKRTGFAIPFKLNLAGMTQFAIKPSWAIDWLTHERFRLPQLENHVKMDGGALS
FT                   ISRYFTEMLDPSMSWDDVAEMVREWGGPFCLKGIMSVEDAKRAAEIGCSGIVLSNHGGR
FT                   QLDGSRSAFDQLAEIVDAVGDRVDVMMDGGVQRGTHVLKALSLGAKAVGLGRYYLFPLA
FT                   AAGQPGVERALETMRTEIERGMKLMGCTSVSQLSRRNLRFRS"
FT   gene            complement(82427..83314)
FT                   /locus_tag="Rleg_0086"
FT   CDS_pept        complement(82427..83314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0086"
FT                   /product="acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="KEGG: rec:RHECIAT_CH0000469 acetylglutamate kinase
FT                   protein; TIGRFAM: acetylglutamate kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54397"
FT                   /db_xref="GOA:C6AZ71"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ71"
FT                   /inference="protein motif:TFAM:TIGR00761"
FT                   /protein_id="ACS54397.1"
FT                   /translation="MNETESEMQARLLAKALPFMQRYENKTIVVKYGGHAMGNPELGKA
FT                   FASDIALLKQSGVNPIVVHGGGPQIGAMLSKMGIESKFEGGLRVTDQKTVEIVEMVLAG
FT                   SINKEIVALINQTGEWAIGLCGKDGNMVFAEKARKTIKDPDSNIERVLDLGFVGEVVEV
FT                   DRTLLDLLARSEMIPVIAPVAPGRDGATYNINADTFAGAIAGALNATRLLFLTDVPGVL
FT                   DKNGQLIKELSVAEAHALIADGTISGGMIPKVETCIDAIKAGVQGVVILNGKTAHSVLL
FT                   EIFTEHGVGTLIVP"
FT   gene            83458..83997
FT                   /locus_tag="Rleg_0087"
FT   CDS_pept        83458..83997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0087"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; Sigma-70
FT                   region 4 type 2; sigma-70 region 4 domain protein; KEGG:
FT                   rec:RHECIAT_CH0000470 RNA polymerase sigma-70 factor
FT                   protein, ECF family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54398"
FT                   /db_xref="GOA:C6AZ72"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ72"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACS54398.1"
FT                   /translation="MQGDDIADLIGRVALGDRRAFVALYNQTGPKLFSICLRILKDRTE
FT                   AEEALQEAYISIWQRARSFSVASGSSSAWLAAIARNRSIDALRARKPVADELDTVYDLA
FT                   DAGADPEMQTVTKDEGRRIDTCMEELEADRAVAVKRAYVEGLSYQELADQFGIPLNTMR
FT                   TWLRRSLLKLRECMER"
FT   gene            83994..84713
FT                   /locus_tag="Rleg_0088"
FT   CDS_pept        83994..84713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0088"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000471 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54399"
FT                   /db_xref="GOA:C6AZ73"
FT                   /db_xref="InterPro:IPR018764"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ73"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000471"
FT                   /protein_id="ACS54399.1"
FT                   /translation="MTSPDKSKGDRSRDEVLAGEYVLGVLSLQDRRVVEERMRHDRPFA
FT                   AIVSRWETNLSAFNDEYEGVAPNRETFKQIEARLFGDGQKPPSFSQGLWNSAVFWRSLS
FT                   FACIVVAVSAVIFASGVVPEPQGPAPLVASLSGQNSTINLLASYELQSGRLKIVPVAAG
FT                   KPEEKSLELWLVPGSGMTRSLGVFQPGESGELVIPADLRSQVADGATLAVSLEPFGGSP
FT                   TGQATGPVIASGPLHRP"
FT   gene            84836..85390
FT                   /locus_tag="Rleg_0089"
FT   CDS_pept        84836..85390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0089"
FT                   /product="beta-Ig-H3/fasciclin"
FT                   /note="PFAM: beta-Ig-H3/fasciclin; SMART:
FT                   beta-Ig-H3/fasciclin; KEGG: rec:RHECIAT_CH0000472 putative
FT                   transforming growth factor-induced protein (and secreted
FT                   protein MPB70)"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54400"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="InterPro:IPR036378"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ74"
FT                   /inference="protein motif:PFAM:PF02469"
FT                   /protein_id="ACS54400.1"
FT                   /translation="MIKSVLRGVALATAMSAVAFAAAKNPVVGGAAMFDSKNIIENAVN
FT                   SKDHTTLVAAVKAAGLVGTLEGKGPFTVFAPTNEAFAALPKGTVDTLLKPENKATLTKV
FT                   LTCHVVAADAMAKTVAKMIKDDGGEHDIKTVGGCVLKAKENMGKITLTDENGGVSHVTI
FT                   ADVKQSNGVIHVVDKVLLPKM"
FT   sig_peptide     84836..84901
FT                   /locus_tag="Rleg_0089"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.917 at
FT                   residue 22"
FT   gene            complement(85663..86739)
FT                   /locus_tag="Rleg_0090"
FT   CDS_pept        complement(85663..86739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0090"
FT                   /product="signal transduction histidine kinase"
FT                   /note="PFAM: histidine kinase dimerisation/phosphoacceptor;
FT                   ATP-binding region ATPase domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; KEGG:
FT                   rec:RHECIAT_CH0000473 probable two-component sensor
FT                   histidine kinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54401"
FT                   /db_xref="GOA:C6AZ75"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011102"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ75"
FT                   /inference="protein motif:PFAM:PF07568"
FT                   /protein_id="ACS54401.1"
FT                   /translation="MTDSKDQPISPEGVGNLPHLAEALDDDRFRHFLDHVPFAVAVSEL
FT                   GGNEPLIYVNLEFERLTALGATEVQGKPWPDIELNSTAVSGEVPLTAAVTSAEEYIGAF
FT                   SLVAEPESTVIIDVWSNTIVDDDDTPLFRLVAFAARSEATAAESFSELLTEKDVLLREL
FT                   QHRVKNNLQMITALIRMEARNAQQNEESERFARLAGRIEALALLYRSLSDEEKGATVDL
FT                   GTYVSQIAASVMAAHAVEGIRLDMKVDTWPVSVDVAMPAGLVINELLTNTLKHAFVGRD
FT                   GGEITLRCVVSETGCRITVADNGVGLPQDVTWPQPGKLSAMIVQSLKQNARAEVEVSSS
FT                   PDTGMSVSLVFPRAEAAQ"
FT   gene            complement(86861..87136)
FT                   /locus_tag="Rleg_0091"
FT   CDS_pept        complement(86861..87136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0091"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00433 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54402"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ76"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00433"
FT                   /protein_id="ACS54402.1"
FT                   /translation="MAETPQELQSINTAWQIAIQEILRMVIRDMYHGGGEASFKTHIKR
FT                   IEEAAVDSIYTDLRLRGTDEWTEVLVKERASNFVTTLLTSFTYDRA"
FT   gene            complement(87257..87481)
FT                   /locus_tag="Rleg_0092"
FT   CDS_pept        complement(87257..87481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0092"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00434 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54403"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ77"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00434"
FT                   /protein_id="ACS54403.1"
FT                   /translation="MTETYSKSRQRAEIAFGNVQTQFFAKNQAAEELESDAQSQQAKTL
FT                   RLREARLAREQSDRVSATSALIAKRARAR"
FT   gene            complement(87615..87824)
FT                   /locus_tag="Rleg_0093"
FT   CDS_pept        complement(87615..87824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0093"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="PFAM: Cold-shock protein DNA-binding; SMART: Cold
FT                   shock protein; KEGG: rec:RHECIAT_CH0000476 probable cold
FT                   shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54404"
FT                   /db_xref="GOA:C6AZ78"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ78"
FT                   /inference="protein motif:PFAM:PF00313"
FT                   /protein_id="ACS54404.1"
FT                   /translation="MATGTVKWFNSTKGFGFIQPDNGGDDAFVHISAVERAGMRELVEG
FT                   QKIGFDLERDNKSGKMSACNLQNA"
FT   gene            complement(88092..88745)
FT                   /locus_tag="Rleg_0094"
FT   CDS_pept        complement(88092..88745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0094"
FT                   /product="GTP-binding protein HSR1-related"
FT                   /note="PFAM: GTP-binding protein HSR1-related; KEGG:
FT                   ret:RHE_CH00436 GTPase EngB"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54405"
FT                   /db_xref="GOA:C6AZ79"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ79"
FT                   /inference="protein motif:PFAM:PF01926"
FT                   /protein_id="ACS54405.1"
FT                   /translation="MPETEKPLFGHPWIFIRGVPSLNFLPPEGPLEVAFAGRSNVGKSS
FT                   LINALVGQKGLARTSNTPGRTQELNYFVPDGYSGEGQDLPPTAIVDMPGYGYAQAPKEQ
FT                   VDKWTKLVFDYLRGRATLKRVYVLIDSRHGIKKNDDDVLDLLDKAAVSYQIVLTKTDKI
FT                   KAAGVPKLLAETAEKIRKRPAAYPGVLSTSSEKGDGLDELRQAIAETVGIARWK"
FT   gene            complement(88899..90692)
FT                   /locus_tag="Rleg_0095"
FT   CDS_pept        complement(88899..90692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0095"
FT                   /product="60 kDa inner membrane insertion protein"
FT                   /note="PFAM: 60 kDa inner membrane insertion protein; KEGG:
FT                   rec:RHECIAT_CH0000478 inner membrane transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54406"
FT                   /db_xref="GOA:C6AZ80"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028053"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="InterPro:IPR038221"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ80"
FT                   /inference="protein motif:PFAM:PF02096"
FT                   /protein_id="ACS54406.1"
FT                   /translation="MENNRNYFIAIALSVLIVLGWQFLYMNPRIEAQRKVQEAQKAQQQ
FT                   TEQVQQPAAGGQTPAQPSGAAPTSQAAATATLEQALAKSPRVVIDTAALSGSINLAGAR
FT                   LDDLKLKGYHETVDDSSPIITLFSPAETKDGYFTELGYIGSDATGSVPGPSTLWTAPEG
FT                   AKLTEKTPVTLSYTNDKGLTFTRTISVDERYMFTVADKIENAGQAPASLNSYGRVTRYN
FT                   KPTTPSVYVLHEGFIGVIGDDGLVETKYTAAEKEAVKPAKSTGGWLGITDKYWAATIVP
FT                   PQSAPYEASFSHFADGQPRYQADYKEDAFTVAPGQSIELKNLVFAGAKEVPVIDGYEAS
FT                   YSIPKFDRLIDWGWFYFITKPMFKLMDFFFRYFGNFGVAILCTTIVVKLLFFPLASKQY
FT                   ASMANMKRMQPKMEELKAKFADDRMGLQQATMQLYKEEKINPIAGCWPVALQIPIFFSL
FT                   YKVIYITIEMRHAPFFGWIKDLSAPDPTTIVNLFGLLPFEAPTILHLGVWPLIMGVTMF
FT                   LQMRMNPTPPDPTQAMIFTWMPLVFMFMLASFPAGLVIYWAWNNTLSVAQQSVIMKRHG
FT                   VKVELFDNLKGLFRRKTAPSK"
FT   gene            complement(90692..91093)
FT                   /locus_tag="Rleg_0096"
FT   CDS_pept        complement(90692..91093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0096"
FT                   /product="ribonuclease P protein component"
FT                   /note="TIGRFAM: ribonuclease P protein component; PFAM:
FT                   ribonuclease P protein; KEGG: rec:RHECIAT_CH0000479
FT                   ribonuclease P protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54407"
FT                   /db_xref="GOA:C6AZ81"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ81"
FT                   /inference="protein motif:TFAM:TIGR00188"
FT                   /protein_id="ACS54407.1"
FT                   /translation="MAGELTISEKKHTVGRLKSRPQFLAAREGEKRRGGLFLLEVLDRK
FT                   EPDSQARVGFTVTKKHGNAVERNRMRRRLKEAVRLHAGFAMQPGHDYVVVARRDVLDAS
FT                   FQELAAELKSRVETRPKHRRSGDGRPRNV"
FT   gene            complement(91114..91248)
FT                   /locus_tag="Rleg_0097"
FT   CDS_pept        complement(91114..91248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0097"
FT                   /product="ribosomal protein L34"
FT                   /note="TIGRFAM: ribosomal protein L34; PFAM: ribosomal
FT                   protein L34; KEGG: rec:RHECIAT_CH0000480 50S ribosomal
FT                   protein L34"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54408"
FT                   /db_xref="GOA:C6AZ82"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ82"
FT                   /inference="protein motif:TFAM:TIGR01030"
FT                   /protein_id="ACS54408.1"
FT                   /translation="MKRTYQPSKLVRKRRHGFRARMSTKGGRKVIAARRAQGRNRLSA"
FT   gene            91668..93665
FT                   /locus_tag="Rleg_0098"
FT   CDS_pept        91668..93665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0098"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SMART: chemotaxis
FT                   sensory transducer; histidine kinase HAMP region domain
FT                   protein; KEGG: rec:RHECIAT_CH0000481 methyl-accepting
FT                   chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54409"
FT                   /db_xref="GOA:C6AZ83"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ83"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACS54409.1"
FT                   /translation="MKIRGKINLLVCVMGAVALLIGATALSAMHEYSRNLTAYEHAAAR
FT                   AYAGERLNRFVTAVVMEARGIYAAKTIKDTPNFAKGLMADLDEIDKVISGWAPLVPESQ
FT                   KADFAKLVARAAEFRTFRTETVRLGTEVGPEAAGQQGNNDANRANRKAFQAEIDAVVAT
FT                   DKAALETVNAEIESFRSWVLMLVLSITGIGIAVGVGMGFYIGTSHLSRPIKRVTHAIKE
FT                   VADGNFDAEVPFAGRPDEIGEMAAAVAVFKANGLAIKRLNAQEAAMRAKSDDLQSSMSV
FT                   VVAAAAAGDFGHRISKDYEDDNLNQFAGNINMLLSSVDAGIGETRRVIASLAEGDLTQT
FT                   MSGNFQGAFAELQQNVNNTFVTLQATMREVRETTEAMNGNTAELRNASDDLSKRTEQQA
FT                   AALEETSAALDEITAVVQNSTERAHEATIMVSEAKENAGRSGVVVRNAVEAMGRIEQAS
FT                   REISQIINVIDEIAFQTNLLALNAGVEAARAGDAGKGFAVVAQEVRELAQRSATAAKDI
FT                   KALITKSGNEVQVGVKLVQATGEALAEIGTRVIAINDHIHSIATAATEQSTGLKEVNTA
FT                   VNQMDQVTQQNAAMVEETSAATHRLSAEAGGLVRLIARFKLSDDAPAPAALVRNEPHRP
FT                   VASPARRAIAKVARAFGGNAAAAEQSWEEF"
FT   sig_peptide     91668..91751
FT                   /locus_tag="Rleg_0098"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.470 at
FT                   residue 28"
FT   gene            93823..95343
FT                   /locus_tag="Rleg_0099"
FT   CDS_pept        93823..95343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0099"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   HAMP region domain protein; KEGG: rec:RHECIAT_CH0000482
FT                   two-component sensor histidine kinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54410"
FT                   /db_xref="GOA:C6AZ84"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ84"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACS54410.1"
FT                   /translation="MPIQDQGDNPSAESPAAGEAARAPCPSAGLFGGLSGKLLWLTVFF
FT                   IMLAEILIFFPSVASMRVRWLQDRLNTAAAAAIVIDGLQPVELPRALQKETLEATGTKA
FT                   IVLRKDGTSRLLATTDMPTSVDEAYDLTDVPPVTAIRDALDTLVFGGGRMIRVYGPVGD
FT                   TNTGVEVVMKDRPLRRAMFVYSRNVLLLSVLISLFTATLIFFAINRILIGPIRRLTGSM
FT                   QQFSSDPDNPAHIYIGDGGRDELAVAGRNLTSMQMELQKTLKQQKNLAALGLAVSKINH
FT                   DMRNILASAQLMSDRLVDVDDPMVKSFAPKLLRTIDRAVGYTTEVLSYGKASESAPRRR
FT                   HIRLLELTQDVKDMLAIDPQSGIEFAEQIGAELEVDADGEQLFRVIHNLCRNALQALTS
FT                   PGEGGPGSVRRITVSAQRVGSVVSITVDDTGPGMPLKARQNLFAAFRGSARSGGTGLGL
FT                   TIARELVLAHGGTIALVEKPTVGTQFRIEIPDRPVSLEDYRSRAHIEK"
FT   gene            95466..95542
FT                   /locus_tag="Rleg_R0001"
FT                   /note="tRNA-Arg1"
FT   tRNA            95466..95542
FT                   /locus_tag="Rleg_R0001"
FT                   /product="tRNA-Arg"
FT   gene            96024..97955
FT                   /locus_tag="Rleg_0100"
FT   CDS_pept        96024..97955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0100"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54411"
FT                   /db_xref="GOA:C6AZ85"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ85"
FT                   /inference="similar to AA sequence:KEGG:Arad_4537"
FT                   /protein_id="ACS54411.1"
FT                   /translation="MAFVLNTFGRLQLVDGEGSLVAFPEKGLLLLVYLLTTGEGSADRT
FT                   TLARFLWGDADRDVALSTLRKLISRVKARQAELGINILSSQGNMVSLDRKSLSSDLLLS
FT                   ETDEAVASFSLLKHLVKLLNQPFLGPVHCHSREFQQWLAEREKCHIDLLANTLKTVSRR
FT                   AQSRAESELLRKAAIILFRTEPKDPDTLQLLIEIFKAEEEVESLRTYFEQRRNSISRGI
FT                   AVRGASDGADTKPVRPALVPSREKHVTAASLEPEDVSIAIPRLVLLPPRNQSIHPQAGF
FT                   LAASLVEDITIGFCAFNSLQVIAPYSAVQIGHHMETQKAFFERHHVNYILDTRISNAGD
FT                   DVTLFAQLIFFDQNQIVWAERFSLDHRDLVKDRRTVSRRIALSISSEIERHEALREDLN
FT                   PAAYHRYLVGRRHLARLTLPNLRRARKEMKAALSLSPDFAPALSSMARTYSKEWLLTAR
FT                   GDIDLLKTAEILAKQATETRPDFADGYREFGVAKLLQGAFDESAEAMEVAESLAPHYAD
FT                   VIADYADTLVHCSLPAIALRKIERAIELNPLSPDTYFWTAAGANYALGEFEASLDYIGQ
FT                   MADASLADRLAAASWAMLGHQDKARIFVRRFREVNPDFDVDKWLSAVPSKEQWHKDLYR
FT                   EGLKKAGF"
FT   gene            97984..98202
FT                   /locus_tag="Rleg_0101"
FT   CDS_pept        97984..98202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0101"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH03206 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54412"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ86"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH03206"
FT                   /protein_id="ACS54412.1"
FT                   /translation="MARVVVISVEGDDDLWVADLDAGTVVPLPSPKSGGLKAVTDLRAT
FT                   GAIVTKGVNLAVVVKSADAALSGHYDG"
FT   gene            complement(98295..98540)
FT                   /locus_tag="Rleg_0102"
FT   CDS_pept        complement(98295..98540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0102"
FT                   /product="protein of unknown function DUF982"
FT                   /note="PFAM: protein of unknown function DUF982; KEGG:
FT                   rec:RHECIAT_CH0004115 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54413"
FT                   /db_xref="InterPro:IPR010385"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ87"
FT                   /inference="protein motif:PFAM:PF06169"
FT                   /protein_id="ACS54413.1"
FT                   /translation="MQTIWKKPVTLALEGPDQWVVIQTTQAATWALVEDWPTEEGPALD
FT                   RACAVCADVMSGKRNREEARQAFIDAAIEAGIPIKE"
FT   gene            complement(98779..99300)
FT                   /locus_tag="Rleg_0103"
FT   CDS_pept        complement(98779..99300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0103"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_A6246 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54414"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ88"
FT                   /inference="similar to AA sequence:KEGG:Bcep18194_A6246"
FT                   /protein_id="ACS54414.1"
FT                   /translation="MHNAKFIRHAAVSACVAFAAFQAGQVLADSANDKFFDAALCKPPY
FT                   TMTSAMKVYDVVEALAKPDTSSLGAAIYKLPNQIGRDGFKSTEIFFANNAVGVLVEGER
FT                   ADDLAVKYGLKPETSDLLGTSTKGYSRELPADLQPEPGMAGPGKVSIVARQGNALPGKT
FT                   LLACEFVQEF"
FT   sig_peptide     complement(99214..99300)
FT                   /locus_tag="Rleg_0103"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 29"
FT   gene            99506..99688
FT                   /locus_tag="Rleg_0104"
FT   CDS_pept        99506..99688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0104"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: atc:AGR_L_287 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54415"
FT                   /db_xref="GOA:C6AZ89"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ89"
FT                   /inference="similar to AA sequence:KEGG:AGR_L_287"
FT                   /protein_id="ACS54415.1"
FT                   /translation="MIAAYIDEIIMFCAGLWMTSVGFGYLPYPGKPASRPPLIRHFKWM
FT                   GPLLLAIAVVLAAAS"
FT   gene            99716..100012
FT                   /locus_tag="Rleg_0105"
FT   CDS_pept        99716..100012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0105"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54416"
FT                   /db_xref="GOA:C6AZ90"
FT                   /db_xref="InterPro:IPR016190"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ90"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS54416.1"
FT                   /translation="MTDMLACPSCGLDKTESIVHRGFYILRCAACGEAIVATSFMAMRD
FT                   SDHLCSAFIDPGPGKPPPPEMLVARGPLRQIATAISAAANDGTLIRLISEVKD"
FT   gene            complement(100275..100724)
FT                   /locus_tag="Rleg_0106"
FT   CDS_pept        complement(100275..100724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0106"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000509 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54417"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ91"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000509"
FT                   /protein_id="ACS54417.1"
FT                   /translation="MNLGGRSAMRISCMGEKSVAVCVRRLLALISIVLGSAVQAFSCDQ
FT                   PIVISNWSFCALANVSEEGGDADWKVVPAWTREKAISAYFGNDPRLLANHGLCNAKFHH
FT                   VVLCQPGWQTGNPDECSYLVCSGYYSSLVGKEEREDYLRDHPTAQ"
FT   gene            100978..101565
FT                   /locus_tag="Rleg_0107"
FT   CDS_pept        100978..101565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0107"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000510 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54418"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ92"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000510"
FT                   /protein_id="ACS54418.1"
FT                   /translation="MAEFNPRDKSRTSQGKTRAMVRRHTAPPSGMDDGSLRWQWFTIQL
FT                   LESAAFTTLSANACRAFFRIVIEHTSHAALENGKLVVTHPQFVSYGVTGEYVADAIDEL
FT                   EYKGLIKVRRGRAGSGVAHPNRFTLTFVGDHEGAPPTDEWKRCTAERCRKWSETDRKIA
FT                   ADKRGRVGRKKKTPLRNPEIPPLRDSEIRRAS"
FT   gene            complement(101656..102354)
FT                   /locus_tag="Rleg_0108"
FT   CDS_pept        complement(101656..102354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0108"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: bja:blr7575 O-methyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54419"
FT                   /db_xref="GOA:C6AZ93"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ93"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACS54419.1"
FT                   /translation="MASPWVNDALSHAQSAFSGNSNTDILEVGGGSRTHIPLKGARYTV
FT                   VDISKEQLEKNRDAAERILGDAQTIDYGDRHFDACVFWDVLEHLESPRSALLRAHDTLS
FT                   PGGLVFVKGPILNSAKGIFTDLTPWWTHVLFYRYVLRQKNAGKPGYAPFRVEHAAEASH
FT                   SEIAGTLKDLGMDVVFVGEYVSTQVHALKDRIPPLYWLYEAFGLLLRTTSAGKIGGRET
FT                   EFLIVAKCLR"
FT   gene            102554..102874
FT                   /locus_tag="Rleg_0109"
FT   CDS_pept        102554..102874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0109"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000511 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54420"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ94"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000511"
FT                   /protein_id="ACS54420.1"
FT                   /translation="MTVGIFRALAALAMMTALGGCIDHANDPVLLAVGVPVNPPVVAHG
FT                   ICMTDGNAMYDEARKQYQLRAQLTGYAGADELEAETIARAAAHRQYVACLSGQGYRTLY
FT                   AN"
FT   sig_peptide     102554..102631
FT                   /locus_tag="Rleg_0109"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.880) with cleavage site probability 0.792 at
FT                   residue 26"
FT   gene            103066..103437
FT                   /locus_tag="Rleg_0110"
FT   CDS_pept        103066..103437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0110"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000512 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54421"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ95"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000512"
FT                   /protein_id="ACS54421.1"
FT                   /translation="MKMLRLAPSTVALSALLALTSIIPAQAAPAQAVRPPAVSGVKMVQ
FT                   YKPHPGSWHGYQGFRTERPGTRRHSDGYWYPLAAFGVEAGTTGSIVRPPVNRPAAPEMC
FT                   NPTFSGSIGPGSMPCDNGY"
FT   sig_peptide     103066..103149
FT                   /locus_tag="Rleg_0110"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.972 at
FT                   residue 28"
FT   gene            103592..103894
FT                   /locus_tag="Rleg_0111"
FT   CDS_pept        103592..103894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0111"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000513 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54422"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ96"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000513"
FT                   /protein_id="ACS54422.1"
FT                   /translation="MTTTFKNGLMAAAFGTILGLSAFSATAAPLQSSATEQGATTRPVA
FT                   QQETKVEHDRRTTGSIGERASETTGSTHYMMNPKKPLNQDCKLGFNPTSSSSCNY"
FT   sig_peptide     103592..103675
FT                   /locus_tag="Rleg_0111"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.970 at
FT                   residue 28"
FT   gene            104191..104862
FT                   /locus_tag="Rleg_0112"
FT   CDS_pept        104191..104862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0112"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 12; KEGG:
FT                   ret:RHE_CH00448 phospholipid N-methyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54423"
FT                   /db_xref="GOA:C6AZ97"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ97"
FT                   /inference="protein motif:PFAM:PF08242"
FT                   /protein_id="ACS54423.1"
FT                   /translation="MTAKAACSDFLHFFRSWISNPLRVAAIAPSGDSLARIMTSEIAAL
FT                   DGPIIELGPGTGVFTRALLARGVSEADLTLIEYGPEFITSLQARFPTARVLQMDAAHLA
FT                   HADIFEGEPVGAVVSGLPLLSMSPRKIASIMAGAFAYMRPGGAIYQFTYGPRCPVPRPI
FT                   LDRLGLKAVRIGGTVRNLPPASVYRISRRKPLELSRERISYRQSETEIDDVAAFSNETG
FT                   G"
FT   gene            104882..105517
FT                   /locus_tag="Rleg_0113"
FT   CDS_pept        104882..105517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0113"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: transcriptional
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54424"
FT                   /db_xref="GOA:C6AZ98"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR041347"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ98"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACS54424.1"
FT                   /translation="MAENKRTETTEGRRERKRRQTRERIEHAAMSLFLQRGFEGTTIED
FT                   ITEAADVSKRSFFDYFPSKEEVVFAWQDAFADRLMAAVAARPAAESSVAAVEAAITATV
FT                   IAAVDEPGLALGELIHRTPALKARDQLKYARLEQKLAEALLLRKGGDPLERPRMRVLAA
FT                   VVIGALRVGAELWQQRPPGASLEDFAREIFADLWKMLAEFGDEAKTRL"
FT   gene            105825..106706
FT                   /locus_tag="Rleg_0114"
FT   CDS_pept        105825..106706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0114"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG:
FT                   rec:RHECIAT_CH0000515 probable oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54425"
FT                   /db_xref="GOA:C6AZ99"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ99"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ACS54425.1"
FT                   /translation="MSNYNAAKSGTFKIGGNIEINRLGFGAMRVTGKGIWGEPSDHAES
FT                   IRTLKRLPELGVNFIDTADSYGPDVSEWLIKEALHPYGGKSVIATKGGLTRHGPDIWLP
FT                   VGRPEYLIQQAHKSLRNLGVEQIDLWQLHRIDQKVPAKEQFDAIKSLLDTGLIRHAGLS
FT                   EVSVADIEAASKHFKVATVQNRYNLVDRTSEDVLDYCTKHNIGFIPWYPLAAGDLAKPG
FT                   SLLDTIAKKHNAAPSRIALAWVLKRSPVMLPIPGTSKVKHLEENVAAVDIALSDEEFSA
FT                   LDAEGSKVFKAA"
FT   gene            107377..108654
FT                   /locus_tag="Rleg_0115"
FT   CDS_pept        107377..108654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0115"
FT                   /product="protein of unknown function DUF900 hydrolase
FT                   family protein"
FT                   /note="PFAM: protein of unknown function DUF900 hydrolase
FT                   family protein; KEGG: rec:RHECIAT_CH0000517 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54426"
FT                   /db_xref="InterPro:IPR010297"
FT                   /db_xref="InterPro:IPR014586"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZA0"
FT                   /inference="protein motif:PFAM:PF05990"
FT                   /protein_id="ACS54426.1"
FT                   /translation="MIGKRGGLPAALTGLLIATMALAGCGGRPVGVMQAAGTAAPGTSK
FT                   VDLLVATTRAADDNPAVLFSGERGTGLAVNAVDVSIPPEANRKVGQVQWPSRLPADPLR
FT                   DFVTVSVDPLEGERAGETWLKSHMPKSRRVLVFVHGFNNRYEDAVYRFAQIVHDSHADV
FT                   APVVFTWPSRGSIFDYNYDKESTNYSRDALEELLTRTAANPAVSDVTIMAHSMGTWLTV
FT                   EALRQMAIRNGHVASKINNVILASPDLDVDVFGRQFASLGKERPHFTIFVSQDDRALAL
FT                   SRRISGNVDRLGQIDPSVEPYRSKLEAAGITVLDLTKLKGGDRLNHGKFAESPEVVKLI
FT                   GDRLIAGQTITDSNVGLGEAVGAVAMGAAQTAGSAVSVAVSTPIAIFDPRTRRNYDAQL
FT                   KRLGQSMNNTVGSVGDSVGAGLPASQ"
FT   sig_peptide     107377..107448
FT                   /locus_tag="Rleg_0115"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.943 at
FT                   residue 24"
FT   gene            108839..110089
FT                   /locus_tag="Rleg_0116"
FT   CDS_pept        108839..110089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0116"
FT                   /product="D-amino-acid dehydrogenase"
FT                   /EC_number="1.4.99.6"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   ret:RHE_CH00451 D-amino acid dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54427"
FT                   /db_xref="GOA:C6AZA1"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZA1"
FT                   /inference="protein motif:PRIAM:1.4.99.1"
FT                   /protein_id="ACS54427.1"
FT                   /translation="MADETKKTVAVVGAGVIGASIAFELQRRGFDVTLIDKGEPGRGTS
FT                   FGNMASIALDFAAGSGPSTWKKIPGWLLDPEGPVWLRPSYAARMLPWFLRFLAAGRPSR
FT                   LREIEDAGMRLSNRALGDFRQMLQAIGAPELMTEEGCLAIYETEAEFAADRGHLAMMQR
FT                   YGLEFEVLSNGAIQHYEPTLSPAIAKAVLLPDNKSIRDPYKLVVKLADAAKAAGTTFVS
FT                   GTVRNIERRGDGTAVVLLEDGRRIEAGSVVLAAGVHTRFLAEKLGEPIPLETERGYHTQ
FT                   IMKPGIAMRYSVIWPHRAFMVTPTAGGIRVGGNVELAGLDAAPDFRRPRVLVRHAQRAL
FT                   PGLKVEETTEWMGHRPALPDTIPIISPSSKLPGVFYATGHGHLGLTFSATTALVIADMV
FT                   TGLKPSLDMTPFRIDRY"
FT   gene            110099..110809
FT                   /locus_tag="Rleg_0117"
FT   CDS_pept        110099..110809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0117"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54428"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZA2"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACS54428.1"
FT                   /translation="MSDTAKPVALITGGGRGMGEAIARELSAQGYRLALMSPSESCEKL
FT                   AAELGGVASRGVAEKAEDLKAIFDLTMKTYGRIDAVVNLSGHPPKGDLLDISDENWTLG
FT                   SDMMILSLVRMARLVTPVMLKQGKGAFVNITTFAAYEPTLVFPVSCTYRAAAGAFTKLY
FT                   SDRYAADNIRMNCILPGYIDSLNHKPETAEKVPMKRIGHVEEIAKTAAFLLSDGAGYIT
FT                   GQNIRVDGGVTRHV"
FT   gene            110825..111862
FT                   /locus_tag="Rleg_0118"
FT   CDS_pept        110825..111862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0118"
FT                   /product="Proline racemase"
FT                   /EC_number="5.1.1.4"
FT                   /note="PFAM: proline racemase; KEGG: ret:RHE_CH00452
FT                   proline racemase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54429"
FT                   /db_xref="GOA:C6AZA3"
FT                   /db_xref="InterPro:IPR008794"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZA3"
FT                   /inference="protein motif:PRIAM:5.1.1.4"
FT                   /protein_id="ACS54429.1"
FT                   /translation="MRWKRTIQLLDVHAEGEIGRVAIGGVPKIPGETIAAQLHWLNTDP
FT                   KGDELRRFLCLEPRGAPIGSVNLLLPARHPEADAAFIILQPDQAHASSGSNSICVTTAL
FT                   LESGIVEMKEPETIVTLETAAGLVKATATCRDGRCEKVKLTMVPSFVHELDVAIDTPHW
FT                   GRIKADISYGGIFYALVDVGQIGLTIEKANAAGLVQAGMILKELINRDIKVVHPEIPAI
FT                   SGVAYVMFRDTEADGTVRTCTTMWPGRADRSPCGTGNSANLATLYARGKAKVGDTFTSK
FT                   SIIGSEFEVGLQAVTEVAGRPAVIPTITGRGFTFGLTQVALDPFDPHPNGFALTDVWGP
FT                   SAGEI"
FT   gene            111968..113086
FT                   /locus_tag="Rleg_0119"
FT   CDS_pept        111968..113086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0119"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   ecd:ECDH10B_2558 IS186/IS421 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54430"
FT                   /db_xref="GOA:C6AZA4"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZA4"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACS54430.1"
FT                   /translation="MKIRPEVLDHWPEVRERLPAGFDLEATARLRGAFTRVREIKNAET
FT                   LLRLALAYGGLGMSLRETCAWAEAGGIARLSDPSLLERLCKAAPWLGDIVAALIAEQAK
FT                   VPTGRFAGYRLRVLDGTSICHPGADRTTWRLHVGYDLATAQVDQLELTDIHGAENLQRL
FT                   TYAPGDIVLADRYYARPRDLRPVIDAGADFIVRTGWNSLRLLQTNGEPFDLFAALAAQQ
FT                   EQEGEVQVRVHEGMTGTPPPPPLALRLIVRRKDPQQAQAEQERLLKAARKHGKKPDPRS
FT                   LEAAKYILLLTSLPATTFPPADILTLYRFRWQIELAFKRFKSLAGLDSLPAKKPELARA
FT                   WLYARLIVAIIAEQIAGQVPDSPPSGCGNPTG"
FT   gene            complement(113470..114153)
FT                   /locus_tag="Rleg_0120"
FT   CDS_pept        complement(113470..114153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0120"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: rpt:Rpal_2059
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54431"
FT                   /db_xref="GOA:C6AZA5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZA5"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACS54431.1"
FT                   /translation="MQKSDETSNVDETPTRGRGRPRAFDREAALAQATRLFWIKGFEAT
FT                   SIADLTEAMGIGSPSLYAAFGSKEALYAEALRHYRDNNEALVWGGFFSAGTAREAVRSF
FT                   LMDSAAALTGCVVDIPRGCMVALSSVGSEGHVELGELVRAARAVTLDRLKLRLNQAISE
FT                   GEIPVSTDVHALARFVQTVQNGMSILARDGATRGELEAVAELAMLGWDTRTGDSERRQT
FT                   YADHA"
FT   gene            114235..114975
FT                   /locus_tag="Rleg_0121"
FT   CDS_pept        114235..114975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0121"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: atc:AGR_pAT_252 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54432"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZA6"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACS54432.1"
FT                   /translation="MTELAGKRALVTGGSRGIGAAIALALADKGADVAITYERSADRAA
FT                   EVVRAIEGKGRKALAIQADSADPAAVKRSVDEAAQALGGLDILVNNAAIALYGAIADVS
FT                   VEQIDALLDVNVRSPLLASQAAIPYLQAGGRVITIGSVGAERIVGDTGTVYYMTKSALH
FT                   SFTRGLARELGSRDITVNLVQPGSTDTDMNPADGDFADFQRALIPLGRYGEPEDVAAAV
FT                   AFLASPAARHITGTILTVDGGLNT"
FT   gene            complement(115478..117025)
FT                   /locus_tag="Rleg_0122"
FT   CDS_pept        complement(115478..117025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0122"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="KEGG: rec:RHECIAT_CH0000527 putative sensory
FT                   box/GGDEF family protein; TIGRFAM: diguanylate cyclase;
FT                   PFAM: EAL domain protein; GGDEF domain containing protein;
FT                   SMART: EAL domain protein; GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54433"
FT                   /db_xref="GOA:C6AZA7"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZA7"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACS54433.1"
FT                   /translation="MPRSQPTRPQIEIVAWLAIFLLLFCLSWLFQWHEGLDEFIEKHHD
FT                   YPLDHALLALNISGFLGLIYSALRIRDLSREVHRRLQAEKNVDWIACHDTLTELPNRRF
FT                   LDSICAQAMSDQRAQETYAVFSIDLDGFKKVNDLLGHDHGDAVLKTVAQRLSSLFPRER
FT                   VFRLGGDEFVVLARRTGNPDLVALGNRIVTVIGKPFTFNGVAVDLGASVGFALFPENGD
FT                   DLGQVIRHSDCAMYVAKKQGRNLVKPFVPSMQDELAKRVRLEADLRAAIKKAEIVPYYQ
FT                   PLVDLKTNRIIGFEALARWKTASGEFIPPNEFIPVAEEAGLIVELTDQLLRHACADALS
FT                   WPNELVLSFNLSPIQLSDRLLGLRILKILGDVGLPAHRVELEVTESAIIQDAVTARIVL
FT                   DDLVNAGVRIALDDFGTGYSSLSQLSNYRFDKIKIDRSFVSSFETNDKQDKVIKAIIAL
FT                   GAGLGVTITAEGIEEESQLQRLQDLGCDIGQGYLLGRPAPAAELATDHVSTRILQRG"
FT   gene            complement(117457..118131)
FT                   /locus_tag="Rleg_0123"
FT   CDS_pept        complement(117457..118131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0123"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: smd:Smed_4441 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54434"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZA8"
FT                   /inference="similar to AA sequence:KEGG:Smed_4441"
FT                   /protein_id="ACS54434.1"
FT                   /translation="MAPDMSTVPRRSTTGLRKFLDPEQQRDWVEGEADLIDAEERSESL
FT                   EQRFKYVARYEKLLRRPQAQDVLEILRVYGQTCIPIPRKTERHYWSVSCLPSTSDKPLI
FT                   RVNASWMELFTLYADGEGLRARFLVHLSHFTTDHSPAQGDVDEPFLEDCVTTPEDVGYF
FT                   FPRGEDIFGITVRGSASIRKFLAERRILRAIRTFNVTHMNRGRNAYQASHCYSLADTML
FT                   AD"
FT   gene            complement(118384..118860)
FT                   /locus_tag="Rleg_0124"
FT   CDS_pept        complement(118384..118860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0124"
FT                   /product="RbsD or FucU transport"
FT                   /note="PFAM: RbsD or FucU transport; KEGG: ret:RHE_CH00463
FT                   fucose dissimilation pathway protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54435"
FT                   /db_xref="GOA:C6AZA9"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZA9"
FT                   /inference="protein motif:PFAM:PF05025"
FT                   /protein_id="ACS54435.1"
FT                   /translation="MLKGLDPLLSPELLLTLRAMGHGDEIAIVDGNYPGVEHARRLIRL
FT                   DGHHLIPVLNAVLSVLPIDDFVAEAIFRSTVKAERDKLDPVHEEMIDCCARHEPHRQVV
FT                   PLIGQDFYGRVKTAHALIQTGEPRLYANIILRKGVIYPKEPGTHAAAGVDPFVY"
FT   gene            complement(118844..120091)
FT                   /locus_tag="Rleg_0125"
FT   CDS_pept        complement(118844..120091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0125"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG:
FT                   rec:RHECIAT_CH0000535 sugar transcriptional regulator
FT                   protein, ROK family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54436"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZB0"
FT                   /inference="protein motif:PFAM:PF00480"
FT                   /protein_id="ACS54436.1"
FT                   /translation="MSTLDGPEHTPVPPPILNPAGGANQVRVRAYNERLVLSLVRLYGT
FT                   LSKADIARRSGLSAQTVSVIMRVLEKEGLLSRGEPVRGRVGQPSIPMHINPDAVYSFGL
FT                   KMGRRSADLVLMDFVGRIRMQLHRTYAYPLPDEILAFVTSGIRELEDRLDDKQRSRIAG
FT                   LGIAAPFELWNWAEEVGAPPGAMEVWRDVDLQADIAARVSHPVFMQNDATSACGAELVF
FT                   GVGPSYPDFVYFFIGSFIGGGIVLNSAIFSGRTGTAGAIGPLPVRGKNGETMQLLEIAS
FT                   IFVLENMLRERGIDPEPLWYSADGWVDFGEPMEAWIQDSAKALAQAIVAAASIVDFSAA
FT                   VIDGGFPDWVRSRVVQATIDEAAKLDLQGVVMPEIIEGAVGAQARAIGGASLPIFARYL
FT                   TDQNVLFKEVDHAERT"
FT   gene            120320..121339
FT                   /locus_tag="Rleg_0126"
FT   CDS_pept        120320..121339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0126"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: ret:RHE_CH00465 fructose
FT                   ABC transporter, substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54437"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZB1"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ACS54437.1"
FT                   /translation="MKKSVLAFGALALGVTFSAPVMAADVAACLITKTDTNPFFVKMKE
FT                   GATAKAKELGVSLKSYAGKVDGDSESQVAAIESCIADGAKGILIAASDTKGIVSSVKKA
FT                   RDAGLLVIALDTPLEPADAADATFATDNLLAGKLIGQWAKETMGDKAKDAKVGFLDLTP
FT                   SQPTVDVLRDQGFMMGFGIDPKDPNKIGDEDDARIVGHDVTNGNEEGGRKAMENLLQKD
FT                   PSINVIHTINEPAAVGAYQALKAVGMEKNVLIVSVDGGCPGVKSVKEGVIGATSQQYPL
FT                   MMAALGVEAIKKFADSGEKPKPTEGKSFYDTGVSLVTDKPVSGVKSIDTKEGTDKCWG"
FT   sig_peptide     120320..120391
FT                   /locus_tag="Rleg_0126"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            121495..122559
FT                   /locus_tag="Rleg_0127"
FT   CDS_pept        121495..122559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0127"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   rec:RHECIAT_CH0000537 fructose ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54438"
FT                   /db_xref="GOA:C6AZB2"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZB2"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACS54438.1"
FT                   /translation="MTGTQEFERVLDGSDKSVASFEHEKVSLIKRAQHFLHSTPAAVPL
FT                   IVLVLAIVIFGITIGGRFFSSYTLTLILQQIAIVGILGAAQTLVILTAGIDLSIGVIMV
FT                   ISAVIMGNVAITYGIPTPIAVAAGMLVGGLCGLLNGFLVAYMKLPPFIVTLGTWNIVMA
FT                   TNFIYSANETIRDTDVDEKAPLLHLFAVSFKLGSAVLTLGVIAMVLLVLVLWYVLNHTA
FT                   WGRHVYAVGDDPEAAKLSGIQTKKVLLTVYAISGVIAGLAAWVSIGRNGSISPSSAVTD
FT                   FNLQAITATVIGGISLFGGRGSILGTLFGAMIVGVVSMGLNMLGADPQWKVLLTGVLII
FT                   AAVAIDQWIRKVSV"
FT   gene            122562..123344
FT                   /locus_tag="Rleg_0128"
FT   CDS_pept        122562..123344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0128"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rec:RHECIAT_CH0000538 fructose ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54439"
FT                   /db_xref="GOA:C6AZB3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZB3"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS54439.1"
FT                   /translation="MAREPLLTARGLVKRYGRVTALDNADFDLYPGEILAVIGDNGAGK
FT                   SSLIKAISGAVTPDEGVITLEGRQVQFRSPMEARDAGIETVYQNLALSPALSIADNMFL
FT                   GREIRKPGVLGSMFRMLDRPAMEKLARNKLSELGLMTIQNINQAVETLSGGQRQGVAVA
FT                   RAAAFGSKVIIMDEPTAALGVKESRRVLELILDVRARGLPIVLISHNMPHVFEVADRIH
FT                   IHRLGRRLTVIDPKEYTMSDAVAFMTGAKAVPTEPVAA"
FT   gene            123341..123973
FT                   /locus_tag="Rleg_0129"
FT   CDS_pept        123341..123973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0129"
FT                   /product="putative fructose transport system kinase"
FT                   /note="KEGG: ret:RHE_CH00468 putative fructose transport
FT                   system kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54440"
FT                   /db_xref="GOA:C6AZB4"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZB4"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00468"
FT                   /protein_id="ACS54440.1"
FT                   /translation="MNARIDEIAGEVLDRAGHSKRFLVAIAGPPGAGKSTMADNLAEAL
FT                   KAKGESAEVLPMDGFHMDNAILIERGLLARKGIPETFDVRGFLDIIRAVRLADQEVLVP
FT                   VFDRSRELAIASARPVSPDHRFIIVEGNYLLFSLGKWAELEGVFDFSIMLAPPIEVLEE
FT                   RLWARWRGYNLTEEAANAKVYGNDLPNGRLILENRRPADVTLEIALA"
FT   gene            124085..125131
FT                   /locus_tag="Rleg_0130"
FT   CDS_pept        124085..125131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0130"
FT                   /product="dihydroorotase, homodimeric type"
FT                   /EC_number="3.5.2.3"
FT                   /note="KEGG: rec:RHECIAT_CH0000540 dihydroorotase protein;
FT                   TIGRFAM: dihydroorotase, homodimeric type; PFAM:
FT                   amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54441"
FT                   /db_xref="GOA:C6AZB5"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004721"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZB5"
FT                   /inference="protein motif:TFAM:TIGR00856"
FT                   /protein_id="ACS54441.1"
FT                   /translation="MQSITIRRPDDWHLHLRDGAMLEGVIADTSRTFARAIIMPNLVPP
FT                   VVTSADAKAYRERILKALPDGHRFQPLMTLYLTEHTSPDDVEEGKNSGLITAVKLYPAG
FT                   ATTNSHGGVRDMEKAMPVLERMAKIGLPLCVHGEVTTPEVDIFDREAVFIETVLDPLRQ
FT                   RLPELKVTMEHVTTSDGVDYIKTAKGNLAGSITTHHLIINRNAILVGGIRPHYYCLPVA
FT                   KRENHRLALRAAAVSGDARFFLGTDSAPHVDPLKECACGCAGIYTSVNTMSCLAHVFEQ
FT                   EGALERLEAFVSLNGPAWYGLQPNEERITLARQADPVVFPARIETGAGPVTVFDPMFPL
FT                   HWQVVQQA"
FT   gene            125305..126483
FT                   /locus_tag="Rleg_0131"
FT   CDS_pept        125305..126483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0131"
FT                   /product="diguanylate cyclase"
FT                   /note="KEGG: ret:RHE_CH00470 hypothetical protein; TIGRFAM:
FT                   diguanylate cyclase; PFAM: GGDEF domain containing protein;
FT                   SMART: GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54442"
FT                   /db_xref="GOA:C6AZB6"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZB6"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACS54442.1"
FT                   /translation="MMLDYNSLLLALGVSAACLAVTLMGSWLVRRSETVLLTATVGLVL
FT                   VVSGIFVYSAYVDTPETWLGVANFVLFHAGFATIWGAGKQFLTGRVSLPAIAIRALAAM
FT                   VFSVVPMLSGYDGLAFIADNLAIALLLFATARQYWLARAEAPAPLLGITVLYTLTAISF
FT                   VLCAAVLISDGKLVLGKAPSNWAEDLSLAVCIAGMTGIGALSLALHQWRLAARHRLDAI
FT                   TDPLTGLLNRRALFDQYGTRPMGTTTAVIVFDIDHFKSVNDRFGHAAGDRVLNVFSGEL
FT                   SAHCRTGDTAARLGGEEFVLVLKEIMPGRAELTAERIRRAFEAREIHIDDEVLTCTVSV
FT                   GVAPGRSKSLDFDTMLSAADKALYVAKRAGRNRVELASYLKAVPVEATRTAS"
FT   sig_peptide     125305..125382
FT                   /locus_tag="Rleg_0131"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.691 at
FT                   residue 26"
FT   gene            126674..127210
FT                   /locus_tag="Rleg_0132"
FT   CDS_pept        126674..127210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0132"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: rec:RHECIAT_CH0000542 putative
FT                   glyoxalase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54443"
FT                   /db_xref="GOA:C6AZB7"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZB7"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACS54443.1"
FT                   /translation="MRDFRDAKLMAKTLRQALADRDISLTHSETLEIVARQFGLDQWNI
FT                   LSAKIDAAGANPSAIGIEPPMPIFRIFSVEKAMEFYCGFLGFHLDWEHRFGENFPLYCQ
FT                   VSRDGMALHLSEHSGDASPGAKAFVRVANIRAYHAELSGKDYRYMKPGVEQAPWGLEMT
FT                   VIDPFSNRIAFCEQK"
FT   gene            complement(127443..128390)
FT                   /locus_tag="Rleg_0133"
FT   CDS_pept        complement(127443..128390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0133"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   transposase IS111A/IS1328/IS1533; KEGG: hne:HNE_3446
FT                   ISHne3, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54444"
FT                   /db_xref="GOA:C6AZB8"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZB8"
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /protein_id="ACS54444.1"
FT                   /translation="MHIQQSFMVGIDVSKAHLDVAVEGKRAVVRFDNNAPGCAALTAAV
FT                   AGAELVVVEATGGYEMAIVRTLMAAGIAVAVVNPRQVRDFARASGRLAKTDQVDARVTL
FT                   HFARAMRPAQIPHIDDGRIALAALVTRRRQLIDMAVAEKNRLEHAPEAVAALIGETLAA
FT                   LRAQLARVDAAIALAIEAEPDMAARRNLLLTVPGIGEVSAAVLIAELPELGAIDDKKLA
FT                   ALVGVAPIAHDSGTWRGQRHIAGGRATVRCALYMATLSAIRCNPAIKTFHKRLRDAGKP
FT                   PKVAIVAAMRKLIIMINTILKRRTPWNQPQQHGC"
FT   gene            complement(128895..129524)
FT                   /locus_tag="Rleg_0134"
FT   CDS_pept        complement(128895..129524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0134"
FT                   /product="Glutathione S-transferase domain protein"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   mlo:mlr2042 glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54445"
FT                   /db_xref="GOA:C6AZB9"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZB9"
FT                   /inference="protein motif:PFAM:PF00043"
FT                   /protein_id="ACS54445.1"
FT                   /translation="MFTLHDYLPSQNGWKVRVLLGLLDMPYHSRIVSIFEGENRTETFL
FT                   ELNPVGAIPVLELDDGRAIAESNAILTFLAEGTRFLPSDHYLRAKVMQWLFFEQYHVEP
FT                   VIGSLRFWTLTGRLERNQSMVAGKREAAARALAAIDRRLTDSLFLVGQQLTIADIAVYA
FT                   YSHRAEDCGFSLAAYPTFSAWSGRVRDAIGADHPVYPYSMDPHSAG"
FT   gene            complement(129622..130104)
FT                   /locus_tag="Rleg_0135"
FT   CDS_pept        complement(129622..130104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0135"
FT                   /product="conserved hypothetical conserved membrane
FT                   protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000543 hypothetical conserved
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54446"
FT                   /db_xref="GOA:C6AZC0"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZC0"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000543"
FT                   /protein_id="ACS54446.1"
FT                   /translation="MQIFLTLFLVAAAIGSGLVAGIFFAFSTFIMTAFSRIPAEQGIAA
FT                   MNSINVTIVRSPFMGLFVPTAILCLVIAVLALIDWRGGASFLMLAGAALYIFASFLSTI
FT                   IFNVPMNDALAKVGGNGPEAVQLWATYVRDWTRWNHVRTIASLLASVAFVRALMIV"
FT   sig_peptide     complement(129997..130104)
FT                   /locus_tag="Rleg_0135"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.835 at
FT                   residue 36"
FT   gene            complement(130107..130931)
FT                   /locus_tag="Rleg_0136"
FT   CDS_pept        complement(130107..130931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0136"
FT                   /product="NmrA family protein"
FT                   /note="PFAM: NmrA family protein; dTDP-4-dehydrorhamnose
FT                   reductase; KEGG: rpd:RPD_2341 NmrA-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54447"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZC1"
FT                   /inference="protein motif:PFAM:PF05368"
FT                   /protein_id="ACS54447.1"
FT                   /translation="MQTSEIVLVGGSGKTGSRIIKRLEARGLTVRAASRSSARPFDWED
FT                   RSTWRGALEGASSAYVAFQPDLSVAWAAEAIEALARVAVECGLEHIVLLSGRGEEGAQR
FT                   SEAALKASGINTTILRASWFCQNFSEGAFVEQIIGGRLQLPAGEISEPFIDADDIADAA
FT                   VAALTDPGHRNKTYELTGPRALTFRQAVAEIAQAAGRPIEYEQVSMADFTGGLADAGLP
FT                   QGLIDLLEELFSQVLDGRNSGTMGGVAEILGRPATDFSECARRTAATGLWSA"
FT   gene            131033..131686
FT                   /locus_tag="Rleg_0137"
FT   CDS_pept        131033..131686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0137"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: ret:RHE_CH00473
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54448"
FT                   /db_xref="GOA:C6AZC2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041674"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZC2"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACS54448.1"
FT                   /translation="MSEQPVATRRRQQESTGQLRRIPSQQRGRERFEKILTVAAELIES
FT                   HGSDGLKMSEIVEKAGLSFGALYQYFPDKTSIIRTLAERFNEEGRRCVEEELAKVTDAA
FT                   ALQGALANIVDEYYAFFRREPVMRDIWHATHTDKLLQQVDAVDMEFHAQAFLAVLIRLW
FT                   PDRDRRELLVIARLTMQLLAAAVRYAVSLDAEEGAQAIALFKKMQIVDIGSLLQ"
FT   gene            131759..132448
FT                   /locus_tag="Rleg_0138"
FT   CDS_pept        131759..132448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0138"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="KEGG: ret:RHE_CH00474 orotate
FT                   phosphoribosyltransferase; TIGRFAM: orotate
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54449"
FT                   /db_xref="GOA:C6AZC3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZC3"
FT                   /inference="protein motif:TFAM:TIGR00336"
FT                   /protein_id="ACS54449.1"
FT                   /translation="MIQTTFPDRAVMAELLAKMLWEIKAVHFNAAQPYKLSSGMASPVY
FT                   IDCRKLLSFPRIRSTVMDFAASILLRDAGFEQFDCIAGGETAGIPFAALLADRLGLPMI
FT                   YVRKQPKGHGRNAQIEGNMPEGSRVLVIEDLTTAGGSMFKFIDAVRAAGGIVDHGIALF
FT                   FYGIFGEQRFADGKVRLHHIATWRNVLAVAKEQKLFDDKTLSEVEAFLDAPLAWSGRNG
FT                   GVSELSL"
FT   gene            132510..133436
FT                   /locus_tag="Rleg_0139"
FT   CDS_pept        132510..133436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0139"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG:
FT                   rec:RHECIAT_CH0000546 fructokinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54450"
FT                   /db_xref="GOA:C6AZC4"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZC4"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ACS54450.1"
FT                   /translation="MILCCGEALIDMLPRDTTLGEKGFAPYAGGAIFNTAIALGRLGIP
FT                   TAFFTGIADDMMGEILLETLKASNVDYSPCAITPHPSTIAFVKLVNGQATYAFYDEGTA
FT                   GRMITTADLPDLGDDCEALHFGAISLIPSPCGETYEALLDREAARRVISLDPNIRPGFI
FT                   KDKPSHMARIKRMAAKADIVKFSDEDLEWFGLQGDHDALAAHWLNHGAKLVVITKGAEG
FT                   ASGYTKERKVTVPSERVTVVDTVGAGDTFDAGILASLKMDNLLTKRQVASLDEQALRNA
FT                   LTLGAKAAAVTVSRAGANPPWAREIGL"
FT   gene            complement(133611..134018)
FT                   /locus_tag="Rleg_0140"
FT   CDS_pept        complement(133611..134018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0140"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; Helix-turn-helix type
FT                   11 domain protein; SMART: regulatory protein ArsR; KEGG:
FT                   ret:RHE_CH00427 ArsR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54451"
FT                   /db_xref="GOA:C6AZC5"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZC5"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ACS54451.1"
FT                   /translation="MMQQARRPDLDEETFDDAVEGRSVSAAQRVFHALSSAPRRKILAY
FT                   LSASGLTAGEIADRFSMSKPAVSQHLSILEAAGLIRREKQGQFVHYSLIENNLVNTLNG
FT                   FVQEVCPVGRPIKKESQARTRGGLVPAKPAK"
FT   gene            134161..135123
FT                   /locus_tag="Rleg_0141"
FT   CDS_pept        134161..135123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0141"
FT                   /product="fatty acid desaturase"
FT                   /note="PFAM: fatty acid desaturase; KEGG: ret:RHE_CH00426
FT                   fatty acid desaturase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54452"
FT                   /db_xref="GOA:C6AZC6"
FT                   /db_xref="InterPro:IPR015876"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZC6"
FT                   /inference="protein motif:PFAM:PF00487"
FT                   /protein_id="ACS54452.1"
FT                   /translation="MSSISTGRMIDNSSDAVKGRVVWMPAKSIWITAMTLIAVIGGPLT
FT                   FTWSAFAVFILLTAITICLGHSVGMHRLLIHRSFSTHTWIEHFLVYLGTVVGMAGPFGM
FT                   IYAHDIRDWAQRQRDCHDLYAHRRSFFIDAFWQMHCIVALDHPPRFVLEERERRDRFYR
FT                   FLEATWMAQQIPLGLALFALGGLPWVVWGIAVRISVSLTGHWLVGHFAHRDGHQGWSVD
FT                   DVAVQGYNLPRFGLVTFGESFHGNHHAFPDSARLGIEPGQLDLGWYFIGLLARLGLASA
FT                   IKLPHTIVPRRGLRRVNATETAGDSHPPHHAAGHAESRP"
FT   gene            complement(135199..136614)
FT                   /locus_tag="Rleg_0142"
FT   CDS_pept        complement(135199..136614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0142"
FT                   /product="alpha,alpha-trehalose-phosphate synthase
FT                   (UDP-forming)"
FT                   /EC_number="2.4.1.15"
FT                   /note="KEGG: ret:RHE_CH00476 trehalose-6-phosphate synthase
FT                   protein; TIGRFAM: alpha,alpha-trehalose-phosphate synthase
FT                   [UDP-forming]; PFAM: glycosyl transferase family 20"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54453"
FT                   /db_xref="GOA:C6AZC7"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="InterPro:IPR012766"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZC7"
FT                   /inference="protein motif:TFAM:TIGR02400"
FT                   /protein_id="ACS54453.1"
FT                   /translation="MSRLVVVSNRVPMPAKDGSAAAGGLAVALQAALQERGGIWMGWSG
FT                   ESSGDREPGPLSQLQKGNITYALTDLTDTDVEEYYRGFANRVLWPICHYRLDLAEYGRK
FT                   EMAGYFRVNRFFAHRLAPMIEPDDIIWVHDYHLIPLAAELRQMGLKNRIGFFLHIPWPP
FT                   ADILVTMPVHEEIMRGLSHYDLVGFQTDYDLQNFAGYLRREGIGDDLGNGLFDSHGRIF
FT                   KAGAYPIGIETAAFAEFAERAANNIMVQKTRRSVEGRDMIIGVDRLDYSKGIIQRLEAF
FT                   ETFLTSNPAYQNKVTYLQVTPKSRSEVPEYEHMQGMVAEQAGRVNGAIGTVDWVPIRYV
FT                   NRSISRNVLAGLYRLATIGLVTPLRDGMNLVAKEYVAAQDPDRPGVLVLSRFAGAAREL
FT                   KGALLVNPYDVEGTANAIAKGLAMSLEERRDRWSMMMEHLLTHDVSLWCENFLGDLVLA
FT                   PELRPERDSRIGS"
FT   gene            complement(137195..138820)
FT                   /locus_tag="Rleg_0143"
FT   CDS_pept        complement(137195..138820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0143"
FT                   /product="Glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /note="PFAM: phosphoglucose isomerase (PGI); KEGG:
FT                   rec:RHECIAT_CH0000548 glucose-6-phosphate isomerase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54454"
FT                   /db_xref="GOA:C6AZC8"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZC8"
FT                   /inference="protein motif:PRIAM:5.3.1.9"
FT                   /protein_id="ACS54454.1"
FT                   /translation="MNAIVEQLKSTADATKATDIRAAFATDSQRFSRFSVALDDLLMDF
FT                   SKTAVNDDILKLLVKLAEDGGVETKREEMFSGKAINFTEDRAVLHTALRNRSNTPVLVD
FT                   GKDVMPDVNAVLAAMGKFADDVRSGTLKGATGKAITDVINIGIGGSDLGPVMATLALAP
FT                   FHDGPRAHFVSNIDGAHIADILKLVQPETTLFIVASKTFTTVETMTNAQTARNFIAKAL
FT                   GEAAVQHHFAAVSTALDKVAAFGIDSARVFGFWDWVGGRYSIWSAIGLPLMIAVGPENF
FT                   GKFLDGAHAVDNHFRKAPITENLPVLLGLIGFYHRNVLGYPTRAILPYDQRLSRFPAYL
FT                   QQLDMESNGKGVTIDGTPVEGNSGPVVWGEPGTNGQHAFYQLIHQGTSIIPAEFMIAAN
FT                   AFEPELRHQHQLLISNVLAQSEALMKGRTFAEAKKQLTDKGMDDKKADFIAPHRVFTGN
FT                   RPSITFVYDKLTPYALGRLIALYEHRVFVEGVLFRINSFDQWGVELGKELATGLLPVVE
FT                   GKESAAAHDSSTQGLVAALAKLAK"
FT   gene            complement(138972..140672)
FT                   /locus_tag="Rleg_0144"
FT   CDS_pept        complement(138972..140672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0144"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   rec:RHECIAT_CH0000549 long-chain-fatty-acid-CoA ligase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54455"
FT                   /db_xref="GOA:C6AZC9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZC9"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACS54455.1"
FT                   /translation="MNSISVHPNGAKPDKPWLAAYPDIVPAEIPPLEYVSLAELLEKSC
FT                   ARYADRTAFSSMGKGMRYRELESQTRKLAAWLQSTGLQKGDRVAVMMPNVLQNPIATYA
FT                   ILRAGLVVVNVNPLYTPRELEHQLKDSGAKAIFVLENFARTVEQVLNKTDLRHVVVTSL
FT                   GEMLGPKGLIVNFVVRKVKKLVPSWSIPQHKSFGQVLSEGAGKKLQPVALTGSDIAFLQ
FT                   YTGGTTGVAKGAMLTHQNLLANKAQLSLWLRSAFERKKEPEVLNFLCALPLYHIFALTV
FT                   NSLMGMSLGAHNILIANPRDIPGLVKEFEKSKVHIFPGLNTLFNALMNNADFAKLDFSS
FT                   LIMSLGGGMAVQRPVADRWLKMTGTAVTEGYGLSETSPVATANRFDSPEFTGTIGLPLP
FT                   STELDIRDEAGNSLPLGDVGEICIRGPQVMAGYWQKPEETARVMTDDGYFRSGDMGFMD
FT                   DRGYTKIVDRKKDMILVSGFNVYPNEIEEVAAMHAGILEAAAIGVPDGHSGEAVKLFVV
FT                   RKDPNLTEAEVKAHCIANLTNYKRPRFIEFRTELPKSPVGKILRKDLRG"
FT   gene            140918..141310
FT                   /locus_tag="Rleg_0145"
FT   CDS_pept        140918..141310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0145"
FT                   /product="PRC-barrel domain protein"
FT                   /note="PFAM: PRC-barrel domain protein; KEGG:
FT                   rec:RHECIAT_CH0000550 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54456"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZD0"
FT                   /inference="protein motif:PFAM:PF05239"
FT                   /protein_id="ACS54456.1"
FT                   /translation="MLNQDTDATRRDPNAKVTHSLIASDRVEGTRVYGADGRHIGSIER
FT                   LIIGKLDGRVAYAVLSFGGFLGIGHDHYPLPWEKLNYDTQLDGYRIDLTKEQIEGAPSY
FT                   SDDDDTWYNDNGRRVYDYYGVPPYWM"
FT   gene            complement(141530..143983)
FT                   /locus_tag="Rleg_0146"
FT   CDS_pept        complement(141530..143983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0146"
FT                   /product="glycoside hydrolase family 2 sugar binding"
FT                   /note="PFAM: glycoside hydrolase family 2 sugar binding;
FT                   KEGG: rec:RHECIAT_CH0000551 beta-mannosidase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54457"
FT                   /db_xref="GOA:C6AZD1"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZD1"
FT                   /inference="protein motif:PFAM:PF02837"
FT                   /protein_id="ACS54457.1"
FT                   /translation="MIEKTALNSGWTLSCNDTVRLGLPAAIPATVPGCVHLDLLANRLI
FT                   PDPYIDVNEITNDWIGKTDWTYRCSFEAMPDDARVQELVFDGLDTVAVISLNGEEIGCT
FT                   FNMHRTYRFDVSRLLKAGQNELTVTFRSAYAYGAEMEKHYGYRPNNYPGPGNLMRKMAC
FT                   NFGWDWGPTLVTAGLWKPVRLESWDRARLAETRVSAILSGGDGLVKVHARLARHGDKTP
FT                   LRLVAEIGGVSKTVAIAPDEDAVSFELALPSPQLWWPHHLGAQPLYPMTLRLFDEASDD
FT                   LLDSYQRELGFRSLRLDTAADDHGSAFTFIINDVPLFICGANWIPDDCFPPRLTAERYA
FT                   ARIEEAKAANIHMLRVWGGGIFEADEFYETCDRKGMLVWQDFLFACAAYPEEEPLRSEV
FT                   EAEVRDNVVRLMPHASLVLWNGNNENIWGFDEWGWRPIIKAGESWGLGYYLDLLPKLCA
FT                   ELDPDRPYYPGSPYSGSMEIEPNANGHGCKHIWDVWNDVGYEVYRNYIPRFCSEFGWQA
FT                   PAAWATIEESVHDAPLTPQSNGVFHHQKATEGNDKLIRGLSGHLPEPKTMDDWHFATQL
FT                   NQARAIRFGVEHMRSHRNICKGSVVWQFNDCWPVTSWAALDSAGRRKPLWYALKTAYDP
FT                   RLLTIQPRGGGLAAVAVNERTLFWRAKISGKRLKLDGTVLAEFEFWRLLCDRFEAKEFP
FT                   LPEEIVTPDLPKDEVIVVQMLDRRAFHYFVEDIELALPAPRLTVDVTSIEGGYGVKVTA
FT                   QNFLKDLCLMADRLDPDAVVDSMLVTLLPGESHVFVVKTTKAIGADDIVFGTVLRSAND
FT                   LTAGR"
FT   gene            complement(144065..144460)
FT                   /locus_tag="Rleg_0147"
FT   CDS_pept        complement(144065..144460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0147"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: ret:RHE_CH00481
FT                   lactoylglutathione lyase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54458"
FT                   /db_xref="GOA:C6AZD2"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZD2"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACS54458.1"
FT                   /translation="MAKMIHSMIRVLDEARSVEFYERAFGLSVADRVDFETFTLIYISN
FT                   AETGFELELTVNKGRTAPYDLGNAYGHLAVSVEEVAVERERLSKLGLKPGELVELNRDG
FT                   KLFGLFFFISDPDGYKIEVLQRHGRFL"
FT   gene            complement(144509..145258)
FT                   /locus_tag="Rleg_0148"
FT   CDS_pept        complement(144509..145258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0148"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rec:RHECIAT_CH0000553
FT                   probable proline/glycine betaine ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54459"
FT                   /db_xref="GOA:C6AZD3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZD3"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS54459.1"
FT                   /translation="MKLVVANLFRLAALALLLILLFRTEWLSFMLVPLTSNNAPAVYRQ
FT                   NSLASLAAGHLQLVIGSIVCSAVLAVVGGIFVTRESGADFLPLSRAIANAGQTFPPVAV
FT                   LALAVPATGFGAMPTLIALFLYGLLPIFENTVAGLKQVSPQVLDAADGMGMNGTQRLLR
FT                   VELPLALPLILEGLKVATVINIGTATIGSTVAAKGLGEVIIAGLISDNTAFILQGGLIV
FT                   GLMAVLIYDAMGLIEGAITRRIGLRAA"
FT   gene            complement(145255..146199)
FT                   /locus_tag="Rleg_0149"
FT   CDS_pept        complement(145255..146199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0149"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rec:RHECIAT_CH0000554 probable proline/glycine
FT                   betaine ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54460"
FT                   /db_xref="GOA:C6AZD4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZD4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS54460.1"
FT                   /translation="MTMIEIRNVTKRYGAATVVDDVSMSVEKGEITVIVGTSGSGKSTL
FT                   MRMINRLVPITEGEIFVGGQNVMDVPVTELRRKIGYAIQGHGLFPHRTVAQNIATVPQL
FT                   LDWDSARIAKRVEELLGLFNLDPATFADKYPHQLSGGQQQRVGVARALAAEPELLLMDE
FT                   PFGALDPVIRGKAQDDLLAIQKQFGTTVILVTHDMDEAFHLGNQIAVMSEGRLLQCSTP
FT                   EKILTEPADPFVQQLTGTSDRALKLMSLLPLKESMEPAKNGLAYALPQSLSLRDALAEM
FT                   IWQGVDEAAVQDGEKAPVGSISMTRLLELGRKA"
FT   gene            complement(146196..147362)
FT                   /locus_tag="Rleg_0150"
FT   CDS_pept        complement(146196..147362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0150"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rec:RHECIAT_CH0000555
FT                   probable proline/glycine betaine ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54461"
FT                   /db_xref="GOA:C6AZD5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZD5"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS54461.1"
FT                   /translation="MAETLAVRRLDRLGVVLVAGGIAATALMPFIYVKANRIAAGKPML
FT                   LLQLLPQPSVVILTVLLLLTAFATLFLRHAIARLAIATLCLAALIVAIGLVSAAATPPG
FT                   STVARMTPGGGFWVLFAVIGLVISDALVKIRLAPWMRIAALAAYTALLFISLSSGLLDS
FT                   LSIMKEFSTRAPQFETEAISHLLLAFGSLAIAVVLGLPLGILCFWVPKLRAIVLQGLSL
FT                   IQTIPSLALFGLLMLPLGYLATHVPLAAAIGIRGIGTAPALIALVLYSLLPIVANTVVG
FT                   LQGVDPSVRDAAAGMGLTRWQILVGIDMPLAFPVILTGIRIVLVQAIGMVTIAALIGGG
FT                   GFGIFIFQGLGQTAMDLVLLGAVPTVFFAFSSAVILDAVIESIRGSAA"
FT   gene            complement(147453..148361)
FT                   /locus_tag="Rleg_0151"
FT   CDS_pept        complement(147453..148361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0151"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system; KEGG: ret:RHE_CH00485 glycine
FT                   betaine ABC transporter, substrate binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54462"
FT                   /db_xref="GOA:C6AZD6"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZD6"
FT                   /inference="protein motif:PFAM:PF04069"
FT                   /protein_id="ACS54462.1"
FT                   /translation="MLKKLALAVSLSAFAVGAAHAADVVVSSKIDTEGTLLGNVIALAL
FT                   EANGIKTQDRIALGATPVVRKAITAGEIDIYPEYTGNAGFFFNKADDAAWKNIDQGYEL
FT                   AKKLDYDANKIVWLTPSPANNTWALAVRSDVAGPNKLKSLTDFGKWVAGGGAAKLAASA
FT                   EFVNSAGALPAFQTTYGFQLKPDQMVVLSGGDTAATIKAAADQTNGVNTAMVYGTDGAI
FT                   EAAELTVLEDDKNVQQVYAPTPIIREEVLKANPKIEEVLSPIFKSLTADELRKLNAKIQ
FT                   VDGEPAKSVAEAYLKEKGFLK"
FT   sig_peptide     complement(148296..148361)
FT                   /locus_tag="Rleg_0151"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            148783..150003
FT                   /locus_tag="Rleg_0152"
FT   CDS_pept        148783..150003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0152"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: rec:RHECIAT_CH0000558 probable transcriptional
FT                   regulator protein, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54463"
FT                   /db_xref="GOA:C6AZD7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZD7"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACS54463.1"
FT                   /translation="MHLGALFIASHVLTSGSVRETARRFHLSPSTVSTAIHNLETELAM
FT                   TLTERASGELAMLIASGRVLEGLKPIMAAIGELGQWAGHDGDGAEIDEVWASRIPVKIV
FT                   TMERFLEVADQGSINRAARRLRLGQPQLSLQLANLEKFLTHRLFERQAQGSVLTEEGRR
FT                   AYQIFMAISQAWNDLKSSADERYRRTARSLRIGSIIPTGSESWVARCLGSLVSEWNARR
FT                   NNNAISLVSMTADDLREALKNGRIDVAILDSVFGLESFRHRELLQTDMVVIAPPDSTET
FT                   SVADLVAGHPICMPSPRTGLGHAAMAFSYERAPNRRRRGQDITAADSLPVIVDLVANHG
FT                   YVSFLGRVSAMPIADKVRIVDLDEHLPMSYHVAFNHRKAAADACTMIIEAAARITSEAV
FT                   VRTAAVA"
FT   gene            150032..150757
FT                   /locus_tag="Rleg_0153"
FT   CDS_pept        150032..150757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0153"
FT                   /product="CutC family protein"
FT                   /note="PFAM: CutC family protein; KEGG:
FT                   rec:RHECIAT_CH0000559 copper homeostasis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54464"
FT                   /db_xref="GOA:C6AZD8"
FT                   /db_xref="InterPro:IPR005627"
FT                   /db_xref="InterPro:IPR023648"
FT                   /db_xref="InterPro:IPR036822"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZD8"
FT                   /inference="protein motif:PFAM:PF03932"
FT                   /protein_id="ACS54464.1"
FT                   /translation="MTILLEVCVDSAEGLAAAIEGGAGRIELCSALELGGLTPLPSLMR
FT                   IAARAPIPVYAMIRPHAGPFIFDGADEEAMMIDIDAVRAAGLAGVVIGANRPDGTLDMP
FT                   LVHRLKAHAAGLGSTLHRAFDLVPDADQALEQAVELGCERILTSGCALKAVDGLDTLKR
FT                   ISAKAAGRIAIMPGSGIRPTNVGEILKATGAREVHGSCSSPVESADPRAVAFGFEARST
FT                   NKTDVAVVRQMRRAIEAGV"
FT   gene            complement(150992..152011)
FT                   /locus_tag="Rleg_0154"
FT   CDS_pept        complement(150992..152011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0154"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   Alcohol dehydrogenase zinc-binding domain protein; KEGG:
FT                   rec:RHECIAT_CH0000560 probable Zn-dependent alcohol
FT                   dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54465"
FT                   /db_xref="GOA:C6AZD9"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZD9"
FT                   /inference="protein motif:PFAM:PF08240"
FT                   /protein_id="ACS54465.1"
FT                   /translation="MKAVLCREPGVLDIVERPSPAAPAAGWVRLAVSHVGICGTDYHIF
FT                   EGKHPFLEYPRVMGHEISATVLEAGDGVTIAVGTPVIVNPYLSCGQCIACRQGKPNCCT
FT                   NIKVLGVHTDGAFCEEISVPAENLYAAKGVSLEAAATTEFLAIGAHAVRRSMTGAGARA
FT                   LVIGAGPIGLGAAIFSRIAGHEVTLLDTSTERLQMASERFGFTSGIVANEATAETVREK
FT                   TNGDGFDVVFDATGYGPSMEKAFSFVAHGGALVLVSVVKDDIRFSDPEFHKREMMVIGS
FT                   RNATRVDFEHVADSIAKGLVPVDKLITHRTTLADAPRDLARWAHEKNGLIKAVISIGG"
FT   gene            complement(152244..153218)
FT                   /locus_tag="Rleg_0155"
FT   CDS_pept        complement(152244..153218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0155"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   rec:RHECIAT_CH0000561 probable sugar ABC transporter,
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54466"
FT                   /db_xref="GOA:C6AZE0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZE0"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACS54466.1"
FT                   /translation="MTATPTEIVAPPPRRKMNILFGLTLIGLLIFLWIVLGVVTPSFWT
FT                   PLNISNLLRQGAMTAILALGQTFVIITAGIDLSVGAIVGFCTVIIAWLLQAGVPVWGAI
FT                   ALTLLMGVAIGAFHGFGIVHMGLPPFIITLATLTSLRGIGLLITNGSTINITNEGFSNF
FT                   ARADLLSIPSLFWMVILVAVPSFIFLHLSRWGRYLFAVGSNAEAARLSGVNVKGMIYLA
FT                   YILSASFAAFVGVLLASRIAIGNATQADGWELQAIASSVIGGTSLFGAVGSVHGPLIGA
FT                   FILATINNGANLLNVNSFWQRIITGLLIIVIVFFDQLRRRRSN"
FT   gene            complement(153246..154799)
FT                   /locus_tag="Rleg_0156"
FT   CDS_pept        complement(153246..154799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0156"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ret:RHE_CH00491 sugar ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54467"
FT                   /db_xref="GOA:C6AZE1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZE1"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS54467.1"
FT                   /translation="MIGLEEVSHRHDDSATLKEANRIPAGSPILELKGLQKNYGHVQAL
FT                   KPATLTFLAGEIHAIVGENGAGKSTLIKLLTGVITRTAGEVLWCGQPVGLATPNEAIAR
FT                   GINAVHQEVVLCRHLTVAANLFLGDEVNRFGLMRKKQMEKMAQAVLDDLGFGLPAGALL
FT                   SSLTIGQQQLVATARAAMRGTQFLIFDEPTAYLTRQESAQLFKLIRRLQGEGVTIVYIS
FT                   HRMEEVFELADRVSVLRDGTHVGTRLIGETNDAELISLMINRSIEQIYHKEKIAIGETI
FT                   LTVNGLSGPGFEDVSLSVKAGQIVGLYGLIGAGRSEFALGLYGRQPTTAGDVEWMGKRV
FT                   DIRNERTAMELGIALAPESRRDQGLCLNLPIGLNINLPVFGRLSHGPVINHTRESANAD
FT                   QQIRNLSIKTPSRRVPASSMSGGNQQKIVIGKWLSHGARLFIFDEPTVGVDVGTKAEIY
FT                   RLFAKLLKDGAGIILISSYLPEVYELADRLHVFRAGKIVASHDYHAATHEEVLSEAIGV
FT                   "
FT   gene            complement(154908..155897)
FT                   /locus_tag="Rleg_0157"
FT   CDS_pept        complement(154908..155897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0157"
FT                   /product="sugar ABC transporter, substrate-binding protein"
FT                   /note="KEGG: ret:RHE_CH00492 sugar ABC transporter,
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54468"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZE2"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00492"
FT                   /protein_id="ACS54468.1"
FT                   /translation="MSFVKSLLSRRAFTALAGAAVIASAMPAPSFAADVTIPIIVKDTT
FT                   SFYWQIVLAGARKAGKDLGVNVPELGAQAESDVNGQISILENAVAGKPAAVVISPTEFK
FT                   ALGKPIDEAAKSVPIIGIDSGADSKAFKSFLTTDNVQGGRIAADGLAAAIKGATGKEEG
FT                   EIVILTNLPGVGSLEQRREGFLDQVKTKYPGLKVIADKYGDGQATTGLNMMTDLITANP
FT                   NLVGIFASNLIMAQGVGQAIAENKLGEKIKVIGFDSDDKTVGFLKDGAIAGLVVQDPYR
FT                   MGYDGVKTALAVSKGEKVEENVDTGANLVTKANMADPKIDALLNPKIK"
FT   sig_peptide     complement(155799..155897)
FT                   /locus_tag="Rleg_0157"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 33"
FT   gene            complement(156106..156552)
FT                   /locus_tag="Rleg_0158"
FT   CDS_pept        complement(156106..156552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0158"
FT                   /product="RbsD or FucU transport"
FT                   /note="PFAM: RbsD or FucU transport; KEGG: ret:RHE_CH00493
FT                   fucose dissimilation pathway protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54469"
FT                   /db_xref="GOA:C6AZE3"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZE3"
FT                   /inference="protein motif:PFAM:PF05025"
FT                   /protein_id="ACS54469.1"
FT                   /translation="MLKGIHPLLGPDLLHALKTMGHGDDIVISDANFPSGSMGPPVIRA
FT                   DGVSATDMAAAILTHMPLDTFVPEAAWRMEVVGDPDAMPEVCTEFQQIVSKHAGDFRIV
FT                   PVERFAFYAMARKATYIVATTEFRLYGNLILKKGVVHPHEVDQA"
FT   gene            complement(156562..157581)
FT                   /locus_tag="Rleg_0159"
FT   CDS_pept        complement(156562..157581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0159"
FT                   /product="Pyridoxal 4-dehydrogenase"
FT                   /EC_number="1.1.1.107"
FT                   /note="PFAM: aldo/keto reductase; KEGG:
FT                   rec:RHECIAT_CH0000565 putative L-fucose dehydrogenase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54470"
FT                   /db_xref="GOA:C6AZE4"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZE4"
FT                   /inference="protein motif:PRIAM:1.1.1.107"
FT                   /protein_id="ACS54470.1"
FT                   /translation="MKTRQIGKTKLEVTEISFGAAALGGLYRACPREVAMDTLQAAWDS
FT                   GIRYFDVAPWYGLGLAERRVGDFLRDQPDGSYVLSTKVGRLLRPVPTGTVPDYSYVDPL
FT                   SFDADYDYSYDGIMRSVEFSYARLGLNRIDILYVHDLGVYTHGAAKNAVHQKQFLDSGV
FT                   KALEELKSSGAISAFGLGVNEVPVCLDVMRHSDLDCILMAGRYTLLDRSAVAELLPLCR
FT                   QKGTSLVVGGVFNSGILATGPVPGSHFDYMPADDDVLAKVGAMEAIAKRHGVPLAAPAL
FT                   QFPLREPIVASVLIGTAKPSSLTRNMEIVEPRLADAIYAEFEPYTLVAPPLGAEAVRV"
FT   gene            complement(157727..159229)
FT                   /locus_tag="Rleg_0160"
FT   CDS_pept        complement(157727..159229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0160"
FT                   /product="Galactarate dehydratase"
FT                   /EC_number="4.2.1.42"
FT                   /note="PFAM: D-galactarate dehydratase/Altronate hydrolase
FT                   domain protein; SAF domain protein; KEGG:
FT                   rec:RHECIAT_CH0000566 probable altronate dehydratase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54471"
FT                   /db_xref="GOA:C6AZE5"
FT                   /db_xref="InterPro:IPR007392"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZE5"
FT                   /inference="protein motif:PRIAM:4.2.1.42"
FT                   /protein_id="ACS54471.1"
FT                   /translation="MDKLPWIILSAGDNVAVATAAIAPGSTVAGIQTREKIDPGHKVAI
FT                   ADIPLGGPVVKYGQAIGRTTAEVKAGDHVHSHNLHFENDRLAATANSAPEAATADDVGR
FT                   TFMGYRRADGRAATRNYIGIIASVNCSTTVCRAIADEANRTILPHYEGIDGFVPIVHDQ
FT                   GCGMSSTGDGMNVLHRTLAGYTRHVNFGGVLMIGLGCEVNQLTLYGQSGAGASKRHFNI
FT                   QDAGGSRRAVERAMGMLREIAADVGKEKRVPMSIGEIIIGLQCGGSDGFSGITANPALG
FT                   VAADLLAAAGGTAILSETSEIYGAEHLLRSRAVSDEVAKKLDDKIAWWEDYVALHGASL
FT                   DNNPSPGNKRGGLTTILEKSLGAVAKGGRSPLTAVYGYAERVTAPGLVFMDTPGYDPVS
FT                   ATGQVAGGANMIAFTTGRGSCFGCRPAPSLKLSSNSALYASMEEDMDIDCGTIATGDAT
FT                   ISGKGREIFDLIVDTASGKKTKSELFGYGDNEFVPWHLGATL"
FT   sig_peptide     complement(159140..159229)
FT                   /locus_tag="Rleg_0160"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.624) with cleavage site probability 0.613 at
FT                   residue 30"
FT   gene            159454..160353
FT                   /locus_tag="Rleg_0161"
FT   CDS_pept        159454..160353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0161"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: GntR domain protein; regulatory protein GntR
FT                   HTH; KEGG: rec:RHECIAT_CH0000567 probable transcriptional
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54472"
FT                   /db_xref="GOA:C6AZE6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZE6"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ACS54472.1"
FT                   /translation="MARQNTVFKEAYNRYAVALRTDTALPSEPEIAAQLGVSRSTARAI
FT                   LTRLSEEGIIRWNKRQKIVLRQPTDHDLFPSEETDSLHDIIERSFMQRILADDAAPGMQ
FT                   INELELAREIGTGTTSVREFLIRFSRFGLIEKRPNSHWTLKGFTREFALELADVREMFE
FT                   LHSAAEFGRLPRDNQSWADLAAMRDEHHAMLADINQRFKDFSVLDERFHLLIHRASKNR
FT                   FIADFYDAIAIVFHYHYQWNKAAARQRNERAIHEHLDYIAALESGDQPAIETACRAHLH
FT                   SARQTLLQSLPQVATENA"
FT   gene            160617..161735
FT                   /locus_tag="Rleg_0162"
FT   CDS_pept        160617..161735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0162"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   ecl:EcolC_3640 transposase IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54473"
FT                   /db_xref="GOA:C6AUF2"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:C6AUF2"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACS54473.1"
FT                   /translation="MKIRPEVLDHWPEVRERLPAGFDLEATARLRGAFTRVREIKNAET
FT                   LLRLALAYGGLGMSLRETCAWAEAGGIARLSDPSLLERLCKAAPWLGDIVAALIAEQAK
FT                   VPTGRFAGYRLRVLDGTSICHPGADRTTWRLHVGYDLATAQVDQLELTDIHGAENLQRL
FT                   TYAPGDIVLADRYYARPRDLRPVIDAGADFIVRTGWNSLRLLQTNGEPFDLFAALAAQQ
FT                   EQEGEVQVRVHEGMTGTPPPPPLVLRLIVRRKDPQQAQAEQERLLKDARKRGKKPDPRS
FT                   LEAAKYILLLTSLPTATFPPADILTLYRFRWQIELAFKRFKSLAGLDSLPAKKPELARA
FT                   WLYARLIVAIIAEQIAGQVPDSPPSGCGNPTG"
FT   gene            162020..164020
FT                   /locus_tag="Rleg_0163"
FT   CDS_pept        162020..164020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0163"
FT                   /product="Sigma 54 interacting domain protein"
FT                   /note="PFAM: ABC transporter related; ABC transporter
FT                   domain protein; SbmABacA family protein; SMART: AAA ATPase;
FT                   KEGG: rec:RHECIAT_CH0000570 probable ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54474"
FT                   /db_xref="GOA:C6AZE8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZE8"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS54474.1"
FT                   /translation="MADAKLKPKSVDGTEPHGAGNSPQETASTVEVMPPPDAIEPDPEL
FT                   TPEEAEQARKRYLLKRFWISARRYWGRGGDKFAWPFSIGLLALIGMNVGFQYGINLWNR
FT                   GIFDAIERHDAGTVYFLTAVFVPLVLGTVAIVTIQVAVRMMIQRRWRSWLTTSVIARWL
FT                   ANGRYYQLNLIGGDHKNPEARISEDLRIATEAPVDFIAGVISAFLAASTFIVVLWTIGG
FT                   ALTLPIAGFPVTIPGFLVVTAVLYAAITSTSMAVIGRYFVHVSEAKNQAEAEFRYTLTH
FT                   VRENGESIALLGGEEEERNDLDKTFANVLRQWALLARQHMRTTLVSHGSMLIAPVVPVL
FT                   LCAPKFLEGSMSLGQVMQAASAFAIVQGAFGWLVDNYPRLADWNACARRIASLMMSLDG
FT                   LERAEQSDSLGRIKHGETEGEAMLSLNDLSVSLDDGTAVVTETRVEIEPGERVLVSGES
FT                   GSGKSTLVRAIAGLWPWGGGSVNFHADRRLFMLPQRPYIPSGTLRRAVAYPGAADSWPL
FT                   DEIKAALDKVGLDYLNDKIEEDAPWDQTLSGGEKQRLAFARLLLHQPDIIVLDEATAAL
FT                   DEKSQDKMMQMVIDELPEVTILSVAHRAELEVFHSRKITLERREGGAKLVSDIDLIKRK
FT                   RKRNLLSRVLEKRRSPPKGSTTANEGGTVPE"
FT   gene            complement(164047..164505)
FT                   /locus_tag="Rleg_0164"
FT   CDS_pept        complement(164047..164505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0164"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: cak:Caul_1741 MarR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54475"
FT                   /db_xref="GOA:C6AZE9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZE9"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACS54475.1"
FT                   /translation="MDDDVLSTPGHLVSLAARGFARLSESRLKPLGFGVGQLPVLVALQ
FT                   DGKASTQRDLARFARIEQPPMAQMLARMERDGLIKRTRDPADRRSSRIVLTKTAQERMP
FT                   KAIAALFQGNREALAGFTDAEAGQLADLLTRLIDNLDQIASAEPSSGV"
FT   gene            164633..165010
FT                   /locus_tag="Rleg_0165"
FT   CDS_pept        164633..165010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0165"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cak:Caul_1742 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54476"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZF0"
FT                   /inference="similar to AA sequence:KEGG:Caul_1742"
FT                   /protein_id="ACS54476.1"
FT                   /translation="MSQNDVEMIKRIYASFNARDIDAVLAVLSDDVAWANGMDGGHVHG
FT                   REAVRDYWTRQWAVISPHVEPVAFEETPDGAIAVEVIQSVFDLDGRPLEGRAHGLKDKT
FT                   VTHIFRMQGDKIVRFDIRDAL"
FT   gene            complement(165149..165400)
FT                   /locus_tag="Rleg_0166"
FT   CDS_pept        complement(165149..165400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0166"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54477"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZF1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS54477.1"
FT                   /translation="MQSSCMHQPWRKKIIKIMVLLHSADGMAWQSPPKGTSLKTLSEAE
FT                   EQGFILIRGEFQKRQFRLTELGSNYVERDKRRLEARRL"
FT   gene            165675..166520
FT                   /locus_tag="Rleg_0167"
FT   CDS_pept        165675..166520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0167"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; UbiE/COQ5
FT                   methyltransferase; Methyltransferase type 12; KEGG:
FT                   reh:H16_A2216 SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54478"
FT                   /db_xref="GOA:C6AZF2"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZF2"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACS54478.1"
FT                   /translation="MSANLDDIRNHQRETWDKFSAGWKKWDSLVLSWLAPFGDAMLRRA
FT                   NLSNGFNVLDIAAGTGEPGLTAAAAIPEGHVVVTDLSENMLTAAAENAARRGLKNFETR
FT                   LCDAGTLPFADASFDAVLCRFGFMFFPDIAAAAKEMARVAEPGARVSAAVWSAPAKNPW
FT                   ATTIMGTIARHVDISAPPPGSPGLFRCAGEGMMVETFKEAGLLDVAEEEVSAMMVHDTP
FT                   ARYWDFMTEVAAPVVAGLSRADAATREKIRGEVLELALQSVSDGKVYLRSTATVITGTR
FT                   "
FT   gene            complement(166709..167284)
FT                   /locus_tag="Rleg_0168"
FT   CDS_pept        complement(166709..167284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0168"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_PC0000028 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54479"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZF3"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_PC0000028"
FT                   /protein_id="ACS54479.1"
FT                   /translation="MSVFVLLLGFPGVGKLTIAKELGSLISAKVVDNHWFNNPILRLLD
FT                   EEGTAPLPKGIWEYTGRVRQAVLDAITAYSGPSANFIFTHAGVEGDERSTRTYEQFVEA
FT                   ARQRAAVFVPVRLLCAEEELARRVSAPARRDHLKTTDVETSRSRSQQAVVLNIPHQHAL
FT                   TLDVTLTSPLESAAALRDHVVTCLPNGR"
FT   gene            complement(167359..168849)
FT                   /locus_tag="Rleg_0169"
FT   CDS_pept        complement(167359..168849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0169"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   ret:RHE_CH00498 putative multidrug transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54480"
FT                   /db_xref="GOA:C6AZF4"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZF4"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACS54480.1"
FT                   /translation="MSNAAQRSNRVLIVATIMLATFMVAIEATIVATAMPRIVGELGGF
FT                   SYYSWVFSAFLLAQSTTTVIYGKLSDIFGRKPVLIGGILIFLVGSLLCGLAWSMMSLVL
FT                   FRLLQGLGAGAIQPVTTTIIGDLFKLEERGRVQGFMATVWATSAVVGPLAGGIIVDNIS
FT                   WAWIFWINLPIGVISIIAFMVFLKEDVAHKQAKIDYLGSVLFSISIVALLVMLTETDAS
FT                   AWILISLFAVFVIAGILFLAQEKRAPEPIISIPLWSRRLIATSNAATLLAGMALIGLST
FT                   ILPLYVQGVLGRSPLVAGFTLTMLVVGWPLAVMLSGRFYRAFGIQRTLRVGSLMFPFGA
FT                   CFLLFLTQESSPIVAGAGSFFMGFGMGLISLTSIVLVQDSVEWSMRGSATASIIFSRSL
FT                   GNTLGATVLGAILNAGINHYASGEAAAGLHEALNQPTGLSALAADPAIRSIFNAALHWS
FT                   FWGVVVVAVLTFFTTWLIPVGPSQKREGTAVASEAASH"
FT   sig_peptide     complement(168766..168849)
FT                   /locus_tag="Rleg_0169"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.889) with cleavage site probability 0.450 at
FT                   residue 28"
FT   gene            complement(169109..169504)
FT                   /locus_tag="Rleg_0170"
FT   CDS_pept        complement(169109..169504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0170"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00499 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54481"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZF5"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00499"
FT                   /protein_id="ACS54481.1"
FT                   /translation="MPCKFIAISLLSIGLAGPALAQTAGGADANGRLSVAPIIGGSGSS
FT                   GAGSAGAGSAGTGSVGGGATGTGSVGTGSVGTDSGTTGSTTGNGGVNLNSGRSTINPGG
FT                   VNPNLQQTPGCTSGSADTGSRGEACPQ"
FT   sig_peptide     complement(169439..169504)
FT                   /locus_tag="Rleg_0170"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 22"
FT   gene            complement(169728..170051)
FT                   /locus_tag="Rleg_0171"
FT   CDS_pept        complement(169728..170051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0171"
FT                   /product="addiction module antidote protein"
FT                   /note="TIGRFAM: addiction module antidote protein; KEGG:
FT                   rru:Rru_A3082 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54482"
FT                   /db_xref="GOA:C6AZF6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR014057"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZF6"
FT                   /inference="protein motif:TFAM:TIGR02684"
FT                   /protein_id="ACS54482.1"
FT                   /translation="MALEIIPFDATEFLDTEESQAHLIEDAFESGDAGYIAHALGVVAK
FT                   ARGMSQVARDAGVTREALYKSLSEKGDPKLSTLIGVAAALGYKLTATRVGDSDTREDER
FT                   RSA"
FT   gene            complement(170053..170418)
FT                   /locus_tag="Rleg_0172"
FT   CDS_pept        complement(170053..170418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0172"
FT                   /product="addiction module killer protein"
FT                   /note="TIGRFAM: addiction module killer protein; PFAM:
FT                   protein of unknown function DUF891; KEGG: btr:Btr_1092
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54483"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="InterPro:IPR014056"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZF7"
FT                   /inference="protein motif:TFAM:TIGR02683"
FT                   /protein_id="ACS54483.1"
FT                   /translation="MTGGPSQHSGQQKVDYSREGVNYSSRKYTVLQTAEFQKWLRKLKD
FT                   RNARDRIVTRIVRAEAGNLGDHKFFDGIGELRLDYGPGYRLYFAMQGSVVVILLCGGDK
FT                   GSQERDIKRAIEMSKEI"
FT   gene            complement(170415..170888)
FT                   /locus_tag="Rleg_0173"
FT   CDS_pept        complement(170415..170888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0173"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000575 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54484"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZF8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS54484.1"
FT                   /translation="MRTSLLSIALFTFSLSAAQAADFPLASCAGWNGTLVSRTGTDSST
FT                   AIMKGKVTQADFREYCERDPGGETTAHGGKLTVKQCVATYTKANGKDTYRSTANCIEGT
FT                   LSFVPPRGEPLRVTFPLPEDADVSCASGMPPLIEQFKLLCPQAAREFHLMDDE"
FT   sig_peptide     complement(170826..170888)
FT                   /locus_tag="Rleg_0173"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 21"
FT   gene            complement(171065..171140)
FT                   /locus_tag="Rleg_R0002"
FT                   /note="tRNA-Thr3"
FT   tRNA            complement(171065..171140)
FT                   /locus_tag="Rleg_R0002"
FT                   /product="tRNA-Thr"
FT   gene            complement(171262..172221)
FT                   /locus_tag="Rleg_0174"
FT   CDS_pept        complement(171262..172221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0174"
FT                   /product="2-nitropropane dioxygenase NPD"
FT                   /note="PFAM: 2-nitropropane dioxygenase NPD; KEGG:
FT                   rec:RHECIAT_CH0000578 probable dioxygenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54485"
FT                   /db_xref="GOA:C6AZF9"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZF9"
FT                   /inference="protein motif:PFAM:PF03060"
FT                   /protein_id="ACS54485.1"
FT                   /translation="MALPPILKDRLRLPVIGSPLFIISHPALTLAQCKAGIVGAFPALN
FT                   VRPESQLDEWLAEITEELARHDAAHPERPAAPFAVNQIVHMSNKRLEHDLSLCVKYKVP
FT                   IVISSLGAVPEVNAAVHSYGGIVLHDIINNRHAHSAIRKGADGLIAVAAGAGGHAGTLS
FT                   PFALVQEIREWFDGPLLLAGAIATGGAILAAEAMGADMAYIGSPFIATEEARAAAAYKQ
FT                   AIVEGAASDIVYSNYFTGVHGNYLKPSILAAGMDPDNLPLADVSKMDFEQAVGGAKAWK
FT                   DIWGSGQGISAVKAVEPVAKLVDRLEAEYRAARTRLAL"
FT   gene            172508..173692
FT                   /locus_tag="Rleg_0175"
FT   CDS_pept        172508..173692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0175"
FT                   /product="putative transcriptional regulator protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000580 putative transcriptional
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54486"
FT                   /db_xref="GOA:C6AZG0"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZG0"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000580"
FT                   /protein_id="ACS54486.1"
FT                   /translation="MSGLETAIRTALENSDRDNPEVRARIYQSARQALEAGLRKQDITD
FT                   TEVVAHHRHRLESTIHAIEGEERDRLHPRQRPPEVPVPPVVEMPAPPVHQAEADEFDGP
FT                   MVSGETRAPEVMHRGDESSLDDVHAGNTDHLAAAPVGEERLARGQRATNMDFRPERAAG
FT                   RRKPRKFFSRLLVWCVLLAFIGIGAWWAHTSGLLMTAAERDTSVANPPASTQPEDFTGN
FT                   DDSAGNAASHTDEPVTIDPQNSFSADWIPLFKPEDADKIQSGPRARTEKIAENDGPAVR
FT                   LISESGAADGNVSISVPPSVLQQLAGKSSTIALTLQSTTDEPTQITVECNFQTLGNCAR
FT                   HRFTVTREKSDALLQVKFDRSLAPNSPGTLTINSDLDGKARGINLFAIRILPGQ"
FT   gene            complement(173746..174627)
FT                   /locus_tag="Rleg_0176"
FT   CDS_pept        complement(173746..174627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0176"
FT                   /product="protein of unknown function DUF344"
FT                   /note="PFAM: protein of unknown function DUF344; KEGG:
FT                   ret:RHE_CH00507 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54487"
FT                   /db_xref="GOA:C6AZG1"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022486"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZG1"
FT                   /inference="protein motif:PFAM:PF03976"
FT                   /protein_id="ACS54487.1"
FT                   /translation="MDEDIENRAVELEIRGKKRTFDVDDPALPNWVDEHALESGDFPYK
FT                   KKLKEEDYLEELEKLQIELVKVQFWLQATGKRVMALFEGRDAAGKGGAISASSAHMNPR
FT                   LARVVALTKPTEREQGQWYFQRYVAQFPTAGEFVLFDRSWYNRAGVEPVMGFCTPQQYE
FT                   DFLKQTPQLEKIIAHEGIFFFKFYLDIGREMQLKRFHDRRHDPLKVWKLSSMDIAALTK
FT                   WGDYSEKRDRMLKETHTDFAPWTVIRANDKRRARLELIRHMLNKMDYDGKDKKALGTVD
FT                   EEIIGSGLGFLK"
FT   gene            174871..176094
FT                   /locus_tag="Rleg_0177"
FT   CDS_pept        174871..176094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0177"
FT                   /product="histidine kinase"
FT                   /note="KEGG: ret:RHE_CH00508 phosphate regulon,
FT                   two-component sensor histidine kinase protein; TIGRFAM:
FT                   phosphate regulon sensor kinase PhoR; PFAM: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; SMART: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54488"
FT                   /db_xref="GOA:C6AZG2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR014310"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZG2"
FT                   /inference="protein motif:TFAM:TIGR02966"
FT                   /protein_id="ACS54488.1"
FT                   /translation="MARIRRERPVLLAAILSALAALAAGMNKWVVLALLLVMILTALFN
FT                   EAPVIEAEPALPVEIKPEAPPSRLPEVSATLSGLDIPVMLLSEDASVLFQNRAAEKAFG
FT                   EVALGAHISARMRSPGVLDMVRETIATNAPNQIEHSERLPSERVYIVRSAPIEFAAEDG
FT                   PRERYFILSFRDISEVRRIDRMRSDFVANASHELRTPLASLRGFIETIQGPAKNDLKAQ
FT                   TRFLNIMLDQATRMSRLVDDLLSLSRLELKSHIAPDEKIDLVPLLGHVRDSLVPLAKDV
FT                   GVDINLHLPEGKVEVLGDRDELVQVFENLMENACKYGQEGEIVDVWLKNGTGQPVEVSI
FT                   VDKGPGIPAEHVPRLTERFYRVSIEDSRSKKGTGLGLAIVKHILTRHRARLIVKSEVGK
FT                   GTDFTVRF"
FT   sig_peptide     174871..174942
FT                   /locus_tag="Rleg_0177"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.983 at
FT                   residue 24"
FT   gene            176678..177712
FT                   /locus_tag="Rleg_0178"
FT   CDS_pept        176678..177712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0178"
FT                   /product="phosphate ABC transporter, substrate-binding
FT                   protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000584 phosphate ABC
FT                   transporter, substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54489"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZG3"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000584"
FT                   /protein_id="ACS54489.1"
FT                   /translation="MNTFKLTVAALAATAAFAGAAVARDQIQVAGSSTVLPYAKIVAES
FT                   FGETFTNFKTPVVESGGTGAGLKEFCKGVGEDTIDIANASRPINKNEAEACKAAGVTDI
FT                   QEVKIGYDGIVFATDASNPDVAYVPADIYKALAAQVVVDGKLVANPYKKWSEVNPKLPA
FT                   VDIAAYIPGEKHGTREVFEQNVLAAGCKASGATDVIAKEIADKAAQGKACVAVRKDGVA
FT                   VDIDGDYPETLARIAANKTGVGVFGLSFYENNADKLKVASMSGIVPSTETIANGTYPVS
FT                   RPLFFYVKKAHLGAVPGLKEYVNFFVSDQMIGPDSPLVEYGLVAAPDAERDAIRKDVEA
FT                   GKSM"
FT   sig_peptide     176678..176749
FT                   /locus_tag="Rleg_0178"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.983 at
FT                   residue 24"
FT   gene            177883..179364
FT                   /locus_tag="Rleg_0179"
FT   CDS_pept        177883..179364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0179"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstC"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstC; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG:
FT                   rec:RHECIAT_CH0000585 phosphate ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54490"
FT                   /db_xref="GOA:C6AZG4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR022182"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZG4"
FT                   /inference="protein motif:TFAM:TIGR02138"
FT                   /protein_id="ACS54490.1"
FT                   /translation="MSTSIILLCLVVIGAAAYLVARIRATALAGGRSSALHSRPVYYGA
FT                   YAAIWAVLPALLVLCLWLSISPGIIQSSVRGAFPDDIKAQAAVEQDLGYSTVATVARGM
FT                   TMLTSDETAAVANDPAALQAKLLEKGVPLASQPLPYMLDAAKKLNAMSMTSRIAMTAIV
FT                   FALAVAGAFYALRSIAPRFRARNRVERVMLWGLLLASSIAILTTIGIVFSMLSEAARFF
FT                   AAVPAMDFFFGTVWDPRFAGAGSSSFGQFGLIPLLLGTIYIGLVAMLVAVPVGLFAAIY
FT                   MAEYASPKLRGVAKPLLEVLAGIPTIVYGFFALVTVGPFLRDFSAQISGLLSGNYSNFI
FT                   QAQSVLTAGIVMGIMLIPYVSSLSDDIITAVPRTLRDGSLGLGATRSETIKKVVLPAAL
FT                   PGIVGALLMTASRAIGETMIVVLAAGVAARIQINPFEPMTTVTVKIVNQLTGDLEFTSP
FT                   QTLVAFALGITLFCITLCLNIYALYIVRKYREQYE"
FT   sig_peptide     177883..177948
FT                   /locus_tag="Rleg_0179"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.976) with cleavage site probability 0.609 at
FT                   residue 22"
FT   gene            179361..180683
FT                   /locus_tag="Rleg_0180"
FT   CDS_pept        179361..180683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0180"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstA"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstA; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: ret:RHE_CH00511
FT                   phosphate ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54491"
FT                   /db_xref="GOA:C6AZG5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR024573"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZG5"
FT                   /inference="protein motif:TFAM:TIGR00974"
FT                   /protein_id="ACS54491.1"
FT                   /translation="MTDIVSPTSGVTVSKAPVRRDIGIKRRYAAERRFQAYGIAAITFG
FT                   LVFLFILLWTVIGKGYTAFQQTAITLPIEFSEKTIDPNNKRATDPSVLIAANYPVLLRD
FT                   AIVKQLNVNAASRPDVRDASAMLSKGAPVQLRDMVVADPSIIGKTVNVTVLADANVDSA
FT                   NKGQIDLSVDEKNRKVNDKQVGWMNELKASGALHKQFNTGLFVNGNSSRPEAAGLGVAL
FT                   IGSLYLMLIVLVLALPIGVAASIYLEEFAPKNKLTDLIEVNINNLAAVPSIVYGLLGLS
FT                   VFINFIGLPRSASLVGGLVLTLMTLPTIIIATRAALRAVPPSIRAAALGLGASKMQMVF
FT                   HHVLPLAMPGILTGTIIGLAHALGETAPLLLIGMVAFVANAPTTPLDPSTALPVQVYMW
FT                   ANEAERAFVERTSGAIIVLLLFLIVMNMGAILLRRRFERRW"
FT   gene            180700..181515
FT                   /locus_tag="Rleg_0181"
FT   CDS_pept        180700..181515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0181"
FT                   /product="phosphate ABC transporter, ATPase subunit"
FT                   /note="KEGG: rec:RHECIAT_CH0000587 phosphate ABC
FT                   transporter, ATP-binding protein; TIGRFAM: phosphate ABC
FT                   transporter, ATPase subunit; PFAM: ABC transporter related;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54492"
FT                   /db_xref="GOA:C6AZG6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZG6"
FT                   /inference="protein motif:TFAM:TIGR00972"
FT                   /protein_id="ACS54492.1"
FT                   /translation="MNMLTEAAVEKALDHKMSNVPYKMIGKDVSVYYGEKRALFDVNLN
FT                   IRENTVTALIGPSGCGKSTFLRSLNRMNDTIDGCRVTGKITLDTDDIYDPDIDVVELRA
FT                   RVGMVFQKPNPFPKTIYENVSYGPRIHGLAKSKADLDQIVETSLQRAGLWNEVKDRVHE
FT                   SGTGLSGGQQQRLCIARAVAVSPEVILMDEPCSALDPIATAKVEELIHELRENYTIVIV
FT                   THSMQQAARVSQRTAMFHLGNLVEENDTDKMFTNPDDPRTQDYIMGRFG"
FT   gene            181560..182273
FT                   /locus_tag="Rleg_0182"
FT   CDS_pept        181560..182273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0182"
FT                   /product="phosphate uptake regulator, PhoU"
FT                   /note="TIGRFAM: phosphate transport system regulatory
FT                   protein PhoU; PFAM: PhoU family protein; KEGG:
FT                   rec:RHECIAT_CH0000588 phosphate uptake transcriptional
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54493"
FT                   /db_xref="GOA:C6AZG7"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZG7"
FT                   /inference="protein motif:TFAM:TIGR02135"
FT                   /protein_id="ACS54493.1"
FT                   /translation="MASTHIYSAYDDDLKFLSRRISEMGGLAEQMVAEAVRALVNGDTA
FT                   LAQKVISDDVILDHAEREIGDKAIVTIARRQPMAADLREIMGSIRIAADLERVGDLGKN
FT                   TAKRVIAVQSTGVPRKLARGLEHLSELALVQLKEVLDVYTNRSADKANAIRERDNEIDA
FT                   MYTSLFRELLTYMMEDPRNITSCTHLLFCAKNIERIGDHATNIAETIYYMTTGAQPEGD
FT                   RPKDDSANTVGAVTE"
FT   gene            182408..183091
FT                   /locus_tag="Rleg_0183"
FT   CDS_pept        182408..183091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0183"
FT                   /product="two component transcriptional regulator PhoB,
FT                   winged helix family"
FT                   /note="KEGG: rec:RHECIAT_CH0000589 phosphate regulon,
FT                   two-component response regulator protein; TIGRFAM:
FT                   phosphate regulon transcriptional regulatory protein PhoB;
FT                   PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54494"
FT                   /db_xref="GOA:C6AZG8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011879"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZG8"
FT                   /inference="protein motif:TFAM:TIGR02154"
FT                   /protein_id="ACS54494.1"
FT                   /translation="MIPRVAVVEDEEALSVLLRYNLEAEGFEVDTILRGDEAEMRLQER
FT                   TPDLLILDWMLPGVSGIELCRRLRMRPETERLPIIMLTARGEESERVRGLSTGADDYVV
FT                   KPFSTPELVARVKAMLRRARPEVLSTVLKCGDIELDRETHRVHRKTREVRLGPTEFRLL
FT                   EFLMSSPGRVFSRSQLLDGVWGHDIYVDERTVDVHVGRLRKALNFSNMQDVIRTVRGAG
FT                   YSMEA"
FT   gene            complement(183334..183867)
FT                   /locus_tag="Rleg_0184"
FT   CDS_pept        complement(183334..183867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0184"
FT                   /product="GcrA cell cycle regulator"
FT                   /note="PFAM: GcrA cell cycle regulator; KEGG:
FT                   rec:RHECIAT_CH0000590 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54495"
FT                   /db_xref="InterPro:IPR011681"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZG9"
FT                   /inference="protein motif:PFAM:PF07750"
FT                   /protein_id="ACS54495.1"
FT                   /translation="MNWTDERVEKLKKLWAEGLSASQIAAQLGGVSRNAVIGKVHRLCL
FT                   PGRAKAGGTNTAARTPKRNTSAPRAPNFASRITTRTVTRQQGATMLKEEIEIETIEEME
FT                   YVPRGNVVVPISRRLGLTELTERTCKWPVGDPLKDDFHFCGCESPDNSPYCGYHQKLAY
FT                   QPVNERRRAAARAS"
FT   gene            184288..185487
FT                   /locus_tag="Rleg_0185"
FT   CDS_pept        184288..185487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0185"
FT                   /product="acetylornithine and succinylornithine
FT                   aminotransferase"
FT                   /EC_number="2.6.1.11"
FT                   /note="KEGG: rec:RHECIAT_CH0000591 acetylornithine
FT                   transaminase protein (diaminobutyrate--pyruvate
FT                   aminotransferase); TIGRFAM: acetylornithine and
FT                   succinylornithine aminotransferase; PFAM: aminotransferase
FT                   class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54496"
FT                   /db_xref="GOA:C6AZH0"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZH0"
FT                   /inference="protein motif:TFAM:TIGR00707"
FT                   /protein_id="ACS54496.1"
FT                   /translation="MAEAAPLYDTYSRAPLRFERGEGVWLITETGERYLDFGAGVAVTS
FT                   VGHSNPHVVGALKEQADKVWHLSNIYEIPGQERLAKRLTDATFADKVFFTNSGAEALEC
FT                   AIKTARRYQFSKGHPERFHIITFEGAFHGRTLATIAAGGQEKYLEGFGPKAPGFDQVAF
FT                   GDIEAVRAAITDATAGILIEPVQGEGGVRPATPEFMKALRQLCDENGLLLILDEVQTGV
FT                   GRTGKLFAHEWSGVTPDIMAVAKGIGGGFPLGACLATSEAASGMKAGTHGSTYGGNPLA
FT                   MAVGSAVLDIILADGFLQQVRDVALVFRQGLASLKDRYPDVIEDVRGEGLLLGIKAAVP
FT                   SAELLQAIRAAHLLGVPAGDNVIRLLPPLVVTAEEAREGLSRVERAAESIRASKVKKTA
FT                   "
FT   gene            185530..186444
FT                   /locus_tag="Rleg_0186"
FT   CDS_pept        185530..186444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0186"
FT                   /product="ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /note="KEGG: ret:RHE_CH00517 ornithine
FT                   carbamoyltransferase; TIGRFAM: ornithine
FT                   carbamoyltransferase; PFAM: aspartate/ornithine
FT                   carbamoyltransferase carbamoyl-P binding domain;
FT                   aspartate/ornithine carbamoyltransferase Asp/Orn-binding
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54497"
FT                   /db_xref="GOA:C6AZH1"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZH1"
FT                   /inference="protein motif:TFAM:TIGR00658"
FT                   /protein_id="ACS54497.1"
FT                   /translation="MSPKHFLDLSAVTSADLRTIMNDALARKQAFKAGQGDKPLAGKML
FT                   AMIFEKPSTRTRVSFDVGMRQLGGETLFLSGTEMQLGRAETIGDTAKVLSRYVDAIMIR
FT                   TTEHSRLVELAQHATVPVINALTDDTHPCQIMADIMTFEEHRGPIKGKTIAWTGDGNNV
FT                   LHSLVEGAARFGYRMNMAVPLGSEPKDHYLNWARNEGAEIMLCHDADRAVAGVDCVVTD
FT                   TWVSMNQEHRARGHNVFQPYQVNAALMAKAGNDALFMHCLPAHRGEEVTDEVIDGPQSV
FT                   VFDEAENRLHAQKSILAWCLGAI"
FT   gene            186535..187527
FT                   /locus_tag="Rleg_0187"
FT   CDS_pept        186535..187527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0187"
FT                   /product="Hsp33 protein"
FT                   /note="PFAM: Hsp33 protein; KEGG: rec:RHECIAT_CH0000593 33K
FT                   chaperonin (heat shock protein 33) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54498"
FT                   /db_xref="GOA:C6AZH2"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="InterPro:IPR023212"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZH2"
FT                   /inference="protein motif:PFAM:PF01430"
FT                   /protein_id="ACS54498.1"
FT                   /translation="MAEAAAALGQFDFAGDDHVVPFQVEGLDVRGRAVQLGPMLDAILE
FT                   RHHYPAPVARLLAEVVVLTVLLGTSLKFDGKFTVQTKGDGPVDLLVADFSTPENVRAYA
FT                   RFDQALLNKAIESGETEPEQLLGKGVLAFTIDQGKFSQPYQGIVPLDGTTLEDIAGVYF
FT                   RQSEQIPTRVRLAAAELFDRDDAGKPRHRWRAGGLVAQFLPEAPERMRQPDLHGGDGDT
FT                   GSRPHGEDDAWLEARSLVETIDADELTDPLVGTERLLFRLFHERGVRVYEPRAVFDRCS
FT                   CSRDKIKGVLKGFSAEEIEASQEDGEIAVTCEFCSTTYRFEPAELQPAE"
FT   gene            187660..188247
FT                   /locus_tag="Rleg_0188"
FT   CDS_pept        187660..188247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0188"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000594 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54499"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZH3"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000594"
FT                   /protein_id="ACS54499.1"
FT                   /translation="MRLLFFVLALIAAMPPVSLADDQTVPWKEVGGWSVAVDPTLDNGC
FT                   FVLTSFDDDTIFRLGFNFRKKDNPLYILLGNPNWKSLEKGKHYPIELSFDQSKRTADGR
FT                   GLDLDGLKSLWIDFEDPDLIEEFAGKLSFRASFGGKQIVALGLKDSASAADELLACQKA
FT                   VNDAVAKHPAPPQSKDPFEAKPGTQASDPFDL"
FT   sig_peptide     187660..187722
FT                   /locus_tag="Rleg_0188"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 21"
FT   gene            complement(188383..188775)
FT                   /locus_tag="Rleg_0189"
FT   CDS_pept        complement(188383..188775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0189"
FT                   /product="ApaG domain protein"
FT                   /note="PFAM: ApaG domain protein; KEGG: ret:RHE_CH00521
FT                   ApaG"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54500"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR023065"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZH4"
FT                   /inference="protein motif:PFAM:PF04379"
FT                   /protein_id="ACS54500.1"
FT                   /translation="MYRALTREIEVVVEPFYLEEQSDPDDDRYVWGYRIVISNNSGIAV
FT                   RLVNRYWNITDQNGQVDEVTGPGVVGEQPRLSPGDTYEYSSGCPLDTPSGLMFGHYQME
FT                   TDDGEMFDVDIPAFSLDSPGLLRVLN"
FT   gene            complement(189146..190330)
FT                   /locus_tag="Rleg_0190"
FT   CDS_pept        complement(189146..190330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0190"
FT                   /product="O-succinylhomoserine sulfhydrylase"
FT                   /EC_number="4.4.1.1"
FT                   /note="KEGG: ret:RHE_CH00522 O-succinylhomoserine
FT                   sulfhydrylase; TIGRFAM: O-succinylhomoserine sulfhydrylase;
FT                   PFAM: Cys/Met metabolism pyridoxal-phosphate-dependent
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54501"
FT                   /db_xref="GOA:C6AZH5"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006234"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZH5"
FT                   /inference="protein motif:TFAM:TIGR01325"
FT                   /protein_id="ACS54501.1"
FT                   /translation="MSKTWRPATQLVHGGTLRSQYGETSEAIYLTQGFVYETSEAAEAR
FT                   FKGETEGFIYARYGSPTNDMFEKRMCMLEGAEDARATASGMAAVTAAILCQLKSGDHIV
FT                   AARALFGSCRWVVETLAPKYGIDCTLIDGRDLANWEKAITPKTKVFFLESPTNPTLEVI
FT                   DIAGVAKLANQVGAKVVVDNVFATPLFQKPLELGAHIVVYSATKHIDGQGRCLGGVVLS
FT                   DKEWIDENLHDYFRHTGPAMSPFNAWTLLKGIETLPLRVRQQTENAAKIADFLAEQGKV
FT                   AKVIYPGRKDHPQADIIAKQMTGGSTLVAFELKGGKDAAFALQNALDIVKISNNLGDSK
FT                   SLITHPATTTHKNLTDEARAELGISPGTVRLSAGIEDTDDLIEDFAKALDKVLA"
FT   gene            190525..191619
FT                   /locus_tag="Rleg_0191"
FT   CDS_pept        190525..191619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0191"
FT                   /product="2-deoxycytidine 5-triphosphate deaminase"
FT                   /note="PFAM: 2-deoxycytidine 5-triphosphate deaminase;
FT                   KEGG: rec:RHECIAT_CH0000597 deoxycytidine triphosphate
FT                   deaminase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54502"
FT                   /db_xref="GOA:C6AZH6"
FT                   /db_xref="InterPro:IPR010550"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZH6"
FT                   /inference="protein motif:PFAM:PF06559"
FT                   /protein_id="ACS54502.1"
FT                   /translation="MMARETGILADRAISALFETGRLISERELDRDQIQPASLDLRLGG
FT                   KAFRVRASFMPGPSHLVSDKLDRLSLHVIDLSEGAVLETGCVYIVPLMESLALPAEMSA
FT                   SANPKSSTGRLDIFTRVITDYAQEFDKIPSGYSGPLYLEISPRTFPIVVRRGSRLSQIR
FT                   FRVGQALLGEPELLKLHESETLVASKLPNVSGGGIALSIDLAGDKDGLIGYRGKHHTAV
FT                   VDVDKKAEHDLFDFWEPLHSRGRNELILDPDEFYILVSREAVHVPPDYAAEMTPFDPLV
FT                   GEFRVHYAGFFDPGFGHAPAGGRGSRAVLEVRSHEVPFILEDGQIVGRLVYEHMQEKPA
FT                   SLYGSGLGSNYQAQGLKLSKHFRI"
FT   gene            191679..191752
FT                   /locus_tag="Rleg_R0003"
FT                   /note="tRNA-Gly1"
FT   tRNA            191679..191752
FT                   /locus_tag="Rleg_R0003"
FT                   /product="tRNA-Gly"
FT   gene            191883..193268
FT                   /locus_tag="Rleg_0192"
FT   CDS_pept        191883..193268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0192"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: oan:Oant_2329
FT                   phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54503"
FT                   /db_xref="GOA:C6B084"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C6B084"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ACS54503.1"
FT                   /translation="MAKVVGLADFDRHLTKRNGFYSYKRRVPAAIGNLDPRYPTVRVAL
FT                   GTREVGEARAKRDAHERADDLLWASLTEGGDQVAAEARYKSAVARAKALGYTYRHLPAI
FT                   LSEESGESILSRLRAVQDVKPASPQETAILGGVPRPQVSVWRALEIYIEEIVADEISGK
FT                   SPAQRELWENTKRRAVTSFVEVCGELNIDEITREHARQFYNRWREKIAPNPKSGQHATH
FT                   TPSSGNREVGNMRVLYQKYFEYMGVEDITNPFRNLSFSEKKVGQKKKKKRLPFTAEWIE
FT                   KHILKPGALARLNDQARAISLVLAETGCRPSEVANLVESQIFLDHPVPHIAIESRLDPE
FT                   DPREIKTDASVRVIPLVGVALEALKKFPKGFPRYRDKESSMSATLNKYFRENGLFPTEK
FT                   HVIYSFRHGFEDRMTVAGLDTELRMMLMGHTNSRPEYGEGGTLEWKQAQLAKIALPFDL
FT                   AIV"
FT   gene            complement(193698..193910)
FT                   /locus_tag="Rleg_0193"
FT   CDS_pept        complement(193698..193910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0193"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54504"
FT                   /db_xref="UniProtKB/TrEMBL:C6B085"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS54504.1"
FT                   /translation="MWVFDGTVNLYRPRDPWPRSSNTWEKSRTMCVTDSDLSVEQNAEI
FT                   QALCRGVQEEPANREPRGNSPDLTR"
FT   gene            194836..196695
FT                   /locus_tag="Rleg_0194"
FT   CDS_pept        194836..196695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0194"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="PFAM: AAA ATPase central domain protein; peptidase
FT                   M41; SMART: AAA ATPase; KEGG: rec:RHECIAT_CH0003340
FT                   putative ATP-dependent hydrolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54505"
FT                   /db_xref="GOA:C6B086"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="UniProtKB/TrEMBL:C6B086"
FT                   /inference="protein motif:PFAM:PF00004"
FT                   /protein_id="ACS54505.1"
FT                   /translation="MYHHLDRRVFAETSSNTAKFLMLCALRQALRGTDQFKVDAKGIIV
FT                   CIVDKAWLWYAKSAANVLMTGGKVHSYYDDFRRPVHIIGESPRRTTSKGVEDSTVFRPE
FT                   HQVIYLASSLDAVRLSLQLAADVIVNILPPTARHVIAARKVLGVEDVDMPLAEAIAQQS
FT                   AEIVIGLTARNSLKGLDIATLTKPIAVPERSHKLSELPGYGPARPWVDAIKQDVADWRE
FT                   GKLPWTDVDRGILLLGAPGTGKTLFATALANELGFDLVLTSVGAWQGSNNGYLGDMLAA
FT                   MSKSFADATARRGAVLLVDELDAIGDRATMRGDHAFYEGNVIGRFLELTTHALEQPGTI
FT                   IVGATNYGHLIDNAVLRSGRLEKHVYLELPEDEERAEILAYHFNQALPAKDLREITDKL
FT                   RLVTPADLEKLARAAKRAARIRKGLLSIQDVKAILPAQVPLPEAVVHRICVHEIGHALM
FT                   AMASGSADVISIRVESHMVEGQFVQDGGRLHYKIHNEALPSDKDLLAKIRIMLGGTAAE
FT                   EVVFGNRSIGAGGVEGSDLDQATRLAYRLVGSYGLGKWLRYQMGANRVDETFVPAPELR
FT                   AEVDGILAREYRATKELLSKEKAHLMRLAAELVVDRKLLIDKK"
FT   gene            196763..197059
FT                   /locus_tag="Rleg_0195"
FT   CDS_pept        196763..197059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54506"
FT                   /db_xref="UniProtKB/TrEMBL:C6B087"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS54506.1"
FT                   /translation="MESGARVEFTVYCHEIISASDVGLHFAATLAKSKAEVGEYRKALR
FT                   TINPTGEPLGTLAIYEMVLRMPDVATMVDLLNSPESLLRTCLMSRKLVALTAD"
FT   gene            197189..199153
FT                   /locus_tag="Rleg_0196"
FT   CDS_pept        197189..199153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0196"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bbt:BBta_3314 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54507"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041685"
FT                   /db_xref="UniProtKB/TrEMBL:C6B088"
FT                   /inference="similar to AA sequence:KEGG:BBta_3314"
FT                   /protein_id="ACS54507.1"
FT                   /translation="MRLKSFSVSEFRSIIASGEITLGDVTCLVGKNEAGKTALLKALYK
FT                   LSPMSTTDARFDVTDDYPRKDLGDYQHEVDEGVRGQAVPIRATFELTDAEVSSVANLFG
FT                   PKALTSNVLTLEKSYDNRRVYSLDFNETEALKYVVSSAELESADLAAVGDVQTWKGLGN
FT                   RLAELAASPTGAKLKMLVDKINDKGSGGGYYAYNSILSRSVPEFLYFDEYYQMVGHDNV
FT                   EALIQRRDSEDLRPSDHPLLGLINLARLSLDDLISSKRTMEMVNKLEAAGNHLTRQILK
FT                   YWSQNKHLQMKFDVREAMADDPVEMRSGHNIWGRVYDQVHWATTELSSRSRGFVWFFSF
FT                   LAWYEDVKRARKNIILLLDEPGTSLHGRAQGDLLRYIEQELRPHHQVIYTTHSPFMVDP
FT                   QHFDRVRIVQDRGIDSDDPLPREEDGTKVLENVFDASDDSLFPLQGALGYDISQTLFIG
FT                   PNSLVVEGPSDLFYLRGMSSLLEREKRTGLSPEWTLTPVGGSSKIPTFVAMLAPQRGMN
FT                   VAVLVDIQASDRQTVEGLYKKKLLDQKNVHTFADFTGLVESDVEDMFERDFYVNLVNEE
FT                   FRGQLSSKITASKLNRNLPRVLRALEEHFQTSPLKSGQFGHYRPARYFAENLAVLTPKI
FT                   SEETKNRFEALFKKLNAQL"
FT   gene            199362..199601
FT                   /locus_tag="Rleg_0197"
FT   CDS_pept        199362..199601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0197"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54508"
FT                   /db_xref="UniProtKB/TrEMBL:C6B089"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS54508.1"
FT                   /translation="MSGYQNSFADRFALIAGEGVLSKALTDARAKFERVSEKERAERAK
FT                   LGEVRDSLARIEKIPEVQKRALSLNYVLLSAGKT"
FT   gene            complement(199729..202566)
FT                   /locus_tag="Rleg_0198"
FT   CDS_pept        complement(199729..202566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0198"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sme:SMc02155 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54509"
FT                   /db_xref="InterPro:IPR007555"
FT                   /db_xref="UniProtKB/TrEMBL:C6B090"
FT                   /inference="similar to AA sequence:KEGG:SMc02155"
FT                   /protein_id="ACS54509.1"
FT                   /translation="MKPWREVAVPHRDVLEGTFQQSEFAADITAVNTGKASREYQDAGA
FT                   FFDRTFITEGMALLLTQVAQRLTGRGGEPVVQLQTAFGGGKTHTMLAVYHLATRKCALS
FT                   DLAGISALVDRAGLMDVPQARVAVLDGVAHAPGQPWKRGSQTIKTLWGEMAWQLGGAEA
FT                   FALLAEADVTGTSPGKDVLRDLLERHSPCVVLIDELVAYIRQFPESQPISGGSYDSNLS
FT                   FVQALTEAAKLVPRAIVLASLPESDLEAGSQRGAAALRALEKTFGRVQALWKPVATEEA
FT                   FEIVRRRLFEPVRDEKTREGVCRAFADAYIAEGVKLPADTQERHYYDRLLHAYPIHPEV
FT                   FDRLFEDWTTIDGFQRTRGVLKLMAKVIFRLWKDDNKDLLIMPGSLPLYDGSSRNELTY
FT                   YLPAGWDAVIERDIDGDRAETTALENKEPRFGQVGAARRIARTVFLGSAPSSVASKVVA
FT                   RGIDRAHIILGCLQPGQAASVYADALGRLADRLHYLNSSGDKSHDATRFWFDTRANLRR
FT                   EMEDRKRRFDDRTEVRGKIAGALKQTVGSLTYFDGVHIFAPHGDVPDDTALRLLVLPPE
FT                   TWYARDENRLAFEAVLETIGKNGPKPRYRSNRLLFLAPDHAALSRLMDATRVALAWGSI
FT                   VEDVKEGRLNIDLLQKNQAEKELKSAEDALPRVVRECYKWLLCPMQDAATDPKPGIEAF
FT                   ALNTAGGSIAADIERVCIDNELVITTWSPIHLRTKLKELYWKGGKRAANAAGFFEDTLR
FT                   YLYMPRLKTRDVLSQAIQAGVAGKDFFGTAYGEADGKFEGFYFGGGTVIFDDTLLLIEP
FT                   QAAQAYEEANREAQPAATPPVSTATAAGGVAEAPNVYVFNGGSTSPPVAITPTSGPTKP
FT                   KTFYGSAEVPPATAKMRLVQIAEEIVSVLTSDPNATVRLVVEISAEFPDGAGDGLKRAV
FT                   SENARSLGLKSADWD"
FT   gene            complement(202580..205489)
FT                   /locus_tag="Rleg_0199"
FT   CDS_pept        complement(202580..205489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0199"
FT                   /product="protein of unknown function DUF1156"
FT                   /note="PFAM: protein of unknown function DUF1156; KEGG:
FT                   sme:SMc02154 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54510"
FT                   /db_xref="InterPro:IPR009537"
FT                   /db_xref="InterPro:IPR014455"
FT                   /db_xref="UniProtKB/TrEMBL:C6B091"
FT                   /inference="protein motif:PFAM:PF06634"
FT                   /protein_id="ACS54510.1"
FT                   /translation="MTATVKTPKKLIEVALPLDAINEACAHEKQPGIGAHPRGLHLWWA
FT                   RRPLAAARAVIFAQMVNDPSWKWELERPGDIPPNNIKASWAASRNRLFAIIKEMVKWEN
FT                   STNEAVLQKARAEILRSWRETCDLNKDHPRAAQLFDPERLPAFHDPFAGGGALPLEAQR
FT                   LGLESYASDLNPVAVLINKAMIEIPTKFAGRPPVSPVARDSQDAWSRQWAGVRGLAEDV
FT                   RHYGQWIRDQAQKRIGNLYPPVEITADMARERPDVMPLVGQRLNVLTTIWARTVKSPNP
FT                   AFRHVNVPLVSTFILSSKAGKEAYVEPIVSGDTYRLTVKVGKAPKDSDEGTKFSRGNFR
FT                   CLLSQAPISADYIRSEAKAGRMGARLLAVIAEGRNGRIYLPPTSEQEDAANKAQPLWKP
FT                   ELEFFQQALGFRIGNYGMTAWSDLFTARQLVALTTFSDLVSDVIEVIRRDAISAGVDDD
FT                   GIPLNDGGNSALAYAQAVGVYLAFAISRLADYGSSIATWKPSGEQVMQTYKRQALPMTW
FT                   DFPDSNLLGDKAICWTNAVKYAADNLLSTAAASTQAEGFAIQSDAQQQTISQNKVVSTD
FT                   PPYYDNIGYADLSDFFYVWLRKTLKPVYPELFATVAVPKAEELVATPARHGGREGAEEF
FT                   FLHGMTQAMQRLATQAHPSFPVTIYYAFKQSETQNDTGTSSTGWETFLDAVIRSGLALT
FT                   GTWPMRTELGNRMRGQESNALASSIVLVCRPRSATADTISRRVFQRELNQVLPEALDEM
FT                   TRGSGEDRSPVAPVDLSQAIIGPGMAVFSKYAAVLEADGTPMTVQTALRLINRFLAEDD
FT                   FDHDSQFCLHWFEQYGWKEGRFGEADTLARAKGTSVDGVKQSGVLLAMGGIVRLLKWAE
FT                   YPAEWDPTNDARLPVWEALHHLIRVFKTDGESGAGKVLAAIAAKAEPTRQLAYRLYTLC
FT                   ERAGWAEDARAYNEIITSWGAIESGAAMAPKARQSDLFG"
FT   gene            complement(205492..206133)
FT                   /locus_tag="Rleg_0200"
FT   CDS_pept        complement(205492..206133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0200"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sme:SMc04429 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54511"
FT                   /db_xref="InterPro:IPR013467"
FT                   /db_xref="UniProtKB/TrEMBL:C6B092"
FT                   /inference="similar to AA sequence:KEGG:SMc04429"
FT                   /protein_id="ACS54511.1"
FT                   /translation="MWRLDRIVYPAPPCLGGYHHSTHSWQDVISGHKAEIRMHLEAMQG
FT                   RRCAYCEGDIDSLGQHIEHFRRKSLHSALTFDWDNLFWSCDQTDSCGHFKDNGAGQYDV
FT                   ADLINPCFDDPDVFFVFQADGTISIRHGLSAVDEHRARETLRILSLDAEWGRLRVMRKI
FT                   AVSGYVDDADTAFNEGWPPDDICSYFAEELECARNLPFYTAIRHVLTERQ"
FT   gene            complement(206135..207463)
FT                   /locus_tag="Rleg_0201"
FT   CDS_pept        complement(206135..207463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0201"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sme:SMc02153 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54512"
FT                   /db_xref="GOA:C6B093"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:C6B093"
FT                   /inference="similar to AA sequence:KEGG:SMc02153"
FT                   /protein_id="ACS54512.1"
FT                   /translation="MALRLDKLSLTNFRCFANCEIEFHSGLTVLVAQNGSGKTAVLDAA
FT                   GAALSVFVNTLYPLEKIWRIERSDVRLIPGQEHKMSPCLPVEYEAQATVQATSVTWRSA
FT                   VRTYGDKVRPSTRNLGPISMAAQPFLSDTAVLPLIAYYGTGRLWNEQRQTEYRRSSVTN
FT                   VDERVAGYADCLTSSSSFKGISAWFEHRFRQTASPLYRESLQTNLAMIEGVKTATDTVL
FT                   QPTGWSNLRWDDELHTLTAKHDGRGELPLSMLSDGVRTMLALVADVARRCASLNPQLSD
FT                   QAALKTPGVLIVDEVDMHLHPSWQQQVLGLLQSAFPALQIIVSTHSPHVLSTVEKSSIR
FT                   VLHVKNGDVVVETPLVQTRGVESADVLATVMDVDPVPALEESTALSAYRKLIEAGEAEG
FT                   QEASALRYRLNAHYGESHPVMLEADRLIRFQRFRLAKSRPESA"
FT   gene            complement(207463..210975)
FT                   /locus_tag="Rleg_0202"
FT   CDS_pept        complement(207463..210975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0202"
FT                   /product="helicase domain protein"
FT                   /note="PFAM: helicase domain protein; SNF2-related protein;
FT                   SMART: helicase domain protein; DEAD-like helicase; KEGG:
FT                   sme:SMc02152 putative helicase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54513"
FT                   /db_xref="GOA:C6B094"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024975"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:C6B094"
FT                   /inference="protein motif:PFAM:PF00271"
FT                   /protein_id="ACS54513.1"
FT                   /translation="MKLEEIKSGQSLSGIEPSQVVMVVALIPLSEGSVQLIYRTPDGGI
FT                   KERLLNRGDERTVEVASAERPFSFDGDGAAFQLACEAKRIDLAFLFDPMMAVHSSNVEP
FT                   LPHQITAVYESLLPRQPLRFVLADDPGAGKTIMAGLYIRELIMRADSHRIVIVAPGGLV
FT                   EQWRDELYEKFGLEFYVYSSLLEQTSPSGNAFDDYPRLIVRLDQLSRSEELQDKLCAPG
FT                   WDLAVFDEAHKLSAHYFGSKLEKTGRFRFAEKLGAHARHLLLMTATPHNGKEADFQLFL
FT                   SLLDSDRFYGKFRDGVHKVDASDLMRRMVKEELVKFDNTPLFPERKAYTANYQLSQIEA
FT                   SLYEAVTSYVQTEMGKADQLEGARKGSVGFALAALQRRLASSPEAIFQSLKRRRERLES
FT                   RLRGEKLGIKGRQAVAETYASAPEDDDDLSAEEQESLEENLIDDATAAKTVAELEAEIV
FT                   ILKGLEEQAKAVVASGQDRKWDELSRILQNNPEMRDASGRQRKIIIFSEHRDTLNYLQA
FT                   RIAGVLGNPDAIVTIHGGTHRDERRRLQALFRSDPDVRVLVATDAAGEGVNLQNANLMV
FT                   NYDLPWNPNRLEQRFGRIHRIGQTEVCHLWNLVAKETREGDVYHRLLLKLEVESQALHG
FT                   RVFDVLGEVFEETSLKDLLVEAIRYGDRPDVRARLTLKIDKALDHDHLKSLLNRNALAQ
FT                   ETMSPERLFAVKEEMEKAEARRLQPYFVRAFFSKALDALGGTAHPREAGRYEISHVPSA
FT                   IRERDRRQNGRNRRDHEPVLRRYSRICFERQAIQPLDRAGLERAVLMHPGHPLMLAMSD
FT                   MILEQHTNLLRQGSILVDPSDDGLDPALLFLLTHEIKSGDNTVLSKRLQFVRVGPDGKT
FT                   TFAGWAPHLDLEPLPEAERPLLKDLLDRPWLSSGHEAGALSFAATTLVPEHYGEVAQRR
FT                   IDNVEKTLNAVHERLSKEIAFWQDRWMKLRDDAVAGKDVRLNLQNVERTLGDLQGRLDN
FT                   RKKELQAMRHVVNGTPVVLGAALIVPAGLMIKLRGDEPIDPVTANFAGDAAARSRIERL
FT                   AMTAVRKAEEARGCRVVDVTAAKCGWDLTSYPPAVDGRQPDPKHIEVKGRVKGANTVTI
FT                   TRNEMLYAFNQGDKFVLAVAIVGENDVVDGPYYIPSPFDREPGWGVASINFSLGDLLAK
FT                   AEVR"
FT   gene            complement(211311..213323)
FT                   /locus_tag="Rleg_0203"
FT   CDS_pept        complement(211311..213323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0203"
FT                   /product="protein of unknown function DUF87"
FT                   /note="PFAM: protein of unknown function DUF87; KEGG:
FT                   rsh:Rsph17029_3200 ATPase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54514"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR008571"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6B095"
FT                   /inference="protein motif:PFAM:PF01935"
FT                   /protein_id="ACS54514.1"
FT                   /translation="MSRDDRKRAIGKIVSVAADRFVVEMHSGTDNFTVVGFDDVHYVAR
FT                   LGSFLMVPVQDEYVVVEVVGLRERDSGNPGHGSGDMDKAASAKYLDVVPVGMLPQVRGA
FT                   KFRFGVSIYPSLYADALYALDAELDRVFETEVVTEQPPDPGGQALPTRYNALSIGRSVV
FT                   FEGYDVKVKIDEFFGAHTAVLGNTGSGKSCTISSVLQSLFQKPDEHRARGATFIVFDVN
FT                   GEYWQSLSPLAADEGIGVSRLVLDGSAEPGRFRLPHWFLDQTEWELLLQASERTQMPVL
FT                   RTALGLTGLFRKDSPEALLVKEHFMARCIIECFRGADGDSPVSKFHRVVSLLQRYPTKD
FT                   LNLALLRAYGANFQFGNFANNNLVPFLEKVGEKVREEIKLPSYDRTPFAFDDLEECLDF
FT                   AILYEESHGNRQIRDYCSQMVTRLKSLKERSDFRFLRHELPTEGDAPTTGTFLKTLLGL
FT                   REAGPGGKLIKDAQIVVVDMNDVEDEVVELVSSVLARMTFRLLRQADPRNRFPVHLLLE
FT                   EAHRYISETPSRFAIDAHRIYERIAKEGRKYGLFLLVASQRPSELSKTVLSQCSNFVVH
FT                   RIQNPDDLSQIRQMTPFISDAVLKRLPSLPKQHALVFGTSVNLPTTFRVRNADPLPKSD
FT                   DAKIRDLWFHGADRAAGISFSQSSAPPGLLESEAC"
FT   gene            complement(213320..214357)
FT                   /locus_tag="Rleg_0204"
FT   CDS_pept        complement(213320..214357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0204"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rsh:Rsph17029_3199 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54515"
FT                   /db_xref="InterPro:IPR039444"
FT                   /db_xref="UniProtKB/TrEMBL:C6B096"
FT                   /inference="similar to AA sequence:KEGG:Rsph17029_3199"
FT                   /protein_id="ACS54515.1"
FT                   /translation="MVRELDDPAFPTKAERTAMLELFGIQIEADEYARNLERLMELLFS
FT                   MRFVLKRSSHETTADGIKLVEGIITKVQAFLWERCTNGVFATGDGTVRGFYETFYRKLV
FT                   LRDRSLPRPWVFTTNYDVFNETAMDRLGLPYANGFSGVVERRFNPATFRYALAEQLDVS
FT                   SRKWSAVDGFVYLCKLHGSITWTEDDHGLFPIREMAPGKQPGKVMIYPTPAKQNSSLGS
FT                   PYSDLFREFQSRVVREQSVLFTMGYAFGDEHINNIIYQALTIPTFRLVIFVDPELGGEI
FT                   AKLRALEDPRIWIIGGDGREKGQKAHYFDTIVEEFMPQRPTERIDEAVRKVLETMGAAS
FT                   RGEAE"
FT   gene            complement(215709..216218)
FT                   /locus_tag="Rleg_0205"
FT   CDS_pept        complement(215709..216218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0205"
FT                   /product="protein of unknown function DUF995"
FT                   /note="PFAM: protein of unknown function DUF995; KEGG:
FT                   smd:Smed_3668 protein of unknown function DUF995"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54516"
FT                   /db_xref="InterPro:IPR009337"
FT                   /db_xref="UniProtKB/TrEMBL:C6B097"
FT                   /inference="protein motif:PFAM:PF06191"
FT                   /protein_id="ACS54516.1"
FT                   /translation="MSMLQKMFLAVVLTGGIATAASAAGTNEPAGIETAKPMSSAEIYR
FT                   LYNQNSWMWKAGAGYFSAKARRFTAWSRENGSPSFGTGRWFITETGKLCFNADWHAKTG
FT                   TATAITCFSHRKKGGLIYQKREPDGEWYVFKSAPAQATDEFAKLRRGDYVRSQLGGIEM
FT                   SVSKTR"
FT   sig_peptide     complement(216147..216218)
FT                   /locus_tag="Rleg_0205"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.936 at
FT                   residue 24"
FT   gene            complement(216237..217202)
FT                   /locus_tag="Rleg_0206"
FT   CDS_pept        complement(216237..217202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0206"
FT                   /product="putative cellulase H precursor protein"
FT                   /note="KEGG: sme:SM_b20462 putative cellulase H precursor
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54517"
FT                   /db_xref="GOA:C6B098"
FT                   /db_xref="InterPro:IPR000805"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022790"
FT                   /db_xref="UniProtKB/TrEMBL:C6B098"
FT                   /inference="similar to AA sequence:KEGG:SM_b20462"
FT                   /protein_id="ACS54517.1"
FT                   /translation="MHSPSKIALLSLTGLLLSGVAVLPTALGSSAEGQPLAMTTSSIAP
FT                   PTKMPVVTKESITFGAYDPHGDLGASPDSKIEHLFLPWEDVDLRTLALADDYAQARGRT
FT                   LLISVEPWTWSTGSRQTSQELLHSILNGSRDANMAAVCSTAAKLKSPVIIRWGQEMDET
FT                   DSQFSWSHWQGDDYAKAYRRMVEVCKVHLKTAKYMWSPKGNEGLQAFYPGNDVVDLIGL
FT                   SVFGLEQYDRDKTGRDQTFAEHLAPGYARVAGYGKPIMVAELGYEGGDSFVRNWAESVT
FT                   KRYPQFPALSAVVYFNDREVYPWPDGYGRPDWRIVRESIN"
FT   sig_peptide     complement(217107..217202)
FT                   /locus_tag="Rleg_0206"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.769 at
FT                   residue 32"
FT   gene            complement(217195..219102)
FT                   /locus_tag="Rleg_0207"
FT   CDS_pept        complement(217195..219102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0207"
FT                   /product="putative cellulose synthase protein"
FT                   /note="KEGG: sme:SM_b20460 putative cellulose synthase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54518"
FT                   /db_xref="GOA:C6B099"
FT                   /db_xref="InterPro:IPR025993"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C6B099"
FT                   /inference="similar to AA sequence:KEGG:SM_b20460"
FT                   /protein_id="ACS54518.1"
FT                   /translation="MTELAIIQATHAPEPSHEPLLVPVLTGHRRTEYLFSAAVWACAFA
FT                   YFWIWWLEPRHHVDAFGTITVSLVLAWVTALPAYFIVVFYRAARPNGPLRLPAGSRVAM
FT                   VVTKAPAEPFSVVSETLLAMLAQEVEHDTWLADEDPSPETLDWCSRHGVLVSTRKGRSD
FT                   YHRTSWPRRTRCKEGNLAFFYDHYGYSRYDFVAQLDADHVPAPDYLFHMLRPFGDPKVG
FT                   YVSAPSICDKNASESWSARGRLYAEASMHGSLQAGYNGGLAPMCIGSHYAVRTVALKQI
FT                   GGLGPELAEDHSTTLMMNAGGWRGVHALDAIAHGDGPRTFSDLVTQEFQWSRSLVMVLL
FT                   RYSPSLLGRLPARLKFQFLFSQLWYPLFAFFMLLMFALPIIALVRGQNFVTVTYPDFLA
FT                   HFAPLSIALVVMAYRWRASSSFRPYDAKILSWECMLFLFARWPWALAGTLAAVHDFVTG
FT                   SFVDFRVTPKGRSEVDLLPVRVLAPYAVLALMAVLPALAIADAGASKGGYFFTILNAAI
FT                   YCALLLVIVGRHSKENTVAAAPRFYRPAMATVLLALVALPGAATIMRGKDATEALAWGS
FT                   GRLQLFEERYAASGAGRGGTALRTIFFKPRWISDPEEIQLRTDAAHPDVRPSVEEVHNA
FT                   "
FT   gene            complement(219099..220085)
FT                   /locus_tag="Rleg_0208"
FT   CDS_pept        complement(219099..220085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0208"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /note="TIGRFAM: UDP-glucose 4-epimerase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; Male sterility domain;
FT                   polysaccharide biosynthesis protein CapD; short-chain
FT                   dehydrogenase/reductase SDR; dTDP-4-dehydrorhamnose
FT                   reductase; KEGG: sme:SM_b20459 putative UDP-glucose
FT                   4-epimerase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54519"
FT                   /db_xref="GOA:C6B0A0"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0A0"
FT                   /inference="protein motif:TFAM:TIGR01179"
FT                   /protein_id="ACS54519.1"
FT                   /translation="MDAPRVLVTGGAGYIGSHTAKLLRSEGIEPVVYDNLTTGNRSSVR
FT                   WGPFVEGDVLDTSCLIEVIEKYAPDAVIHFAASAYVGESVENPAKYYNNNVCGALSLID
FT                   ACRQTGLQNVIFSSSCAVYGVPSVLPIDETLPKAPINPYGKTKLIFEHMLADYAAAYGL
FT                   RYVALRYFNACGADPDGELGEWHVPETHLIPRALLAAAGRIPHLEIFGDDYDTPDGTCI
FT                   RDYIHVADLARAHVQAFTHLAKGGANLAVNLGTGRGYSIREVLRVIQETTGCEVPVVIH
FT                   PRRPGDPPSLYADASLARETLCFQPRYSDLETIVRTAAPFFGLEVRA"
FT   gene            complement(220085..221131)
FT                   /locus_tag="Rleg_0209"
FT   CDS_pept        complement(220085..221131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0209"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; Male
FT                   sterility domain; KEGG: sme:SM_b20458 putative dTDP-glucose
FT                   4,6-dehydratase protein; SNP /replace=T"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54520"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0A1"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACS54520.1"
FT                   /translation="MNYLGKIRARSVQVSARDANCPSGIHRAPKRVLVTGGAGFLGSHL
FT                   CETLLAAGHQVICLDNFSTGMRRNIVHLKRVDRFNVVAHDIVHPLDLEVDEIYNLACPA
FT                   SPPHYQADPIHTTKTCVLGSLNLLELAARTGARILQASTSEVYGDPNVHPQVESYWGNV
FT                   NSFGPRSCYDEGKRCAETLFFDFHNTHGVEIKIIRIFNTYGPRMRPDDGRVVSNFIVQA
FT                   LTGQDITIYGDGSQTRSFCFVDDLIGGMVRMMASPSSLTGPVNLGNPGEFTIRELAEQV
FT                   IGLTGSRSQIIHRALPVDDPRQRRPDISLAMQELDWRPKIDLSSGLRQTIDYFDGVLTR
FT                   PARELEAV"
FT   gene            221486..222634
FT                   /locus_tag="Rleg_0210"
FT   CDS_pept        221486..222634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0210"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; SMART: helix-turn-helix- domain containing
FT                   protein AraC type; KEGG: ret:RHE_PE00361 AraC family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54521"
FT                   /db_xref="GOA:C6B0A2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0A2"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ACS54521.1"
FT                   /translation="MATGSESDDDPAAEQERPAHMERRRWPREPAMRKERPPHASPALV
FT                   PLRFSTQDLPPAEQFQAWRAHMAPLVDVHLPEGKSPEDGFLAEQIGWHLGDILIVQQRA
FT                   HAHRYVRDQAMLRSSPIDHWNVGLQRSGQAWTEVNRRVTETGAGEIFFMSLGSPYRGRT
FT                   TDTEALLVFLPYEMLARDASLLQSAGNTVLSGSHAELLTGYLTGLETNLGNLTIEEVPR
FT                   IIQTIGDMVVAGAASSTRTDTGQNQANMGLMERAHRYIHVNLHSENLTPDVMCRALGIS
FT                   RTRLYQLFEASGGVLNYIRKRRLLQAYADLSNSADHRPISEIAEAAGFEVAANFTRAFI
FT                   HEFGLSPREIRRTMATQQRPAPAIRSTRRYEKTIGDWLALTG"
FT   gene            complement(222795..223073)
FT                   /locus_tag="Rleg_0211"
FT   CDS_pept        complement(222795..223073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0211"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00530 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54522"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0A3"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00530"
FT                   /protein_id="ACS54522.1"
FT                   /translation="MKPAIIGLVGTLVLAGCNTVSYSGPGLEPIPGSITYSGQPRSKLT
FT                   KSPPGSAFPHDFIDQYGREVEETYIIQPDRSLIIAHRQYKPIRFFGD"
FT   sig_peptide     complement(223002..223073)
FT                   /locus_tag="Rleg_0211"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.866) with cleavage site probability 0.777 at
FT                   residue 24"
FT   gene            223497..223877
FT                   /locus_tag="Rleg_0212"
FT   CDS_pept        223497..223877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0212"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: ret:RHE_CH00531 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54523"
FT                   /db_xref="GOA:C6B0A4"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0A4"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACS54523.1"
FT                   /translation="MRLNHLDFHVPDIAATADFFIRHFGLRLKDMRGQNGLAILEDDTG
FT                   LEIVLSHAIAKFGTADQVEMGRQTYHIGFILPERADVDAVHAGLAAAGAALSGRPAAMR
FT                   GGWLFYCTAPGNILVEIGWRPG"
FT   gene            complement(224243..224782)
FT                   /locus_tag="Rleg_0213"
FT   CDS_pept        complement(224243..224782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0213"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ecl:EcolC_3640 transposase IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54524"
FT                   /db_xref="GOA:C6B0A5"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0A5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS54524.1"
FT                   /translation="MKIRPEVLDHWPEVRERLPDLFAALAAQQEQEGEVQVRVHEGMTG
FT                   TPPPPPLVLRLIVRRKDPQQAQAEQERLLKDARKRGKKPDPRSLEAAKYILLLTSLPTA
FT                   TFPPADILTLYRFRWQIELAFKRFKSLAGLDSLPAKKPELARAWLYARLIVAIIAEQIA
FT                   GQVPDSPPSGCGNPTG"
FT   gene            complement(224903..226894)
FT                   /locus_tag="Rleg_0214"
FT   CDS_pept        complement(224903..226894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0214"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SMART: chemotaxis
FT                   sensory transducer; histidine kinase HAMP region domain
FT                   protein; KEGG: ret:RHE_CH00532 methyl-accepting chemotaxis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54525"
FT                   /db_xref="GOA:C6B0A6"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0A6"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACS54525.1"
FT                   /translation="MLKHLKIRTKIISVVALMGLITMAGLIYVISEFRRADAAYSAFID
FT                   HEAQASMLSARASASAVASVLQVTLIADMKPDTPAFQTALATPSKLPQARDRMKQALAL
FT                   VPSRKPAIDEIQAGIDEIETLANKIIEQSKAKDSAGALSNVALINAKLDALTPKMIANN
FT                   DAMMAMLNDGGDALSASVNGRIVFCFVLIGIAVLAAVGFSVVVAQKGIAGPMTQLRLRM
FT                   TRLAEGDTTSDVSGLDRGDEVGQMAKAVSVFRDNAIERARIEARAETDRDVSDSERRDR
FT                   EAQKAREASELDRAVTALGDGLRRLAAGDLASHIAEPFVAHLDALREDFNNSVEKLNET
FT                   LHTVGANARAIGAGANEIRSSADQLSQRTEQQSASVEETAAALEEITTTVRDAAKRAEE
FT                   ASQLVARARLGAEKSGEVVRKAVSAMQQIEKSSGEISNIIGVIDDIAFQTNLLALNAGV
FT                   EAARAGDAGKGFAVVAQEVRELAQRSAKAAKEIKALISTSGSHVQTGVSLVGETGKALD
FT                   AIVQEVQEINQHVHAIAEASREQSIGLQEINTAVNTMDQGTQQNAAMVEESTAASHNLA
FT                   TEASALNNLLGQFRLTGTGGFTTSTPIAAAAPRAAARPAARAAPVRVAREGTARPAASP
FT                   ARALGQKIANAFGAGSTSPSQDPDWTEF"
FT   sig_peptide     complement(226820..226894)
FT                   /locus_tag="Rleg_0214"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.977) with cleavage site probability 0.503 at
FT                   residue 25"
FT   gene            227472..228347
FT                   /locus_tag="Rleg_0215"
FT   CDS_pept        227472..228347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0215"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   SMART: extracellular solute-binding protein family 3; KEGG:
FT                   rec:RHECIAT_CH0000603 probable amino acid ABC transporter,
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54526"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0A7"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ACS54526.1"
FT                   /translation="MMQSKLASLTLKGFLAFGLFFGVLFSSLAASAQQVSPSLPLLFDA
FT                   RERLARPDLSSLVRLRFLTSVDFPPFNFTDQNGKLSGFNVDLAREICSELEISDKCQIQ
FT                   AIPFADLRDALAASQGDAVIAGFAVTPELRRQFVFSRPYLMLPARFVRNLAVPLDGKTA
FT                   SALSSHPVGVVRGTVHEAMLAAFFPTLKAEPFDTKDALLAALRDRKVDAAFADALQLSF
FT                   WVSSPASAKCCALFDGPYLSEHFLGEGMTIMLRQKDSVLTSAIDHALATLSRNGRLQEI
FT                   YLRYFPYGLY"
FT   sig_peptide     227472..227570
FT                   /locus_tag="Rleg_0215"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.848 at
FT                   residue 33"
FT   gene            complement(228380..228793)
FT                   /locus_tag="Rleg_0216"
FT   CDS_pept        complement(228380..228793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0216"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00534 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54527"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0A8"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00534"
FT                   /protein_id="ACS54527.1"
FT                   /translation="MNKPLSAHDALIYVMVMASAVDSTMNDREMERIGQLIGFLPVFRD
FT                   FDDDKLIAVARDCASLLAGPEGLDVVLETVRDTLPAKLYDTAYALAVEVASADLSVKAE
FT                   ELRLLSLLRDRLGLDKLTCAAIERSAIARFRKG"
FT   gene            complement(228896..229606)
FT                   /locus_tag="Rleg_0217"
FT   CDS_pept        complement(228896..229606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0217"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000605 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54528"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0A9"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000605"
FT                   /protein_id="ACS54528.1"
FT                   /translation="MRPAAFITGITGMVVVTGLLLAGEARLGGGTAGEETASAEETATA
FT                   AVDAASDADEGAAISDDRAEMIARSTEPAASPSPAPGDGVTSKPADLPQQADTAAGQTA
FT                   SPSAKKAVELARPMVDNAGMLSFGERRLQLAGIVPTPVDRICGPAGRQWPCGMMAKTAL
FT                   RLLLRNRSVSCDLETVEWKDTVTTACRLGTEDLGAWLAENGWAEAAVGSPLTAAAEKAR
FT                   QAGKGLYGDDPRRH"
FT   sig_peptide     complement(229538..229606)
FT                   /locus_tag="Rleg_0217"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.920) with cleavage site probability 0.912 at
FT                   residue 23"
FT   gene            complement(229618..230295)
FT                   /locus_tag="Rleg_0218"
FT   CDS_pept        complement(229618..230295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0218"
FT                   /product="putative phage repressor"
FT                   /note="PFAM: peptidase S24 and S26 domain protein; KEGG:
FT                   rec:RHECIAT_CH0000606 putative phage-related
FT                   transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54529"
FT                   /db_xref="GOA:C6B0B0"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0B0"
FT                   /inference="protein motif:PFAM:PF00717"
FT                   /protein_id="ACS54529.1"
FT                   /translation="MLSHNQIWEALDRLAERHELTPSGLARRAGLDPTSFNKSKRLSAD
FT                   GRLRWPSTESIAKVLDATGASMEQFMAFMRPDAGLSKQPAGQQENAFPPQGGSIPLLGF
FT                   AQAGAGGFFDDGGFPAGQGWDVVEFPAAPSQKAGVYALEVQGESMMPLYRDGDVLIVEP
FT                   GAQVRRNDRVVVRTNEGEVMAKVLLRQSPRSIELLSLNPEHPNRTLELSDVDWIARIIW
FT                   ASQ"
FT   gene            complement(230418..231065)
FT                   /locus_tag="Rleg_0219"
FT   CDS_pept        complement(230418..231065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0219"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: response regulator receiver; regulatory
FT                   protein LuxR; Sigma-70 region 4 type 2; SMART: response
FT                   regulator receiver; regulatory protein LuxR; KEGG:
FT                   rec:RHECIAT_CH0000607 probable two-component response
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54530"
FT                   /db_xref="GOA:C6B0B1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0B1"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACS54530.1"
FT                   /translation="MHEQTIIIADDHPLFRDALRQAVIGMEGRQSIVEAGDFAAARRAA
FT                   GAHADADLMLLDLAMPGVSGFSGLMALRSEFASLPIVIVSATDDATTIRRALELGASGF
FT                   ISKSSGIDDIRRGIQTVLAGDIATPESYRDGQEQDPDVADLIHRLHTLTPQQSRVLTML
FT                   GEGLLNKQIAYELGVSEATIKAHVSAILLKLDVDSRTQAVIQLGKINMAMVA"
FT   gene            complement(231158..231556)
FT                   /locus_tag="Rleg_0220"
FT   CDS_pept        complement(231158..231556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0220"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000608 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54531"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0B2"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000608"
FT                   /protein_id="ACS54531.1"
FT                   /translation="MKAFVITLGVFFMPLAAAAAEADAGRFQLEKSGDHFIRLDRQSGA
FT                   MSICQDKDGALVCRMAADERAAYEDELDRLAKRVTALEQGNVAQRALPSDAEVDRSISI
FT                   MERMMKSFMGMVKEFQAEENTNPLPQKT"
FT   sig_peptide     complement(231497..231556)
FT                   /locus_tag="Rleg_0220"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.939 at
FT                   residue 20"
FT   gene            231692..232045
FT                   /locus_tag="Rleg_0221"
FT   CDS_pept        231692..232045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0221"
FT                   /product="protein of unknown function DUF952"
FT                   /note="PFAM: protein of unknown function DUF952; KEGG:
FT                   ret:RHE_CH00539 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54532"
FT                   /db_xref="InterPro:IPR009297"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0B3"
FT                   /inference="protein motif:PFAM:PF06108"
FT                   /protein_id="ACS54532.1"
FT                   /translation="MTLTPTLYKIVTETLWQQARQTGTFHGAGIDLQDGFIHFSTADQV
FT                   KQTAALHFAGQSGLLLIAVDGGGFSDKLVFEPSRGGDLFPHLYADLPLAAVLWEAPLPL
FT                   DEAGAHVFPELQP"
FT   gene            232042..233130
FT                   /locus_tag="Rleg_0222"
FT   CDS_pept        232042..233130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0222"
FT                   /product="dihydroorotate dehydrogenase"
FT                   /EC_number="1.3.98.1"
FT                   /note="KEGG: ret:RHE_CH00540 dihydroorotate dehydrogenase
FT                   2; TIGRFAM: dihydroorotate dehydrogenase; PFAM:
FT                   dihydroorotate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54533"
FT                   /db_xref="GOA:C6B0B4"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005719"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0B4"
FT                   /inference="protein motif:TFAM:TIGR01036"
FT                   /protein_id="ACS54533.1"
FT                   /translation="MIDPFKRLARKGLFLFDPETAHGMSIAALKSGLVPACQITPDPRL
FT                   RQTVAGLTFENPLGMAAGYDKNAEVPEALLKLGFGFTEIGTVTPKPQSGNPRPRIFRLV
FT                   EDEAVINRLGFNNEGHDAAFGHLAALRGGGMIGVNIGANKDSEDRIADYVAGIRRFYSV
FT                   ARYFTANISSPNTPGLRDLQGRESLAVLLSAVLAARDEMAAASGRTIPVFLKIAPDLTE
FT                   EGMDDIAAEALSHGLDGLIVSNTTLSRDGLKDQRQAKEAGGLSGVPLFEKSTAVLARMR
FT                   KRVGPDLPIIGVGGVSSAETALEKIRAGADLVQLYSCMVYEGPGLAGDIVRGLSKLLDR
FT                   EKAASIRDLRDVRLDYWAARKV"
FT   gene            complement(233106..234452)
FT                   /locus_tag="Rleg_0223"
FT   CDS_pept        complement(233106..234452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0223"
FT                   /product="MATE efflux family protein"
FT                   /note="TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE; KEGG: ret:RHE_CH00541
FT                   DNA-damage-inducible F protein (Na+ driven multidrug efflux
FT                   pump)"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54534"
FT                   /db_xref="GOA:C6B0B5"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0B5"
FT                   /inference="protein motif:TFAM:TIGR00797"
FT                   /protein_id="ACS54534.1"
FT                   /translation="MDTRSNHNALAFDVTHLMVLSIALPMTLGFMTTPLLGLTNTAVVG
FT                   RMGNAEALAGLAIGAMLFDLILGSFNFLRASTTGLTAQAYGRHDQHEQQAVFFRAMISA
FT                   LGCGLALLCLSPLLMTAGLRLMGAEGAIAEATSTYFSIRMLAAPAALANYAILGFVLGR
FT                   GQGKIGLLLQAIINGINILLSIYLGLTLDWGVAGVAWGTMAGESVGALAGLFIVLNGFG
FT                   KAARPAWAEIFSRHRLAELFALNRDILIRTFVLIGAFTIMTRIGTSFGAVTLAANAVVM
FT                   NFFLLSGYYLDGLANAAEQIIGRAIGAHYRPAFDRGLKLTTLWSFGLAALGSAVFFLAG
FT                   PWLISVLTTSPDVRQAAETYLPWAAVTGLTGALAFVMDGVFIGATWSADMRNRMLISFA
FT                   GYLMMLAIFVPLFGNHGLWLAMNAFLLFRGFFLAMLVRSRADQTFRAAQ"
FT   gene            complement(234538..235035)
FT                   /locus_tag="Rleg_0224"
FT   CDS_pept        complement(234538..235035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0224"
FT                   /product="SCP-like extracellular"
FT                   /note="PFAM: SCP-like extracellular; KEGG:
FT                   rec:RHECIAT_CH0000612 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54535"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0B6"
FT                   /inference="protein motif:PFAM:PF00188"
FT                   /protein_id="ACS54535.1"
FT                   /translation="MTSIDLSRRGLLRLSGLALAAGIAGCTTTPRMAGTPSDGEDETAS
FT                   VLPLVNQLRAKNGLPPLTVDPAASTAALFQAKRMASAGKMAHLMGMTDSFGARVKASGV
FT                   RLPAAENIASGQQSVDAVVTAWINSPHHLENMLGRYGGLGVAVAHNTSSRNLPYWAMVL
FT                   SS"
FT   sig_peptide     complement(234934..235035)
FT                   /locus_tag="Rleg_0224"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.998 at
FT                   residue 34"
FT   gene            complement(235037..235303)
FT                   /locus_tag="Rleg_0225"
FT   CDS_pept        complement(235037..235303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0225"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000613 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54536"
FT                   /db_xref="GOA:C6B0B7"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0B7"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000613"
FT                   /protein_id="ACS54536.1"
FT                   /translation="MSDQANRFLGDSIGRTLIKLIVVSLIVGFVMTVFGLTPWGIIYGI
FT                   RDFIQEIWYRGFSALGRVGDYLLLGATIVIPLFIILRLFSYRR"
FT   gene            235505..236440
FT                   /locus_tag="Rleg_0226"
FT   CDS_pept        235505..236440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0226"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 12; TPR
FT                   repeat-containing protein; Tetratricopeptide TPR_2 repeat
FT                   protein; KEGG: rec:RHECIAT_CH0000614 probable
FT                   methyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54537"
FT                   /db_xref="GOA:C6B0B8"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0B8"
FT                   /inference="protein motif:PFAM:PF08242"
FT                   /protein_id="ACS54537.1"
FT                   /translation="MQPHQLSSGDVIADRRADYARMLEEGGEPEAAAELMEQALELVPA
FT                   WAAGWYRLATYLEKAGRGEAAIEAYRRTLALGPDDIFGAALKLALLGDGAVPPDRPPSR
FT                   YVERLFDDYADRFESALVEKLDYSVPQKLAALIASTGRRYERAVDLGCGTGLLGPEIRA
FT                   NVDRLEGFDLSQNMLAKAAEKHVYDSLAQADLSLAPDLSVVFADAARHRADLVTAADVL
FT                   MYLGNLESVFAIVGELAASGADIAFSVEDAGEGDGFHLAPSLRYAHSESYVRMLLARHG
FT                   FQILKTVKSVIRKDGGKPVSGILFLTQKPA"
FT   gene            236652..237287
FT                   /locus_tag="Rleg_0227"
FT   CDS_pept        236652..237287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0227"
FT                   /product="protein of unknown function DUF161"
FT                   /note="PFAM: protein of unknown function DUF161; KEGG:
FT                   ret:RHE_CH00545 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54538"
FT                   /db_xref="GOA:C6B0B9"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0B9"
FT                   /inference="protein motif:PFAM:PF02588"
FT                   /protein_id="ACS54538.1"
FT                   /translation="MTQLINALGFWNTTATRHTPIEDVQGIFSGSLVAALGLYVLASAG
FT                   LLTGSTAGVAFLLHYAFGVNFGLAFFLLNLPFFYLSWKRLGMAFTIKTFIAIGLTSVIA
FT                   DVQSRFLSISSIHPAWAALLGGLLLGFGLLALYRHRASLGGVGILGIYLQERFGIRAGL
FT                   VQLAIDMCVLAAAFFVTTPPVVFYSVLGAVVLNLFVAINHRADRYIAL"
FT   gene            237441..237608
FT                   /locus_tag="Rleg_0228"
FT   CDS_pept        237441..237608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0228"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54539"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0C0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS54539.1"
FT                   /translation="MSDLEKLVRRRMQEEYAKGASAEEIAKVVRDLFNSVDLSGNRFDA
FT                   VAVRATRDRE"
FT   gene            complement(237674..238135)
FT                   /locus_tag="Rleg_0229"
FT   CDS_pept        complement(237674..238135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0229"
FT                   /product="alkylhydroperoxidase like protein, AhpD family"
FT                   /note="TIGRFAM: alkylhydroperoxidase like protein, AhpD
FT                   family; PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   rec:RHECIAT_CH0000617 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54540"
FT                   /db_xref="GOA:C6B0C1"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0C1"
FT                   /inference="protein motif:TFAM:TIGR00778"
FT                   /protein_id="ACS54540.1"
FT                   /translation="MQPRFNFAKAAPDAYKAVAALEQYVQSSGLERRFIHLIKLRASQI
FT                   NGCAYCVDMHVKEARHDGLSEQWINLMCVWRESPVYDARERALLGWVDSVTNIAKTGAP
FT                   DADYETLKAHFSEEEMTKITVAIGAINIWNRLAVGFRSQHPLDAAAKAA"
FT   gene            complement(238158..238658)
FT                   /locus_tag="Rleg_0230"
FT   CDS_pept        complement(238158..238658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0230"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="TIGRFAM: transcriptional regulator, Rrf2 family;
FT                   PFAM: protein of unknown function UPF0074; Helix-turn-helix
FT                   type 11 domain protein; KEGG: rec:RHECIAT_CH0000618
FT                   putative transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54541"
FT                   /db_xref="GOA:C6B0C2"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0C2"
FT                   /inference="protein motif:TFAM:TIGR00738"
FT                   /protein_id="ACS54541.1"
FT                   /translation="MKIGDGVEQAIHSVAMLSGLSEGGVLSAAALAEFHGVSTSYLLKH
FT                   LQALSGAGILDTVPGPKGGYRLAKAPKEISLLDIVLAVEGSAPAFRCAEIRQRGPNPVS
FT                   DRLFAQPCTINAAMLKAERVYRAELAKTSLADIGIELAAVDDGSIAARGCAFLEIHERK
FT                   TAR"
FT   gene            238791..239423
FT                   /locus_tag="Rleg_0231"
FT   CDS_pept        238791..239423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0231"
FT                   /product="protein of unknown function DUF161"
FT                   /note="PFAM: protein of unknown function DUF161; KEGG:
FT                   rec:RHECIAT_CH0000619 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54542"
FT                   /db_xref="GOA:C6B0C3"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0C3"
FT                   /inference="protein motif:PFAM:PF02588"
FT                   /protein_id="ACS54542.1"
FT                   /translation="MASNAFAGLLNSSADRHSLFDDAQGIVAGSMLAVLGVTLLSSAGL
FT                   LAGGTAGLAFLAHYATGFSFGLCFFVVNLPFYYLAFRRLGLAFTIKTFAAIALTSVLSE
FT                   FISGFVSMAHVDPIAGALFGGLVIGAGMLALFRHRASLGGIGILALYIQDRLGWRAGFV
FT                   QLGFDGTILALSFFVASPFIIACSVLGAIVLNLTIAINHRKDRYIAM"
FT   gene            239420..241981
FT                   /locus_tag="Rleg_0232"
FT   CDS_pept        239420..241981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0232"
FT                   /product="DEAD/H associated domain protein"
FT                   /note="PFAM: DEAD/H associated domain protein; DEAD/DEAH
FT                   box helicase domain protein; helicase domain protein;
FT                   SMART: DEAD-like helicase; helicase domain protein; KEGG:
FT                   rec:RHECIAT_CH0000620 ATP-dependent RNA/DNA helicase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54543"
FT                   /db_xref="GOA:C6B0C4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013701"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR017170"
FT                   /db_xref="InterPro:IPR026362"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0C4"
FT                   /inference="protein motif:PFAM:PF08494"
FT                   /protein_id="ACS54543.1"
FT                   /translation="MKARGSSFSLAFHYLPGVDQIDSEARTLLPAAFTRWFAEKGWRPR
FT                   AHQLELLARAEAGESTLLIAPTGAGKTLAGFLPSLTDLTRRGKIPPGSAFTGIHTLYVS
FT                   PLKALAIDIERNLMKPVEEMGLPVTVENRTGDTPNAKRQRQKLNPPDILLTTPEQVALL
FT                   LANREAERFFKDLKYIVLDELHSLVTSKRGHMLSLGLARLRRLAPGLKTIGLSATVAEP
FT                   MDLQKWLVGQEEGGEHHAGLVVVEGGAKPDISILSTEERIPWAGHSARYAIPDVYNKLV
FT                   EHRTTLLFVNTRSQAEMLFQALWTINDDNLPIALHHGSLDVAQRRKVEAAMAENRLRAV
FT                   VATSTLDLGIDWGDVDLVIHVGAPKGASRLAQRIGRANHRMDEPSKAILVPANRFEVME
FT                   CQAALDANYIGAQDTPPVGRGALDVLAQHVLGMACAEPFDMLELYDEIISASPYADLSW
FT                   ETFERIIDFVATGGYALRTYERYARIRKTAEGRWRVSNPAVAQQYRLNLGTIVESPMLN
FT                   IRMVKRGEGGRIGRGGATLGKVEEYFLEQMSPGDTFVFSGKVLRFEGIRENECLASQAF
FT                   SLDPKIPSYNGGKFPLSTYLAEQVRAMIADPDRWRRLPDQVRDWLSLQNDKSMLPKRDE
FT                   FLIETFPRGSRGYMVAYPFEGRLAHQTLGMLLTRRLERIGAKPLGFVATDYSLAVWGLE
FT                   DMGLMIRNGRLNLSDLFDEDMLGDDLEAWLDESFLLKRTFRNCAVIAGLIERRHPGKEK
FT                   SGRQITVSADLIYDVLRSHEPDHILLQATRQDAATGLLDIGRLGDMLRRIRGHITHRAL
FT                   DHISPLAVPVMLEIGREAVPGEAHDALLAEAADDLIAEALA"
FT   gene            242024..242749
FT                   /locus_tag="Rleg_0233"
FT   CDS_pept        242024..242749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0233"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG:
FT                   rec:RHECIAT_CH0000621 putative phosphoesterase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54544"
FT                   /db_xref="GOA:C6B0C5"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR024173"
FT                   /db_xref="InterPro:IPR026336"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0C5"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ACS54544.1"
FT                   /translation="MNRLALARDISGLAAIPGIETSVNGIAAVCDPLGALYLPDAGLLV
FT                   VSDLHLEKGAAFARRGMMLPPYDTLATLTVLAAVISRYDPKLVISLGDNFHDRIGSKHL
FT                   PENFRTLIVNMARGREWIWINGNHDPDGIVDLPGTSADEMHYAGLTFRHEPKNGLQSGE
FT                   IAGHLHPSATVRRREKSVRRPCFATDGARLLMPAFGLMSGGLDLGHQAMKGLFDKALLV
FT                   AHLLGRDRIYSVRYGNLRG"
FT   gene            complement(242782..243363)
FT                   /locus_tag="Rleg_0234"
FT   CDS_pept        complement(242782..243363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0234"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00551 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54545"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0C6"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00551"
FT                   /protein_id="ACS54545.1"
FT                   /translation="MRTRIVLTAVGLALLAGCATAPKQTRNICAVFDERDGLFSSWQSA
FT                   AERTEKKYGVPVPILMATMYTESGFQPYARPPRTKLFGFIPWTRPSTAYGYSQALDGTW
FT                   DHYQSQTGNWTARRANFADAIDFIGWYHYQNSVETGIPLNDAYNLYLAYYSGPTGYKRG
FT                   DWRSNGQLQQTAQKFARMAGTYQRQLQECD"
FT   sig_peptide     complement(243301..243363)
FT                   /locus_tag="Rleg_0234"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.951) with cleavage site probability 0.671 at
FT                   residue 21"
FT   gene            complement(243512..244069)
FT                   /locus_tag="Rleg_0235"
FT   CDS_pept        complement(243512..244069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0235"
FT                   /product="bifunctional deaminase-reductase domain protein"
FT                   /note="PFAM: bifunctional deaminase-reductase domain
FT                   protein; KEGG: rec:RHECIAT_CH0000623 putative dihydrofolate
FT                   reductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54546"
FT                   /db_xref="GOA:C6B0C7"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0C7"
FT                   /inference="protein motif:PFAM:PF01872"
FT                   /protein_id="ACS54546.1"
FT                   /translation="MRKLIVWNLMTLDGYFEGTKPWDIDFHNLAWGPELQRYAEQFGRE
FT                   SDLLVFGRKTYEGMASYWPTAEGEGEIKTYMNGIAKIAVSRTMSEPGWNNARVVSDPIP
FT                   ELTRLKQEDGKTILIFGSAELADSLLKAGLIDEVRVCLVPVILGGGNPLFKQAEGQLPL
FT                   KLIESSTTEGGAVILRYEPVKA"
FT   gene            complement(244271..245071)
FT                   /locus_tag="Rleg_0236"
FT   CDS_pept        complement(244271..245071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0236"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000624 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54547"
FT                   /db_xref="GOA:C6B0C8"
FT                   /db_xref="InterPro:IPR019088"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0C8"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000624"
FT                   /protein_id="ACS54547.1"
FT                   /translation="MRLAAAFIALLCLLPASAGAQWLPGQATEAVREGLEIGTSTSEIA
FT                   ITSDFHGADLTIFGALSNTDQLLLAVGQYDVVVVLEGPREDATVRKKERVFGIWVNTRS
FT                   MTFEAVPHSYSMSSSRMIDDIVTPLDLTDQGIGIDHIPLTPVGFVGDGSNLGEFREAFR
FT                   RLQQGGGLYDRNPSGVRFVSSNLFKASLRLPANIPNGVHSVRAYLFKSGLFVTEKSLPL
FT                   RVIKTGIEQTITDAAHDQPILYGFAAVLLAVITGWGASLIFRKD"
FT   sig_peptide     complement(245009..245071)
FT                   /locus_tag="Rleg_0236"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.967 at
FT                   residue 21"
FT   gene            complement(245071..245994)
FT                   /locus_tag="Rleg_0237"
FT   CDS_pept        complement(245071..245994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0237"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   ret:RHE_CH00554 putative permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54548"
FT                   /db_xref="GOA:C6B0C9"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0C9"
FT                   /inference="protein motif:PFAM:PF01925"
FT                   /protein_id="ACS54548.1"
FT                   /translation="MTIYLPIAELSVNIFIILGMGAAVGFLSGMFGVGGGFLITPLLIF
FT                   YNIPPVVAVATGANQVVASSISGAITHFRRGSLDVKLGTVLLVGGLTGATVGIWIFSLL
FT                   RAIGQLDLIISLMYVVFLGTVGGLMLLESINAMRRAARNEPPAPRKPGHQHWVHKLPLK
FT                   VRFKKSKIYLSVIPIVALGFAIGILTSIMGVGGGFIMVPAMIYLLRIPTNVVVGTSLFQ
FT                   IIFVTAYTTIVQAATNFSVDIVLAFILMVAGVIGAQYGVRVGQKLRGEQLRALLGLLVL
FT                   AVGVRLAIALVVTPADVYSVVMGAGN"
FT   gene            complement(246309..250100)
FT                   /locus_tag="Rleg_0238"
FT   CDS_pept        complement(246309..250100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0238"
FT                   /product="Peptidoglycan-binding domain 1 protein"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein; Sel1
FT                   domain protein repeat-containing protein; SMART: Sel1
FT                   domain protein repeat-containing protein; KEGG:
FT                   rec:RHECIAT_CH0000627 putative hemaglutinin protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54549"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0D0"
FT                   /inference="protein motif:PFAM:PF01471"
FT                   /protein_id="ACS54549.1"
FT                   /translation="MNGSRSNPSRQSDRTSLDALNRTIEGLEARIEGLMGSGREQRPRT
FT                   AAAERDPYAASHAPRPAKAPPEPRPDPLAEIRQRQRALEASRERPYAREQAPQLREPAP
FT                   RAAAPVPAPALRAGNDTMTEIAQALVNLRQDLKRDISEGVTREMNALRAELREIKTNAG
FT                   DGRFADDMRADMGRLAQSITQLTGRSVAPEATGLREDFEELRSLMDGLAREDSLRHMEN
FT                   RWDGFENRLAALDTEGLQEELVSLAYRLDDIKRHIGGMGESPAVRALEDKLISIATAME
FT                   HFGNMIQPHDRVMSEQFAAMDMRLDEISRAIAASGRTATTNDPGLMQRLENRLEALADQ
FT                   IDLMSHDAASRVNPADELAMRLEALTGRVEEMTKAEATSRLDERLEHLSYLLERTQETA
FT                   PQADLTGTLSDISRKIDALENGAVNDVLAQRLDHLARRIDEMAHQQQAPAPAAVADDSA
FT                   FLRLEGRLSDIAARLEESTSAAPTDPRALKNLEDQIANLSALMSAPRESAVIPPEFDQR
FT                   MGAIEDYMATSDEYIIEAARQAAEAVVEAYSRHGGPQGVMPAADMSALTALAEDLRHLE
FT                   DLSRDSEERTHKTFQALHETLVHIADRLDGMEDRGRPLAQMPVADVDFDVDPYALMVAE
FT                   AELNRTPATAQTAKASPVIRTAEVAAEPAAPAQATAMSGTSAIAIEAATRTTEVATAAR
FT                   AQAPAKASLLASLGKRLLPGKKAESRATERPMIDPAPSIDPTDVVPTDAANELLEPGSG
FT                   APDVKKILERVRASQSAARGKPAGETDRADYIAAARRAAQAAAMEVDANPKQAAVKAEK
FT                   KGANADKAGKTSDKTGKTSAFSRYRRPILLAVGAVLLAIMAFPLARTLTSGERAPQPPA
FT                   EVSALTGAAENPAPPLPEATPAQPDAAALGTTAPAAEAVPPAAEQAQPEATPPDAGEHL
FT                   TDVAPLDGEGAATLAPPGPSGAAQETSGFVPNAPAAAAPAPAITIPDTVQPKSLADAAS
FT                   SGDTLALFEIGARYSDGRNGMTVDQKQAASWYQLAADKGFAPAQYRLGSMYEKGNGVER
FT                   DITKAKGFYEQAANQGNASAMHNLAVLYASGALGQQDYATAAAWFTKAANLGITDSQFN
FT                   LAILCARGNGVPADLEESYKWFAIAAKGGDKDAAQKRDEVAKAMKPDQLERARAKADLW
FT                   KPEPVDHRTNAIDIPDEWAGTGAKTASVDMKKAVRNIQAILNNNGFDAGVPDGEMGAKT
FT                   VTAIKNFQKSVGQEPDGKVTDATVKALLERNKQAGKAI"
FT   gene            complement(250427..250792)
FT                   /locus_tag="Rleg_0239"
FT   CDS_pept        complement(250427..250792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0239"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: rec:RHECIAT_CH0000628 putative
FT                   lactoylglutathione lyase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54550"
FT                   /db_xref="GOA:C6B0D1"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0D1"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACS54550.1"
FT                   /translation="MPRLDHVTIETRDAPVMIGFLETLLGVREGYRPPFASPGHWLYLD
FT                   ECPVIHLSLTSRSTDFPPGIFNHVAFSLYEFEPALERIKATGYRYEYYDIPDTDLGQVF
FT                   VYGPEGVKIELQYPRPA"
FT   gene            complement(250879..251580)
FT                   /locus_tag="Rleg_0240"
FT   CDS_pept        complement(250879..251580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0240"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bja:blr7900 putative nodulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54551"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0D2"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACS54551.1"
FT                   /translation="MTDFPYESALIVGAGSGISASLARQLSAQGVKVGLAARNIEKLQG
FT                   LIEETGASAFTTDVSQPASVAALFEEAAAAIGGPDVVIFNASARQRGPLAELDPADVEK
FT                   AIATSAFGGFLVVQQAARRMIPRGRGAILITGASASVKGFAQSAPFAMGKFALRGLAQS
FT                   AARELGPMGIHVAHFVIDGAVRSQIRPDRVEKPDGTLLPEAIAQTYIDVLRQHRSAWSL
FT                   EVEVRPWTESF"
FT   sig_peptide     complement(251509..251580)
FT                   /locus_tag="Rleg_0240"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.606) with cleavage site probability 0.317 at
FT                   residue 24"
FT   gene            251851..253647
FT                   /locus_tag="Rleg_0241"
FT   CDS_pept        251851..253647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0241"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   rec:RHECIAT_CH0000630 acyl-CoA dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54552"
FT                   /db_xref="GOA:C6B0D3"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0D3"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ACS54552.1"
FT                   /translation="MPVYKAPVNDTLFVLNDVLGLERYNNLPGFADATPDMIEAILGEA
FT                   GRVAEEALFPLNYSGDQEGCTRHDDASVSTPKGFKEAYKAYREGGWIGLAVPEEFGGQG
FT                   LPYTLHTAVGEYTSAANMSLMMYPGLTQGAIAALLVHGSDEQKATYLPKMVDGTWSGTM
FT                   NLTEPHCGTDLGMLRTKAVPQADGSYKISGQKIFISAGEHDLTGNIIHLVLARIEGAPE
FT                   GTKGISLFIVPKFLVGKDGAPGARNAVSCGAIEHKMGIHANATCVMNYDEATGFLIGAE
FT                   NRGLNAMFVMMNEARLMVGLQGIAISEIAYQNAASYARDRIQGRSLSGPKAPDKKADPI
FT                   IVHPDIRRTLMTIRAFNEAGRAFLLWTALKSDIAHRASDEKERQTADDILGLVTPILKG
FT                   VMTDKGFDHAVMAQQVFGGHGYIEEHGMSQYVRDARIAMIYEGANGIQALDLVGRKLAL
FT                   NGGRAAMALFKEIGDFCEENRGNEKLSFFTKHLKKGLNDAQGATMWFMQNAMAKPDNAG
FT                   AGSTDYMHLFGLVILGYMWAKMAKAAEDGLASGDAAREEYLKNKLVTARFFMERLMPET
FT                   ALRKARIEAGADTMMELAAEAF"
FT   gene            253787..254995
FT                   /locus_tag="Rleg_0242"
FT   CDS_pept        253787..254995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0242"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /note="KEGG: ret:RHE_CH00558 acetyl-CoA acetyltransferase;
FT                   TIGRFAM: acetyl-CoA acetyltransferase; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54553"
FT                   /db_xref="GOA:C6B0D4"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0D4"
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /protein_id="ACS54553.1"
FT                   /translation="MTEVFIYDHVRTPRGRGKKDGALHEVPSVRLAAKTLEAIRDRNGL
FT                   DTATVDDIIMGCVDPVMDAGAVIPKAAAFEAGYSTKAPGMQISRFCASGLDAVNFGAGK
FT                   IAQGADDIVIAGGVESMSRVGLGMSGGAWFMDPSVNFPAYFMPQGVSADLIATKYGFSR
FT                   TDVDAYAVESQKRAAHAWEKGWFDKSVIPVKDQNGLTILAKDEHMRPGTDMQALASLNP
FT                   SFQMPGEMGGFEAVGIQAHPEIERINYVHHAGNSSGIVDGASVVLLGSKAGGQSMGKKP
FT                   RARIKAFANIGSDPALMLTGPVDVTEKLLKRSGMSLSDIDLFELNEAFAAVVLRYMQAF
FT                   DIDHDRINVNGGAIAMGHPLGATGAMILGTVLDELERRDLNTALVTLCIGAGMGTATVI
FT                   ERV"
FT   gene            254998..255381
FT                   /locus_tag="Rleg_0243"
FT   CDS_pept        254998..255381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0243"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   bac:BamMC406_6039 cupin 2 domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54554"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0D5"
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /protein_id="ACS54554.1"
FT                   /translation="MGFNTGTIETEYAEVSEHWSPRVIADLNGQSVKLAKVRGQLAWHS
FT                   HRDEDELFLIWKGALTIEYRDRPHVHLKSGDFHVVPRGVEHNPVAEEECWIVLFEPSLT
FT                   KHTGDVVTEKTKTLDAQRSHLPA"
FT   gene            255398..257611
FT                   /locus_tag="Rleg_0244"
FT   CDS_pept        255398..257611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0244"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase NAD-binding"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase NAD-binding;
FT                   Enoyl-CoA hydratase/isomerase; 3-hydroxyacyl-CoA
FT                   dehydrogenase domain protein; KEGG: ret:RHE_CH00559
FT                   enoyl-CoA hydratase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54555"
FT                   /db_xref="GOA:C6B0D6"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0D6"
FT                   /inference="protein motif:PFAM:PF02737"
FT                   /protein_id="ACS54555.1"
FT                   /translation="MTYTNFTLETDADGIALVTWDMPGKSMNVFTAEVMAELDAIIDAT
FT                   TADAAVKGVVFTSGKSSFSGGADLSMIKSMFSSYQEEKAKSPETAVQNLFGLVGRMSGL
FT                   FRKLEISGKPWVSAINGTCMGGAFELSLACHGRVASNAKSVKIALPEVKVGIFPGAGGT
FT                   QRVPRLANAQDALQMMTTGQSLTGSRAKAMNLVHQVVEPDQLIPAAKQMIKDGLKPVAP
FT                   WDEKGFKAPGGGIWTPASAQLWPAAPAILRRETSGNYPAALAILKCVYEGLQVPFDTGL
FT                   KIEQRYFTEVLQTREAFSMIRSLFISMQELGKGARRPAGHAKTELKHVGVVGAGFMGAS
FT                   IAYVTAAAGIPVTLIDRDIEAATKGKTVSEGLVKDSIGKGRLTQDEAAALLSRITPSAD
FT                   YADLANADLVIEAVFEDREVKKAVIEAVEAVLPEGAIFASNTSTLPISGLAKNSKRPAD
FT                   FIGIHFFSPVEKMMLTEVILGSDTGDKALAVALDYVAAIRKTPIVVNDTRGFFVNRCVL
FT                   RYMSESYDMLIEGVPPVMIENAAKMAGMPVGPLALNDEVAIDLSLKILKATVADLGEKA
FT                   IDPRHMDLISSMVEKEGRFGRKNSKGFYDYPPKPAKKSLWPDLKSFYPQKQADEVDVNV
FT                   LKQRFLVTIALEAARTVEEGIVTDPREADVGSILGFGFAPYTGGALSYIDGMGAKAFVE
FT                   LAEKLAGTYGKHFKPTPLLKDMAAKGETFYGRFDPYAKVGKAA"
FT   gene            257728..258291
FT                   /locus_tag="Rleg_0245"
FT   CDS_pept        257728..258291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0245"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_3660 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54556"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0D7"
FT                   /inference="similar to AA sequence:KEGG:MXAN_3660"
FT                   /protein_id="ACS54556.1"
FT                   /translation="MQPSTDILAFADPMEWESWLCLHHAASTGAWLKIGKKNPKRTLIT
FT                   IDEALDVALCYGWIDSQRKGFDAHSYLQRYSPRRAKSSWSKLNVDRVAALAETGRMRPA
FT                   GLAEVAAAKADGRWAVAYAPQRDAGLPDDLAAALAENAAADAAFARLDKTGQYAIVLPL
FT                   LKATTPEVRVARLGKAITRLAQAE"
FT   gene            258573..258782
FT                   /locus_tag="Rleg_0246"
FT   CDS_pept        258573..258782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0246"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="PFAM: Cold-shock protein DNA-binding; SMART: Cold
FT                   shock protein; KEGG: rec:RHECIAT_CH0000633 cold shock
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54557"
FT                   /db_xref="GOA:C6B0D8"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0D8"
FT                   /inference="protein motif:PFAM:PF00313"
FT                   /protein_id="ACS54557.1"
FT                   /translation="MSTGTVKWFNATKGFGFIQPDDGAADVFVHISAVERAGMRDLKDG
FT                   QKLSYELVRDNKSGKMSADRLQAA"
FT   gene            complement(258973..259407)
FT                   /locus_tag="Rleg_0247"
FT   CDS_pept        complement(258973..259407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0247"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: rec:RHECIAT_CH0000634 probable
FT                   transcriptional regulator protein, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54558"
FT                   /db_xref="GOA:C6B0D9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0D9"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACS54558.1"
FT                   /translation="MEGDAFSAFAITALRLAGHLTAAGDQLAKPAGQTSARWQVLAAAR
FT                   RGGMSVAQIARALGVARQGVQRLADVLENEGLIAYADNPQHQRAKLVRLTEEGAARLGV
FT                   IEIAQAGWADGLGAAFTSAELDAARVVMARVMEMLEGGEA"
FT   gene            259523..259927
FT                   /locus_tag="Rleg_0248"
FT   CDS_pept        259523..259927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0248"
FT                   /product="glutathione-dependent formaldehyde-activating
FT                   GFA"
FT                   /note="PFAM: glutathione-dependent formaldehyde-activating
FT                   GFA; KEGG: ret:RHE_CH00562 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54559"
FT                   /db_xref="GOA:C6B0E0"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0E0"
FT                   /inference="protein motif:PFAM:PF04828"
FT                   /protein_id="ACS54559.1"
FT                   /translation="MKKTYRGSCHCGKVHYQVDMDLEEGTGRCNCSICAKRRYWGANVK
FT                   PEDFRLMCDQAETSDYQFNTMSGHHRFCRTCGVPAYGDGYVEQIGGAYVSINIACLDDI
FT                   TPEELAALPVRYADGRHDAWWNEPAVTSYL"
FT   gene            260021..260464
FT                   /locus_tag="Rleg_0249"
FT   CDS_pept        260021..260464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0249"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000636 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54560"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0E1"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000636"
FT                   /protein_id="ACS54560.1"
FT                   /translation="MKDEANARIEEEAIIAMLMMRAKALGEKNASDALSYEAEDSVEFS
FT                   LAPPLVYHGQDEAGLQAWFDTWEGPIGGEVRDARLTVGEDVAFWSGLTRMSGTKTDGTA
FT                   VDLWFRQTLGLVKQDGRWLVAHQHASVPFAMDGSGRALLDLKP"
FT   gene            complement(260474..261676)
FT                   /locus_tag="Rleg_0250"
FT   CDS_pept        complement(260474..261676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0250"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rec:RHECIAT_CH0000637 probable transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54561"
FT                   /db_xref="GOA:C6B0E2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0E2"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACS54561.1"
FT                   /translation="MFAAAKSTENSPRPSIGFHALTLATFFGASAAPTPLYRIYQESFS
FT                   VSPVLITVIFAVYAFALLAALLIAGSISDHLGRKPVIFFALVLEIAAMGLFVVASGPAW
FT                   LIAARIVQGLATGIAGASIGAALVDVDRAKGQIVNSIAPLCGMAVGAVGTSALIQYGPF
FT                   PMHLVYALLLVAFTLQAAAIWLTGETGGTRPGALGSLIPRVTIPQQVKRPLSLVTPINI
FT                   ANWTLAGFYLSLVPSLVASTTGSRAPLTGGAVVTALMVSGAIAVYLRRSKTASANLVFG
FT                   VSAKTLGILTVVAGVHLANVPLLLVGTIFTGVGFGTNFLGSIGTIMPLAKPDERAGLLS
FT                   AFYVQSYLAFSLPAILAGFLAKSAGYALTTDIYATAILLLMGVGMVSIRADRRRVAESA
FT                   A"
FT   sig_peptide     complement(261581..261676)
FT                   /locus_tag="Rleg_0250"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.850) with cleavage site probability 0.850 at
FT                   residue 32"
FT   gene            261814..262371
FT                   /locus_tag="Rleg_0251"
FT   CDS_pept        261814..262371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0251"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG:
FT                   rec:RHECIAT_CH0000638 probable transcriptional regulator
FT                   protein, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54562"
FT                   /db_xref="GOA:C6B0E3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0E3"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACS54562.1"
FT                   /translation="MTVKENLRPGGRSARVQASVHKAVRELMAEMSRAEVTIPLIAGKA
FT                   GVTPSTIYRRWGDLQELLADVAVDRLRPDMQPIDAGSGKADLETWAEQYAEEMSSGPGR
FT                   EMIRDVLAAQAGANACKCAEFTRQQVDVIAERAKARGEAFPDVDRVMDQVVAPIMYRIL
FT                   FGDVPATARVRDLVARVMSATD"
FT   gene            complement(262483..266007)
FT                   /locus_tag="Rleg_0252"
FT   CDS_pept        complement(262483..266007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0252"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   response regulator receiver; PAS fold-4 domain protein;
FT                   histidine kinase A domain protein; SMART: ATP-binding
FT                   region ATPase domain protein; response regulator receiver;
FT                   histidine kinase A domain protein; KEGG: ret:RHE_CH00566
FT                   two-component sensor histidine kinase/response regulator
FT                   hybrid protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54563"
FT                   /db_xref="GOA:C6B0E4"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0E4"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACS54563.1"
FT                   /translation="MLPGWVIFASAFGYLLLLFAVASYGDRKNRSPGTLDRGRGTLEGG
FT                   WPVVYALSLAIYCTSWTYFGSVGLAAQRGLEFAGIYIGPILVFTLGMPLLRRIIELAKA
FT                   EKLTSVADFVAARYGKNPTVATIVALISLIGAIPYIALQLKAISSTVSAMVNPSDYGIG
FT                   SGNLYFLDLPLVATLVLACFAIMFGTRHTDATEHQDGLILAVSMESVVKLVAFLTAGVC
FT                   VIWFLFDGPTDLWRRTVDNELVMSALNYHTPISRWITLIILSAFAIILLPRQFHVTVVE
FT                   NRTPKQLKLAGILFPSYLIAINLFVLPVAIGGLLTFGGSGNADFYMLSLPLAGQMPVIS
FT                   LIIFIGGFSAATAMVIVDSVALSIMVSNDIIMPIFLRRKLAGRASLRDNFAKTLLNIRR
FT                   SAIFAVLLFGYAYYRSTDSTAGLASIGLLSFAAIAQIAPALFGGLIWRRANARGAILGL
FT                   SSGFIIWIYLLFLPSLGGPDYSYVASAVLGFIFPGTTLFTAPDADPLVNATAMSLLVNT
FT                   AFFVVGSLTRNAKPLERIQAGIFVKRHSRSQFATRGWKTRISVGDLKAAISRYLGEERM
FT                   QRSLTTYEQSSGRKLEDEQPADMALIHFSEQLLGSAIGSSSARLVLSLILQKIEDASSD
FT                   TAWLLDQASEALQYNQDMLQTALSQMDQGIAVFDSSNRLTIWNRRFRQLLDLPESAGQV
FT                   GFPLSDIVTTLIQRGDIAPGDLSQTVRHFLTLDKPFSLVLGGGERIIEVRSNAMPDKGI
FT                   VATFTDITQRVSADQALKQANETLEQRVAERTAELTRVNRELGEARAAADEANIGKTRF
FT                   FAAAGHDILQPLNAARLYSSALVERMAQSENSLIVRNIDSALESVETILGAVLDISRLD
FT                   TGAMRPRLASVALSDLLERIQTDFAPIAREKQLKLVIMPTSLRVRSDPNLLRRLVQNLV
FT                   SNAIKYTISGKVLVGARRRGNQVIIQVIDSGIGIPPSKFRTVFKEFARLDEGAKTASGL
FT                   GLGLSIVDRIARVLNHPVELQSTHGKGTEFRIAMPLDVSRPAAATAAITPADRPGQPLS
FT                   GLKILCIDNEPKILEGMRLLISGWGCEVEALDCLADVIALDGQEGPPDIVIADYHLGDG
FT                   TGIAAILHLRRQFGADIPALLITADRTPEVRSEAERDGIAVQHKPVRPAALRAYITQIS
FT                   GLKRAAAE"
FT   sig_peptide     complement(265930..266007)
FT                   /locus_tag="Rleg_0252"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.798) with cleavage site probability 0.650 at
FT                   residue 26"
FT   gene            266230..266667
FT                   /locus_tag="Rleg_0253"
FT   CDS_pept        266230..266667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0253"
FT                   /product="large conductance mechanosensitive channel
FT                   protein"
FT                   /note="TIGRFAM: large conductance mechanosensitive channel
FT                   protein; PFAM: large-conductance mechanosensitive channel;
FT                   KEGG: rec:RHECIAT_CH0000640 large-conductance
FT                   mechanosensitive channel transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54564"
FT                   /db_xref="GOA:C6B0E5"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR019823"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0E5"
FT                   /inference="protein motif:TFAM:TIGR00220"
FT                   /protein_id="ACS54564.1"
FT                   /translation="MLNEFKAFIARGNVMDLAVGVIIGGAFGGIVKSLVDDLIMPIVGA
FT                   IFGGFDFSNYFLPLSSAVNAQSLAAAREQGAVFAYGSFLTVLINFLILAWIIFLMVKGV
FT                   NTLRAQVERQEKVAPEELPAPPADVQLLTEIRDLLATRPTA"
FT   gene            266790..267956
FT                   /locus_tag="Rleg_0254"
FT   CDS_pept        266790..267956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0254"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   ret:RHE_CH00568 aspartate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54565"
FT                   /db_xref="GOA:C6B0E6"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0E6"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ACS54565.1"
FT                   /translation="MSIVSSLSPRALAAPESGIVELVNYARGREGLLPLWVGEGDLPTP
FT                   DFISRAAMDALASGETFYTWQRGIPELRQALSDYYDRHFGIRLPVEHFYVTGSGMQAIQ
FT                   IAVQALTSPGDELVYLSPSWPNIAAALEIAGARSLSVELQFEGGKWAVDLDRIETAITP
FT                   KTKGIFINTPSNPTGWTATKQDLGDLLALARKHDLWIMADEIYARYYFAGGRAPSFLDV
FT                   MEPDDKIIFVNSFSKNWSMTGWRVGWIVAPPEMGQVLENLIQYSTSGVAQFMQKGAVAA
FT                   LDQGDDFVAANIAKAARSRDTLCDALVATNRVETLKPDGAIYAFLKIDGVADSRTAALD
FT                   IVDKTGVGLAPGTAFGSGGELFLRACFLRDPTQVAIAAERLCDYILKL"
FT   gene            268177..269211
FT                   /locus_tag="Rleg_0255"
FT   CDS_pept        268177..269211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0255"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /note="TIGRFAM: UDP-glucose 4-epimerase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; Male sterility domain;
FT                   polysaccharide biosynthesis protein CapD; short-chain
FT                   dehydrogenase/reductase SDR; dTDP-4-dehydrorhamnose
FT                   reductase; KEGG: ret:RHE_CH00569 UDP-glucose 4-epimerase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54566"
FT                   /db_xref="GOA:C6B0E7"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0E7"
FT                   /inference="protein motif:TFAM:TIGR01179"
FT                   /protein_id="ACS54566.1"
FT                   /translation="MAVLVTGGAGYIGSHMVWALLDAGEDVVVLDRLSTGFRWAVAPAA
FT                   RFYLGDVADPDILKKVFIENDIEAIIHFAGSAVVPVSVADPLSYYDNNSGKTRALLSAS
FT                   VKAGIRNFVFSSTAAVYGQQKTDLPVKETAPLNPENPYGQSKLMTEFMLRDAAAAYDFN
FT                   YVALRYFNVAGADPHHRAGQSTSGATHLIKVACEAALGRRDSVNVYGVDYPTHDGTGVR
FT                   DYIHVSDLTDAHLKALQHLRRSKGSLVANCGYGSGYSVLDVLNMVTRLHGHSFKIHMAP
FT                   RRAGDSASVVADASLARQVLDWKPRYDSLETIVQSSLDWELFLSNKNVDDLHSIHRALA
FT                   AASF"
FT   gene            269319..271280
FT                   /locus_tag="Rleg_0256"
FT   CDS_pept        269319..271280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0256"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="KEGG: rec:RHECIAT_CH0000643 putative sensory
FT                   box/GGDEF family protein; TIGRFAM: diguanylate cyclase;
FT                   PFAM: EAL domain protein; GGDEF domain containing protein;
FT                   SMART: EAL domain protein; GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54567"
FT                   /db_xref="GOA:C6B0E8"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0E8"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACS54567.1"
FT                   /translation="MKNFLASLQLQKDNPTLLLAQFRALSSQIPILYVLLVINALAVAI
FT                   THLKSAPLWLSLYIPVALSVVCVFRLCWWEIRGKENVTAERAYRLMKLTISGAGILAVA
FT                   FGSWAIALYQYGDASQQGQIAYFLVVTGISCIFCLMHLPMAAALTTVITFSAMVATFLF
FT                   SGNPVFVATAISGLFLILPFLRVINSYFQNFVGLVQLTEELKQKQAEAEELNLVNSRNA
FT                   LHDQLTGLANRRSFFLSLEKRLQKDSSTPPVLGILDLDGFKPVNDVFGHAAGDLVLKET
FT                   ARRFVALVGEEGIVSRLGGDEFGIIFPSLMTRQAIADLGQALCAAVRDPFEIPDGSVRV
FT                   FGSCGIVYPDIGTYTAEDLYEKADFALYQVKSKRSSGVEFFSAEHEKILTQRHLIELEL
FT                   QANDFAKELKLDYQPIVELRSGRVVAYEALARWDSARFGRISPDAFIPAAERTAVIGRI
FT                   TRILFAKALEALAIIPRHLRLSFNLSARDICDHETSMALLAMITRSGIDPKRIEFEITE
FT                   TALLSDFDTADQVISMLRAAGISIALDDFGTGYSSLSHIHRLGFDKLKIDKSFVMNFDR
FT                   DARCMNITRSVANLCQNLGIASVAEGVESEEIAEGLKAMGVRLAQGYHFSRPLPLELAI
FT                   DYAARCEAAASARNSLSA"
FT   gene            271364..272416
FT                   /locus_tag="Rleg_0257"
FT   CDS_pept        271364..272416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0257"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   rec:RHECIAT_CH0000644 probable enoyl-CoA hydratase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54568"
FT                   /db_xref="GOA:C6B0E9"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR032259"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0E9"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ACS54568.1"
FT                   /translation="MQDGEVIIERRGTAGVIRLNRPRALNSLTLPMIRTITAALHDFAG
FT                   DPEVASVVATGEGERGFCAGGDIRALHESARAGDGLAASFWREEFRLNHMIASYPKPYV
FT                   ALMDGITMGGGVGLSSHGRHRIVTERTRLAMPETGIGYVPDVGATWLLPRGPGEAGTWL
FT                   GLTGLDIGAADAIHARLADLQIASSRLGEAIDALSALPRASSSGDVDAVLQALPEPQGE
FT                   SRLRQNAAMIDRAFCFDNVEEILATLAEEEGEFAAETRRVLLTRSPTSLKLALRLLRAG
FT                   RSSASLAECLGRELGACLRMLDNPDFFEGIRAAVIDKDRNPKWSPASVEAVEVARVEHF
FT                   LKPAEPPLSL"
FT   gene            complement(272428..274485)
FT                   /locus_tag="Rleg_0258"
FT   CDS_pept        complement(272428..274485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0258"
FT                   /product="UvrD/REP helicase"
FT                   /note="PFAM: UvrD/REP helicase; KEGG: rec:RHECIAT_CH0000646
FT                   ATP-dependent DNA helicase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54569"
FT                   /db_xref="GOA:C6B0F0"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0F0"
FT                   /inference="protein motif:PFAM:PF00580"
FT                   /protein_id="ACS54569.1"
FT                   /translation="MYLEKLNPQQRMAVEHGTLIDGSHIAGPLLVIAGAGSGKTNTLAH
FT                   RVAHLIVKGADPRRILLMTFSRRAAAEMARRVERICRDVLGANAGVMADALSWSGTFHG
FT                   IGARLLRDYAEQIGLDPGFTIHDREDSADLMNLIRHDLGFSKTESRFPTKGTCLAIYSR
FT                   AVNSETALDLVLRDVFPWCATWEKQLRELFASYVEAKQSQNVLDYDDLLLYWAQMVGEA
FT                   MIAEDIGSRFDHVLVDEYQDTNRLQASILLALKPQGQGLTVVGDDAQSIYSFRAATVRN
FT                   ILDFPAAFSPAANIVTLDRNYRSTQPILAAANAVIDLASERFTKNLWTERQSSERPRLV
FT                   TVRDEAEQARYITDMVLDNREEGLTLKQQAVLFRASHHSGPLEVELTRRNIPFVKFGGL
FT                   KFLDSAHVKDMLAALRFAQNPRDRVAGFRLMQILPGVGPSTAQKTLDLMAEDASPITAL
FT                   GAMPAPPRSGEDWTMFVAMLQELKTGKAGWPAEIGLARQWYAPHLERLHEDAATRQADL
FT                   LQLEQIASGYASRERFLTELTLDPPDATSDQAGVPLLDEDYLILSTIHSAKGQEWTKVF
FT                   MLNVVDGCIPSDLAVGTTAEIEEERRLLYVAMTRARDGLDLVVPQRFFTYGQNSQGDRH
FT                   VYASRSRFIPATLLQFFEACSWPQVKSEAAQAHARQVRIDVGARMRGMWR"
FT   gene            complement(274593..274859)
FT                   /locus_tag="Rleg_0259"
FT   CDS_pept        complement(274593..274859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0259"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00574 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54570"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0F1"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00574"
FT                   /protein_id="ACS54570.1"
FT                   /translation="MKALLPALFAGAMLAGCSSADTRALEPIPGSITYGGQPRTKLAKS
FT                   PVGSAVYNQFYNGTGQRVEETYILQPDRSLKLVRREIGPDFPD"
FT   sig_peptide     complement(274797..274859)
FT                   /locus_tag="Rleg_0259"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.914 at
FT                   residue 21"
FT   gene            275038..275298
FT                   /locus_tag="Rleg_0260"
FT   CDS_pept        275038..275298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0260"
FT                   /product="transport-associated"
FT                   /note="PFAM: transport-associated; KEGG:
FT                   rec:RHECIAT_CH0000648 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54571"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0F2"
FT                   /inference="protein motif:PFAM:PF04972"
FT                   /protein_id="ACS54571.1"
FT                   /translation="MLGFPAFTGHGEPGRQGHSDAATRASVESALHAAADFEAGEITVS
FT                   ISGSYVILEGFVRRRGDVERAIEIAEGVVGRGYVRARLLRR"
FT   gene            275390..275653
FT                   /locus_tag="Rleg_0261"
FT   CDS_pept        275390..275653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0261"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000649 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54572"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0F3"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000649"
FT                   /protein_id="ACS54572.1"
FT                   /translation="MQLLPRLWATTLIVGCGVFAGSAHASLETGTNYSALPKDQIALNE
FT                   YTGTVACQPVEPHYLPSFIRAADGTIIGVGYVEIENESGADC"
FT   sig_peptide     275390..275467
FT                   /locus_tag="Rleg_0261"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 26"
FT   gene            complement(275920..276162)
FT                   /locus_tag="Rleg_0262"
FT   CDS_pept        complement(275920..276162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0262"
FT                   /product="protein of unknown function DUF982"
FT                   /note="PFAM: protein of unknown function DUF982; KEGG:
FT                   ret:RHE_CH00575 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54573"
FT                   /db_xref="InterPro:IPR010385"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0F4"
FT                   /inference="protein motif:PFAM:PF06169"
FT                   /protein_id="ACS54573.1"
FT                   /translation="MATERWNSPVKVGFEGADARTVNGPFDALKCLADLWPSMRGLRYI
FT                   KARSACRAALDGRKSVEEARAEFLAAAEEAKLKLH"
FT   gene            276526..276888
FT                   /locus_tag="Rleg_0263"
FT   CDS_pept        276526..276888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0263"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000651 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54574"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0F5"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000651"
FT                   /protein_id="ACS54574.1"
FT                   /translation="MPVLARGAEVSAEDALLTRLSIETVPRLQREYLRATLTPQDEGTA
FT                   IDVAAYVLSKTFDRWYVEGIFDGAFSWLHAPIKDEVLVTRELIELWQFSPFISYYLEVT
FT                   EIPDCANNSVLLPSCH"
FT   gene            complement(276934..277008)
FT                   /locus_tag="Rleg_R0004"
FT                   /note="tRNA-Thr2"
FT   tRNA            complement(276934..277008)
FT                   /locus_tag="Rleg_R0004"
FT                   /product="tRNA-Thr"
FT   gene            277162..277356
FT                   /locus_tag="Rleg_0264"
FT   CDS_pept        277162..277356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0264"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000653 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54575"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0F6"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000653"
FT                   /protein_id="ACS54575.1"
FT                   /translation="MNEKTETGQQSRKQAIEAQAKLRRERAADKLRENLGRRKQQVRAR
FT                   RSGQADETNGLPAAKMDES"
FT   gene            277464..278756
FT                   /locus_tag="Rleg_0265"
FT   CDS_pept        277464..278756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0265"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /note="KEGG: rec:RHECIAT_CH0000654 UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase protein; TIGRFAM:
FT                   UDP-N-acetylglucosamine 1-carboxyvinyltransferase; PFAM:
FT                   EPSP synthase (3-phosphoshikimate
FT                   1-carboxyvinyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54576"
FT                   /db_xref="GOA:C6B0F7"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0F7"
FT                   /inference="protein motif:TFAM:TIGR01072"
FT                   /protein_id="ACS54576.1"
FT                   /translation="MDRIRIVGGNELNGIIPISGAKNAALPLMIASLLTSDTLTLENVP
FT                   HLADVELLMRILGNHGVDVAVNGRRERQEDAYSRTIHFTCRTIVDTTASYELVSKMRAS
FT                   FWVIGPLLAREGHCRVSLPGGCAIGTRPVDLFIEGLTALGATMEIDAGYINAKAPAGGL
FT                   IGARYTFPKVSVGATHVMMMAATLARGTTVIGNAAREPEVVDLANCLNAMGARISGAGT
FT                   ATITIEGVTSLSGARHRVLPDRIETGTYAMAVAMAGGDVVLENTDVALLETAVETLRRA
FT                   GAEISSTNNGMRIKRNGAGIRPVDIVTDPFPGFPTDLQAQFMALMTRSSGVSHVTETIF
FT                   ENRFMHVQELARLGARISLSGQTAKIEGVQRLRGAPVMATDLRASVSLVIAGLAAEGET
FT                   TVSRVYHLDRGFERLEEKLTRCGAIVERISE"
FT   gene            278865..279296
FT                   /locus_tag="Rleg_0266"
FT   CDS_pept        278865..279296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0266"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000655 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54577"
FT                   /db_xref="InterPro:IPR021335"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0F8"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000655"
FT                   /protein_id="ACS54577.1"
FT                   /translation="MTDLKLVALDNEDLAIMSAHMQDSVFKVGDIDWSPRDAQFALAAN
FT                   RFVWEGAERKRKGFERRRAALVFKRVLAVRSLGIDRGKRDEVLSLLALRFEQKGEGPEG
FT                   TIELSLSGTASIALDVECIEVQLADIGGAWEASSKPRHR"
FT   gene            279413..280711
FT                   /locus_tag="Rleg_0267"
FT   CDS_pept        279413..280711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0267"
FT                   /product="histidinol dehydrogenase"
FT                   /EC_number="1.1.1.23"
FT                   /note="KEGG: rec:RHECIAT_CH0000656 histidinol dehydrogenase
FT                   protein; TIGRFAM: histidinol dehydrogenase; PFAM:
FT                   histidinol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54578"
FT                   /db_xref="GOA:C6B0F9"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0F9"
FT                   /inference="protein motif:TFAM:TIGR00069"
FT                   /protein_id="ACS54578.1"
FT                   /translation="MAIWLDQASEGFEQHFAAFLTTKREVSEDVNVVVRTIIDDVRARG
FT                   DVALAEYSLKFDSIDYATVPMRVTAEEIDAAVEAVPSEVLGALKLAALRIESHHRRQLP
FT                   KDDIYEDDMGVSLGSRWTAIEAVGLYVPGGTASYPSSVLMNAVPAKVAGVDRIVIAVPA
FT                   TGGAVNPAVLAAAKLVGVTEIYRVGGAQAIAALAYGTETIAPVAKITGPGNAYVAAAKR
FT                   HVFGTVGIDMIAGPSEVLVIADKDNNPDWIAADLLAQAEHDVSSQAILITDDAAFGKAV
FT                   EQAVERQLKTLNRAETAAASWRDFGAVILVADLKQAIPLANRIAAEHLELAVADPDRLL
FT                   DGIRNAGAIFIGAHTPEVIGDYVGGSNHVLPTARSARFSSGLSVLDFVKRTSILRLGPQ
FT                   QLRTLGPAAIALAVSEGLDAHARSVAIRLNLER"
FT   gene            280716..281189
FT                   /locus_tag="Rleg_0268"
FT   CDS_pept        280716..281189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0268"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   ret:RHE_CH00582 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54579"
FT                   /db_xref="InterPro:IPR008321"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0G0"
FT                   /inference="protein motif:PFAM:PF06793"
FT                   /protein_id="ACS54579.1"
FT                   /translation="MAKGEFRLCDVVLDDTIGRSTPDVEHERAVAIFDLIEENRFEPLG
FT                   HAGGPYRLNISLVDSKLVFAITTEEGGGVATHILSLTPFRRIVKDYFMICESYYEAIRS
FT                   STPSRIEAIDMGRRGIHNEGSQTLKDRLAGKIEVDFDTARRLFTLVCVLYWRG"
FT   gene            281195..281671
FT                   /locus_tag="Rleg_0269"
FT   CDS_pept        281195..281671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0269"
FT                   /product="Protein-tyrosine phosphatase, low molecular
FT                   weight"
FT                   /note="SMART: Protein-tyrosine phosphatase, low molecular
FT                   weight; KEGG: rec:RHECIAT_CH0000658 putative arsenate
FT                   reductase (phosphatase) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54580"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0G1"
FT                   /inference="protein motif:SMART:SM00226"
FT                   /protein_id="ACS54580.1"
FT                   /translation="MELAVDVEEGKRPGAILFMCGMNAIRSPMAEAIARSILPANTYIR
FT                   SAGVRAGERDPFVDVVLEEIGLSLGRRQPQTLEELEDDYFDLIITLSPQAHHAALELTR
FT                   SSAVDVVYWPTMDPTVAIGTREQILESYREVRDHLAGLIESRLLKRNGIAAQSA"
FT   gene            281795..282013
FT                   /locus_tag="Rleg_0270"
FT   CDS_pept        281795..282013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0270"
FT                   /product="translation initiation factor IF-1"
FT                   /note="TIGRFAM: translation initiation factor IF-1; PFAM:
FT                   S1 IF1 family protein; KEGG: rec:RHECIAT_CH0000659
FT                   translation initiation factor IF-1 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54581"
FT                   /db_xref="GOA:C6B0G2"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0G2"
FT                   /inference="protein motif:TFAM:TIGR00008"
FT                   /protein_id="ACS54581.1"
FT                   /translation="MPKEEVLEFPGIVTELLPNATFRVKLENEHEIIAHTAGRMRKNRI
FT                   RVLAGDKVLVEMTPYDLTKGRITYRFK"
FT   gene            282071..282691
FT                   /locus_tag="Rleg_0271"
FT   CDS_pept        282071..282691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0271"
FT                   /product="maf protein"
FT                   /note="TIGRFAM: maf protein; PFAM: Maf family protein;
FT                   KEGG: ret:RHE_CH00585 Maf-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54582"
FT                   /db_xref="GOA:C6B0G3"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0G3"
FT                   /inference="protein motif:TFAM:TIGR00172"
FT                   /protein_id="ACS54582.1"
FT                   /translation="MALKYKLILASGSPRRVDLLNQAGIEPSRLMPMDIDEAPKKSEHP
FT                   RSLARRLSAEKAEAALAAIKGDITWKGSYILSADTVVAVGRRILGKAEFADEALSSLHL
FT                   LSGRNHMVYTGVCLVTPDRKIRQKIVETKVRFKRLSGFEIENYLASGQWRGKAGAYGIQ
FT                   GLAGTFVQKMVGSYTNVVGLPLYETILLLTGEGFDVHSRWPEG"
FT   gene            282827..283039
FT                   /locus_tag="Rleg_0272"
FT   CDS_pept        282827..283039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0272"
FT                   /product="protein of unknown function DUF329"
FT                   /note="PFAM: protein of unknown function DUF329; KEGG:
FT                   rec:RHECIAT_CH0000661 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54583"
FT                   /db_xref="GOA:C6B0G4"
FT                   /db_xref="InterPro:IPR005584"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0G4"
FT                   /inference="protein motif:PFAM:PF03884"
FT                   /protein_id="ACS54583.1"
FT                   /translation="MPEDKKAAAKVEPLRKTRPCPECGKPSHREHYPFCSNRCREADLS
FT                   RWLTGAYAIPVADDETKADYPDEEN"
FT   gene            283220..283295
FT                   /locus_tag="Rleg_R0005"
FT                   /note="tRNA-Phe1"
FT   tRNA            283220..283295
FT                   /locus_tag="Rleg_R0005"
FT                   /product="tRNA-Phe"
FT   gene            283679..284026
FT                   /locus_tag="Rleg_0273"
FT   CDS_pept        283679..284026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0273"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: sme:SMc00089
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54584"
FT                   /db_xref="GOA:C6B0G5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0G5"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACS54584.1"
FT                   /translation="MGEIQKLTIDGKGYVLLSEDDYQDLVDVSDARAAKARIDAGEETW
FT                   PEDVVKALIAGEDPVRVFRKHRGMSIKELAEKSGLSQPYLSEIETGKKEGSLDALRSIA
FT                   SALDVDLDDVA"
FT   gene            complement(284185..284463)
FT                   /locus_tag="Rleg_0274"
FT   CDS_pept        complement(284185..284463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0274"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   gdj:Gdia_2654 transposase IS3 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54585"
FT                   /db_xref="GOA:C6B0G6"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0G6"
FT                   /inference="protein motif:PFAM:PF01527"
FT                   /protein_id="ACS54585.1"
FT                   /translation="MGKRKFDDDQITGILKEHQAGVTVADVCHKHGISEPTFYRWQSLQ
FT                   FGNVGLHAKRLRALEEENQKLKKLLAESMLSAATLSEMLAKTLKGRH"
FT   gene            complement(284471..285916)
FT                   /locus_tag="Rleg_0275"
FT   CDS_pept        complement(284471..285916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0275"
FT                   /product="type I secretion membrane fusion protein, HlyD
FT                   family"
FT                   /note="TIGRFAM: type I secretion membrane fusion protein,
FT                   HlyD family; PFAM: secretion protein HlyD family protein;
FT                   KEGG: rec:RHECIAT_CH0000667 putative protein secretion
FT                   protein, HlyD family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54586"
FT                   /db_xref="GOA:C6B0G7"
FT                   /db_xref="InterPro:IPR010129"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0G7"
FT                   /inference="protein motif:TFAM:TIGR01843"
FT                   /protein_id="ACS54586.1"
FT                   /translation="MALVQLDATPAKFSNSSRTSQQLVPRSTATARQQTAYLPVIESKQ
FT                   RGPAPPSPMPGLRGVVWTGNLLILVFIVGLGIWSVLAPLKSAAIASGVVEPESSRKTIQ
FT                   HLEGGIVRRILVKNGDAVMGGQIVIELDDTKSRSERDSIQGQLWDAEGSRARLLAEQTG
FT                   GDHIAYPEDLRAAMDKYPSVSTILIGQQKIFEARRRVMQAEIQIANEKIAQVRQEIVGL
FT                   GAQKAALADRATISSQELDQVTILSAKGLERRSRLLNLQREKADLDGQQGQVEAQISRA
FT                   YQVISGSQADLAKLESDRLSEVAQGMRDTESRIMQLRERLRAIDDQLSRTDIRAPEDGT
FT                   IMNLRIHTSGGVIGAGEPLVDLLPRSDRLVVSAHVRPEDINLVHAGLEAQVHLLPYNQR
FT                   RVPLLKGRVEYVSADRLTDPQSGQPYFAATIRVTDERLAKMKDVELVAGMPAQILIETG
FT                   KSSVALYAVRPLLDSFNRAFRED"
FT   gene            complement(285931..287646)
FT                   /locus_tag="Rleg_0276"
FT   CDS_pept        complement(285931..287646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0276"
FT                   /product="type I secretion system ATPase"
FT                   /note="KEGG: rec:RHECIAT_CH0000668 putative protein ABC
FT                   transporter protein; TIGRFAM: type I secretion system
FT                   ATPase; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54587"
FT                   /db_xref="GOA:C6B0G8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010128"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0G8"
FT                   /inference="protein motif:TFAM:TIGR01842"
FT                   /protein_id="ACS54587.1"
FT                   /translation="MTTISIKPPRPPTQLVVALRACAGAFGLVFLYSCGYNLFLLAPSI
FT                   YLLQIYDRVLSSRSADTLLMLTMIIAIGVMVGSTLDIVRRAALSRIGSWLDHRLRPMVL
FT                   TASFEYAARADTGAATECYRDLAALRQFLDSPASSLFFDVPWAPVFLFLLFLVHPLLGT
FT                   IGLLSALALLLFAFLTELATREPLAYANLALSRSYIRFATALKNIEVIRAMGMQDGAAL
FT                   IVYRDAEMARRAQDIAMHRTEIILGFSKSIRTLAQILMMGSATWLVLANNGSAGIIFVA
FT                   SLLLGRGLAPIEGAIGAWRSFTFARNAFNRLNRMLISVASEHDARMVPLPEPNGLVLDN
FT                   VSYIKPFADRPILTGITLRLAPGDCIALIGPSGSGKSTLGRVIAGVVQATSGCALLGGV
FT                   DISALRLCGGTRHVGYLPQDIELFGGAIKDVIGRLDGGDPGKAIDAAKLVGLHDAIMRL
FT                   PQGYETDIGEGGNLLLRAQRQQLGLARAAYGNPSLIVLDDPNSSLDYDGERMLFTAIER
FT                   MKSRGMTVVIMTHRMGILPVTNKIAIMRNGTVAAFGDSERIYETYLQPPSRTGT"
FT   gene            complement(287737..288312)
FT                   /locus_tag="Rleg_0277"
FT   CDS_pept        complement(287737..288312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0277"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000669 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54588"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0G9"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000669"
FT                   /protein_id="ACS54588.1"
FT                   /translation="MPIPQISDTIHLNNPDAGDANAGNGGDGHNDGNINYNPVAYVDPV
FT                   QTVYGADTHLHNGDHVWQKAGWDAGSGGDGGFAQAKNGFLAAVTNSGDGGAGGDSHSNG
FT                   SQGNSSGGDTATVNAATTATQYTQLVADQHATILAGVGGNGGNGNNALGGDISSALVHT
FT                   DPETTTVNNSLDHFINAFGHIDVDHLGS"
FT   gene            288902..289996
FT                   /locus_tag="Rleg_0278"
FT   CDS_pept        288902..289996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0278"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000670 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54589"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0H0"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000670"
FT                   /protein_id="ACS54589.1"
FT                   /translation="MAETRSLVEDLPKAGTDQHLASNLAAGHLALVPTWLPLDVASGPS
FT                   SNSAGSGGDGISEGVISSNALAVFMPSNAAIAGPHSGADAFQGNDALINQHPTEMAGIG
FT                   GNGGSGNVAIGSGDGANHAGTGGNGLFYGGLVSTEVALFAPVNTAVAAGPGATAHAEQS
FT                   NNALFLQGATQIGGMGGSGGDHNVASHGSSMSPGTALTLTGDFYAGHGGDGYFVGTMVD
FT                   VSIAIFSPINIAIGAAGGSAEAHQTNNVIFDQGAVQIAGIGGNGGGFNLSSDTIFTGNH
FT                   ALGGGGDGVGSSTGSMVDVNFGYFHPINIAVPAGGTADAQQVDHVLYDQHALQLAGIAG
FT                   HGGDGNLTDAHSALVDDILSFMHG"
FT   gene            complement(290404..290673)
FT                   /locus_tag="Rleg_0279"
FT   CDS_pept        complement(290404..290673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0279"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54590"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0H1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS54590.1"
FT                   /translation="MNACWFDLSLQTFQPSPNSRTASGSTKLSKALKRQLICYRSISES
FT                   AIGYNELPIGSALFSYLNSKQSQTRQQNDKREKQQKLEIADYPL"
FT   gene            290862..291599
FT                   /locus_tag="Rleg_0280"
FT   CDS_pept        290862..291599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0280"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; SMART: regulatory
FT                   protein LuxR; KEGG: rec:RHECIAT_CH0000671 putative
FT                   transcriptional regulator protein, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54591"
FT                   /db_xref="GOA:C6B0H2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0H2"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ACS54591.1"
FT                   /translation="MSDITGTRRRIGRNAPTVIIIEHSTLARTTVVKLLERELAGWNVI
FT                   DLISTESLESALGAEVRLIVLGLAGRSVESTSLRDDLAAIAARFPEAPVTLLSGTDDAI
FT                   IARQALKMGLRGLFSTSLPIDIALAGLRLVLAGGTFFPQLLGAVTAVPNDHTPVRNEAE
FT                   KSLDERTQYLAIADFTPREADVLAELQCGCSNKVIAGKLNLSGHTVKMHLQHIMRKLQA
FT                   QNRTEVVARLIQRAAGGPDVSPS"
FT   gene            291725..291976
FT                   /locus_tag="Rleg_0281"
FT   CDS_pept        291725..291976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0281"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54592"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0H3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS54592.1"
FT                   /translation="MRKRKAIVEAALESEYERQALGIMNTEQALKLEDSDGLVFSHPDK
FT                   EAGVTDHFVDQDELRRLVRRSTPPLSRLQSQPRTTRSS"
FT   gene            complement(291980..292705)
FT                   /locus_tag="Rleg_0282"
FT   CDS_pept        complement(291980..292705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0282"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54593"
FT                   /db_xref="GOA:C6B0H4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0H4"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACS54593.1"
FT                   /translation="MEFRGKTVIVTGAGKGIGREIVRMLVERSAQVVALTRSAADVEAL
FT                   RGEFGCRAIQVDLADADATREAAIAALPADFLINCAGTTELQPFLETTVEAFDRLVAVN
FT                   TRAPMIVAQEYARSLIKEGRKGAIVNVSSVASFVGIPDHAAYCASKGGLDGLTRVMAKE
FT                   LAPHGIRANGVHPTVTLTPMAVKAWSDPEKAAGMMKRIPVGRFAEPADIAEVVLFLLSD
FT                   QAAMVNGISMPVDGGYMIA"
FT   gene            complement(292717..293778)
FT                   /locus_tag="Rleg_0283"
FT   CDS_pept        complement(292717..293778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0283"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; Transport-associated
FT                   OB domain protein; SMART: AAA ATPase; KEGG:
FT                   rsq:Rsph17025_3579 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54594"
FT                   /db_xref="GOA:C6B0H5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0H5"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS54594.1"
FT                   /translation="MANVQVSDVTKKYGSLQVMHGVSVDIEDGEFVVLVGPSGCGKSTL
FT                   LRMIAGLETVSSGDIRIGGRVVTDAPPKERDIAMVFQSYALYPHKTVAENMGFPLKMAK
FT                   RPKAEIDEKVGRAAEILDLTRYLDRYPKQLSGGQRQRVAMGRAIVRDPKVFLFDEPLSN
FT                   LDAKLRVTMRVEIKELHQRLKTTTVYVTHDQIEAMTMANKIVVMRDGRVEQIGKPLDLY
FT                   DFPVNLFVAGFIGSPSMNFLEGRIATRDGRKIVVTEQGITLPMADTNAEEGRAVTYGIR
FT                   PEHITIGEEGVPVEVSVFEPTGSETLIFGRTGGVPIDALIRERIEVDPGRTMYFHIDPR
FT                   RAHIFDRETGQRL"
FT   gene            complement(293839..294045)
FT                   /locus_tag="Rleg_0284"
FT   CDS_pept        complement(293839..294045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0284"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rsq:Rsph17025_3581 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54595"
FT                   /db_xref="GOA:C6B0H6"
FT                   /db_xref="InterPro:IPR018678"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0H6"
FT                   /inference="similar to AA sequence:KEGG:Rsph17025_3581"
FT                   /protein_id="ACS54595.1"
FT                   /translation="MTSQSRNNERKPGFLPIETNWFDRLFISIVIWVALSLFWMRFIEP
FT                   FGPSVWFAAAISAVLGAYVVWKG"
FT   gene            complement(294050..294889)
FT                   /locus_tag="Rleg_0285"
FT   CDS_pept        complement(294050..294889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0285"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rsq:Rsph17025_3582
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54596"
FT                   /db_xref="GOA:C6B0H7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0H7"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS54596.1"
FT                   /translation="MKKTRFPWLPVVLWTLISLATLFPIYWLFVISVKQPFDLFSTPDV
FT                   ILRSFFWKNYQDVLTNPTLRGYMLNSMIISSGNALLVTTLGFLACYALTRFDLAGKESI
FT                   FFWTITNRMAPPAVFLLPLFLLLTQVYRIGDFSLADSKLGMILVYCSFNLPFAIWTLRP
FT                   TVEGIPKELDEAAYMDGASPWTVLYDIIFPLARPGLAVTLILTWVFAWNEYLLAATLTN
FT                   FHARTLTTGLSEYVTTTGTAWGIMAAISMLTLVPALIVFSVVQRHIVAGLTFGAVKG"
FT   sig_peptide     complement(294827..294889)
FT                   /locus_tag="Rleg_0285"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.725) with cleavage site probability 0.567 at
FT                   residue 21"
FT   gene            complement(294894..295769)
FT                   /locus_tag="Rleg_0286"
FT   CDS_pept        complement(294894..295769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0286"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: sugar ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54597"
FT                   /db_xref="GOA:C6B0H8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0H8"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS54597.1"
FT                   /translation="MHSQKLGWLLLSPTIVILGLFGIFPFIYVLWVSFHSWNPFAANPG
FT                   MIFNWAENYRRLVFDPQFLASLGITLTFVFFAVVSELVLGYILAQALLKDFPGKAVFRT
FT                   IHTLPLIMAPIIVGSVWKLMTTPSIGIIPYLLRSWFGYDLNIGQSAVAAFTVTVIMDIW
FT                   HWTPLVTLSLIAALVSLPSDPFEQAQIDGAGKSQIFWHITLPLIRPAMLATVFIRLMDA
FT                   LRTVDEVLMLTGGGPGSSTRYIGVHIFKEVFPKTNYGYGSAISVIVLYLTIVVCWLLYV
FT                   GLIAPRVKRG"
FT   gene            complement(295867..297300)
FT                   /locus_tag="Rleg_0287"
FT   CDS_pept        complement(295867..297300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0287"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: sugar ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54598"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0H9"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACS54598.1"
FT                   /translation="MNYALKASALALTLSLAATASPAWADFWSDAGAKFKGVTLHGVTE
FT                   STPPSNYIRNVLAPEFEKKTGIKVDIETTSWDQMYDKAIKDMEAKTGIYDMVYIEQDII
FT                   YSYLARNFLVDITKTLKDQPDLKAPTYDDANFTSFADYFKDASGDLFGVPMEAFLKAYL
FT                   YRKDLFEDPKIKEAFKKETGKDLKPATTHAEYTEIAEFFTKYGKDNGMELWGTTAQAHT
FT                   GHPASWYEFFESIAPTFGVYNWGIDAKNNYAATVEHGGAMNGDKAKAALKYWLHLRDIA
FT                   PPESTQSTWTETATTFAAGRVAQGLIYGENAAWIASDPAQSKVVGQVGFALPPLEPGVL
FT                   DDAKAGKGYIGYYDGGAFGVPVTSKNKEASLLFLEFIGQNEVQPDWAIAAPRITNKATF
FT                   DDPKVKEMDVKLGGFYTMLKDDGKLFAGAPPYPFHAQVREATAPIFYDILTGKIGPDEG
FT                   LDQMAAKAEEELTSLGYRK"
FT   sig_peptide     complement(297223..297300)
FT                   /locus_tag="Rleg_0287"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 26"
FT   gene            297598..298482
FT                   /locus_tag="Rleg_0288"
FT   CDS_pept        297598..298482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0288"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: xylose isomerase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54599"
FT                   /db_xref="GOA:C6B0I0"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0I0"
FT                   /inference="protein motif:PFAM:PF01261"
FT                   /protein_id="ACS54599.1"
FT                   /translation="MRRLGIHSFVWTGGQTQEGLEMALNKTAEHGYRTIEFAYLRPEKF
FT                   NLDRLAKLAQSLDVEIGVTMGLPLDRDVSSEDTSAVSAGKQTLADAVRAVRDIGGNKLG
FT                   GILYSAHTKYNRQPTKKGWDNSVAAIAATAEVARQANVDLVLEVVNRFETNLLNTAAQG
FT                   LKFVAETGSEHVRLHLDTFHMNIEEANPAAAIRLAGDKVGYFHIGESNRGYLGDGVINF
FT                   DLIFDALLDIDYKRDIVFESFSTTVVDEGLSLACAIWRDTWEDNDPLAAHAKRYIELKY
FT                   DEAKRRRATNARP"
FT   gene            298545..299759
FT                   /locus_tag="Rleg_0289"
FT   CDS_pept        298545..299759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0289"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: transcription
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54600"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0I1"
FT                   /inference="protein motif:PFAM:PF00480"
FT                   /protein_id="ACS54600.1"
FT                   /translation="MNDTVSIGSSPRRIRQNNIVAALQTIYAHRSLSRADLARKLGMNR
FT                   SSSGEIVAELTEGGFVQESDESGKQRLEHSRAGRPGIMLELVPDAAFFVGIEIGVEHIS
FT                   AAVIDLSADVRACRKMAFDTMSSTVEKAVAEGVELIVSAMEKRMIGRCKGLGISAPAHI
FT                   RPDGIVTLAPIIGWREVSLKEIGRSAFPAAVPIAVENDANAFAIGDSYRHGVSGVTLFL
FT                   LMETGVGGGIMIDGKLFRGGHGLAGEIGHTLVPGSGGQKFEQLIGREVLIRQYREAIGR
FT                   KHVDLQEFLGDVHDRVPAAVNIAETWSRHLAYALLQACRLLDPDRIVLGGSVASLYPMV
FT                   AARVAVHMSEGQSIPFPTPEIVVDDDAEFGSAFGAACMLHQRFLSLESEEFGGEDGAPI
FT                   QSATS"
FT   gene            299790..300767
FT                   /locus_tag="Rleg_0290"
FT   CDS_pept        299790..300767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0290"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: fructokinase;
FT                   K00847 fructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54601"
FT                   /db_xref="GOA:C6B0I2"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0I2"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ACS54601.1"
FT                   /translation="MTSVLAPDPLGPTVCVGEILVEIVATTVGDGFLKAQPLVGPFASG
FT                   APAIFISQCGRLGGKAAMVGAVGDDDFGRVNTDRLKRDGVDVSTISIDSDYPTGSAFVR
FT                   YRKDGSRDFVYNIATSAAARFGWSQAVGDLIHRSGHLHVMGSALSVPSARAVIDKAVDI
FT                   VKARGGTLSVDPNIRKELKLNEDTERRFSKLVAAADLLLPSGEELERAAGVEGEAEAIR
FT                   RLFEIGVKEIVLKRGAEGATYFGRQGDRIDASAFVVQEVDPTGAGDCFGGAYLTCRRLG
FT                   MSPQQALTYASAAGARNVTVLGPMEGAGTQQELDAFIASTERRP"
FT   gene            300767..302044
FT                   /locus_tag="Rleg_0291"
FT   CDS_pept        300767..302044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0291"
FT                   /product="D-tagatose-bisphosphate aldolase class II
FT                   accessory protein AgaZ"
FT                   /note="PFAM: D-tagatose-bisphosphate aldolase class II
FT                   accessory protein AgaZ; KEGG: D-tagatose-bisphosphate
FT                   aldolase, class II, non-catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54602"
FT                   /db_xref="GOA:C6B0I3"
FT                   /db_xref="InterPro:IPR012062"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0I3"
FT                   /inference="protein motif:PFAM:PF08013"
FT                   /protein_id="ACS54602.1"
FT                   /translation="MQVHLNELAKMRIEGHPRGVTSVCSAHPIVLRAALRHGRQQASTV
FT                   LIEATCNQVNHLGGYTGMTPSDFASLVRKIAVEEGCPENLIVLGGDHLGPNPWRDRPAE
FT                   EAMAEAEKMVAAYVDAGFRKIHLDASMGCKGEPVALDDETTAHRAARLAAVAEASAKKR
FT                   GGAMPVYVIGTEVPPPGGADHALTTIDPTAAAAALKTIEVHRRIFAEAGLGQAFERAIG
FT                   LVVQPGVEFGNQNVILYDRSKIDALKSVLTEEPQFVFEAHSTDYQGTRPLAALVEDGFP
FT                   ILKVGPELTFVLREALYALDAIASHLLPDYGQRPLYAAMEALMLDQPGNWSRHYHGTNA
FT                   EMRWLRHYSLSDRIRYYWASAEAQEAVGRLCEALRGQIVPLPLFWQHMPAAQEFADAPL
FT                   DPEQVLIWRVTKSLSDYHAACGVGKN"
FT   gene            302075..302800
FT                   /locus_tag="Rleg_0292"
FT   CDS_pept        302075..302800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0292"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: ribitol 2-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54603"
FT                   /db_xref="GOA:C6B0I4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0I4"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACS54603.1"
FT                   /translation="MTELNGKIAAVTGAASGIGLASTEAMLAAGATVVLVDRDEKALET
FT                   VCARLGERAIPLKINLLDPGECAGLLDGILSKTGKLDILHANAGTYIGGDLMETDLDTI
FT                   DRMLNLNVNVVIKNVRSVIPHMIERGTGDIVVTSSVAGHSAIPWEPVYSSSKWAMTCFV
FT                   QTMRRQLLKSGIRVGSVSPGPVISALLADWPEENLRKAKEAGALIEPKEVADAIIFMLT
FT                   RPRNVTIRDIVVLPSAFDI"
FT   sig_peptide     302075..302167
FT                   /locus_tag="Rleg_0292"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.832) with cleavage site probability 0.222 at
FT                   residue 31"
FT   gene            302812..303585
FT                   /locus_tag="Rleg_0293"
FT   CDS_pept        302812..303585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0293"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: sme:SMc02339 putative oxidoreductase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54604"
FT                   /db_xref="GOA:C6B0I5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0I5"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACS54604.1"
FT                   /translation="MSYQQKFRLDGERAVVTGGGRAIGLCCTEALAEAGAAVVVIERSE
FT                   ADAVQALALRDRGYDVEVRVGDVTDAARMDAIAAELADGGRPATILVNNAGIGQSGIPA
FT                   QDLTDADWLRMMDVNLNGVFWCSRAFGRPMISMKRGAIVNLGSMSGTICNRPQPQTAYN
FT                   VSKAAVHHLTRSLAAEWAHHGIRVNAVAPTYIETPMVVAVEANRERIPLWLADTPMGRM
FT                   GTPEEVASAVLFLASGAASLMTGAIVNVDAGFTCW"
FT   gene            303723..304547
FT                   /locus_tag="Rleg_0294"
FT   CDS_pept        303723..304547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0294"
FT                   /product="deoxyribose-phosphate
FT                   aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /note="PFAM: deoxyribose-phosphate
FT                   aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase; KEGG:
FT                   aldolase protein; K01623 fructose-bisphosphate aldolase,
FT                   class I"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54605"
FT                   /db_xref="GOA:C6B0I6"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0I6"
FT                   /inference="protein motif:PFAM:PF01791"
FT                   /protein_id="ACS54605.1"
FT                   /translation="MKSARLNRLFGVSGNCFDVAIDHGMFNERTFLAGIENMKTAIEVI
FT                   AQAAPGAIQLPPGTAPMLQAIPGKQRPALVLRTDIANIYGNPLPSQLFSEMIDRAVEQG
FT                   VALDAACVVVNLLMLPDQPEVYRACVRNVNSLKRECEIYGMPLMVEPLVMQDNSKGAYM
FT                   VDGAIDKILPLVRQAAELGADIIKADPCDNVEEYHRVVEIAQGLPVLVRGGGRVSDQEI
FT                   LIRTKQLMEQGARGIVYGRNVIQHQNPAGMTRALMAIVHDKASVEQALLHIG"
FT   gene            304570..305724
FT                   /locus_tag="Rleg_0295"
FT   CDS_pept        304570..305724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0295"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; KEGG: thuBf;
FT                   myo-inositol 2-dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54606"
FT                   /db_xref="GOA:C6B0I7"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0I7"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ACS54606.1"
FT                   /translation="MTKIFRFGVIGCGLMGREFASAAARWLHLADVKARPEIVAVCDTN
FT                   ATLLDWFRDHVPTVRQFAADYKELLANPEVDAVYCAVPHVLHQQFYIDVLKAGKHLLGE
FT                   KPFGMDAAQNRDIMAVLAEHPELLVRCSSEMPFFPGAQKVIALAKSGEMGDIIEVEAGF
FT                   LHSSDIDRQKPINWKRMADINGDYGCMGDLGMHVLHVPLRLGWRPTTLHAQLVKKVTER
FT                   PDGKGGMLPCTTWDNATISSRVRTGDQDFPMVLKTWRIAPGESNTWYLRVLGMKKSAFF
FT                   STKSPRQWQWMDYNGGVQAWSTEDLGYGSLFPAITGKIFEFGFADAIQQMWAAFVDELV
FT                   GGNANGFGCATPAEAQAHHAVLTAALKSGLEDVVIPVEYDGASA"
FT   sig_peptide     304570..304638
FT                   /locus_tag="Rleg_0295"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.971) with cleavage site probability 0.920 at
FT                   residue 23"
FT   gene            305724..306395
FT                   /locus_tag="Rleg_0296"
FT   CDS_pept        305724..306395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0296"
FT                   /product="protein of unknown function DUF1498"
FT                   /note="PFAM: protein of unknown function DUF1498; KEGG:
FT                   hypothetical protein; K09988 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54607"
FT                   /db_xref="InterPro:IPR010864"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0I8"
FT                   /inference="protein motif:PFAM:PF07385"
FT                   /protein_id="ACS54607.1"
FT                   /translation="MKRSEINAALLRATETLERWHWSLPAWGSWTAADFAAHPEASAYL
FT                   RAHQLGWDVTDFGSNRFAECGLVLFSLRNGVVDIRGERTYAEKLLFVGEGQVTPTHRHA
FT                   AKMEDIINRAGGDLVIEFAATDADGNVLAEDVTVPVDGLQHRLAAWEPLVLQPGQSVTI
FT                   RTGLYHRFYGRKGGGPVLVGEVSQVNDDNSDNFFLEPIARFAAIEEDEPPLRPLWNEGV
FT                   S"
FT   gene            306395..307453
FT                   /locus_tag="Rleg_0297"
FT   CDS_pept        306395..307453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0297"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: iolC; myo-inositol
FT                   catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54608"
FT                   /db_xref="GOA:C6B0I9"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0I9"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ACS54608.1"
FT                   /translation="MRAGEEVHDRDSQKQGGIVCAGNFIVDRVHTLSYWPEQGNLAHIL
FT                   HQDLGVGGGAANVVTDLASLGFPGKLAAAGCIGADQDGEIVKARLAVAGVDVVGLTALA
FT                   DRVTAHTHVMNVPGQNRTFFYHGGANDAVTDELVSPAAFAKAGYRLFYLGYLMLLPGLD
FT                   RIGPDGRSGASRLLEAARRAGLTTCVDFVSSEDPEFAAKVGVALPFCDYLIINEMEAGR
FT                   ATGVIVRDAEGDLTEAGLLEAGERLLAAGVSKGAIIHAPETCFWFSPGASPIMTRSRPV
FT                   DPDDIVSTVGAGDAFCAAVLYGLHENWPVEHICAVAHAAAARCLKGATATDGIPDMSVL
FT                   IREAKETNPQSA"
FT   gene            307589..308377
FT                   /locus_tag="Rleg_0298"
FT   CDS_pept        307589..308377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0298"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; NAD-dependent epimerase/dehydratase; KEGG:
FT                   smoS; sorbitol dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54609"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0J0"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACS54609.1"
FT                   /translation="MTHTETARLSGKVALVTGGASGIGKAVCQRFAAEGARVVVADLDG
FT                   ERCARVAEAIGPDVWGAALDVTRQDSIEEAVRFTISTAGQIDILVNAAGIYDVESILEI
FT                   SRERTARVFQVNIEGLIFMTQAVARHMVERGEGGRIINFSSQAGRRGEGPAVAYCASKA
FT                   AVISITQSCALELIRYGINVNAIAPGVVDTPMWDVVDAKLGSREGLRPGDVKRRVAAAV
FT                   PAGRFGAPQEQAAMAAFLAGPDAAYIVAQCYNVDGGNVMS"
FT   gene            308435..309445
FT                   /locus_tag="Rleg_0299"
FT   CDS_pept        308435..309445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0299"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   Alcohol dehydrogenase zinc-binding domain protein; KEGG:
FT                   L-iditol 2-dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54610"
FT                   /db_xref="GOA:C6B0J1"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0J1"
FT                   /inference="protein motif:PFAM:PF08240"
FT                   /protein_id="ACS54610.1"
FT                   /translation="MRAVRLESIGSLTMRSVERPVAGPGELLVRVAVAGICGSDRHMYK
FT                   GEYPTAIPVTLGHELCGIVEAIGDTVTRFTGGELVTVDPNIACGTCRACTQARPNLCES
FT                   LTAIGVTRDGGFAEYVAVPQAQAFVLPAGLDPVHGAFSEPLACCIHAIDKARIRPGDSV
FT                   AILGGGVIGLLMVQLARLAGAGEIILITRQQSRRQTALRLGATHAFDPTSSDTIASVRE
FT                   VTKGGADVVIECAGVSDTLQSGLKMARRGGTFVLFGVTPAGVEVPVLPFDLLVNEVDIR
FT                   PAYLNPFTHSRAAAMVASGVLELDALVTKTISLEEVADVVGNAPLPGEIKVIVRP"
FT   gene            complement(309461..310480)
FT                   /locus_tag="Rleg_0300"
FT   CDS_pept        complement(309461..310480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0300"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; regulatory protein LacI; SMART:
FT                   regulatory protein LacI; KEGG: transcriptional regulator
FT                   protein; K02529 LacI family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54611"
FT                   /db_xref="GOA:C6B0J2"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0J2"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ACS54611.1"
FT                   /translation="MTTSIRHIAKLAGTSVSSVSRVLNNSGYASPELRERVEAAIRTLN
FT                   YTPSKGARMLRGAPSRMIGLMLPSVDVPFFGILAHAIEQELFQHGYQTLICSTAENMDH
FT                   EVRYISMLLAQRVDGVIVASAFGSIEHFGVLRDAGIPIIAIDRELSGIADDAVMADHEE
FT                   GGRLMARHLIDLGHRAIAIVGAPAHSQPIQLRLQGITAEMAKDGIAPAIVAMAEEHSFA
FT                   ETYRLARELLASRPEVTAIIGTTDVSAIAAIHAIQDRGFSVPGDYSVVGFDDLPEAAYV
FT                   FPRLTTVAQPIRNVGQQAARLLEALIEEHQTGDESRQGAIVKVPVTLIERDSTGLVRN"
FT   gene            310730..311380
FT                   /locus_tag="Rleg_0301"
FT   CDS_pept        310730..311380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0301"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ots:OTBS_0057 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54612"
FT                   /db_xref="GOA:C6B0J3"
FT                   /db_xref="InterPro:IPR002472"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0J3"
FT                   /inference="similar to AA sequence:KEGG:OTBS_0057"
FT                   /protein_id="ACS54612.1"
FT                   /translation="MNDTVLLFHGIARTKKSMAKLAGFLSGHGYRVVNVGYPSTRFSIS
FT                   DLIDIIRPEIDDAVKKAGDGRVHFVGYSMGGLVIRAFLRRYRPAKLGRVVMVGTPNNGS
FT                   QIADFLKSWPLYRKIYGPAGQQLITDQTAMTELFGTVDYELGIIAGNRTIDPVSSLIIG
FT                   LRVPNDGKVSVESTRLGGAAAHIVIPANHTFLPVNKTMWSQALSFLKDGRFTS"
FT   gene            311455..312600
FT                   /locus_tag="Rleg_0302"
FT   CDS_pept        311455..312600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0302"
FT                   /product="polysaccharidase protein"
FT                   /note="KEGG: ret:RHE_CH00615 polysaccharidase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54613"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0J4"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00615"
FT                   /protein_id="ACS54613.1"
FT                   /translation="MTAILRKKVHGASTRGQVIDGAPDVGVAYQVFSDTVIEDVIVKNS
FT                   PRGFKFHNGKNLTVRRCETENVNGDGIYLTKTTHVLLENNRIGAAPGEGADCCQFAYQN
FT                   SDDNISSDIVIRGNLFLQSPASASNKGALVCDKTRQYLVEYNFIGGKNFSFSSIGDDAV
FT                   VRSNIMRDGRMNDYSFGYGVGDKADHAGHHIYDNWIENTNRGVSLSGFSDQELAFRKDI
FT                   DIHDNVISQCDIAFFANRRWSGSFRRNIFLRCEQDIVLKGNGKATAGDIDGNYRNDGSF
FT                   LNVTPPPLRLKPDGNASVASGEWTSEPDEIRIQWRNKGIDIPGANRPSFTAEPGMELSC
FT                   VLLARKDQNWMLAIAETAYDDFTPRAWQEHKLPWQKRYLSI"
FT   gene            complement(312632..313738)
FT                   /locus_tag="Rleg_0303"
FT   CDS_pept        complement(312632..313738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0303"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: cak:Caul_4545
FT                   acyltransferase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54614"
FT                   /db_xref="GOA:C6B0J5"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0J5"
FT                   /inference="protein motif:PFAM:PF01757"
FT                   /protein_id="ACS54614.1"
FT                   /translation="MHQAKKMTSNNRRLVGLDGIRGLAAICVAVHHTEGFVGFDAAPAA
FT                   YLAVDLFFCLSGFVIGHAYERKLIQESSLSANDFAIKRLIRLYPLYLLGLLLGVLAYAG
FT                   MSLSRNQQIDPMLFATSLIASMFFLPAIGGTSLKAPNLFPFNGPSWSLFLEIVINLAYG
FT                   YAARMLSSGVLALILLASWVWLAAQTLAHGSADLIPLDGALLSGFPRVLFSFSLGILMY
FT                   RYRQRLSPSGIGKAAAVTTIVVATALLVFQAPAAWVGIKDLIVITALFPIAVLVLYTAN
FT                   FDGVLRQPLLIAGEASYALYAIHVPLLGLLLGAWKAAGLGQPPAWAIFAIVLPLIVLLA
FT                   IVVTRLYDEPVRKALSAGKAMRLRWRRS"
FT   gene            complement(313725..315080)
FT                   /locus_tag="Rleg_0304"
FT   CDS_pept        complement(313725..315080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0304"
FT                   /product="O-antigen polymerase"
FT                   /note="PFAM: O-antigen polymerase; KEGG:
FT                   rec:RHECIAT_CH0003464 putative exopolysaccharide production
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54615"
FT                   /db_xref="GOA:C6B0J6"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0J6"
FT                   /inference="protein motif:PFAM:PF04932"
FT                   /protein_id="ACS54615.1"
FT                   /translation="MSTSFDSYQPIGLQRHRPRARAQYRIRRETLVRILLSAIFYISLW
FT                   RATGMWYGLPADFQEGVGKDPMPMRLLLMSLVPLIGLYCLLEPRRVVEMLRSASPLVGI
FT                   ICLCVFLSIAFSVSVTASLRALVAVALLTAGPLLYRARYGAVDTFESLAKFAIATAFIN
FT                   ILYTAAFPRFAVMRGSYAGMVKGAFYHKNMLGQFSATNFILLLPALPMWRLRYYDLLRW
FT                   AAMLLYLVLIVLAKSSTAIILLSIGIAVYYGMSWIQRFPGRIFRSFVVLLAFALLGFVV
FT                   SVALMGVAQAIAESFGKDLTLSGRTNVWEQLLPLIYERPFSGWGFALFRQPDIMEQYVR
FT                   LTWDAQSTHNTYIELALNMGIPATIIWTSFVVVRLVGKMTSSPLNQALAITKRKEVVII
FT                   LLILIGAFTEAGMMLAPFILWPHTVIALTSLGPEFLSRFRKPTQAGAQHASG"
FT   gene            complement(315124..315858)
FT                   /locus_tag="Rleg_0305"
FT   CDS_pept        complement(315124..315858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0305"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: si:ch211-139a5.3"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54616"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0J7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS54616.1"
FT                   /translation="MLRLFANLVIVLALNFLLIVGNAGPSFAQECPDPAKATNASAQQK
FT                   QASKRLNRALPSYRVKSARYNLALVGDSLVELWQPWIKDSFPTRPAMNLAVAGDTTQNA
FT                   LYRLDDLDLPDFHPTDVVVLIGTNNLGAKTAPCAVAAGVVAVVSKVRALWPGAHIYALS
FT                   IPPRGKRYAFYEDVRIPANQLVASSLAEMPGVTFVQMNDDMLRCGKPSDKDCSNYKPDH
FT                   LHFNEGAYKLITSFLAAAGLQL"
FT   sig_peptide     complement(315772..315858)
FT                   /locus_tag="Rleg_0305"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.990 at
FT                   residue 29"
FT   gene            316093..316899
FT                   /locus_tag="Rleg_0306"
FT   CDS_pept        316093..316899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0306"
FT                   /product="Ku protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000691 putative DNA helicase
FT                   protein; TIGRFAM: Ku protein; PFAM: Ku domain protein;
FT                   SMART: Ku domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54617"
FT                   /db_xref="GOA:C6B0J8"
FT                   /db_xref="InterPro:IPR006164"
FT                   /db_xref="InterPro:IPR009187"
FT                   /db_xref="InterPro:IPR016194"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0J8"
FT                   /inference="protein motif:TFAM:TIGR02772"
FT                   /protein_id="ACS54617.1"
FT                   /translation="MARQTFWKGYLKLSLVTAAVSLTPATTESNKVRFHVLNRQTKNRV
FT                   ESRYVDSVTHKPVAERDQVKGYPRGEDDYVLLEDEEIEEVGLESTRTIEIDNFVPRGSI
FT                   DWIWYDKPHFLAPEDKVGVEAFCVIREAMKANDVVGIARLVLYRRERAVLLEPLGKGIV
FT                   LWTLRYGDEVRDPVAELDNKTEIDSKLLALMTQLVKEETKNWSPAMVQDPIQKRLKSMI
FT                   RGKQKSLKKAAPAQKPAPVKSTGNVINIMDALKKSLAAEGGQKPRQ"
FT   sig_peptide     316093..316176
FT                   /locus_tag="Rleg_0306"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.807) with cleavage site probability 0.712 at
FT                   residue 28"
FT   gene            complement(317078..317932)
FT                   /locus_tag="Rleg_0307"
FT   CDS_pept        complement(317078..317932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0307"
FT                   /product="Ku protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000693 putative DNA helicase
FT                   protein; TIGRFAM: Ku protein; PFAM: Ku domain protein;
FT                   SMART: Ku domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54618"
FT                   /db_xref="GOA:C6B0J9"
FT                   /db_xref="InterPro:IPR006164"
FT                   /db_xref="InterPro:IPR009187"
FT                   /db_xref="InterPro:IPR016194"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0J9"
FT                   /inference="protein motif:TFAM:TIGR02772"
FT                   /protein_id="ACS54618.1"
FT                   /translation="MAARASWKGHLKVGDLACAVGLYTAVSSSDRVSFNIINRRTGHRV
FT                   ERQFVDSETGKPVERGDQVKGYQMENGDYIVIEGDEIAEIMPESDKVLNIKAFIAYDDI
FT                   DKLYFDRPYYLAPVDEHDEEALSLIARGMRDGKVAALAEAVLFRRNRTLLIRPHDDYIV
FT                   ATMLNFDYEVRSAETVFEDIPDIKFDKEMIALAGHIIGTKQGSFEPSTYEDRYEAALVE
FT                   LVKAKIEGRAPPKKKPAPERKVVDLMEALRQSAKMSGNAPAKKALAKKKAPARSDSRSK
FT                   KAS"
FT   gene            complement(317950..318183)
FT                   /locus_tag="Rleg_0308"
FT   CDS_pept        complement(317950..318183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0308"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000694 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54619"
FT                   /db_xref="InterPro:IPR018691"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0K0"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000694"
FT                   /protein_id="ACS54619.1"
FT                   /translation="MADITYQVVPHDNGWAYKLGDTLSETYATADEAIIHAKDAASRQK
FT                   IGDGDALLAYPAPDGRGWAFQELETDKSGSRL"
FT   gene            complement(318230..318490)
FT                   /locus_tag="Rleg_0309"
FT   CDS_pept        complement(318230..318490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0309"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00619 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54620"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0K1"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00619"
FT                   /protein_id="ACS54620.1"
FT                   /translation="MTDVRSMDNQGRRMDARDRLIVALYAQLKAERETRETLEWAIRNG
FT                   AVSQEVLEAIAADPVPVVTSEDIASLEKIIALDERRKANRN"
FT   gene            318636..319196
FT                   /locus_tag="Rleg_0310"
FT   CDS_pept        318636..319196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0310"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG:
FT                   rec:RHECIAT_CH0000696 putative stress-induced protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54621"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0K2"
FT                   /inference="protein motif:PFAM:PF02566"
FT                   /protein_id="ACS54621.1"
FT                   /translation="MADLKARPRPTGATAVLGRTGFPHVTSATKGEIDIVTAPSQPGFN
FT                   PLDLLYSSLSACLVLSARIAASQMGILDKINEITAEVTGEKATEGLSRVAKFNIAFSIK
FT                   GDIDEETRQKIAHAAEDEICTVSNTIRGNPEFSTTISGVRLNLHNNYRQSRAEDCVTNA
FT                   RLLCSGIESNDPGHHAAQASPDV"
FT   gene            319168..320604
FT                   /locus_tag="Rleg_0311"
FT   CDS_pept        319168..320604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0311"
FT                   /product="putative FAD-dependent oxidoreductase protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000697 putative FAD-dependent
FT                   oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54622"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038732"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0K3"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000697"
FT                   /protein_id="ACS54622.1"
FT                   /translation="MQPKPLPTSEQPVVAIIGGGVSGAGVAYHLARANCGERLAIVVFE
FT                   PRAELGRGLAYDTADPAHRINVPAAKMSLQPDDLGEFLAWIEVRDAVAGDPEARQPDGS
FT                   LFPRRRLFGDYVASLLKPLLEDGSVRHCRAAVTAVERCAGRWSIRDDRGGVTKADIVAI
FT                   ATSHPPPTAPSRLGSRLAAHPRFVADTTKPNALDVIRPHDRVLVIGNGLTAADVIASLA
FT                   QRGHDGSVTAISRRGLRSRGHPLVPQELFGDFVSSAAHSAVSLLRGIRTAIGAAKAQGI
FT                   SWHGVIDQVRAQGYDLWQALPVAERRRLVRHLRPYWDVHRFRIAPQVEAVLDAAVTSGR
FT                   LDILAGSVADARIEGELILCSLQPRHQRQPLERRYDAVVVTTGPAHGGILDTQPWLAAL
FT                   AANGHLALDPTGLGLACTERSEAIGPSGKVDPSLLISGPLARGTFGELMGLPQVTEHAF
FT                   FVAGEIAEKLRTSATNRHPA"
FT   gene            320820..321725
FT                   /locus_tag="Rleg_0312"
FT   CDS_pept        320820..321725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0312"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: rec:RHECIAT_CH0000698 putative
FT                   transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54623"
FT                   /db_xref="GOA:C6B0K4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0K4"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACS54623.1"
FT                   /translation="MSQAAPTLSEASPSNRFALAALLLGGAAIGGSPIFVRLSEVGPMA
FT                   TAFWRVALALIPIVIVSLLKKERGPKPQSLSDYGMLILPGVILALDLAAWHLSLTMTSV
FT                   ANATLLANLAPVFVTLIAFVFFSARISRGFALGLVLALSGVVILKGGPAAIGNGDLRGD
FT                   GIAMIAAFFYACYILAIGRLRSRFDTLRIMLWSTTCAAACIFPIGLIYEGHMLPATVYG
FT                   WSIVFGLAFISHAGGQVAITYALAYLPPAFSSLTLLLQPVVAAILAWALLNEAIGTMQA
FT                   LGGAVVLAGIMIARTSRVQV"
FT   gene            complement(321738..323294)
FT                   /locus_tag="Rleg_0313"
FT   CDS_pept        complement(321738..323294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0313"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; phospholipase/Carboxylesterase; KEGG:
FT                   rec:RHECIAT_CH0000699 putative glyoxalase/bleomycin
FT                   resistance protein/dioxygenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54624"
FT                   /db_xref="GOA:C6B0K5"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0K5"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACS54624.1"
FT                   /translation="MVSGIHHVTAVTRKVQANVDFYAGFLGMRLVKQTAGYEDATQLHL
FT                   FYGDGEGTPGSLLTFLAWEDGAPGRAGYGQISEISLSINPTSIGYWLTRAMSFGLSSEG
FT                   PADEFGEPVLRLKDPDNIILKLAGAKSLVSPAAWDGASIPVEHAIQRVRGATMLTEKPT
FT                   ESRSFLESHFGYRFQASRGTIDRLVSQSGDIIDVRDARGFWSGAPGTGTVDHVAFRAAD
FT                   EETLLVVRKALEATDASPTNMHDRKYFRSLYAREPGGTLVELATDKPGMTVDEEQAALG
FT                   GKLFAPPEAITNLHDLKVMLPQFSMPGQPRVNYRELPFVHRFYTPPDPDGSVFVLLHGS
FT                   GGNETTLMPLLNKAAPRATLLGVRGRATEEGFPRWYKRITPFSFDQNDIKTEAEAFAAF
FT                   IEGAVKSYGLDPQKVVYVGYSNGANLLNSLLYLHPHLVHKAVLLRSMPVLSDYPHADLK
FT                   GTDLLVISGKTDAYGKYASELEGRLKSSGATVDSDVIPGGHDLGDADIPIIQKWLLQEN
FT                   R"
FT   gene            complement(323379..324974)
FT                   /locus_tag="Rleg_0314"
FT   CDS_pept        complement(323379..324974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0314"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   response regulator receiver; histidine kinase A domain
FT                   protein; SMART: ATP-binding region ATPase domain protein;
FT                   response regulator receiver; histidine kinase A domain
FT                   protein; KEGG: rec:RHECIAT_CH0000700 probable two-component
FT                   sensor histidine kinase/response regulator hybrid protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54625"
FT                   /db_xref="GOA:C6B0K6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0K6"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACS54625.1"
FT                   /translation="MAEHCSILIIDDNIDDLEVYRRILGRVSSTAYTVVEAETGEEGRA
FT                   LNGRKRPDCILLDYSLPGRDGLGVLADILEDDPAANVIMLTGQGSETVAVEVMKSGARD
FT                   YLTKDSLSPETLHRCIQNAIMHGMLEAKLEQKRQSLEIFTRAMAHDLKEPLRTIKSFTR
FT                   ILHGSAALPAEDRELLDYVLSAADHMEDLIVKVSGFTKLEASGGLELRPVSLSDVLDQV
FT                   EDNLRQQTESRGAVIIRGALPEVMGDATLLTQLLQNLVSNAIRYCEQKVPEISITGEAQ
FT                   GDTCRLTVRDNGPGIDPEHRELIFQPFKRLVGRGIEGTGLGLAICRRIAQMHGGSIWCE
FT                   AENGPGATFILEVPLAEARPVPSAASAVPHSTRPAEQQAEGSGRLAEVLLVEDSPADIQ
FT                   LLKIKLMRREKVNFNLHVATNGREAMRLLEERAGIADLPQIDLMLLDINMPIMDGFEVL
FT                   HALSADVRLKQIPVCILSTSSDESDMRRARNLGARAYMVKPPTLQQLEEALEDVENLEL
FT                   LQRGDSLALCAEQN"
FT   gene            complement(324979..325404)
FT                   /locus_tag="Rleg_0315"
FT   CDS_pept        complement(324979..325404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0315"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; KEGG: rec:RHECIAT_CH0000701 probable
FT                   two-component response regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54626"
FT                   /db_xref="GOA:C6B0K7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0K7"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACS54626.1"
FT                   /translation="MQQRDTQPILIVEDSEDDFEATMRAFKRTNLRNSIRWAASGQEAL
FT                   DMLAEMVPKPGLILLDLNMPGLDGRKTLEAIKSNAGWRKIPVVILTTSDDERDIEGCYA
FT                   LGANTYVQKPVDLDGLFAAIQRLKEYWFEIAILPLED"
FT   gene            complement(325391..327532)
FT                   /locus_tag="Rleg_0316"
FT   CDS_pept        complement(325391..327532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0316"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: rec:RHECIAT_CH0000702 probable two-component
FT                   sensor histidine kinase protein; TIGRFAM: PAS sensor
FT                   protein; PFAM: ATP-binding region ATPase domain protein;
FT                   PAS fold domain protein; PAS fold-4 domain protein;
FT                   histidine kinase A domain protein; SMART: ATP-binding
FT                   region ATPase domain protein; PAS domain containing
FT                   protein; histidine kinase A domain protein; PAC
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54627"
FT                   /db_xref="GOA:C6B0K8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0K8"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ACS54627.1"
FT                   /translation="MQDQGNVDLQDQPRQHYRAFAIAVGCLMLLLGATALTGWLLQAEI
FT                   VISLVPGFPSMAFNTALCFVLSGAGLAASTLAARRFRIMAAITMGLAAAIAAARLVEIV
FT                   TIGRSFHNVDVLISRFLVSPDFLAEIGGGMGPNTALVFLIANLSLLLSLQVEKSRSQVV
FT                   QELTSYVVITLGMIALASYVTDAEQGYRWGPYAAMALHTAAGMVIFGSGLLARSWWMQP
FT                   ANRAQIPLWIPAAVCFTGLLVDLYTPLGVANGILYVPLVLTALWFGNRNAPLFFAFACT
FT                   VLLMLGFFAVKHNEAAFWQEIANRAITAATLWLIAILVFYFMRNNYNLETERVRFGALV
FT                   RGTPDAVVVIDERGTIRNFNPAAESMFGYSPQETIGKNIKMLMPEPYHSEHDGYLAHYR
FT                   QTGDERIIGTTRMVSGRRKNGIVFPIDVSISAVVTGHTKTFVGIVRDISERVRQEERMK
FT                   TTLSQLEAYTAELERSNHDLDEFAYIASHDLKEPLRGLHNHSRFLLEDYEDKLDADGVR
FT                   RLNRLVRLSQRMEKLVNELLYFSRLGRQQLAVKRTDIGLIVKDVVATMELLLEERHAKV
FT                   IIDGRLPEVVCDATRLTEVFRNLITNAIKYNDKPAPLVSIGYLDRFVGKDGTVARNVFF
FT                   VKDNGKGIPREFHEDIFRIFKRLEKSQDSDDGTGAGLTFVRKIIARHNGDIWLESEVGT
FT                   GTTFYFTLGKKREGQNAAA"
FT   gene            327726..328103
FT                   /locus_tag="Rleg_0317"
FT   CDS_pept        327726..328103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0317"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; KEGG: rec:RHECIAT_CH0000703 putative
FT                   two-component response regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54628"
FT                   /db_xref="GOA:C6B0K9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0K9"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACS54628.1"
FT                   /translation="MTTLFYVDDSKDDLFYLDYMSRKQQIDIDLFCFSTAETALEALET
FT                   RAAEGKTSPDLLVADLYMPLDSGIGLITRLRLDDRFKAMRLAICSGSDAAEDRARSLDA
FT                   GADVYLEKPLDLAKIILNLEM"
FT   gene            328584..329288
FT                   /locus_tag="Rleg_0318"
FT   CDS_pept        328584..329288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0318"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; Sigma-70 region 4
FT                   type 2; SMART: regulatory protein LuxR; KEGG:
FT                   ret:RHE_CH00628 LuxR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54629"
FT                   /db_xref="GOA:C6B0L0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0L0"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ACS54629.1"
FT                   /translation="MNNAPAIPFHAGPELSRAINRTDFFRLLKSAAQHYNFDNFALARI
FT                   SEASAPFGERDVVITNVAERRVGLFITTLKEALGTVRAKTAQFLATPVHGRSAQPEVYP
FT                   SDLVFNEFLSGVFLFIPLFTPEGRRYCLVLSGERQEPDQSEIADILLDAMRIFDKLYEE
FT                   ILTPEMSGRLTQRESEIVKWTSEGKTSAEIAIILGLSEHTVNSHITAAARKLDAVNRVH
FT                   MVAIALRNGLVS"
FT   gene            329319..329756
FT                   /locus_tag="Rleg_0319"
FT   CDS_pept        329319..329756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0319"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000705 putative two-component
FT                   response regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54630"
FT                   /db_xref="GOA:C6B1B1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1B1"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000705"
FT                   /protein_id="ACS54630.1"
FT                   /translation="MITETGRRNAVKVLFVDDEFIEFRALKKKIADLSEPAVEVEYSPS
FT                   IGDALEKIRLARFDLILLDNRLLPNADFRETVPELRGIGYTGPIGVVSTDISGGYFQEF
FT                   PDYGVDFRIGKDEIDAQTLQHIIREYVTYDVPDFWKDDYSI"
FT   gene            complement(329760..330476)
FT                   /locus_tag="Rleg_0320"
FT   CDS_pept        complement(329760..330476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0320"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; SMART: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; KEGG: ret:RHE_CH00630 putative two-component
FT                   sensor histidine kinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54631"
FT                   /db_xref="GOA:C6B1B2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1B2"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACS54631.1"
FT                   /translation="MSSNPTRPPETTVAGDSEERIKRFLATASHDLQSPLRHIAMYAEL
FT                   LLDDLEETLDGEQLQSLRMIMEKAQTAQRLTKALMSLAAGTPQVTPEEVDLQALAENVW
FT                   GELTDETAVGAATLESDGLPSIRTDPALLGLVLRHLLTNALTYRGEAPPHVAIAAERER
FT                   TDWFIRISDNGTGIDPAYRERIFEPFWKLPKAGAVPGAGLGLTTAREFLAALGGDISLE
FT                   RSDESGSRFIIRLPIA"
FT   gene            complement(330635..333181)
FT                   /locus_tag="Rleg_0321"
FT   CDS_pept        complement(330635..333181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0321"
FT                   /product="protein-export membrane protein SecD"
FT                   /note="TIGRFAM: protein-export membrane protein SecD;
FT                   protein-export membrane protein SecF; protein-export
FT                   membrane protein, SecD/SecF family; PFAM: SecD/SecF/SecDF
FT                   export membrane protein; KEGG: rec:RHECIAT_CH0000707
FT                   protein-export translocase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54632"
FT                   /db_xref="GOA:C6B1B3"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1B3"
FT                   /inference="protein motif:TFAM:TIGR01129"
FT                   /protein_id="ACS54632.1"
FT                   /translation="MRTSRWLVITYSVIILLGLLIALPNVLPQSVLQRVPAWLPHEQVS
FT                   LGLDLRGGSHLVLEVDEADLTKERLQSLLQDARRVLREKGIQPKAVVRSQNQIVVTLAD
FT                   AAQSDAAVTELKTLANPISTGLSAGQADLAVTANGATITVGFSPAGISANVDNAVQQSL
FT                   EVIRQRVDQVGVSEPTIQRIGANRVLVQLPGAQDPSRLRELLGSTAKMSFHMLSPNNAP
FT                   GPGVTMLKDDEGRSFPVLDRVEISGDRLSDARVSFDPNTHEPIVSFRFDSAGASRFAEI
FT                   TRQNVGNPFAIVLDDKVLSAPVIREPITGGSGQISGSFSADSATTLAAMLRAGALPAKL
FT                   TVIEERTVGADLGADAIKMGIYSGIVGFVLVAVFIFVLYGTWGFLANIALLIHTILTFS
FT                   ALTLVGATLTLPGIAGVVLGIGLAVDANVLINERIREETRKGKSAFAAIDTGFRRAYST
FT                   IIDGNMTALIAAAILFFFGSGPVRGFAVTMALGLIISMFTSVAFVRVAMIEITRRSKLK
FT                   VLNIRPLIPFSPYDKHIQFMKARFFGITVSALLSIASIVLFIHPGLNYGVDFRGGIQMA
FT                   VKTTGPADLGTFREGLNTLGLGEISLQSFGDKNSILVRAQRQEGGEEAQTAAVTKLKAE
FT                   VTKIDPTATIEGTDVIGPKVSGELAWAGILSVVIASFAMLIYIWVRFEWPFAVGAIVTL
FT                   VLDVTKAIGFFAITGLDFNLTAIAAILTLVGYSVNDKVVVYDRMRENMRLYKSMPLREI
FT                   IDKSINETLARSLYTNATAFLALVPMAIWGGSAVSSFAIPMVFGILVAGASSIFIAAPI
FT                   LLFLGDWRRRHAKASATDAAVEIIPPEQGRPRKSAS"
FT   gene            complement(333265..333645)
FT                   /locus_tag="Rleg_0322"
FT   CDS_pept        complement(333265..333645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0322"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000708 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54633"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1B4"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000708"
FT                   /protein_id="ACS54633.1"
FT                   /translation="MELEQHRLTSRIAASVLVAVLAYLGLLFGGNLVISPAAAANTLSS
FT                   SGRDPQPPQLTARDTVRGLLATERKLVPKQTAHDGGSPALAAAPTLNFAGWNISAAFPA
FT                   FEASLHAAVSRTHQPRAPPVAA"
FT   sig_peptide     complement(333526..333645)
FT                   /locus_tag="Rleg_0322"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.966) with cleavage site probability 0.711 at
FT                   residue 40"
FT   gene            complement(333700..335520)
FT                   /locus_tag="Rleg_0323"
FT   CDS_pept        complement(333700..335520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0323"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: sodium/hydrogen exchanger; TrkA-N domain
FT                   protein; KEGG: ret:RHE_CH00633 putative potassium-efflux
FT                   system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54634"
FT                   /db_xref="GOA:C6B1B5"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1B5"
FT                   /inference="protein motif:PFAM:PF00999"
FT                   /protein_id="ACS54634.1"
FT                   /translation="MPHDTPLISTIVGGLVLAFIFGAFAHRLRMPPLVGYLIAGVLVGP
FT                   HTPGYVADQNLAPELAEIGVILLMFGVGLHFSLKDLLSVRGIAVPGAIVQIAFATLLGW
FT                   GLGAFMGWPTGGSLVFGLALSVASTVVLLKALQERRLVETERGRIAVGWLIVEDLAMVL
FT                   ALVLIPAAASIGGEGHAPVEPLSAALSRLFGLDLGIGGMIAMTLVKVALFVALMLVFGR
FT                   KLIPWTMHRIAHTGSRELFRLGVLAIALGVAFGAAKLFGVSLALGAFFAGMVLAESELS
FT                   HRAAQESLPLRDAFAVLFFVSVGMLFDPNILIDKPLPILATIFIIVIGKSVAALLIVLA
FT                   FKKPLSTALTISASLGQIGEFSFILAALGVELGLLPEEGRDLILAGAIISIILNPLLFF
FT                   LCDRMRPLLDGAKREDVAADPAPAADAIAAPEEIPPEDDEVHPTALRGHAILVGYGRVG
FT                   SIVGQNLKSSATPFLVIEDSDKRIGELKAQGIETLAGNAVMRETLDLANLSGARSIAIA
FT                   IPNAFEACRIAEQARSVNPSILIVARAHSDAEVDELKQYGADTVIMGEREIALGMVDRL
FT                   AQVHHESVPYEDSHGPDTIAPTDDPPPERE"
FT   sig_peptide     complement(335443..335520)
FT                   /locus_tag="Rleg_0323"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.949) with cleavage site probability 0.949 at
FT                   residue 26"
FT   gene            335555..335854
FT                   /locus_tag="Rleg_0324"
FT   CDS_pept        335555..335854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0324"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00634 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54635"
FT                   /db_xref="GOA:C6B1B6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1B6"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00634"
FT                   /protein_id="ACS54635.1"
FT                   /translation="MTYMVYIDQYGQLEIMGQGARETILTPALCRAARGLLDWTQTDLA
FT                   DRAAVSRSTIRDYEGRHHDIHRATEAQLRLAFEEGGVKFVEIQGAGTGVYLPTA"
FT   gene            complement(335936..337357)
FT                   /locus_tag="Rleg_0325"
FT   CDS_pept        complement(335936..337357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0325"
FT                   /product="putative glycosyltransferase protein"
FT                   /note="KEGG: ret:RHE_CH00635 putative glycosyltransferase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54636"
FT                   /db_xref="GOA:C6B1B7"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1B7"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00635"
FT                   /protein_id="ACS54636.1"
FT                   /translation="MSPRSGLLIVLGFTLWRVVMLNFDTTDLFVDEAQYWFWSQNLDLG
FT                   YYSKPPMIAWVIRAMTELSGSNAIYWIRLLGPLIHMAAALVLMKTAKRFVGPEIEGWTG
FT                   ATYITLPGVALSSVFFSTDVILLFFIAIALLAYFGLTQRRSVGLALVMGLGVGLAFLTK
FT                   YAVLFVVPGGALALLLIPAARIAIRDFIIAVAVAAVVALPNLWWNLQHDNTTVRHTQDI
FT                   AHWSELGINLRRGLEFFAAQFGVVGPIIFFAMLWAVYRMIKGRSDDREKMLVWLSMPVV
FT                   VLITLQATVAKAYANWAVTAYVAGTILAVWLLYLKWPKGLRLSLTINGIASLLFPLATI
FT                   FPHQLLLPNGDALMKRYLGRAEVSRETAALAAQAGTDIIVTDNRDMVADLFYTLRDASY
FT                   RIYARAPAGLPESYYEQEFALPADITGKVLFLTDGAFTCATETPEVLKNWQPTEGNYKG
FT                   KTLSIYKVSAACLAP"
FT   gene            complement(337641..337754)
FT                   /locus_tag="Rleg_0326"
FT   CDS_pept        complement(337641..337754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0326"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54637"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1B8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS54637.1"
FT                   /translation="MIVLGLGACLIAMTLLAAVARLDSIAANRDIRALRVF"
FT   sig_peptide     complement(337692..337754)
FT                   /locus_tag="Rleg_0326"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.281 at
FT                   residue 21"
FT   gene            338186..339820
FT                   /locus_tag="Rleg_0327"
FT   CDS_pept        338186..339820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0327"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; SMART:
FT                   chemotaxis sensory transducer; KEGG: rec:RHECIAT_CH0000713
FT                   methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54638"
FT                   /db_xref="GOA:C6B1B9"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR039379"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1B9"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACS54638.1"
FT                   /translation="MPSDQARGAQAGSLRDRLRFAGLDTDQCELVRRNRPALEAHLKAG
FT                   LRDLFHRFQSFPDASRNFESERQVERLHDLQSSHWDVLTDARFDSLYAERVKVLSDTES
FT                   KMGLDPRWHVAGHGVMLEHVVSGLAEQIAGRPLLPSAKRRTREISDLMTAIIRIVMVDV
FT                   EIAVSLRFNALRAGEQRALADQRAANEAEIIRIFGDVIEGLSARDLTRRAPVDGDGAYG
FT                   GIAAALNGALDGLQAEFTAITERTVKAEAATGSLAGLSRQFAGTASGQADRLQLSAAAL
FT                   AGIAGSVRDGAADSRAAEQAAATTRAAVEESGEVVGRAISAMADIEQSAEKIGQIIGAI
FT                   DEIAFQTNLLALNAGIEAARAGDSGRGFAVVAQEVRALAQRSAEAAREIKTLVTTTKAQ
FT                   VDAGVQMVGRTQDSIGSIVRQVTDINAAISGIATRTGEHAASLDSVTSDVKGLGGEVAD
FT                   SAGLAERSAEGADHLHSVILELGQTIREFRIARENATAGRPAPVRVTPPRALEGATRPA
FT                   PVVDEYENDDFGLPQAFASVGGGRNVY"
FT   gene            339884..340180
FT                   /locus_tag="Rleg_0328"
FT   CDS_pept        339884..340180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0328"
FT                   /product="chemotaxis protein CheX"
FT                   /note="KEGG: rec:RHECIAT_CH0000714 chemotaxis protein CheX"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54639"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1C0"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000714"
FT                   /protein_id="ACS54639.1"
FT                   /translation="MAAKKSGKTLDLTAVLDLNEASALRDKLLSLRGSGLSIDASGVER
FT                   IGALCAQVLMSAEKTWEQDKQPFTFSKVSDAFQKTMQLVGVNIDHLLAKEIRQ"
FT   gene            340177..340542
FT                   /locus_tag="Rleg_0329"
FT   CDS_pept        340177..340542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0329"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; KEGG: rec:RHECIAT_CH0000715 chemotaxis
FT                   two-component response regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54640"
FT                   /db_xref="GOA:C6B1C1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1C1"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACS54640.1"
FT                   /translation="MKKKVLTVDDSRTIRNMLLVTLNNAGFETIQAEDGIEGLEVLEES
FT                   NPDVIVTDINMPRLDGFGFIEGVRRNEKYRAIPILVLTTESDAEKKNRARQAGATGWIV
FT                   KPFDPAKLIDAIERVTA"
FT   gene            340560..342836
FT                   /locus_tag="Rleg_0330"
FT   CDS_pept        340560..342836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0330"
FT                   /product="CheA signal transduction histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: rec:RHECIAT_CH0000716 chemotaxis two-component
FT                   sensor histidine kinase protein; PFAM: ATP-binding region
FT                   ATPase domain protein; Signal transducing histidine kinase
FT                   homodimeric; Hpt domain protein; CheW domain protein;
FT                   SMART: CheW domain protein; Hpt domain protein; ATP-binding
FT                   region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54641"
FT                   /db_xref="GOA:C6B1C2"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037006"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1C2"
FT                   /inference="protein motif:PRIAM:2.7.13.3"
FT                   /protein_id="ACS54641.1"
FT                   /translation="MDMNEIKEIFFQECEEQLAELESGLLKMNDGDRDPETVNAVFRAV
FT                   HSIKGGAGAFGLDDLVAFAHVFETTLDCVRSNKLEPNQDVLKVMLKSADVLADLTNVAR
FT                   DGGSVDESRSRGLVRELEALANGEMPSPSASVEAPAPKAAAKAAPAPTPKPTDDSGFQP
FT                   VPFSFDDFGGEGDAGGMPAYEVIFKPRYELYSKGNDATLLLRDLSRLGEMTIYCNTDDL
FT                   PGLEELDPEGAYFFWNVTIKTDKGEDAIRTVFEFAEWDCELTVKPVEEARAEATSNDEL
FT                   PMVPVPFDLSILDEAGAIEEVSASDARAEETAAAVAAAETASNVTQIVAARVEKKESAA
FT                   AAAAAASAAAQNNAAGAGQTIRVDLDRVDRLINLVGELVINQAMLSQSVIENDTTGTSS
FT                   INMGLEELQQLTREIQDSVMAIRAQPVKPVFQRMSRIVREIADMTGKSIRLITEGENTE
FT                   VDKTVIDKLAEPLTHMIRNAVDHGIETPEKRAAAGKNTEGTVRLTAKHRSGRILIELAD
FT                   DGAGINREKVRQKAIDNDLIPADSNLSDEEIDNLIFLPGFSTADKISDISGRGVGMDVV
FT                   KRSIQALGGRINITSKPGHGSVFTMSLPLTLAVLDGMVVTVAGQTLVVPLTAIVETLQP
FT                   EAAAIHSFGANHRLISIRNSFCPLVDVGRILNFRATQANPVEGVALLVESEGGGQRALM
FT                   VDAIQGQRQVVIKSLEANYTHVPGIAAATILGDGRVALILDVDAVVGASRGQSLKAEMS
FT                   LAAVG"
FT   gene            342841..343308
FT                   /locus_tag="Rleg_0331"
FT   CDS_pept        342841..343308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0331"
FT                   /product="CheW protein"
FT                   /note="PFAM: CheW domain protein; SMART: CheW domain
FT                   protein; KEGG: rec:RHECIAT_CH0000717 chemotaxis signal
FT                   transduction protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54642"
FT                   /db_xref="GOA:C6B1C3"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1C3"
FT                   /inference="protein motif:PFAM:PF01584"
FT                   /protein_id="ACS54642.1"
FT                   /translation="MSYTVKNLNEGDRELIAFRIGDQEFCVNIMSVREIRGWTPATAMP
FT                   HSPGYMLGVINLRGAVLPIIDLAARLGMKPADPTARHVIIVAQVRRKVVGLLVDAVSDI
FT                   LTVTDETIQPTPEISSELERQFARGILAIEKRMICLIELESLFPETESEAA"
FT   gene            343305..344213
FT                   /locus_tag="Rleg_0332"
FT   CDS_pept        343305..344213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0332"
FT                   /product="MCP methyltransferase, CheR-type"
FT                   /EC_number="2.1.1.80"
FT                   /note="KEGG: rec:RHECIAT_CH0000718 methyl-accepting
FT                   chemotaxis protein O-methyltransferase protein; PFAM: MCP
FT                   methyltransferase CheR-type; SMART: MCP methyltransferase
FT                   CheR-type"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54643"
FT                   /db_xref="GOA:C6B1C4"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR026024"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036804"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1C4"
FT                   /inference="protein motif:PRIAM:2.1.1.80"
FT                   /protein_id="ACS54643.1"
FT                   /translation="MSVMGAKDQRQGSDEVLASGEYPLTRRDLTEIAAMIYSDAGIFLN
FT                   ETKASLVYSRLSKHIRNLGLSGFREYCDLVASPAGAAPRREMLSHLTTNFTRFFRENHH
FT                   FDHLRDHVLPELLQRARSGGRVRIWSAASSDGQEPYSIALTVLSLMPNVADYDFKILAT
FT                   DIDPKILAIARAGAYDESALETVSPAMRKQWFSEVEIQGRRKFQVDDRVKRLITYNELN
FT                   LMAQWPFKGKFDVIFCRNVVIYFDEPTQMKIWQRFAGLLPEGGHLYIGHSERVSGEAKH
FT                   VFDNIGITTYRYTSKGLGRKA"
FT   gene            344210..345253
FT                   /locus_tag="Rleg_0333"
FT   CDS_pept        344210..345253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0333"
FT                   /product="response regulator receiver modulated CheB
FT                   methylesterase"
FT                   /EC_number="3.1.1.61"
FT                   /note="KEGG: rec:RHECIAT_CH0000719 chemotaxis-specific
FT                   methylesterase protein; PFAM: CheB methylesterase; response
FT                   regulator receiver; SMART: response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54644"
FT                   /db_xref="GOA:C6B1C5"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1C5"
FT                   /inference="protein motif:PRIAM:3.1.1.61"
FT                   /protein_id="ACS54644.1"
FT                   /translation="MSAPARVLVVDDSPTMRGLITAVLSSDPEVNVIGQAGDALEAREA
FT                   IKRLNPDVLTLDIEMPNMNGLDFLEKIMTLRPMPVIMVSTMTHRGAEATLAALEIGAFD
FT                   CVGKPAPGELRPFGDLAEKVKAAARTQRQYSQPVAAVAPPPSVGDFRVGRKIVAIGSST
FT                   GGVEALIAVLQKFPANCPPTVITQHMPPTFTKSFAERLNRLCAPVVQEATDGARLEIGK
FT                   IYLAPGGERHLQVSNASAPCCRLIDRAPVNGHRPSVDVLFDSVAELAGRNAVGVILTGM
FT                   GRDGAAGLLKMRHAGARTLGQNEKTCVVYGMPRVAHELGAVEQQLPLSAIGEEILKMTA
FT                   ARKEGTE"
FT   gene            345254..345643
FT                   /locus_tag="Rleg_0334"
FT   CDS_pept        345254..345643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0334"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; KEGG: rec:RHECIAT_CH0000720 chemotaxis
FT                   two-component response regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54645"
FT                   /db_xref="GOA:C6B1C6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1C6"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACS54645.1"
FT                   /translation="MSIAEKIKVLIVDDQVTSRLLLSDALTQLGFKQITSAGDGEQGMK
FT                   IMAEQPHHLVISDFNMPKMDGIGFLQAVRTNPNTKKAAFIILTAQGDRALVQKAAQLGA
FT                   NNVLAKPFTIEKMKAAIEAVFGALK"
FT   gene            345640..346194
FT                   /locus_tag="Rleg_0335"
FT   CDS_pept        345640..346194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0335"
FT                   /product="CheD, stimulates methylation of MCP protein"
FT                   /note="PFAM: CheD family protein; KEGG:
FT                   rec:RHECIAT_CH0000721 chemotaxis protein CheD"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54646"
FT                   /db_xref="GOA:C6B1C7"
FT                   /db_xref="InterPro:IPR005659"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038592"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1C7"
FT                   /inference="protein motif:PFAM:PF03975"
FT                   /protein_id="ACS54646.1"
FT                   /translation="MITEGAARRVHIIQGEYKVLNDPNAVLSTILGSCVAACLRDPVAG
FT                   VGGMNHFLLPGSATSPTSGGDATRYGVHLMELLINGLLKQGARRDRLEAKIFGGAKTIS
FT                   TFSNVGEQNAAFAVQFLRDEGIPVVGSSTGGEHGRKLEYWPVSGRARQYPLTGAETQRT
FT                   VALEQRPAAPQKPVETSIEFF"
FT   gene            346211..346600
FT                   /locus_tag="Rleg_0336"
FT   CDS_pept        346211..346600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0336"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00645 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54647"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1C8"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00645"
FT                   /protein_id="ACS54647.1"
FT                   /translation="MTFTQMMETPAPVEALSDILMRIVSELHDVAYLIERIEPQLLDLG
FT                   SAEILNSPDAMKVMQGIDLAVQKSRGLAEFIDTITGEIPHGWAVDVATALSLVKLAEMQ
FT                   KALGGATRHGHSQPLSKAAGDFDFF"
FT   gene            346810..348501
FT                   /locus_tag="Rleg_0337"
FT   CDS_pept        346810..348501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0337"
FT                   /product="flagellar M-ring protein FliF"
FT                   /note="TIGRFAM: flagellar M-ring protein FliF; PFAM:
FT                   secretory protein YscJ/FliF family protein; Flagellar
FT                   M-ring domain protein; KEGG: rec:RHECIAT_CH0000723
FT                   flagellar M-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54648"
FT                   /db_xref="GOA:C6B1C9"
FT                   /db_xref="InterPro:IPR000067"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="InterPro:IPR013556"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1C9"
FT                   /inference="protein motif:TFAM:TIGR00206"
FT                   /protein_id="ACS54648.1"
FT                   /translation="MNLLNQLVQIFKNFGSLGRTRLMILGGVGAVSIAIVLAAALFVNK
FT                   PAQETLYVGLDSPDLNQISMALAEANINFQVGTDGTSISVPAGMTGKARLMLAERGLPN
FT                   SANAGYELFDNVGSLGLTSFMQEVTRVRALEGEIARTIQSISGITAARVHIVMPEVGNF
FT                   RKAEQKPTASVMIRASATTGRSAATSIRHLVASAVPGLDVDDVTILDSAGQLLASGDEA
FT                   SNSSLNRSLNIVQNVQQEVESNIDKALAPFLGMDNFRSSVTADLNTDAQQIQETTYDPE
FT                   SKVERSVRSTKEAQQSQQKQSDSATTVEQNIPQAAPEAGGSAGPESQDKSDKREEQTNY
FT                   EINSKTTATTRSSYKVEKLSIAVVVNKGRIAKMVGEPADQTKVDAYLAEMQKIVASAAG
FT                   IDAKRGDVVTVTAMDFLENQLLEDATGGVRVMDMLSRNLAGIINSLAFVAVAFLVVWMG
FT                   LRPLVRSVSGNGSSAAFGDATPEAAGLELPDFAPASGAPGGALMDGFGSDFGFDSTEDL
FT                   LSLGDDDGNFNRRVKEGPERKLSRMVEINEERAAKILRKWAIDEAA"
FT   sig_peptide     346810..346926
FT                   /locus_tag="Rleg_0337"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.914) with cleavage site probability 0.792 at
FT                   residue 39"
FT   gene            348947..349693
FT                   /locus_tag="Rleg_0338"
FT   CDS_pept        348947..349693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0338"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; Bacterio-opsin
FT                   activator HTH domain protein; SMART: regulatory protein
FT                   LuxR; KEGG: rec:RHECIAT_CH0000724 probable transcriptional
FT                   regulator protein, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54649"
FT                   /db_xref="GOA:C6B1D0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1D0"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ACS54649.1"
FT                   /translation="MDMNVIQASKGERQMANFASAAVPDLLPRDELLQRLHGVASTGRL
FT                   QSGLRALTDYVGASYYLLARCDLLQESGLDFIVSSDWPFDLVRDIANDLVRGYARSTEL
FT                   EKCMQVFQPNFALLPDSAEVPDGASRQYCSVTFNVGRSRLALMFLFGEGFILSPERLRD
FT                   VGLLAGYVASFLRCGGTKVDRDFELTDRELECLFWIAEGKTSDEIAMILGISRNTINNY
FT                   ITSVMRKTATKTRSEAIAFAVRNNLV"
FT   gene            349702..350448
FT                   /locus_tag="Rleg_0339"
FT   CDS_pept        349702..350448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0339"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; SMART: regulatory
FT                   protein LuxR; KEGG: rec:RHECIAT_CH0000725 probable
FT                   transcriptional regulator protein, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54650"
FT                   /db_xref="GOA:C6B1D1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1D1"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ACS54650.1"
FT                   /translation="MGYPSGRTMSSAEQLRMVRVNRISSRSDLFPRLIAMQKLADAQGF
FT                   AIFRVSGSGIPAKQRLVCELENWGSSNAGFGKAFTDAYGDILLDHIDKSLLPLSWAGGY
FT                   DRAAPGPADFSPFMTRLQDGILPFSGLAFPVRLGAVGNGFILFTGDEIDPSSDTIVELH
FT                   GRCCHIMMDLLSLDERRTAAAEALSEREIACLQLAGDGRISEEIADKLGLSVHTVNAYL
FT                   GSATIKLDSVNRIQAIAKAIRLGYIS"
FT   gene            complement(350561..351004)
FT                   /locus_tag="Rleg_0340"
FT   CDS_pept        complement(350561..351004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0340"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000726 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54651"
FT                   /db_xref="InterPro:IPR017024"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1D2"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000726"
FT                   /protein_id="ACS54651.1"
FT                   /translation="MKKCPHSTQREKILADAISPVATELRLLDASDLISLLRFEYYGNL
FT                   SDLVASAAELFFHPGTVNFGLGGNYTLEWGGKPEVVLDLEIKPRGVTVYAQLTLAEDHA
FT                   GIEINHIAFQNPSADPDENTIFLRRSLRESRYSINQPPQTLAG"
FT   gene            complement(351010..352089)
FT                   /locus_tag="Rleg_0341"
FT   CDS_pept        complement(351010..352089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0341"
FT                   /product="flagellar biosynthetic protein FlhB"
FT                   /note="TIGRFAM: flagellar biosynthetic protein FlhB; PFAM:
FT                   type III secretion exporter; KEGG: rec:RHECIAT_CH0000727
FT                   flagellar biosynthesis transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54652"
FT                   /db_xref="GOA:C6B1D3"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006136"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1D3"
FT                   /inference="protein motif:TFAM:TIGR00328"
FT                   /protein_id="ACS54652.1"
FT                   /translation="MADDDKDSKTEAPTAKKQSDAAEKGNVPSSRELSIFATILATFIY
FT                   LVFFLPDSVGRMSETLRDIFEQPDQWKIETGPDVLALFVRLGWASAALVAPAFILFMVF
FT                   GVASSVFQNLPTLVLERIRPQASRISPIKGWSRLFSVPGLVEFGKSLFKVVVVGVILFF
FT                   VLRSEYFGSIDAMFSDPQTILVRLMAAMRKIIIVMLIATAIVAIADLFWTRHHWFTELK
FT                   MTRHEVKEENKQAQGDPFVKSRQRSLMRDRARRRMIADVHRATLVIANPTHYAVALRYA
FT                   REENDAPVVLAKGQDLIALKIREIAEKNGIPVFEDPPLARSMFAQVSIDSVIPSVFYKA
FT                   VAELIHRVYAADAKNKRVR"
FT   gene            complement(352426..353466)
FT                   /locus_tag="Rleg_0342"
FT   CDS_pept        complement(352426..353466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0342"
FT                   /product="flagellar motor switch protein FliG"
FT                   /note="PFAM: flagellar motor switch protein FliG; KEGG:
FT                   rec:RHECIAT_CH0000728 flagellar motor switch protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54653"
FT                   /db_xref="GOA:C6B1D4"
FT                   /db_xref="InterPro:IPR000090"
FT                   /db_xref="InterPro:IPR011002"
FT                   /db_xref="InterPro:IPR023087"
FT                   /db_xref="InterPro:IPR028263"
FT                   /db_xref="InterPro:IPR032779"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1D4"
FT                   /inference="protein motif:PFAM:PF01706"
FT                   /protein_id="ACS54653.1"
FT                   /translation="MMDFDDFGGALAGKPLTQAEKAAAVLLAMGKGVAGRLLKYFTQAE
FT                   LQTIISSAQSLRAIPPDELLLLVSEFEDLFTEGAGLMDNAKAIEAILEEGLTPDEVDSL
FT                   LGRRTAFQAYETSIWDRLSEAEPTFVAQFLLREHPQTVAYILSMMPSSFGAKVLLQLPD
FT                   NRRADIMNRTVNMKTVSPKAAQIIENQVMTLLAEVEAERNAAGSTKVADLMNELDKPQV
FT                   DTLLSSLESISRESVNKVRPKIFLFEDLMYMPQRSRVMLLNDISTDVLTVALRGSPPEI
FT                   RESVLSAISPRQRRMIESDLQSGMGGVNPREIAIARRAVAQEAIRLANSGQIELKEKEG
FT                   DASAAA"
FT   gene            complement(353495..354079)
FT                   /locus_tag="Rleg_0343"
FT   CDS_pept        complement(353495..354079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0343"
FT                   /product="flagellar motor switch protein FliN"
FT                   /note="TIGRFAM: flagellar motor switch protein FliN; PFAM:
FT                   surface presentation of antigens (SPOA) protein; KEGG:
FT                   rec:RHECIAT_CH0000729 flagellar motor switch protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54654"
FT                   /db_xref="GOA:C6B1D5"
FT                   /db_xref="InterPro:IPR001172"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR012826"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1D5"
FT                   /inference="protein motif:TFAM:TIGR02480"
FT                   /protein_id="ACS54654.1"
FT                   /translation="MATKKTQQNSDLSLDLPGSEADLDQAIDDLRGVLKQDADGDLPQF
FT                   GDDPQSDPFAAGTDLAAFGGEASESPFGGDDFGGDFGGSASSAAGMDFGSSPSFEESPA
FT                   PLGSALNSNFDLIMDIPIDVQIMLGTSRMQVSGLMNLNEGATIALDKKIGEPVEIMVNG
FT                   RRIARGEITVLDNDDTRFGVKLIEVLSTKKA"
FT   gene            complement(354145..355095)
FT                   /locus_tag="Rleg_0344"
FT   CDS_pept        complement(354145..355095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0344"
FT                   /product="surface presentation of antigens (SPOA) protein"
FT                   /note="PFAM: surface presentation of antigens (SPOA)
FT                   protein; KEGG: rec:RHECIAT_CH0000730 flagellar C-ring motor
FT                   switch protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54655"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1D6"
FT                   /inference="protein motif:PFAM:PF01052"
FT                   /protein_id="ACS54655.1"
FT                   /translation="MTMSNASHDKPAMDPALLAKLTGGLGDRGGVAKICSSFGEIYSEF
FT                   FPDVIKSETGLDVTVNYLGCEIGYKNHLIEDLSANVTLVDATLRNWSQNITLACGNGFV
FT                   ITLMEHLLGATADTIEEPADRLLSIIELDLAVMVFDKIAKVLRSAVNAPGGFEPSLSAP
FT                   HALDARARPPEDRPDEFAAAINMSITLAGIVSEFALIVPQTALLKTKVTPPKPKRQATG
FT                   KSPEWTEQLGDQVRRSHVTLEAKIRLQDLTLRTISKLMVGDVIPFRDHGDVRVEVSANS
FT                   KELYVCEFGRSGENYMVRVKDTMNSDDELIRHLMN"
FT   gene            complement(355096..355968)
FT                   /locus_tag="Rleg_0345"
FT   CDS_pept        complement(355096..355968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0345"
FT                   /product="chemotaxis motility protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000731 chemotaxis motility
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54656"
FT                   /db_xref="GOA:C6B1D7"
FT                   /db_xref="InterPro:IPR000540"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR022522"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1D7"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000731"
FT                   /protein_id="ACS54656.1"
FT                   /translation="MNIIIGFIVTCGCIVGSFMAMGGEVDALFQPFEFLIIGGAGLGSF
FT                   IMANPMKVVKDSGKALSEAFRHAVPKERNYLDTLGVLYSLMRDLRTKSRNEIEAHIDNP
FT                   AESTIFQSAPTVLKNKELTAFICDYVRLIIIGNARSHEIEALMDEELNTIMHDKMKPYH
FT                   SIQIMSDSFPAIGIVAAVLGVIKAMAHINDSPEVLGHLIGSALVGTFLGILLSYCVCSP
FT                   LVSQIKVVRNKQHRLYVIVKQTLLAYMNGSVPQVALEYGRKTISAYERPSIDAVEQEMM
FT                   NPGGENKAA"
FT   sig_peptide     complement(355900..355968)
FT                   /locus_tag="Rleg_0345"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.997 at
FT                   residue 23"
FT   gene            356223..356957
FT                   /locus_tag="Rleg_0346"
FT   CDS_pept        356223..356957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0346"
FT                   /product="flagellar basal-body rod protein FlgF"
FT                   /note="TIGRFAM: flagellar basal-body rod protein FlgF;
FT                   PFAM: flagellar basal body rod protein; protein of unknown
FT                   function DUF1078 domain protein; KEGG: ret:RHE_CH00655
FT                   flagellar basal body rod protein FlgF"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54657"
FT                   /db_xref="GOA:C6B1D8"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012836"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1D8"
FT                   /inference="protein motif:TFAM:TIGR02490"
FT                   /protein_id="ACS54657.1"
FT                   /translation="MQSGLYVSLSSQMALEKRLNTIADNMANVNTTGFRATEVKFDEMV
FT                   AATKNKLNTKVAFVSQGNDYLNEGNGELQHTGNMLDFAIKGDAWFALDTPAGRVLTRDG
FT                   RFTIKDTGELVSIRGYPVLDAGGAPIQLNTKGGEPAVGTDGIIYQADRQVASLGLFEAD
FT                   ISKGYLRYENSGIMTTDQPRAVVDRFNVGVEQGYLENSNVNAMREITQLIEVNRAFESV
FT                   SSLMRDSEDSFKEAVQTLGGSR"
FT   gene            357077..358477
FT                   /locus_tag="Rleg_0347"
FT   CDS_pept        357077..358477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0347"
FT                   /product="ATPase, FliI/YscN family"
FT                   /EC_number="7.1.2.2"
FT                   /note="KEGG: ret:RHE_CH00656 flagellum-specific ATP
FT                   synthase; TIGRFAM: ATPase, FliI/YscN family; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54658"
FT                   /db_xref="GOA:C6B1D9"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005714"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022426"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032463"
FT                   /db_xref="InterPro:IPR040627"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1D9"
FT                   /inference="protein motif:TFAM:TIGR01026"
FT                   /protein_id="ACS54658.1"
FT                   /translation="MSTTLLSEDGLSPKLAHLAGLVDRYASPEFAVAHGGRVQTIAAGH
FT                   YTVHGLSRHVRLGEFVAHKSATGIHLGEVVRVEPELIYVCPIEPGEPIGIHDTVIRKGA
FT                   FRIAPTDSWCGRTVNSLCEPIDGLGPIAEGLDRRSISNTAPPSMTRKRVETGFKTGVRA
FT                   IDIFSPLCLGQRLGIFAGSGVGKSTLLSMLARADAFDKVVIALVGERGREVREFIEDTL
FT                   GSNMKKAIAVVATSDESPMLRKMAPLTAVTIAEHFRDKGENVLFIIDSVTRFAHAIREV
FT                   ATASGEPPIARGYPASVFTELPRLLERAGPGPEGAGTITAIISILVDGDNHNDPIADST
FT                   RGILDGHIVLQRSLAEEGRYPPIDPLASISRLARKAWTPDQEKLVSRLKVLIHRFEETR
FT                   DLRMIGGYRQGADPDLDMAIKQVPIIYDVLKQSPGDRDSLDAFADLAGALKAAAGMGNQ
FT                   GAPIQRRG"
FT   gene            358480..359022
FT                   /locus_tag="Rleg_0348"
FT   CDS_pept        358480..359022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0348"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00657 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54659"
FT                   /db_xref="GOA:C6B1E0"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1E0"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00657"
FT                   /protein_id="ACS54659.1"
FT                   /translation="MADFDDERIASLKQRRKAAILDRFLTFAGLALAGASAFFPWYVFF
FT                   NADKFGINVASSSNSRELPDWPARNVFSVSPLAMVNKNEADKKAPPIDPLTTATVSDLG
FT                   KERDGRAIQEDQPFPGKSSFRLLHVSNGRALIEDPSGMYVVRIGSILPDESRLATLEQR
FT                   DGKWVIVTSKGETYQNN"
FT   gene            359289..359681
FT                   /locus_tag="Rleg_0349"
FT   CDS_pept        359289..359681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0349"
FT                   /product="flagellar basal body rod protein FlgB"
FT                   /note="KEGG: ret:RHE_CH00658 flagellar basal body rod
FT                   protein FlgB"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54660"
FT                   /db_xref="GOA:C6B1E1"
FT                   /db_xref="InterPro:IPR006300"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1E1"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00658"
FT                   /protein_id="ACS54660.1"
FT                   /translation="MQPIQLFDLASRQAEWLTIRQQVVAGNIANANTPKFHAKDVTPFD
FT                   AVLDNSNINMARTNPAHLSGNDFSDSGDIDVKDAALDQEIGVQESGNTVGLAEELSKSG
FT                   DIKRQYDLNTSLVSSFNRMMLMTVRK"
FT   gene            359686..360102
FT                   /locus_tag="Rleg_0350"
FT   CDS_pept        359686..360102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0350"
FT                   /product="flagellar basal-body rod protein FlgC"
FT                   /note="TIGRFAM: flagellar basal-body rod protein FlgC;
FT                   PFAM: flagellar basal body rod protein; protein of unknown
FT                   function DUF1078 domain protein; KEGG: ret:RHE_CH00659
FT                   flagellar basal body rod protein FlgC"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54661"
FT                   /db_xref="GOA:C6B1E2"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006299"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1E2"
FT                   /inference="protein motif:TFAM:TIGR01395"
FT                   /protein_id="ACS54661.1"
FT                   /translation="MDPLSAAMKIAGSGLEAQSTRLRIVSENIANARSTGDTPGADPYR
FT                   RKTITFGQQMDRTNGVETVGVKKVGVDEGDFSTEFDPSNPAADPKGVVKLPNVNILVEM
FT                   ADMREANRSYDANLQTIKQTRDLISSTIDLLKSQ"
FT   gene            360105..360446
FT                   /locus_tag="Rleg_0351"
FT   CDS_pept        360105..360446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0351"
FT                   /product="flagellar hook-basal body complex protein FliE"
FT                   /note="PFAM: flagellar hook-basal body complex protein
FT                   FliE; KEGG: rec:RHECIAT_CH0000737 flagellar hook-basal body
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54662"
FT                   /db_xref="GOA:C6B1E3"
FT                   /db_xref="InterPro:IPR001624"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1E3"
FT                   /inference="protein motif:PFAM:PF02049"
FT                   /protein_id="ACS54662.1"
FT                   /translation="MISSVQNVSNLSMTRALGAVDTENSTSSSAATMPGAAGAANGMSF
FT                   ASVMGNMASDAVSSLKGAESMSFAGIKGTATTREVVDSMLQAEQTLQTAIAIRDKVVSA
FT                   FLEVTKMQM"
FT   gene            360466..361254
FT                   /locus_tag="Rleg_0352"
FT   CDS_pept        360466..361254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0352"
FT                   /product="flagellar basal-body rod protein FlgG"
FT                   /note="TIGRFAM: flagellar basal-body rod protein FlgG;
FT                   PFAM: protein of unknown function DUF1078 domain protein;
FT                   flagellar basal body rod protein; KEGG: ret:RHE_CH00661
FT                   flagellar basal body rod protein FlgG"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54663"
FT                   /db_xref="GOA:C6B1E4"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012834"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1E4"
FT                   /inference="protein motif:TFAM:TIGR02488"
FT                   /protein_id="ACS54663.1"
FT                   /translation="MRALAIAATGMDAQQTNLEVIANNIANINTTGFKRARAEFSDLLY
FT                   QTERAKGVANRANQAVVPEGANIGLGVQTSAVRNLHLQGELTQTGNDLDVALIGKGFFQ
FT                   IQSTDGTTLYSRAGAFNKNDQGQLVTIDGYEVLPGITIPTGSTELTISRSGQVTAKLPG
FT                   ATEATELGQLTLADFVNEAGLQPLGDNLFQETPASGEAVIGNPDEEGFAYMKQGYLESS
FT                   NVDPVKEITELISAQRAYEMNSKVITTADEMASIVSKNLK"
FT   gene            361271..361753
FT                   /locus_tag="Rleg_0353"
FT   CDS_pept        361271..361753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0353"
FT                   /product="flagella basal body P-ring formation protein
FT                   FlgA"
FT                   /note="TIGRFAM: flagella basal body P-ring formation
FT                   protein FlgA; KEGG: ret:RHE_CH00662 flagellar basal body
FT                   P-ring biosynthesis protein FlgA"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54664"
FT                   /db_xref="GOA:C6B1E5"
FT                   /db_xref="InterPro:IPR017585"
FT                   /db_xref="InterPro:IPR039246"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1E5"
FT                   /inference="protein motif:TFAM:TIGR03170"
FT                   /protein_id="ACS54664.1"
FT                   /translation="MMFCRAGHISGWVAAATIAVAGIFLPADVDAGMGYAVVPTTIIYP
FT                   GDTLSSSQLQEVEVTNPNLAGDYAKSISQVEGMVSKRTLLPGRTISVSGLREAYTVTRG
FT                   SSIRLVLSFGALTISAAGTPLEDGTTGQVVRARNMDSGVIVSGTVLADGTVHVRAK"
FT   gene            361750..362871
FT                   /locus_tag="Rleg_0354"
FT   CDS_pept        361750..362871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0354"
FT                   /product="flagellar P-ring protein"
FT                   /note="PFAM: flagellar P-ring protein; KEGG:
FT                   rec:RHECIAT_CH0000740 flagellar basal body P-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54665"
FT                   /db_xref="GOA:C6B1E6"
FT                   /db_xref="InterPro:IPR001782"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1E6"
FT                   /inference="protein motif:PFAM:PF02119"
FT                   /protein_id="ACS54665.1"
FT                   /translation="MKLFFRFVTLVAVLAMSLADVVPAWALTSRIKDIASLQAGRDNQL
FT                   IGYGLIVGLQGTGDGFRSSPFTEQSMRAMLQNLGISTQGGQSNAKNTAAVMVTANLPPF
FT                   ASPGSRIDVTVSSLGDATSLRGGTLVMTSLSGADGQIYAVAQGAAIVSGFQAQGQAATV
FT                   TEGVTTAGRVPGGAIIERELPSRFKDSVNLVLQLRNPDFSTAIRIADIVNGYASARFGG
FT                   PVAEAKDSQEVVIQKPRTADLTRLMADIENLIVETDTPAKVVINERTGTIVIGSDVRVS
FT                   PVAVSYGTLTVQVTETPQIIQPEPFSQGRTAVQPQTDIAAEQTGGRVAIIDGPDLRTLV
FT                   AGLNNIGVKPDGIIAILQGIKSAGALQAELVLQ"
FT   sig_peptide     361750..361830
FT                   /locus_tag="Rleg_0354"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.742 at
FT                   residue 27"
FT   gene            362868..363410
FT                   /locus_tag="Rleg_0355"
FT   CDS_pept        362868..363410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0355"
FT                   /product="putative exported flagella related protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000741 putative exported
FT                   flagella related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54666"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1E7"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000741"
FT                   /protein_id="ACS54666.1"
FT                   /translation="MIDIINPDMTVLQLLRRLALPAAGLVLLSIPSAFAQEHAPAGDIT
FT                   SQDEIKQFCTNIAEPARDQRYLLQKQELEKLRADIDARMAEMDKRKAEYQDWLKRRDDF
FT                   LKQAEAGLTEIYRKMKPDAAALQLQDMKIEVASAVIMRLGPRQSSLILNEMDPEKAAVI
FT                   ASVIASASDPNTSKDPS"
FT   sig_peptide     362868..362975
FT                   /locus_tag="Rleg_0355"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.979 at
FT                   residue 36"
FT   gene            363407..364123
FT                   /locus_tag="Rleg_0356"
FT   CDS_pept        363407..364123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0356"
FT                   /product="flagellar L-ring protein"
FT                   /note="PFAM: flagellar L-ring protein; KEGG:
FT                   rec:RHECIAT_CH0000742 flagellar L-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54667"
FT                   /db_xref="GOA:C6B1E8"
FT                   /db_xref="InterPro:IPR000527"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1E8"
FT                   /inference="protein motif:PFAM:PF02107"
FT                   /protein_id="ACS54667.1"
FT                   /translation="MNMRFPAAIAALALLAGCQSPTAVSEIGRAPAMSPIGSGLAYGQT
FT                   PQMALYPKQPRAVAQGYSLWSDSQAALFKDARALNVGDILTVDIQINDKGSFDNETNRS
FT                   RKNSSGMNWDVNAQIFGWTPESKTDLTYGSDTSTDGKGKIERTDKLTLLVAAVVTGILE
FT                   NGNLVISGSQEVRLNQELRILNVAGIVRPQDVNAENQISYDKIAEARISYGGRGRLMEV
FT                   QQPPRGQQAVDLFSPL"
FT   sig_peptide     363407..363484
FT                   /locus_tag="Rleg_0356"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.543 at
FT                   residue 26"
FT   gene            364136..364642
FT                   /locus_tag="Rleg_0357"
FT   CDS_pept        364136..364642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0357"
FT                   /product="flagellar basal body-associated protein FliL"
FT                   /note="PFAM: flagellar basal body-associated protein FliL;
FT                   KEGG: ret:RHE_CH00666 flagellar biosynthesis transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54668"
FT                   /db_xref="GOA:C6B1E9"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1E9"
FT                   /inference="protein motif:PFAM:PF03748"
FT                   /protein_id="ACS54668.1"
FT                   /translation="MAEPDASAGQSQKKSGALMTIIGIAVLTLLGAGGGWAVGTIVAPN
FT                   IKGAKEVEQAKDAEAKKKAEEGLARISTEANNVVQLEPITSNLAYPSENWVRLEVALLF
FT                   NGPPDVKVSEDIHQDILAYIRTVSLQQIEGPRGFQYLKDDIQERVDLRSQGRVSKVMFR
FT                   TFVIE"
FT   gene            364639..365376
FT                   /locus_tag="Rleg_0358"
FT   CDS_pept        364639..365376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0358"
FT                   /product="flagellar biosynthetic protein FliP"
FT                   /note="TIGRFAM: flagellar biosynthetic protein FliP; PFAM:
FT                   type III secretion system inner membrane P protein; KEGG:
FT                   ret:RHE_CH00667 flagellar biosynthesis protein FliP"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54669"
FT                   /db_xref="GOA:C6B1F0"
FT                   /db_xref="InterPro:IPR005837"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1F0"
FT                   /inference="protein motif:TFAM:TIGR01103"
FT                   /protein_id="ACS54669.1"
FT                   /translation="MIRLIVFLAAMMAVPELAVAQQLPTDLLNVPVDGSVAAWIIRTFG
FT                   LLTILSVAPGILIMVTSFPRFIIAFSILRSGMGLSSTPSNMILLSLSLFMTFYVMSPTF
FT                   DQAWQNGVQPLLANQINETEAVQRIAEPFRTFMAANTRDKDLALFVDLARERGQNIQTT
FT                   DPIDYRVLIPAFMISEIRRGFEIGFLVVLPFLVIDLIVATITMAMGMMMLPPTSISLPF
FT                   KILFFVLIDGWNLLVGSLVRSFS"
FT   sig_peptide     364639..364701
FT                   /locus_tag="Rleg_0358"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.967 at
FT                   residue 21"
FT   gene            complement(365518..367491)
FT                   /locus_tag="Rleg_0359"
FT   CDS_pept        complement(365518..367491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0359"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000745 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54670"
FT                   /db_xref="GOA:C6B1F1"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR029489"
FT                   /db_xref="InterPro:IPR037919"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1F1"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000745"
FT                   /protein_id="ACS54670.1"
FT                   /translation="MRASAIDSHARTFPSRSWVLNSKVSFSAASKDYQMGRYTQSLATL
FT                   NQLMDIQQDAKTYALLAKNLVQLGFKADAAKAYGLAGNCEGPNSYEYQKQAAKLHYETG
FT                   NEDDALLIAMRNLTKAQEDAELAFIITAIYLKRQQRDIIRPFKTVLSQSANPDHMRLAA
FT                   LLLSDDLNDATNQNLARNIFKRFPGNLAFRFLHLVFAREFNEFEEASKHQAVIDAALAK
FT                   GDIEILRKDNPFYHLHWCGNEDFNRYATIGTTPLNQERVAFRRNQPHTWSDKIRIGYMS
FT                   SDFWDRHATMKLLQRILELHDTDRFEVTLFCHTGPEYLKHNTIDRSRWGRIVTVHGFSD
FT                   QAVLEAVREHNIDIMVDLKGHTSGSRATAFNLPLAPVHVGWLGFPGSTVNVDLDYVIGD
FT                   HFVLPEVAKPFYHEKFCRLPESYQPNDPMHRPKPRPVTREQLGLPDDAFIFASFNGNRK
FT                   ITPETIDSWCRILKRAPNSVLWLMANTPRNQANLLKQFQTAGISAKRIIFCPRAPYEQH
FT                   IDRQQAADIGIDTFPVNGHTTTSEQLWGGLPVLTVKGTNFASRVSESLLRAIDLPELVA
FT                   PDLRAYEDMAVELAENPGRIAEYKAHLKEKRYTAPLFDAERFCDHLEQAYQIMAERAKQ
FT                   GLAPDHMDIPALPPRTAPFAAE"
FT   gene            367922..368827
FT                   /locus_tag="Rleg_0360"
FT   CDS_pept        367922..368827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0360"
FT                   /product="flagellin domain protein"
FT                   /note="PFAM: flagellin domain protein; KEGG:
FT                   ret:RHE_CH00669 flagellin C protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54671"
FT                   /db_xref="GOA:C6B1F2"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1F2"
FT                   /inference="protein motif:PFAM:PF00700"
FT                   /protein_id="ACS54671.1"
FT                   /translation="MTSINTNSSAQAALQTLRSVNQNLNNTQNHVSSGYRVEKASDNAA
FT                   YWSIATTMRSDNKALSAVSDALGVGAAKVDTAYTAMDSAIDVVGDIKAKLVAATENGVD
FT                   KAKVQEEIGQLQQQLLSIAQSASFNGENWVAGADGTKSVVSSFVRDGSNAVSITTTDYV
FT                   LDSGSAGNVLFGMSGGSVETSTGILGTSSGATGSIYAMDITSFTAGQIQSALTNVEAAL
FT                   KSMTSAGAALGSLSSRIDAQDDFVSALSDSIDSGVGRLVDANMEEESSKLSALQTQQQL
FT                   AIQSLSIANSSSQNILSLFR"
FT   gene            369110..370018
FT                   /locus_tag="Rleg_0361"
FT   CDS_pept        369110..370018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0361"
FT                   /product="flagellin domain protein"
FT                   /note="PFAM: flagellin domain protein; KEGG:
FT                   rec:RHECIAT_CH0000748 flagellin C protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54672"
FT                   /db_xref="GOA:C6B1F3"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1F3"
FT                   /inference="protein motif:PFAM:PF00700"
FT                   /protein_id="ACS54672.1"
FT                   /translation="MTSINTNNAAMAALQTLRGINQGLQETQAHVSSGYRVGKASDNAA
FT                   YWSIATTMRSDNKALSAVSDALGLGAAKVDTAYSAMDSAIDVVGDIKAKLVAATESGVD
FT                   KAKVQEEISQLQQQLLSVAQSASFSGENWVAGADGTKNVVASFVRDGSNAVSVVMTDYV
FT                   LDSSSMGNVLFGMSVGSVETSTGILGTSNGATGSVYAMDITNFTLGEIQSALTNVESAL
FT                   KAMTSAGAQLGSISKRIELQENFVSALSDSIDSGVGRLVDANMEEESSKLSALQTQQQL
FT                   AVQSLSIANSSSQTILTLFRG"
FT   gene            370266..371177
FT                   /locus_tag="Rleg_0362"
FT   CDS_pept        370266..371177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0362"
FT                   /product="flagellin domain protein"
FT                   /note="PFAM: flagellin domain protein; KEGG:
FT                   ret:RHE_CH00671 flagellin C protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54673"
FT                   /db_xref="GOA:C6B1F4"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1F4"
FT                   /inference="protein motif:PFAM:PF00700"
FT                   /protein_id="ACS54673.1"
FT                   /translation="MTSILTNVAAMAALQTLRGINDSLEDTQNRVSSGYRVEKAADNAA
FT                   YWSIATTMRSDNKALSAVSDALGLGAAKVDTAYSAMDSAIDVISEIKAKIVAATEKGVD
FT                   KAKVQEEIGQLQQQLLSIAQSASFSGENWVAGADGTKSVVSSFVRDGNGNVSVKTTDYI
FT                   LDTSSTGNVLFGMDSTGAIETSSGLIGTSSGTIGSIYSMDITNFDSPEISMALTSIEAG
FT                   LEAMTKAASQLGSISTRIELQEGFVSALSDSIDSGVGRLVDANMEEESSKLSALQTQQQ
FT                   LAIQSLSIANSSAQNILTLFRS"
FT   gene            371478..372440
FT                   /locus_tag="Rleg_0363"
FT   CDS_pept        371478..372440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0363"
FT                   /product="flagellin domain protein"
FT                   /note="PFAM: flagellin domain protein; KEGG:
FT                   rec:RHECIAT_CH0000750 flagellin C protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54674"
FT                   /db_xref="GOA:C6B1F5"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1F5"
FT                   /inference="protein motif:PFAM:PF00669"
FT                   /protein_id="ACS54674.1"
FT                   /translation="MTVKITSAAAVNALAVLRSINKEASQTQQQVSSGYRIETAADDAS
FT                   YWSVATVMRSDSTNLGTIGDALGLGAAKVDATYTAMDSAIDLIGEIRAKLVSAREPGAD
FT                   KDKINAEISEYKEQLQTVVESTSFAGENWLLNGDAAAPPTWQVISGFVRAPTGEYQAQT
FT                   IDFPSSQTILIDKNNASGGLLTKSVDANAINNSGATSRNYYLLNANSTTPATGTEIAIG
FT                   KNTTDAQLTDMLDVTDSLLSSLTTTAASIGVMKTRIDDQIDYTANLSDSIDKSVGALVD
FT                   TDMDEASIRQKAIETQKQMAVEAISILNTAASKILILLE"
FT   gene            372644..373273
FT                   /locus_tag="Rleg_0364"
FT   CDS_pept        372644..373273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0364"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000751 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54675"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1F6"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000751"
FT                   /protein_id="ACS54675.1"
FT                   /translation="MSIALSRYLKDFGEPESSAPILDMDDFGSDAFPEMASEPAIDVEA
FT                   ERREAYAEGHAAATVELTEKYEREVRMLAEVHARELEELKLRYEVEAAAVIASRIRDIA
FT                   EEIAQLVSAGAAVAIAPVMTEALAAKAAESLASLLRDAILEGAAGAVVVRGPTRLFDIL
FT                   KAELGEHAEAVRHIETDDIDLAVEIGDAVIVTRMSAWAASLKKVLE"
FT   gene            373270..374601
FT                   /locus_tag="Rleg_0365"
FT   CDS_pept        373270..374601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0365"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG:
FT                   rec:RHECIAT_CH0000752 chemotaxis motility protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54676"
FT                   /db_xref="GOA:C6B1F7"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1F7"
FT                   /inference="protein motif:PFAM:PF00691"
FT                   /protein_id="ACS54676.1"
FT                   /translation="MSEGENHHHGKNEIIIVKRHGGGDHDGAHGGAWKIAYADFMTAMM
FT                   AFFLVMWLVNAANEETKASVATYFNPIKLSDEKPTEKGLKKPVDNAEGEEKQEKSKQKE
FT                   EDPNDGKAAADGDDQTSTSGDQTNYSEADFFENPYSVLAEIAQEVGQQANVSAKGDGGA
FT                   ADSGPATGADGGEAYRDPFDPDFWTKQVEVTTAGKPLPPGKSDDQAVESETTEIAKLED
FT                   AKPIPLTTDQKAAQETKETKETKGAVEAKDGKTPGGKSPEDKKAEAQKDADHQKDADKS
FT                   AAETEQQQQKEAEQLQAQIAQQIGGVAGKLAEGLTVTASEGGLLVSISDQTDDSMFNIG
FT                   SAVPRQEMVLAMEKIGAILKERGGAVAVRGHTDGRQYKGTQNENWRLSMDRAQSAYYML
FT                   VRGGLDEKRISQVSGFADRRLKLPSDPFNATNRRIEILVQADQG"
FT   gene            374606..375901
FT                   /locus_tag="Rleg_0366"
FT   CDS_pept        374606..375901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0366"
FT                   /product="chemotaxis motility protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000753 chemotaxis motility
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54677"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1F8"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000753"
FT                   /protein_id="ACS54677.1"
FT                   /translation="MARRQHRYVGFVALGLAMLSPAGGNAQDPDDLAPYKMLRSLQFVQ
FT                   DSVVSGDHSAGEMQRFMLGTIDERLRTVDPSTFDDDRNVDAALIYAMSGGNPQTLEYLI
FT                   AHDVNGYFDNRVTDVLRKYLSGKGLLVAKTLEETAREYRDKKIGPYLALIGGNVLIATK
FT                   PTDALDLYDQARLAAPGTIVEEAALRRSVAICVDKGMLDRGMAYSQRYVRRFLHSPYAS
FT                   QFADLFVTLVVGHDHDVKPQDVIDILSFMDAPRQREVYLRIARAAAISGKPELARMAVG
FT                   RVQSLGAGTDNPFGSLADFYGGMAGLPTEDIDQAAKNVSGIDGNALSPRDQALQEAARS
FT                   VADQILRAPDPASLTQASDPNTDHQEITSEKAAAIATQPGAPGALPEPVPGGVASTGQS
FT                   QDTDPSFNAFVTTNRSKLDEIDGLLAQEGNEQ"
FT   sig_peptide     374606..374686
FT                   /locus_tag="Rleg_0366"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.981 at
FT                   residue 27"
FT   gene            375898..377331
FT                   /locus_tag="Rleg_0367"
FT   CDS_pept        375898..377331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0367"
FT                   /product="chemotaxis motility protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000754 chemotaxis motility
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54678"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="InterPro:IPR038610"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1F9"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000754"
FT                   /protein_id="ACS54678.1"
FT                   /translation="MMDMSVSGGAPGAESAATAKSARPAGKDDAAGQKNGFSDALAKAS
FT                   GSAANDDADDAQPNQGVAADGSAEKAAQSIRGRNGAKPLIDLSDAALKAQAEAQPETIV
FT                   SADKAAAKPVKAEIKMPTDLGLGKLDPKDSSANGVAPAAKGGKHTKADALETDTDKASD
FT                   DDDGGISDVLGLLKQEPADGTVTLPAATAHHVSANVDEAGAADKKIDGIEAKAGGHASD
FT                   ALAAVSGNVESGKADNIKVPGSQAAEAADGKTFRISRADGRGVSMDVHIGTDQVGPKDG
FT                   SKKADVENVSVLESRRYIGLMQNSNSAAVTAALSGDSEWARAMEPSSALSNAAEWTSTG
FT                   RVVNTLKIQMNPLDLGLVTATMRLSGDALNVDLKVETGAAYRQMKEDHGKILEALRSQG
FT                   YAVENVTISMAPVERSDAGNQGQASQQQSPPQQGQGGEARERHNQTAQRTDGGFNGAGE
FT                   TGIEDARAGGSSGTGGVYL"
FT   gene            377279..377836
FT                   /locus_tag="Rleg_0368"
FT   CDS_pept        377279..377836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0368"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="PFAM: Lytic transglycosylase catalytic; KEGG:
FT                   ret:RHE_CH00677 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54679"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1G0"
FT                   /inference="protein motif:PFAM:PF01464"
FT                   /protein_id="ACS54679.1"
FT                   /translation="MKTLVLAAAAVLAAFTSEATASTGACEREIQSAAAKYGIPEGILY
FT                   SVGLTETGRKGSLYPYAMNVEGKAIFPPSEQDAMRQFDVARNSGAKLIDIGCMQINHYF
FT                   HGENFRSAEEMFDPHRNVEYAAKFLRNLHDRHETWTMAVARYHAGPNNNPAQKQYVCRV
FT                   ISNLVATGYGKWTLNASNFCRN"
FT   sig_peptide     377279..377344
FT                   /locus_tag="Rleg_0368"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.754 at
FT                   residue 22"
FT   gene            378117..378788
FT                   /locus_tag="Rleg_0369"
FT   CDS_pept        378117..378788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0369"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: transcriptional regulator domain protein;
FT                   KEGG: ret:RHE_CH00678 two-component response regulator
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54680"
FT                   /db_xref="GOA:C6B1G1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1G1"
FT                   /inference="protein motif:PFAM:PF00486"
FT                   /protein_id="ACS54680.1"
FT                   /translation="MIVVVDERELVKDGYTSLFGREGIPSTGFDPAEFGEWVQTAADSD
FT                   IAAVEAFLIGQGQRNFELPRAIRDRSMAPVIAVSDQHSLENTLALFDCGVDDVVRKPVH
FT                   PREILARAAAIRRRLKAITNYTEIGGIRVFSDGRDPEINGEVFALPRRERRILEYLIAN
FT                   RGRRVTKTQIFNAIYGIFDEEVEENVVESHISKLRKKLRKKLGVDPVDSKRFLGYCIDW
FT                   A"
FT   gene            378912..380210
FT                   /locus_tag="Rleg_0370"
FT   CDS_pept        378912..380210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0370"
FT                   /product="protein of unknown function DUF1078 domain
FT                   protein"
FT                   /note="PFAM: protein of unknown function DUF1078 domain
FT                   protein; flagellar basal body FlaE domain protein;
FT                   flagellar basal body rod protein; KEGG:
FT                   rec:RHECIAT_CH0000757 flagellar hook protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54681"
FT                   /db_xref="GOA:C6B1G2"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR011491"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037058"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1G2"
FT                   /inference="protein motif:PFAM:PF06429"
FT                   /protein_id="ACS54681.1"
FT                   /translation="MSIFGSMKTAVSGMNAQANRLSTVADNIANVNTTGYKAVSTSFSS
FT                   LVLPSSGGNYNSGGVQTSVRQAVSDQGDISYTTSSTDLAISGDGFFIVQGPDGTPVLTR
FT                   AGDFTKDDEGNLVNAAGFMLMGYSYDSGSPAVVVNGFDGLVPVNVNQDGLTAIASTSGI
FT                   FKGNLDSNAKIAPVAPATLPSANLATTTTDTKKVSMVAYDRLGNKVMYDFYFTKKTVVT
FT                   PPPATPATAATWEVSMFRNADAAVGGTTSFPYSTASVGTGTLSFDANGKLTAGGAVNIV
FT                   DPVTGQTIAMDFSAFTQLGADFSGTGTPNGQAATPVKDVTVDGDGIVYAKYEDGSTKPL
FT                   YRIPLANVASPDKLTLMSGNVYSANGQSGVTVTGFPQTNGLGTIKSGALEGSNVDLAGE
FT                   LTEMIESQRSYTANSKVFQTGSDIMDVLVNLKR"
FT   gene            380230..381717
FT                   /locus_tag="Rleg_0371"
FT   CDS_pept        380230..381717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0371"
FT                   /product="flagellar hook-associated protein FlgK"
FT                   /note="TIGRFAM: flagellar hook-associated protein FlgK;
FT                   PFAM: protein of unknown function DUF1078 domain protein;
FT                   KEGG: ret:RHE_CH00680 flagellar hook-associated protein
FT                   FlgK"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54682"
FT                   /db_xref="GOA:C6B1G3"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1G3"
FT                   /inference="protein motif:TFAM:TIGR02492"
FT                   /protein_id="ACS54682.1"
FT                   /translation="MSLTSALNTAQNIFNNTGTQSSVVSNNISNAGNKDYVRRQAMLTT
FT                   SLNGAQVVKIDRAQEEALLRQYLKTSSQDSAQQALLGGLEDLKSIVGGNDYETSPSTYL
FT                   GVFQQKLQAFRTTPGSTVAAQGAITAAQDVANSLNNASQSVQNVRATADKQIATDVDKL
FT                   NTLLNDFEKANNAVKTATASGADASGALDEREKALKQISQIVGVNTTTRDNNDMVLSTS
FT                   DGTILFETIPRKVTFKSQDVYTATITGNSVYVDGVALPRGSGSTTTGQGSLQSLLQVRD
FT                   EIAPNFQKQLDEVARGLVSLFKEQNTAAGPAYVPGLFTWSGGTVDTGATAVAGMAATIT
FT                   VSSRVITSQGGDPMRLRDGGVNATGLVLNTSGASGYTTELDRLYTALGSDIDFDPAAGT
FT                   PVGFDATTGIDSNVSIMEFATNSLGWLEQYRSNATTAAENTSAALSRSDEAYSNETGVN
FT                   LDEELTLLLDIEQSYKAATKILNAVDEMLKSLLDIAS"
FT   gene            381721..382773
FT                   /locus_tag="Rleg_0372"
FT   CDS_pept        381721..382773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0372"
FT                   /product="flagellar hook-associated 3 family protein"
FT                   /note="PFAM: flagellar hook-associated 3 family protein;
FT                   KEGG: ret:RHE_CH00681 flagellar hook-associated protein
FT                   FlgL"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54683"
FT                   /db_xref="GOA:C6B1G4"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1G4"
FT                   /inference="protein motif:PFAM:PF07164"
FT                   /protein_id="ACS54683.1"
FT                   /translation="MKSSFISSSAIQNAMRLTIRQAQNQMTKATMEATTGVYADIGVSL
FT                   GGNAARSVDFSREVDRIDSIKSSNSLVTARMESSQLGLSKMKDVGDGLVSKLTALQGSH
FT                   DPGSITVAIQSATSALSTMMDTANTMVNGEYLFSGINTDVQPLTDKTTATSAAIVTELN
FT                   TYAAALVPPKAVSALTGAEMSTFITTKVEPMFSQAAWTDPTTGWSQASSQNMTSRISNS
FT                   EVIESSTNANSEGMRYFALASVMTSALLGQGLSSDAMSTVSKQAISYTTKATSGLVTQA
FT                   SQLGLSQERVKKSNDALDAQSNIIKNKLVDLQGVDPYEASTLVKTLETQLETAYTIVSK
FT                   IQQLSLVNYL"
FT   gene            382808..383155
FT                   /locus_tag="Rleg_0373"
FT   CDS_pept        382808..383155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0373"
FT                   /product="flagellar FlaF family protein"
FT                   /note="PFAM: flagellar FlaF family protein; KEGG:
FT                   rec:RHECIAT_CH0000760 flagellin synthesis regulator
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54684"
FT                   /db_xref="GOA:C6B1G5"
FT                   /db_xref="InterPro:IPR010845"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1G5"
FT                   /inference="protein motif:PFAM:PF07309"
FT                   /protein_id="ACS54684.1"
FT                   /translation="MYQFSYAEVMQDSVADAKEREWQVLDRSIDLLAAAREKEKYGREA
FT                   IEALFYTRRVWISFIEDLKHPDNQLEIGLRANLISIAIWILKECDRIRKRQSNNYQGII
FT                   DVTTIIRDGLK"
FT   gene            383152..383601
FT                   /locus_tag="Rleg_0374"
FT   CDS_pept        383152..383601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0374"
FT                   /product="flagellar FlbT family protein"
FT                   /note="PFAM: flagellar FlbT family protein; KEGG:
FT                   rec:RHECIAT_CH0000761 flagellin synthesis regulator
FT                   (repressor) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54685"
FT                   /db_xref="GOA:C6B1G6"
FT                   /db_xref="InterPro:IPR009967"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1G6"
FT                   /inference="protein motif:PFAM:PF07378"
FT                   /protein_id="ACS54685.1"
FT                   /translation="MKSTLRISLKAGERIFINGAVLRVDRKVALEFLNDVTFLLENHVL
FT                   QPEGATTPLRQLYFIAQMILINPEGKDHSTALFRKSITMLLTCFKNEEILAELKRIDAL
FT                   VSTGRAFDALKAIRGLYAIEDNILNNHEMPPTMVEQIRREIAPWR"
FT   gene            383592..384026
FT                   /locus_tag="Rleg_0375"
FT   CDS_pept        383592..384026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0375"
FT                   /product="flagellar hook capping protein"
FT                   /note="PFAM: flagellar hook capping protein; KEGG:
FT                   ret:RHE_CH00684 flagellar basal body rod modification
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54686"
FT                   /db_xref="InterPro:IPR005648"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1G7"
FT                   /inference="protein motif:PFAM:PF03963"
FT                   /protein_id="ACS54686.1"
FT                   /translation="MAVDATSSVANTSSTSTTNTAQQKATLNYDNFLQLLIAQMKNQDP
FT                   TDPVDASEQMSQLASFSQVEQTIQTNTKLDTLLASSSLTQASSYVGKYMESADGTVKGT
FT                   IESVKVYSDGIIATTTDGGNILVQAGITVADKAPTTSTDT"
FT   gene            384126..384392
FT                   /locus_tag="Rleg_0376"
FT   CDS_pept        384126..384392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0376"
FT                   /product="flagellar biosynthetic protein FliQ"
FT                   /note="TIGRFAM: flagellar biosynthetic protein FliQ; PFAM:
FT                   export protein FliQ family 3; KEGG: rec:RHECIAT_CH0000763
FT                   flagellar biosynthesis transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54687"
FT                   /db_xref="GOA:C6B1G8"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="InterPro:IPR006305"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1G8"
FT                   /inference="protein motif:TFAM:TIGR01402"
FT                   /protein_id="ACS54687.1"
FT                   /translation="MNEADALDLFQAAIWTVLIAAGPAVIAAMVVGLVIALIQALTQVQ
FT                   EATLTFVPKIVAVLITVGVTAPFVGSQISIFTNLVFSRIQSGF"
FT   gene            384608..386695
FT                   /locus_tag="Rleg_0377"
FT   CDS_pept        384608..386695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0377"
FT                   /product="flagellar biosynthesis protein FlhA"
FT                   /note="TIGRFAM: flagellar biosynthesis protein FlhA; PFAM:
FT                   type III secretion FHIPEP protein; KEGG: ret:RHE_CH00686
FT                   flagellar biosynthesis protein FlhA"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54688"
FT                   /db_xref="GOA:C6B1G9"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR006301"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1G9"
FT                   /inference="protein motif:TFAM:TIGR01398"
FT                   /protein_id="ACS54688.1"
FT                   /translation="MAQPPALPLPKVAPNLRDVGFALGIIVIICILFLPIPPFLIDMGL
FT                   AFSIALSVLILMVALWIQKPLDFSSFPTILLIATMTRLALNIATTRVILSHGHEGHDAA
FT                   GGVIAGFASLVMSGDFVIGLIVFLILITINFIVITKGATRIAEVGARFTLDAIPGKQMS
FT                   IDADLSAGIIDEREAQRRRKELEEESSFFGAMDGASKFVRGDAVAGLIITCINIFGGII
FT                   IGYFRHGMPIGEAADVFVKLSVGDGLVAQMPALIVSLAAGLLVSRGGTTGSTDQAVVNQ
FT                   LSGYPRALSVSAVLMFILALMPGLPFVPFVSLGGLLAFGAWFIPRQVEAENMLRREQEE
FT                   KKVVQSKELEKDSVKAVLRTSEIELALGKMVSTRLLGAHQELAFRVGKMRKKFATQYGF
FT                   VVPEIKVTDDIAIAEKSYQIRIHGTTVASNLLRVGEVLVVTGAGRRPSIPGDEIREPAF
FT                   GMPAVSILENFADDLKREGFQPIDNVSVVLTHMSEVIRNNLPQLLSYKDVKVLIDRLDP
FT                   EYKKLADEICSSHMSYSGLQAVLKLLLAERVSIRNLHLILEAVAELAPHVRKTEQIVEH
FT                   VRIRMAQQLCGDLADNGVLRVLRLGSKWDLAFHQALKRDAKGEVIEFDIDPRSLEEFSE
FT                   QATKVIREFMDRGLPFALVTSPETRSYVRMIIERLFATLPVLSHVELAKGIEIKILGSI
FT                   S"
FT   gene            386692..387444
FT                   /locus_tag="Rleg_0378"
FT   CDS_pept        386692..387444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0378"
FT                   /product="type III secretion system inner membrane R
FT                   protein"
FT                   /note="PFAM: type III secretion system inner membrane R
FT                   protein; KEGG: rec:RHECIAT_CH0000765 flagellar biosynthesis
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54689"
FT                   /db_xref="GOA:C6B1H0"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="InterPro:IPR006303"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1H0"
FT                   /inference="protein motif:PFAM:PF01311"
FT                   /protein_id="ACS54689.1"
FT                   /translation="MITDPQGTVLALFLVFCRIGGCVLALPGFSSARVPDQLRVFIAGA
FT                   LSIAVMPLLWDTVYPAVHTGAGTYIGLIFSESLIGVMYGMLARIYTLGMQFAATIIAMM
FT                   VGYTQPGSADILEDTPETSLSGFITFAGMMILFIMDFHHIVFRALIDSYTTMPFGGLMQ
FT                   MRATLISFTDTLEQTTYIMLRLSSPFLIYGLIFNVSIGFINKLAPQIPVYFISTPYLLM
FT                   GGLFLIYFSIAAMVSQFGQSFGSIYIGR"
FT   gene            387452..387865
FT                   /locus_tag="Rleg_0379"
FT   CDS_pept        387452..387865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0379"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000766 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54690"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1H1"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000766"
FT                   /protein_id="ACS54690.1"
FT                   /translation="MIEKKRSQKLKRLLSVQRHIERMAENDLAETSRQRVEVNVAMDDV
FT                   ILALGSMDPVHHAFSQNYADRFGRLTIKDQQLTGMHQIHEMRLTRERAKGDRLEEGMQE
FT                   ALEAERREADDNAVYDVIDQQFATPASSKLQKP"
FT   gene            387898..388461
FT                   /locus_tag="Rleg_0380"
FT   CDS_pept        387898..388461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0380"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000767 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54691"
FT                   /db_xref="InterPro:IPR019301"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1H2"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000767"
FT                   /protein_id="ACS54691.1"
FT                   /translation="MAISPPSDLVLDVVKAADPMELQAAQEKLKANRAAFAATSLAENG
FT                   KGFSNTVDVLDQVGHKSGLNNIQNRTKAEEAPESYRKFEAMVLQNFVKSMLPSESEDVY
FT                   GKGATGDIWKGMMAEQLGNVMAKGDGIGIAKQMYSEQLRRQEGKIVNASTDDDDRNTAL
FT                   SMIDDFQRKTFGTPTAEAKTDRTG"
FT   gene            388586..388951
FT                   /locus_tag="Rleg_0381"
FT   CDS_pept        388586..388951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0381"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00690 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54692"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1H3"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00690"
FT                   /protein_id="ACS54692.1"
FT                   /translation="MEIVSNEYRIKSVLGRLEMIIDNENTRIGNDPQFDLKVSNAHKSR
FT                   CLYELSTLFRDTDPAELAAAHLDQLHGLKKKLVLNARRVEAHLEAVRAVADLLKNAVQD
FT                   ADADGTYSQEQFAARGN"
FT   gene            388951..389490
FT                   /locus_tag="Rleg_0382"
FT   CDS_pept        388951..389490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0382"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00691 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54693"
FT                   /db_xref="GOA:C6B1H4"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1H4"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00691"
FT                   /protein_id="ACS54693.1"
FT                   /translation="MIKLVLTGVWVCAITLASVYFSVYLATAPAPAATDSKQSALELVK
FT                   GETITVPIIGNGAITGYFLGRVSFMMNKDMLKGVTLPLSEMTTDELFSLLVGNKMVDIA
FT                   HIKSFDPKAFREEIKKGMNERLGGEYVADVMLEQLDYLSKEEVKESSAGQPKKVGKPVK
FT                   IVETAPAAEAPAPAAH"
FT   sig_peptide     388951..389034
FT                   /locus_tag="Rleg_0382"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.938) with cleavage site probability 0.396 at
FT                   residue 28"
FT   gene            389782..390621
FT                   /locus_tag="Rleg_0383"
FT   CDS_pept        389782..390621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0383"
FT                   /product="glycosyl transferase, WecB/TagA/CpsF family"
FT                   /note="TIGRFAM: glycosyl transferase, WecB/TagA/CpsF
FT                   family; PFAM: glycosyl transferase WecB/TagA/CpsF; KEGG:
FT                   rec:RHECIAT_CH0000770 N-acetyl mannosamine transferase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54694"
FT                   /db_xref="GOA:C6B1H5"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1H5"
FT                   /inference="protein motif:TFAM:TIGR00696"
FT                   /protein_id="ACS54694.1"
FT                   /translation="MNLIANFAVLASRRTIFDLPVCDLGWDDALVFINELASIPVGQTV
FT                   VCFVNAHNMLTALRDDEYYRIMSHNLVLPDGIGLNIASQIAHGSPFPANLNGTDFVPAF
FT                   LTFMEAPRRIGLIGGERSVVEAAAENFRRHTPWHEFVVVSDGYFDKVDPTDVIEELERQ
FT                   KVDILIVGMGTPLQEKWVHDHIRADHARLVLTVGALFDFVSGAVPRAPRTVRMMRLEWA
FT                   YRLLQEPTRLWRRYIIGIPVFLFHVLRYRFRRRERILSHPEEHGSALQPRSDHKKAS"
FT   gene            390778..392550
FT                   /locus_tag="Rleg_0384"
FT   CDS_pept        390778..392550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0384"
FT                   /product="putative succinoglycan biosynthesis transport
FT                   protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000771 putative succinoglycan
FT                   biosynthesis transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54695"
FT                   /db_xref="GOA:C6B1H6"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1H6"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000771"
FT                   /protein_id="ACS54695.1"
FT                   /translation="MYDIRARNNFQDRVAAGPRHDDDSYGAPRSRQPDIAPPEAELLRA
FT                   IGRVLEEQRARAARTAPLVDRIETILGNRLRAANDVGHLLLQQPAGDEELSVPADEPMI
FT                   SPEPLAAVREEPAAARSVAPRRRVGGIGLVMMVAAATIVGAGLPAQMPASPALYRAEAT
FT                   LAVKSDAASRAAFTQAAAKGLLSARVVASTVAALKLDHDPEFAGASANALGVALDLLSA
FT                   TGAAADPASRAEATLKHAVEILPDAAAGTILVRATTGNSGKSMRIAAKLAEAVSAADGP
FT                   GGNVETDTALRKTYDEVKVELAAFTAKSGEGNVKVAIDLRRQIDQLDADLKAADQNILA
FT                   AKAQTDRLKAAKLAEVLDGSLPSDMLSPALQDWRDKYAVAKTTLAQLSAELGPRHPRLL
FT                   QQQAETDGLKENMGKELTRLAQTANLAAKAAVDARKGLNDRRNTLIAQSRDTGVDLSRL
FT                   TELSEKANAARSRLEEATSTAVETAADGRIVLLKPALATAVSGSDGLTGRSLAGAAAGL
FT                   AIGLAAAFLLRLRRPVADPAREKMPVLRPQAALPSMPAQAPAPVDEMELLRSEISGLRD
FT                   RLRVHALEARQPLR"
FT   gene            392669..393568
FT                   /locus_tag="Rleg_0385"
FT   CDS_pept        392669..393568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0385"
FT                   /product="Methenyltetrahydrofolate cyclohydrolase"
FT                   /EC_number="3.5.4.9"
FT                   /note="PFAM: tetrahydrofolate dehydrogenase/cyclohydrolase;
FT                   KEGG: rec:RHECIAT_CH0000772 folD1"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54696"
FT                   /db_xref="GOA:C6B1H7"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1H7"
FT                   /inference="protein motif:PRIAM:3.5.4.9"
FT                   /protein_id="ACS54696.1"
FT                   /translation="MTTVIDGKNVAASVIQTVKSATAALEKSSGVTTGLAVVIVGDDPA
FT                   SHAYVGSKGRMAKECGFKSVQHTLPAETKQEDLAALVASLNADPSIHGILVQLPLPKPL
FT                   DSEAIIQSILPEKDVDGLSVVNAGKLATGDLKTGLVSCTPAGAMVFVRRTHGEDLSGLN
FT                   AVVIGRSNLFGKPMAQLLLNANATVTIAHSRTKNLAEVCRNADILVAAVGRPEMVRADW
FT                   VKPGATVIDVGINRVAAPERGEGKTRLVGDVAFEEVSAVASTITPVPGGVGPMTIAMLM
FT                   ANTVIAAHRTAGQTPPQF"
FT   gene            complement(393619..394644)
FT                   /locus_tag="Rleg_0386"
FT   CDS_pept        complement(393619..394644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0386"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; SMART: regulatory protein LacI;
FT                   KEGG: rec:RHECIAT_CH0000773 transcriptional regulator
FT                   protein, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54697"
FT                   /db_xref="GOA:C6B1H8"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1H8"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ACS54697.1"
FT                   /translation="MNLKQLSELLGLSQTTVSRALNGYPEVNEATRERVLQAVKETGYR
FT                   PNKAAQRLATGKAGSIGLVMPTAPGHQSDVHFGEFLAGLGEEAVRHDFHFVIMPADPDD
FT                   EVAALRRLAISGNVDALFVAYMRGHDPRLAMLKSLSMPYVVHGRSFGSEPDYPYLDIDN
FT                   EGAFYDATRLLLQLGHTRFALMNGPMHLDFAIRRKNGVVAALAERGLALEEGCMSHALM
FT                   TDEQGLLAMEHFLQLPERPTAILCSSTVLALGAIRAVNQAGLRLGEDISLIAHDDVLPL
FT                   LKPESFSVPLTTTRSSLRAAGVRIAQRLIGTVKQAGPFPDQELWKTELIVRASTGPVPQ
FT                   A"
FT   gene            394953..396314
FT                   /locus_tag="Rleg_0387"
FT   CDS_pept        394953..396314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0387"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: ret:RHE_CH00696 alpha-glucoside ABC transporter,
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54698"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1H9"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACS54698.1"
FT                   /translation="MKKSFLMGVAVAALFAGAASAADLKFAPGQDSKFNWKSYDEFKAA
FT                   HADLKGQPLTIFGPWRGEDEAFFMSVLAYFTEATGIDAKYSSSENYEQQIVIDTQAGSP
FT                   PNIAVLPQPGLLADLASKGFLTPLGDDNSKWIKDNYGAGDSWVGYGTYKGKDGKEAFYA
FT                   FPYKADVKSLVWYVPENFEEAGYKIPTTMEELHALTDQIVKDGGVPWCIGLGSGGATGW
FT                   PATDWVEDIMLRMQPPEAYDKWTTNELKFTDPAVVAAIDEFGKFAKNAKYVDGGVAAVA
FT                   STDFRDSPKGLFAVPPKCYMHHQASFIPSFFPEGTKLGQDADFFYMPTFASHPELGKPV
FT                   LGAGTLVSIAKDSKTARAFIDFLKTPIAHEVWMAQSSFLTPYKGVSTEAYANPQMKKEG
FT                   DILTSATTFRFDGSDLMPGKIGAGAFWTGMVDFVGGKSAEEAAGEIQSAWDGIK"
FT   sig_peptide     394953..395018
FT                   /locus_tag="Rleg_0387"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            396503..397516
FT                   /locus_tag="Rleg_0388"
FT   CDS_pept        396503..397516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0388"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ret:RHE_CH00697
FT                   alpha-glucoside ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54699"
FT                   /db_xref="GOA:C6B1I0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1I0"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS54699.1"
FT                   /translation="MLSQIVSALGVVVGAVIACSAYFYFSNKILDLALPVKDGDIRAAS
FT                   RNLNRRALVRPWLFIGPALFLLVVYLVYPVVATFILSFYDRAGLQFVGLANYKWALGDR
FT                   EFRQSIFNNILWLAVVPAACTFFGLVIAVMTDRIWWGNIAKSIVFMPMAISFVGASVIW
FT                   KFIYEYRGGNDVQIGLLNAIVQTFGGTPEVWISIPFWNNFFLMIILIWIQTGFAMVILS
FT                   AALRGIPEETIEAAVIDGANGWQIFWRIMVPQVWGSIAVVWTTITILVLKVFDIVLTMT
FT                   NGQWQTMVLANLMFDWMFRGGGDSGRSAVIAIIIMLAVTPIMVWNVRRANRELKGH"
FT   sig_peptide     396503..396559
FT                   /locus_tag="Rleg_0388"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.689) with cleavage site probability 0.371 at
FT                   residue 19"
FT   gene            397518..398681
FT                   /locus_tag="Rleg_0389"
FT   CDS_pept        397518..398681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0389"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rec:RHECIAT_CH0000777
FT                   alpha-glucoside ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54700"
FT                   /db_xref="GOA:C6B1I1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1I1"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS54700.1"
FT                   /translation="MTAIGSYFKIGPARLFVHAAVLLIVIIWLIPTLGIFVSALRDKDQ
FT                   IVVSGWWTAFVGSTQTAAVRLGTPDQQKQEGATYVISGNVLEGQTGRAVKAFGNRIQQP
FT                   AAFKAGETADLGDGETLQINSDGSYRYVKNAAFSPDQRPKRIYASVSAPPEFTMQNYNT
FT                   VLTGEGIGQSFINSLTVTIPATIIPILIAAFAAYALSWMEFPGRGLLIALVVGLIVVPL
FT                   QMSLIPLLRLYNEIGNMLGQPSKTYPGIWLAHTAFGMPLAIYLLRAYIAGLPKEIIESA
FT                   RVDGASDFEIFVRIVLPLSFPALASFAIFQFLWVWNDLLVAMVFLGTDKDHIVLTGSLN
FT                   ALLGSRGGNWEILTASAFVTIIVPLLVFFGLQRYLVRGLLAGSVKGG"
FT   gene            398715..400367
FT                   /locus_tag="Rleg_0390"
FT   CDS_pept        398715..400367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0390"
FT                   /product="alpha amylase catalytic region"
FT                   /note="PFAM: alpha amylase catalytic region; SMART: alpha
FT                   amylase catalytic sub domain; KEGG: ret:RHE_CH00699
FT                   alpha-glucosidase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54701"
FT                   /db_xref="GOA:C6B1I2"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1I2"
FT                   /inference="protein motif:PFAM:PF00128"
FT                   /protein_id="ACS54701.1"
FT                   /translation="MNVASQSISTPDKDWWRGAVIYQIYPRSYQDSNGDGIGDLKGITA
FT                   RLPHVANLGVDAIWISPFFTSPMRDFGYDVSDYENVDSIFGTLVDFDTMIAEAHRLGIR
FT                   VMIDLVISHSSDQHPWFAQSRSSKTNAKADWYVWADAKPDGTPPNNWLSIFGGSAWAWD
FT                   PTRMQYYLHNFLTSQPDMNLHNPEVQDRLLDVVRFWLNRGVDGFRLDTINFYFHDTQLR
FT                   DNPALAPERRNASTAPAVNPYNFQEHLYDKNRPENLAFLKRFRAVLEEFPAIAAVGEVG
FT                   DSQRGLEIVGEYTSGNDKMHMCYAFEFLAPDPLTPERVEEVMQDFEAAAPDGWACWAFS
FT                   NHDVMRHVSRWGGLVADHDAFAKLYASLLMTLRGSVCLYQGEELALTEADLAYQDLQDP
FT                   YGIQFWPEFKGRDGCRTPMVWDSQVAQGGFSTVKPWLPVPVEHILRAVSVQLGDEASVL
FT                   EHYRRFIAFRKLHPAFAKGEIEFEEQQADSLVFTREYGNEKLLCIFNMSPAEAAVILPA
FT                   GEWQALTGHGFTSNNYGDKIDIPAWGAYFARLA"
FT   gene            400418..401506
FT                   /locus_tag="Rleg_0391"
FT   CDS_pept        400418..401506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0391"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; TOBE domain protein;
FT                   Transport-associated OB domain protein; SMART: AAA ATPase;
FT                   KEGG: rec:RHECIAT_CH0000779 alpha-glucoside ABC
FT                   transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54702"
FT                   /db_xref="GOA:C6B1I3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1I3"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS54702.1"
FT                   /translation="MTGLTLKDIRKSYGSVDVLHGIDLDIKQGEFIVFVGPSGCGKSTL
FT                   LRMIAGLEAITGGEMYIDGHLVNDVPPSKRGIAMVFQSYALYPHMTVFDNMAFGMKIAG
FT                   ESKQDIDRRVKAAAESLQLTQYLGRLPKALSGGQRQRVAIGRAICRDPKVFLFDEPLSN
FT                   LDAALRVATRIEIARLNEQMADTTMIYVTHDQVEAMTLADRIVVLSAGNIEQVGAPLDL
FT                   YERPANLFVAKFIGSPAMNIIPATVAGTGSQTTVTLTGGMSVTLDVATDASEMGKQASF
FT                   GVRPEDLRVADGADYLFEGEVSIVEALGEVTLLYIEGLVPGEPIVVKLPGIYDVKKGQR
FT                   MRFAADRQKLHLFDATGHTYRK"
FT   gene            401623..402036
FT                   /locus_tag="Rleg_0392"
FT   CDS_pept        401623..402036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0392"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000780 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54703"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1I4"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000780"
FT                   /protein_id="ACS54703.1"
FT                   /translation="MAASNPSQPKSHFLSKEESFMYDREARFKMEDTMNAARIEYTEKG
FT                   VMHAASRRCDIVRISMSSATLAILTQFSLPKQFYLDIPDARITKVGCLLMKVNANNTVE
FT                   VRFLRLLTQKELNKIFVYSTHPAHRDYVLDIRA"
FT   gene            complement(402117..403940)
FT                   /locus_tag="Rleg_0393"
FT   CDS_pept        complement(402117..403940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0393"
FT                   /product="6-phosphogluconate dehydratase"
FT                   /EC_number="4.2.1.12"
FT                   /note="KEGG: rec:RHECIAT_CH0000783 phosphogluconate
FT                   dehydratase protein; TIGRFAM: 6-phosphogluconate
FT                   dehydratase; PFAM: dihydroxy-acid and 6-phosphogluconate
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54704"
FT                   /db_xref="GOA:C6B1I5"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004786"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1I5"
FT                   /inference="protein motif:TFAM:TIGR01196"
FT                   /protein_id="ACS54704.1"
FT                   /translation="MSAHARISAITDRIVERSKPSRERYLERLRAAASKGVARSVLGCA
FT                   NLAHGFAVCSPADKDALAGDRIPNLGIITAYNDMLSAHQPFETYPAIIREAAAEAGGVA
FT                   QVAGGVPAMCDGVTQGQPGMELSLFSRDLIAMSAGVGLSHNMFDAALFLGVCDKIVPGL
FT                   VIAALSFGHLPSIFVPAGPMTTGLPNDEKSRVRQLFAEGKVGRAELLEAESKSYHGPGT
FT                   CTFYGTANSNQMLMEIMGFHMPGSSFINPGTPLREALTREAAKRALAITALGNEFTPAG
FT                   EMIDERSVVNGVVGLHATGGSTNHTLHLVAMARAAGIHLTWQDIAELSEIVPLLARVYP
FT                   NGLADVNHFQAAGGMGFLIKELLKHGLVHDDVRTVFGHGLQAYTVDARLGENGAVLREP
FT                   SPEKSVDPKVLSSIETPFQANGGLKMLRGNLGKAVIKISAVKPERHIIEAPAIIFHSQQ
FT                   ELQDAFKEGKLNRDFIAVVRFQGPKANGMPELHKLTPPLGVLQDRGFRVALLTDGRMSG
FT                   ASGKVPAAIHVTPEAVDGGPIARIREGDIIRLDAIKGTLELLVDAADLAERDPVVVDLS
FT                   DNEFGMGRELFAPFRRAVGASDQGASVLFHH"
FT   gene            complement(404018..404716)
FT                   /locus_tag="Rleg_0394"
FT   CDS_pept        complement(404018..404716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0394"
FT                   /product="6-phosphogluconolactonase"
FT                   /note="TIGRFAM: 6-phosphogluconolactonase; KEGG:
FT                   rec:RHECIAT_CH0000784 6-phosphogluconolactonase protein;
FT                   SNP /replace=G"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54705"
FT                   /db_xref="GOA:C6B1I6"
FT                   /db_xref="InterPro:IPR005900"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR039104"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1I6"
FT                   /inference="protein motif:TFAM:TIGR01198"
FT                   /protein_id="ACS54705.1"
FT                   /translation="MASTLHSFASAADLAGSLADKVADALSAAIAARGTASIAVSGGST
FT                   PKVFFQTLSTRDVAWDKVTITLVDERFVPADNPRSNHLLVDANLLQNKAKVARFLPLYQ
FT                   DAASAEEAARLATEKTRAISSPFDIVILGMGGDGHTASFFPGGSNLAKAIDASTPRGII
FT                   TMEAEGAGEPRLTFTFSSLEDAALLVLHIEGEGKKDVLAKAEGSGDEAEMPIRAVLRRA
FT                   TSPVEIYWAP"
FT   gene            complement(404727..406202)
FT                   /locus_tag="Rleg_0395"
FT   CDS_pept        complement(404727..406202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0395"
FT                   /product="glucose-6-phosphate 1-dehydrogenase"
FT                   /EC_number="1.1.1.49"
FT                   /note="KEGG: ret:RHE_CH00704 glucose-6-phosphate
FT                   1-dehydrogenase; TIGRFAM: glucose-6-phosphate
FT                   1-dehydrogenase; PFAM: glucose-6-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54706"
FT                   /db_xref="GOA:C6B1I7"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1I7"
FT                   /inference="protein motif:TFAM:TIGR00871"
FT                   /protein_id="ACS54706.1"
FT                   /translation="MSSQIIPVEPFDYVVFGGSGDLAERKLLPALYHRQIEGQFSEPTR
FT                   VIGASRSPLTHEEYRKFAKDALNEHLKKGEYDEAEVEKFCARLYYVSVDARTDAGWDQL
FT                   KKLLDEGKDRVRAFYLAVAPGIFGDISQKIHDHKLITKSTRIVVEKPIGRDLASALQLN
FT                   DTIGRAFKEEQIFRIDHYLGKETVQNLMALRFANALYEPLWNANYIDHVQITVAESVGL
FT                   EGRAGYYDTAGALRDMVQNHILQLLCLTAMEVPSSMDSEAVRDEKLKVLRALKPLNASN
FT                   VEQATVRGQYRAGASGSGPVKGYLEELEGGVSNTETFVAIKAEINNWRWAGVPFYIRTG
FT                   KRLTGRMSEIVITFKPIPHAIFDQAAGRINANQLIIRLQPDEGVKQSLMIKDPGPGGMR
FT                   LRNVSLDMSFAQAFNVRNPDAYERLLMDVIRSNQTLFMRRDEVEAAWKWVDPILKGWET
FT                   TGQQVQGYTAGTWGPSQAIALIERDGRTWHDEI"
FT   gene            complement(406337..407635)
FT                   /locus_tag="Rleg_0396"
FT   CDS_pept        complement(406337..407635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0396"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   ret:RHE_CH00705 oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54707"
FT                   /db_xref="GOA:C6B1I8"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1I8"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ACS54707.1"
FT                   /translation="MASQETWQSPIAPGLSWYQATVGERPTYPALDGSRTCDVAIVGGG
FT                   YTGLQAAYNLAKSGVSVVLIEAYRFGDGASGRNGGQLGTGQRWWPEELEEKIGYERSKA
FT                   LFDLAEAAKRHLIDFAREHQIEIDYVPGQLNVAHKASYKRDYYENAEIAALRYGYPHLS
FT                   FMDEKETQERLGSKRFHCGVRDVGTGHIHPLKLLVGLARVAANAGAEIFEMTKATAIRQ
FT                   SGGKVTIETERGTITAERALIACNGHIGDLEPVTASHVMPIRSFIGATAPLDGHAGVLP
FT                   GGEAVADSRFVVRYFRKFGDGRLLFGGREAYTSDNPRDISEHIRRQIAEIYPELKDIEI
FT                   THAWGGSVGITLPRQPFVREVMPGVISIGGYSGHGVMLSNYCGKLYAETVLGTSGDLDL
FT                   FTSLDIPAFPGGARMRAPLLFLALSWFALRDKF"
FT   gene            complement(407648..409084)
FT                   /locus_tag="Rleg_0397"
FT   CDS_pept        complement(407648..409084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0397"
FT                   /product="Glutamate--putrescine ligase"
FT                   /EC_number="6.3.1.11"
FT                   /note="PFAM: glutamine synthetase catalytic region; KEGG:
FT                   ret:RHE_CH00706 glutamine synthetase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54708"
FT                   /db_xref="GOA:C6B1I9"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1I9"
FT                   /inference="protein motif:PRIAM:6.3.1.11"
FT                   /protein_id="ACS54708.1"
FT                   /translation="MSPKKTTLKPARNVPASKKTPPEPGSLRGVANWKEAARWLRARGI
FT                   EDIECITPDLAGVARGKMMPSSKFTSNTSLALPSAIYRHTISGEYPDETESFRYEPRDS
FT                   DLKLMPDLSTLSVVPWETDPTAQVICDIVDSDGGEVPYTPRNVLKRIMSLYHERGWKPI
FT                   VAPEIEFYLVAKNDDPDYPLHPPKGRSGRSILGGQGYSIAGINEFDELIDDVYHFSEKQ
FT                   GLEIDTLIHEEGPAQMEINLRHGNPIELADQVFLFKRTIREAALKHDIYATFMAKPMQG
FT                   QPGSAMHIHQSVVDIETGKNIFSNADGSASKEFFHFIGGMQKFVPSAMAMLAPYVNSYR
FT                   RLQPDMSCPVNNAWGYDNRTTAFRVPVSDPQARRVENRLPSSDANPYLALAASLASGLL
FT                   GIMKQIEPTAPTEDSANEGSIDLPRGLLEAVALLEDEPAFEEMFGKQFIGLYAGVKRGE
FT                   FETFMQVISPWEREFLLLNV"
FT   gene            409173..410393
FT                   /locus_tag="Rleg_0398"
FT   CDS_pept        409173..410393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0398"
FT                   /product="HI0933 family protein"
FT                   /note="PFAM: HI0933 family protein; FAD dependent
FT                   oxidoreductase; FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; fumarate
FT                   reductase/succinate dehydrogenase flavoprotein domain
FT                   protein; KEGG: rec:RHECIAT_CH0000788 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54709"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1J0"
FT                   /inference="protein motif:PFAM:PF03486"
FT                   /protein_id="ACS54709.1"
FT                   /translation="MEKEDAGLIGETGLQRKSDVIVIGAGAAGMMAAIRAGKRGRSVVI
FT                   LDHARAPGEKIRISGGGRCNFTNIHAGPKNFLSANPHFCKSALARFTPADFIAMVDRHG
FT                   ITWHEKTLGQLFCDDSAKDIIRMLLAEMRAAGATLHLGTEISGVEKTESGFRVSTSEGH
FT                   CEASSLIVATGGKSIPKMGATGFAYRLAEQFGLAVLETRPGLVPLTLDPGLLESIAPLA
FT                   GIAAPAEIRHGRTGFREALLFTHRGLSGPAILQISSYWREGDEIVLAIEPDIDIAAHLK
FT                   VAKQLNGRQSPQTALGDILPKRLAQFLVEREKISGNMADLPDKALLRLAAGVQNWAVKP
FT                   SGSEGYRTAEVTLGGIDTAALDSRSMEAKAVPGLYFIGECVDVTGWLGGYNFQWAWASG
FT                   FAAGECV"
FT   gene            410638..410781
FT                   /locus_tag="Rleg_0399"
FT   CDS_pept        410638..410781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0399"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54710"
FT                   /db_xref="GOA:C6B1J1"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1J1"
FT                   /inference="similar to AA sequence:KEGG:Arad_0951"
FT                   /protein_id="ACS54710.1"
FT                   /translation="MNRNARRARAIAIAEAKPNARMVALRYLMLAAGATAASLALLLSH
FT                   FI"
FT   sig_peptide     410638..410748
FT                   /locus_tag="Rleg_0399"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.738) with cleavage site probability 0.574 at
FT                   residue 37"
FT   gene            411095..413626
FT                   /locus_tag="Rleg_0400"
FT   CDS_pept        411095..413626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0400"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SMART: chemotaxis
FT                   sensory transducer; histidine kinase HAMP region domain
FT                   protein; KEGG: rec:RHECIAT_CH0000790 methyl-accepting
FT                   chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54711"
FT                   /db_xref="GOA:C6B1J2"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1J2"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACS54711.1"
FT                   /translation="MLIDKILSRFRIKTKVLIFVLPFVVTISAVGLTGLYASGLLQGRM
FT                   EISNSVLQSLSGFKDLYGSMDDFLRVTSPEARDKLSADLKIQQGVLDQTLSQVGDEAAG
FT                   RDSLAEASRRTKEISGVVDKLWALHEQEQALHEQIDAAQKSVISTRFTVSYQAEQLQST
FT                   VQSDESAATSTLRTADRLLKGGDFLGTVASGFSKPQTPQDKIAFINEQMPEIIKSQRLI
FT                   AISVPSNQKNVIEALAATIDGIKAIVQTPNPTDETATELGRLVSRFRQTSTYTQLTATQ
FT                   KMRDATQEFAALDGRIAQANSVLQDTRRLENSVYSLQIVLSDFLADSSKENLVRLQQQA
FT                   GTLGKDMQVLVTSAKGMGFAEGISGAIQPALDVISGGGSKIVDTIGERVTAYAAARQEL
FT                   DQIWKKLTDFAELQKQTAGTERTQANSISVMTTGLGILLSILGGIALVLTLQRPISHIT
FT                   AAMRRIAEGALDTSISGEQRHDEIGDMARALGIFKENAISKIRIEEQSDEERAAAEHER
FT                   LRNDAEKREMDRQIEFAVNALAAGLERMSQGDISTTIETPFIGRLEQLRQDFNGSMMRL
FT                   QATMSQIRDNVELIQGNGNQMAQSAEDLSKRTEQQAASLEETAAAVDQITVTVRSSAER
FT                   AKDADQIVRQAKRSADDSAVVVSNAIDAMSRIEGASRQIEQIIGVIDEIAFQTNLLALN
FT                   AGIEAARAGEAGKGFAVVAMEVRELAQRSAAAAQEIKGLINKSTNEVNSGSQFVQETGT
FT                   VLAKISAQIVTISQHVEMIARASHDQSNALQSVNATVNQMDQMTQQNAAMVEETTAASR
FT                   ELADEAGSLRRLIQQFKIDGEATSAPVYRAA"
FT   sig_peptide     411095..411208
FT                   /locus_tag="Rleg_0400"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.945) with cleavage site probability 0.614 at
FT                   residue 38"
FT   gene            413858..415705
FT                   /locus_tag="Rleg_0401"
FT   CDS_pept        413858..415705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0401"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SMART: chemotaxis
FT                   sensory transducer; histidine kinase HAMP region domain
FT                   protein; KEGG: ret:RHE_CH00709 methyl-accepting chemotaxis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54712"
FT                   /db_xref="GOA:C6B1J3"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033462"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1J3"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACS54712.1"
FT                   /translation="MLRLFSTSIVRQIVAITLFLLAISTAAIVGVTYYNLSHQVMDGAV
FT                   SDANDAARAMAVLYGAADQAAKIELKDNQLFAVTEDAIPALADHSLVDRTAQSIAGVAT
FT                   IFQKQGGDYVRISTNVKKENGDRAVGTKLIAEHPAQPVLARGEAYYGPAELFGRKFMTG
FT                   YFPMKNASNANVGILFIGIPMEVYYQRMYELQMLVLGVGAIVMLIVGVLAFYAIRLSVK
FT                   PLQALTASVHSISAGDLEGAIPCVEKKNEFGDIGRALALFSDSARARRDLETQAAEQRE
FT                   LSDAERARNDADKRSLDGQIDFAVNQLAAGLGRLSQGDVSQTIGTPFVGRLEQLRVDFN
FT                   ASLLRLQDTLSGIRDSASTIQRNSGAVSVSAGELSKRTEAQAANLEETAAAVEEITVTV
FT                   RSSAERAREANNVVAATKKTADSSGAVVGDAVAAMDRIEQASQRIEQIIEVIDDIAFQT
FT                   NLLALNAGIEAARAGEAGKGFAVVAQEVRELAQRSADAAREIKSLIETSSREVTAGSEL
FT                   VQKTGSVLASISQEIIAISGHVETIATASRDQSAALQEVNGSVNAMDQMTQKNAAMVAE
FT                   TTQASRLLAGEADTLMALIERFRIVAESAPAHLGARRVA"
FT   sig_peptide     413858..413947
FT                   /locus_tag="Rleg_0401"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.732 at
FT                   residue 30; SNP /replace=G"
FT   gene            complement(415678..415914)
FT                   /locus_tag="Rleg_0402"
FT   CDS_pept        complement(415678..415914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0402"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000792 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54713"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1J4"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000792"
FT                   /protein_id="ACS54713.1"
FT                   /translation="MIDMLTIAGTIGYRHYPKRSGCKAEEDRFYAEFGNNSLIGFAAWL
FT                   TSLDLDLRRHRKTAAQSRSGCGCAVQATLLAPR"
FT   gene            416005..416874
FT                   /locus_tag="Rleg_0403"
FT   CDS_pept        416005..416874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0403"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; KEGG:
FT                   rec:RHECIAT_CH0000793 probable transcriptional regulator
FT                   protein, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54714"
FT                   /db_xref="GOA:C6B1J5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1J5"
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /protein_id="ACS54714.1"
FT                   /translation="MKNASWDSYQLFLQVARLGGLTGASTASGLSPATVGRRMLDLEQE
FT                   IGRALFSRSQTGYRLTQDGQALLDHLQEMEAAARKVAAWRQSGEGGTTVRVAAGTWLAW
FT                   LLTENFAAIRMPGDAFAISLTIGEARASLAYRESDIGIRAFEPEEANLAARLLGEVAYA
FT                   VYIRRNAAETDERWIAVAEEEAISAYLRWPHAHAATGIVATVNRPRSLPDLVRAGAGKT
FT                   VLPCFVGDLHPELQRQGGELPELRHRQWIVMNAEDRHRPEIRMVADRMTKLIKSYADLF
FT                   AGKRPSRG"
FT   gene            complement(417013..417249)
FT                   /locus_tag="Rleg_0404"
FT   CDS_pept        complement(417013..417249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0404"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000794 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54715"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1J6"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000794"
FT                   /protein_id="ACS54715.1"
FT                   /translation="MASITRVRERAEEQATSMSEDQQTTIRMLANDLHRLNQSVMKAVE
FT                   AGVSVELVRSARHHGGDGHWGDLLIPVVVTNRH"
FT   gene            complement(417271..418560)
FT                   /locus_tag="Rleg_0405"
FT   CDS_pept        complement(417271..418560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0405"
FT                   /product="isocitrate lyase"
FT                   /note="TIGRFAM: isocitrate lyase; PFAM: isocitrate lyase
FT                   and phosphorylmutase; KEGG: ret:RHE_CH00712 isocitrate
FT                   lyase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54716"
FT                   /db_xref="GOA:C6B1J7"
FT                   /db_xref="InterPro:IPR006254"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1J7"
FT                   /inference="protein motif:TFAM:TIGR01346"
FT                   /protein_id="ACS54716.1"
FT                   /translation="MTDFYKLVPNALADRFDGIERPYSAEDVQRLRGSVALSHTLAAMG
FT                   ADRLWQLLHQEDFVNALGALSGNQAMQMVRAGLKAIYLSGWQVAADANTASAMYPDQSL
FT                   YPANAGPELAKRINRTLQRADQIETAEAQGLSVETWFAPIVADAEAGFGGPLNAFEIMK
FT                   AYIEAGAAGVHFEDQLASEKKCGHLGGKVLIPTAAHIRNLDAARLAADVMGVATLVIAR
FT                   TDAEAAKLLTSDIDERDQPFVDYDAGRTVEGFYQVRNGIEPCIARAVAYAPHCDLIWCE
FT                   TSKPDLDQARRFAEGVHKVHPGKLLAYNCSPSFNWKKNLDEATIARFQRELGAMGYKFQ
FT                   FITLAGFHQLNYGMYELARGYRQRQMSAYSELQQAEFAAEVNGYTATKHQREVGTGYFD
FT                   AVSLAITGGRSSTTAMHGSTEHAQFKPAAE"
FT   gene            418751..420160
FT                   /locus_tag="Rleg_0406"
FT   CDS_pept        418751..420160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0406"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: protein of unknown function DUF955;
FT                   helix-turn-helix domain protein; SMART: helix-turn-helix
FT                   domain protein; KEGG: rec:RHECIAT_CH0000796 probable
FT                   transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54717"
FT                   /db_xref="GOA:C6B1J8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR018653"
FT                   /db_xref="InterPro:IPR026281"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1J8"
FT                   /inference="protein motif:PFAM:PF06114"
FT                   /protein_id="ACS54717.1"
FT                   /translation="MAERKIFAGPKVRRIRNALALTQTAMAEALEISPSYLNLIERNQR
FT                   PLTVQLLLKLASVYRVDLEELRGQTGGSLGQLKEVFADPLLSGELPGDQELVEVAEAAP
FT                   NAASGMIKLYRAYREQAARLSDLTVLMAAEGHAPVAAGRLPLDEVRETLERRSGYFARI
FT                   ETAAEAFAATLPGGLDLAAGLKDWLRSERGIAVRVLPVHVMPDLRRRFDRHSMRLFISE
FT                   RLSQADRAHEIAVEAATLALLPAIDAELDDLSLSSAEARRIARFELARIAALALAMPYE
FT                   AFLSAAKATRYDIDILRARFGVSFGQAAARLAMLQRPGAAAIPFFLIEIDAAGHRLRRA
FT                   GAQGFPQARFGGGCPKLNLHAAFLQPGQILAETVVMPDGASFLTVARTLEGPSVEFGER
FT                   VRRTAILIGCDAALGEGVVYGQAMALEPVAVGPACRLCERRGCLSRAEPPVTRPLGLDE
FT                   MVAGLSAFDFQ"
FT   gene            420287..421384
FT                   /locus_tag="Rleg_0407"
FT   CDS_pept        420287..421384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0407"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: sme:SMc00770 putrescine-binding periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54718"
FT                   /db_xref="GOA:C6B1J9"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1J9"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACS54718.1"
FT                   /translation="MRSTILCVTAAAVTALLAAAPALAQERVVNVYNWSDYIDSSILED
FT                   FTKETGIKVVYDTFDSNETLETKLLAGGSGYDVVVPTVSFMKRQIAAGVYQKLDKSKLP
FT                   NLVNMWDVIMKGVASFDPGNEYSVDYMWGTTGIGYNVDKVKAALGTDEKPNWDALFDPA
FT                   KAAKLKDCGIYMLDSPTDVVPSVLAYLGLNPNSTDAADLKKAQAVLTAVRPFVRKFHSS
FT                   EYISALANGDICIALGYSGDMFQARDRAKEANVGVKVDYSVPSQGAQIFFDVFGIPKDA
FT                   PHVAEAHEFINYMMKPEVVAKASNVVFYANGNKASQQFLDKEVLDDTAIYPTPEVMAKL
FT                   FTVPPLDPKAQRLVTRLWTTVVTGQ"
FT   sig_peptide     420287..420361
FT                   /locus_tag="Rleg_0407"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 25"
FT   gene            421498..422640
FT                   /locus_tag="Rleg_0408"
FT   CDS_pept        421498..422640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0408"
FT                   /product="spermidine/putrescine ABC transporter ATPase
FT                   subunit"
FT                   /note="KEGG: rec:RHECIAT_CH0000798 spermidine/putrescine
FT                   ABC transporter, ATP-binding protein; TIGRFAM:
FT                   spermidine/putrescine ABC transporter ATPase subunit; PFAM:
FT                   ABC transporter related; Transport-associated OB domain
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54719"
FT                   /db_xref="GOA:C6B1K0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1K0"
FT                   /inference="protein motif:TFAM:TIGR01187"
FT                   /protein_id="ACS54719.1"
FT                   /translation="MKSLGNIRRSFAPWTDPSAKPFISIKNVTKRFGDFTAVDNLSLDI
FT                   YHREFFALLGASGCGKSTLLRMLAGFEQPTSGEIVLDGTDMAGTPPYRRPVNMMFQSYA
FT                   LFPHMTVEKNIAFGLRQDGMAKDEMTDRVLQMLKLVKLEQFASRKPNQLSGGQRQRVAL
FT                   ARSLAKRPKVLLLDEPLGALDKKLREETQFELMDLQQNLGLTFVVVTHDQEEAMTMADR
FT                   IAVMSHGKVVQVATPAEIYEAPNCRFVADFIGDVNIFDGKVASSGNGTVEISVDSGFSV
FT                   RVAAAETPSAGSAVGFAIRPEKMRVGRTPPANASVNAARGELWDIAYLGDMTVFHVKLQ
FT                   SGNVVKASSLNAQRSVDDPFTYDQEVWVSFDENAGVLLKD"
FT   gene            422645..423556
FT                   /locus_tag="Rleg_0409"
FT   CDS_pept        422645..423556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0409"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ret:RHE_CH00716
FT                   spermidine/putrescine ABC transporter, permease component I
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54720"
FT                   /db_xref="GOA:C6B1K1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1K1"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS54720.1"
FT                   /translation="MGKFTSGLYNRLVIVIPYAWLLLFFLAPFFIVFRISLSTTAIAMP
FT                   PYEPVFSFADGWAGLLSKIGEFSFDNYTYLTDDPLYFNAYVSSVVIAGISTFLTLLIAY
FT                   PIAYGMAQAPRGLRPTLVMLVILPFWTSFLIRVYAWIAILKPEGLFNQLLLSLHLIDTP
FT                   LIILNTNTAVYIGIVYSYLPFMVLPLYSALEKMDGTLIEAAQDLGCPPITAFWRITFPL
FT                   SIPGVVAGCMLVFIPAVGEFVIPDLLGGSQTLMIGKTLWNEFNSNRDWPVSSAVATILL
FT                   LILVIPIVFFQNVQAKAEERGK"
FT   gene            423560..424378
FT                   /locus_tag="Rleg_0410"
FT   CDS_pept        423560..424378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0410"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rec:RHECIAT_CH0000800
FT                   spermidine/putrescine ABC transporter, permease component
FT                   II protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54721"
FT                   /db_xref="GOA:C6B1K2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1K2"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS54721.1"
FT                   /translation="MLKWTRFNIVSVTLGFAFLYLPIVLLVIFSFNESKLVTVWGGFST
FT                   KWYVSLMSNQALLDAAWVTLRVGLLSATFATILGTMAALTLVRYTRFRGRMLFSGMVYA
FT                   PLVMPEVITGLSLLLLFVAIGLDRGFWTITLAHTTLTMCFVAVVVQSRLLSFDHSIEEA
FT                   AQDLGAPPVRTFFEITLPIIAPAVASGWILAFTLSLDDLVIASFTSGPGATTLPMRIYS
FT                   QVRLGVTPEINAVCTILIGIVALGVICASIITKRRETQRQRDERAAAAGA"
FT   gene            complement(424468..426360)
FT                   /locus_tag="Rleg_0411"
FT   CDS_pept        complement(424468..426360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0411"
FT                   /product="AsmA family protein"
FT                   /note="PFAM: AsmA family protein; KEGG: ret:RHE_CH00718
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54722"
FT                   /db_xref="InterPro:IPR007844"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1K3"
FT                   /inference="protein motif:PFAM:PF05170"
FT                   /protein_id="ACS54722.1"
FT                   /translation="MSTSRHRRWRRKIGPVSRWLPAFARLSTVFLLIALALFVALRVAA
FT                   PYLISTGFVRSGIEDALSKWTGYHAEIKGSPVLEFWPTPRITLNQITIRQPRESGDKLL
FT                   GSIESLSADFSLIDALRGRTSFHEFHLVRPNLALTRDEKGLIDWSYAGLLARAISGVRY
FT                   ENGAEVLDPDLDAEIGAVTVEDGTLVVTDIKSAKTYHFDSVTADIAWPRLSGAISSVVI
FT                   ARINGQDLKVDFASRQPLLAFAGRNAETRTSLTSNLLTAHFQGIASIANLSALSGNVTA
FT                   TIPDVPALLTWSGKSIPGIATLKSASLESDIMSSGNGLRFNNLSLSLNEASATGVMDLF
FT                   TQPGKRPKIGGTLAFDQMNLKPFLDAFALRLAAGEAEEISAGISGPLRLLDIDVRLSAR
FT                   RAQMGLFELSDVGASVIVAGGEAKFDIGDSQFEGGEMTAHLEATQRDFDGGGKLRLSIR
FT                   DADFAALAERLQLKGPLPLATGSIDLDLQSPKAIWTTGLADVTGKLHFWTGEGTIPGID
FT                   ATALRTQAAEKPFFPLSAAAGGAFAFSQLNLQADFANGSAEIHDAHIAGPTQTLTLSGI
FT                   ITYHSNGLALSGSLDATDPAKAAELPLLPFFIGGSWPNPVISPVPLFGNTPHAQ"
FT   sig_peptide     complement(426226..426360)
FT                   /locus_tag="Rleg_0411"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.988 at
FT                   residue 45"
FT   gene            426636..428588
FT                   /locus_tag="Rleg_0412"
FT   CDS_pept        426636..428588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0412"
FT                   /product="acetoacetyl-CoA synthase"
FT                   /note="TIGRFAM: acetoacetyl-CoA synthase; PFAM:
FT                   AMP-dependent synthetase and ligase; KEGG:
FT                   rec:RHECIAT_CH0000803 acetyl-CoA synthetase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54723"
FT                   /db_xref="GOA:C6B1K4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR005914"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1K4"
FT                   /inference="protein motif:TFAM:TIGR01217"
FT                   /protein_id="ACS54723.1"
FT                   /translation="MQDNRPLWVPSEDAIAKSPIHAFMERCNADFGLSLSGFEDLHAWS
FT                   VAERENFWSAVWDFCGVQGERGAEVLANGDRMLEARFFPDATLNFAENLLSGRGDGDAI
FT                   IFRGEDKAEDRWSWDRLRALVSKLQQAFVARGIGKGDRVAAMMPNMPETVAAMLAAASI
FT                   GAIWSSCSPDFGEQGVLDRFGQIEPRLFIACDAYWYSGKLQDVGAKVATVAKTLAIPTV
FT                   IVHYAGNAEAVARKTPGALTLEAFVAPYEAREVEFTRLAFAHPLYILFSSGTTGVPKCI
FT                   VHSAGGTLLQHLKEQRLHCGLQAGEKLFYFTTCGWMMWNWLVSGLASGATLCLFDGSPF
FT                   APDGNVLFDYAEAEKFVIFGTSAKYIDAVRKGGLTPRVSHDLSSLRLMTSTGSPLSPEG
FT                   FTFVYEGIKKDVQLASISGGTDIVSCFVLGNPLQPVWRGEIQGAGLGLAVDVWNDDGKP
FT                   VRGEKGELVCTKAFPSMPVMFWNDPDGAKYRAAYFDRFDNVWCHGDFAEWTEHGGLVIH
FT                   GRSDATLNPGGVRIGTAEIYNQVEQMAEVAEALCIGQDWDDDVRVILFVRLAPDVKLTE
FT                   DLVKAIKSRIRTGASPRHVPAKIIAVADIPRTKSGKIVELAVREVVHGRPVKNQEALAN
FT                   PEALGLFAGLSELRD"
FT   gene            complement(428804..432634)
FT                   /locus_tag="Rleg_0413"
FT   CDS_pept        complement(428804..432634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0413"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: rec:RHECIAT_CH0000804 probable two-component
FT                   sensor histidine kinase protein; TIGRFAM: PAS sensor
FT                   protein; PFAM: ATP-binding region ATPase domain protein;
FT                   PAS fold domain protein; histidine kinase A domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; histidine
FT                   kinase A domain protein; PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54724"
FT                   /db_xref="GOA:C6B1K5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1K5"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ACS54724.1"
FT                   /translation="MPAVQYPFIDIAVHARVRERFSRGEAMVLFSADLARLLWANGAGA
FT                   ELFGHSAVYDLLDQGVDRADITFRQLETAARQLTDIGDSRSLMIRVAKGFQRAQVQAAA
FT                   ELIRLSQGEQAILFSVPVSAKPLAAGASAAQMLQGLDDPDTHMAVIGANGEVIAASPGF
FT                   ASLGISEQTAKTLINLAGAHPDRLVKRPVATGRGNLPAAVGKLSDDPALNLLFAVETAV
FT                   GHLDPVDAPALAPVDAPALDPVDAPAQEESAPPMEVLQDEPVAATGFTEIIDAVSGIEE
FT                   VEETLEEITGENEQPAEIAVASADEAIDGMDPAEDAEPKSDDGVTDSSADEPAAVIEDD
FT                   VTSIAETAEPPVEASETPIEDAPEAVHEETAIATPVVPDVPPAPQLEAESGFVFRPNSR
FT                   ATRFVWKIDAEGRFNEVSHEFAAAVGPHASDIIGSAFGDVAALFNLDPDGKLSEALARR
FT                   DTWSGKTILWPVEGTSLVVPVDLAALPTYTRNRDFDGFRGFGVVRLSDAQEDPLALGLT
FT                   LGPDGIGHDAASLGPPAETIAEVAHEAETVLEEPLIDPSPTQEVEDQALTASEPQAEPA
FT                   PEEIATEQAAEIPAQESAAEKAEGSADAGDISAAEPVAELPQEPPALRISETPNRRFSD
FT                   KIVQLHNTGAGLTAAEQANFREIAKRLEAFGANKDEPAAPAPMEPNATETAAFNEASGP
FT                   EAFGAETPTADQADIPSLEEIAPQEAIFENAVEAEREDDGATEEPAVIVEDEATEGLEE
FT                   TASQIEVLTSFIPPRIKMTDGLSVGTVDQLPVAVLIHIGDALIHANPEFMRLTGYGSLD
FT                   ALREVGGIEGLLQRRELEEKAAGSGTMMLVKADDTLAPVTARLQSVRWEDANALMLALM
FT                   PVEGKEDGRGDANRFDGRSEDRPERMVEKVAKLQVEVEELRSILETATDGVVVIGTEGD
FT                   IRSMNRSASALFNYDEQETRGKPFVMLFAHESQKAVIDYLNGLSGHGVASVLNDGREVI
FT                   GREAAGGFVPLFMTMGQLTSSNGYCAVIRDITQWKRTEDELRNAKGAAETANAHKTDFL
FT                   ARVSHEIRTPLNAIIGFSDMMAGERFGPIGHPRYIEYANDIGRSGRHVLDIVNDLLDIS
FT                   KIEAGEMDLDFAAVGLNEAVSEAVALVQPQANGQRVIIRTALSQAVPEVVADLRSIKQI
FT                   ALNILSNAIRFTPSGGQIVVSTSYEANGSVVLRVRDTGIGMTRSELDQAMKPFRQVSST
FT                   QSRHRGDGTGLGLPLTKAMVDANRATFTINSAPNEGTLVEITFPSQRVLAG"
FT   gene            432848..433297
FT                   /locus_tag="Rleg_0414"
FT   CDS_pept        432848..433297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0414"
FT                   /product="phasin"
FT                   /note="TIGRFAM: phasin; KEGG: ret:RHE_CH00721 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54725"
FT                   /db_xref="InterPro:IPR010234"
FT                   /db_xref="InterPro:IPR018968"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1K6"
FT                   /inference="protein motif:TFAM:TIGR01985"
FT                   /protein_id="ACS54725.1"
FT                   /translation="MATIKTDDVFSIASFDPSKFTESFREFAEKGAQQSKDAYAKLKTA
FT                   GEEAGKTLEATVQTAQAGSVEIGLKAIDILRINSENSLSHFEALLGVKSPAEFFELQTS
FT                   FIRKQAELTVEQAKSIQETTKQVAEKLAKPSKDAAEKAMASFKVA"
FT   gene            433427..433503
FT                   /locus_tag="Rleg_R0006"
FT                   /note="tRNA-His1"
FT   tRNA            433427..433503
FT                   /locus_tag="Rleg_R0006"
FT                   /product="tRNA-His"
FT   gene            433597..434040
FT                   /locus_tag="Rleg_0415"
FT   CDS_pept        433597..434040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0415"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00727 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54726"
FT                   /db_xref="InterPro:IPR025232"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1K7"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00727"
FT                   /protein_id="ACS54726.1"
FT                   /translation="MSKTLLYGATKIDETNSAYAPMESLAAFQWKNRVFILFADRDNSR
FT                   ASRQENQLLADRSALDDRHLVVLKISGAGVRPLFGAADGLDGEAIRRDLEAPEVGEFAA
FT                   FLLGKDGTVKLEISEPITDGELFAIIDSMPMRAAESLKPDKSS"
FT   gene            434097..434264
FT                   /locus_tag="Rleg_0416"
FT   CDS_pept        434097..434264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0416"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00728 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54727"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1K8"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00728"
FT                   /protein_id="ACS54727.1"
FT                   /translation="MSVPNEPIPDQPPMPAPGWKPVPPIKEPEPDRLPDEAPVPNPDEN
FT                   DEPAKHTFET"
FT   gene            complement(434261..435142)
FT                   /locus_tag="Rleg_0417"
FT   CDS_pept        complement(434261..435142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0417"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: ret:RHE_CH00729 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54728"
FT                   /db_xref="GOA:C6B1K9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1K9"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACS54728.1"
FT                   /translation="MNWDDVRIFLAVARTGQILAASKRLGLNHATLSRRLTSLEEALKT
FT                   RLFIRRTNGCELTAEGEVFLASAERMETEMLAAQASLGHTDTAIAGTVRVGAPDGFGVS
FT                   FLAPRMGRLIERHPELKIQLVPVPRSFSLSQREADIAITLERPEQGRLVSSKLTDYTLG
FT                   LYASRAYLAAQGTPADIDALKAHRRIGYVEDLIFTASLNFSGAVMRSWDAGFEISTAIG
FT                   QTEAVRTGAGIGILHDYIARQYPELQRILPEVSIRRAYWTTYHETARDLLRVRSVADFL
FT                   QELVSAERHIFL"
FT   gene            complement(435139..435453)
FT                   /locus_tag="Rleg_0418"
FT   CDS_pept        complement(435139..435453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0418"
FT                   /product="Antibiotic biosynthesis monooxygenase"
FT                   /note="PFAM: Antibiotic biosynthesis monooxygenase; KEGG:
FT                   rec:RHECIAT_CH0000812 putative antibiotic biosynthesis
FT                   monooxygenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54729"
FT                   /db_xref="GOA:C6B1L0"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1L0"
FT                   /inference="protein motif:PFAM:PF03992"
FT                   /protein_id="ACS54729.1"
FT                   /translation="MNRKPVVRMAELEIEPDTLETYRALLTEEIEASIALEDGVLSLSA
FT                   VSIRNNPNRIRILEVYADQEAYEAHLRTPHFIKYKNQTAHMVTSLTFIEVDPIAMRAKP
FT                   "
FT   gene            435646..437142
FT                   /locus_tag="Rleg_0419"
FT   CDS_pept        435646..437142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0419"
FT                   /product="methylmalonate-semialdehyde dehydrogenase"
FT                   /note="TIGRFAM: methylmalonate-semialdehyde dehydrogenase;
FT                   PFAM: Aldehyde Dehydrogenase; KEGG: rec:RHECIAT_CH0000813
FT                   methylmalonate-semialdehyde dehydrogenase (acylating)
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54730"
FT                   /db_xref="GOA:C6B1L1"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1L1"
FT                   /inference="protein motif:TFAM:TIGR01722"
FT                   /protein_id="ACS54730.1"
FT                   /translation="MREIGHFIGGKHVAGTSGRVSNVYNPATGEVQATVALASVEELRA
FT                   AVENAKAAQPKWAATNPQRRARVFFKFVELLNKHMDELAEILSKEHGKTIEDAKGDVIR
FT                   GLEVCEFVCGIPHLAKGEFTEGAGPAIDMYSIRQPVGIGAGITPFNFPGMIPMWMFAPA
FT                   IACGNAFILKPSERDPSLPIRLGELMIEAGLPAGILNVVNGDKGAVDAILTDPDIGAVS
FT                   FVGSTPIARYVYGTAAMNGKRAQCFGGAKNHMIIMPDADLDQAVNALMGAGYGSAGERC
FT                   MAISVAVPVGEETANRLVEKLTPKIESLRIGPYTDDKADMGPLVTKEAYTRVRGLIDRG
FT                   IEEGAKLVVDGRDFKLQGYEDGYFVGGCLFDHVTPEMDIYKTEIFGPVLSVVRANNYEE
FT                   ALSLPMKHEYGNGVAIYTRDGDAARDFASRINIGMIGINVPIPVPLAYHSFGGWKASSF
FT                   GDLNQHGTDSIKFWTKTKTVTARWPSGIKSGAEFVMPTMK"
FT   gene            437207..437307
FT                   /pseudo
FT                   /locus_tag="Rleg_0420"
FT   gene            437487..437969
FT                   /locus_tag="Rleg_0421"
FT   CDS_pept        437487..437969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0421"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="TIGRFAM: transcriptional regulator, Rrf2 family;
FT                   PFAM: protein of unknown function UPF0074; KEGG:
FT                   rec:RHECIAT_CH0000814 rhizobial iron transcriptional
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54731"
FT                   /db_xref="GOA:C6B1L2"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1L2"
FT                   /inference="protein motif:TFAM:TIGR00738"
FT                   /protein_id="ACS54731.1"
FT                   /translation="MRLTKQTNYAVRMLMYCAANDGHLSRIPEIARAYGVSELFLFKIL
FT                   QPLNKAGLVETVRGRNGGVRLGKPAADISLFDVVRVTEDSFAMAECFEDDGEVDCPLVD
FT                   SCGLNSALRKALNAFFAVLSEYSIDDLVKARPQINFLLGITGEPAYRKPSIVAPAA"
FT   gene            438308..439903
FT                   /locus_tag="Rleg_0422"
FT   CDS_pept        438308..439903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0422"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: rec:RHECIAT_CH0000815 dipeptide ABC transporter,
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54732"
FT                   /db_xref="GOA:C6B1L3"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1L3"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ACS54732.1"
FT                   /translation="MKKISVLLAATALISVMATSAWSKTLVYCSEGSPEGFDPSLYTAG
FT                   TTFDASSRTVYSRLVEFKHGGTEIEPGLADSWSVSADGTEYTFKLHPGVKYQTTDFFTP
FT                   TRDFNADDVVFSFERQLKSDNPWNKYVEGGSYEYAAGMGFPELIKSVEKVDDLTVKFTL
FT                   NHPEAPFLADLAMDFASIVSKEYADKLAADGKMAQLNQQPLGTGPYTFVAYQPDAVIRY
FT                   KANETYFKGKEKIDDLVFAITSDAAVRAQKLKAGECHLIPYPNAADVPELKKDENLTVL
FT                   EQAGLNVGFLAYNTQMAPFDKPEVRRALNMAINKQAIIDAVFQGAAAVAKNPIPPTMWS
FT                   YNDAVQDDKYDPDAAKKALADAGVKDLSMKIWAMPVSRPYMLNARRAAELMQADFAKIG
FT                   VKVEIVTHEWAEYLKLSSDVKRDGAVILGWTGDNGDPDNFMDTLLGCDAVGGNNRAQWC
FT                   NKEYDDLMTKAKLTADVGERTKAYEQAQLIFKKEAPWATIDHSLVFVPMSKKVSGFQMD
FT                   PLGIHRFDGVDVSE"
FT   sig_peptide     438308..438379
FT                   /locus_tag="Rleg_0422"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.956 at
FT                   residue 24; SNP /replace=TC; SNP /replace=GT"
FT   gene            439990..440994
FT                   /locus_tag="Rleg_0423"
FT   CDS_pept        439990..440994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0423"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rec:RHECIAT_CH0000816
FT                   dipeptide ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54733"
FT                   /db_xref="GOA:C6B1L4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1L4"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS54733.1"
FT                   /translation="MLRFFIGRLAVLIPTFLGVSLIAFSFIRMLPGDPVMLLSGERVMA
FT                   PERHAQIMHDLGFDRPMYVQYFDYLGKILHGDLGTSIVTKRPVLGEFLTLFPATLELSL
FT                   CAIILAVCLGVPAGIFAAVKRGTWFDQSVMGIALIGYSMPIFWWGLLLIIFFSGYLGWT
FT                   PVSGRISLMYFFKPVTGFMLVDSLLSGQKGAFSSAVSYLILPTIVLATIPLAVIARQTR
FT                   SAMLEVLGEDYVRTARSKGLKPLRVVGVHALRNAMIPVITTIGLQIGVLLAGAILTETI
FT                   FSWPGIGKWMVDSVFKRDYAVVQGGLLLIAGVIMLVNLIVDVLYGFINPRIRH"
FT   sig_peptide     439990..440067
FT                   /locus_tag="Rleg_0423"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.757) with cleavage site probability 0.482 at
FT                   residue 26"
FT   gene            441004..441894
FT                   /locus_tag="Rleg_0424"
FT   CDS_pept        441004..441894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0424"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rec:RHECIAT_CH0000817
FT                   dipeptide ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54734"
FT                   /db_xref="GOA:C6B1L5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1L5"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS54734.1"
FT                   /translation="MSTVTVKTGQPSALAEFWHYFSRNKGAVIGLVVFTIILVVAVLAP
FT                   LFAPHEPNEQNRAVLLAVPFWMEGGSASFPLGTDAVGRDILSRLIYGARFSLFIGVVVV
FT                   TLSVISGVLIGLVAGFFRGKVDTAIMRLMDIILAFPSLLLALVLVAVLGPGLTNAMIAI
FT                   SLVNQPHFVRLTRASVISEREKEYVIASRVAGAGTFRLMFKTILPNCLGPLIVQATLAF
FT                   SAAILDAAALGFLGMGAQPPTPEWGTMLAESREFISRAWWVVTFPGLAILITVLAINLM
FT                   GDGLRDALDPKLKRS"
FT   gene            441894..442910
FT                   /locus_tag="Rleg_0425"
FT   CDS_pept        441894..442910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0425"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: ret:RHE_CH00739 dipeptide ABC transporter,
FT                   ATP-binding protein; TIGRFAM: oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54735"
FT                   /db_xref="GOA:C6B1L6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1L6"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACS54735.1"
FT                   /translation="MPLLEIENLTVEFQTSSGLFRAVDGVSLACDKGEILSVVGESGSG
FT                   KSVAMLALMGLLPWTAKITADRMQFDGKDLRGISGRQRRRIVGKDMAMIFQEPMSSLNP
FT                   CFTVGFQLGETLRFHMGLNRKERRQRSIELLNLVGIPAPEDRLSNFPHQMSGGMSQRVM
FT                   IAMALACNPKLLIADEPTTALDVTIQAQILDLLVRLQKEQGMALVLITHDMGVVAETAE
FT                   RVQVQYAGQKVEEQPVRALFRDPHHPYTAALLAALPERAKVGQRLPSIAGVVPGQHGRP
FT                   TGCLFAPRCGFATVECDRGVVRQGPELGLALCNYPLKDGKPLGHPGIMAVETAGDLV"
FT   gene            442907..443860
FT                   /locus_tag="Rleg_0426"
FT   CDS_pept        442907..443860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0426"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: ret:RHE_CH00740 dipeptide transporter
FT                   ATP-binding subunit; TIGRFAM: oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54736"
FT                   /db_xref="GOA:C6B1L7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1L7"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACS54736.1"
FT                   /translation="MTDAVLEGRDLARFYTVNRGLFKADATVKALNGVSFSLHSGKTLA
FT                   VVGESGCGKSTLARLVTMIENPTSGQLLIDGKPAHVGDRSLRSQVQIVFQNPYGSLNPR
FT                   QKVGSILEEPLKINTNLDGAARRRKAEEMMARVGLRPEHYGRYPHMFSGGQRQRIAIAR
FT                   ALMLRPKVLVLDEPVSALDLSIQAQVLNLLMDLQKEMGLAYLFISHGLSVVHHIADEVM
FT                   VMYLGRPVETGPAAEVFARPRHPYTAALLSATPIADPDRAKNRIRLQGELPSPLKPPTG
FT                   CHFNPRCWKAQDHCRQVSPELSGEGTHQYACHFPLD"
FT   gene            443982..444518
FT                   /locus_tag="Rleg_0427"
FT   CDS_pept        443982..444518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0427"
FT                   /product="carbohydrate kinase, thermoresistant glucokinase
FT                   family"
FT                   /EC_number="2.7.1.12"
FT                   /note="KEGG: rec:RHECIAT_CH0000820 gluconokinase protein;
FT                   TIGRFAM: carbohydrate kinase, thermoresistant glucokinase
FT                   family; PFAM: shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54737"
FT                   /db_xref="GOA:C6B1L8"
FT                   /db_xref="InterPro:IPR006001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1L8"
FT                   /inference="protein motif:TFAM:TIGR01313"
FT                   /protein_id="ACS54737.1"
FT                   /translation="MPEQMNKPQAIIVMGVSGCGKSSVGEKLAEALHLAFVEGDALHPA
FT                   ANVEKMSKGIALTDEDRMPWLDRIGEDMKASLEKSKGIIVSCSALKRLYRDRLRAAAGG
FT                   NLFFVYLEGSRALLMKRMGERKGHFMPVSLLDSQLATLEVPTGEPGVVTVDIDDTIDGI
FT                   AATALKSLAALGVTG"
FT   gene            complement(444508..445755)
FT                   /locus_tag="Rleg_0428"
FT   CDS_pept        complement(444508..445755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0428"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   rec:RHECIAT_CH0000821 putative D-amino acid dehydrogenase
FT                   protein; SNP /replace=C"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54738"
FT                   /db_xref="GOA:C6B1L9"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1L9"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ACS54738.1"
FT                   /translation="MTKNAIVLGAGIVGVSTAIHLQRRGRQVTLIDRKDPGNETSFGNA
FT                   GLIQREGVAPYGFPQQLGLLLRYAVNNRIDAHYHLRALPSQIAFLARYWWNSNARRHAI
FT                   ITRAYAPLIENSVVEHKDLIEASQAEGLIRKDGWIKIFRTEAKRDGALAEAALWQNEFG
FT                   VEYDSLTPADIARMEPYMTGDFAGGIRWRDPWSVLDPHALTSAYRRYFESLGGRFVTGD
FT                   AASLGPFGSGWKIMTAEGPLEAEDAVMALGPWAAVATRRLGYSFPLGVKRGYHMHYAAG
FT                   GNAVLNNWMLDAERGYLLAPMNRGIRLTTGAEFATLDAPKTPVQLDRAEAVARTIFPLG
FT                   DRLDPEPWMGARPCTPDMMPVIGKAPRHQGLWFAFGHAHHGLTLGPVTGRVLAELITGE
FT                   TPFIDISAYSPQRFNP"
FT   gene            complement(445832..446335)
FT                   /locus_tag="Rleg_0429"
FT   CDS_pept        complement(445832..446335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0429"
FT                   /product="Isoprenylcysteine carboxyl methyltransferase"
FT                   /note="PFAM: Isoprenylcysteine carboxyl methyltransferase;
FT                   KEGG: ret:RHE_CH00743 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54739"
FT                   /db_xref="GOA:C6B1M0"
FT                   /db_xref="InterPro:IPR007269"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1M0"
FT                   /inference="protein motif:PFAM:PF04140"
FT                   /protein_id="ACS54739.1"
FT                   /translation="MMWPSIALLAFVTLQRLAELVLARRNTAALLSRGAREVAPEHYPT
FT                   MVALHAGWIIGLWLLAPGRPVAFFWFLVFMGLQALRLWVLATLKGRWTTRIIVLPGAPL
FT                   VRSGPYRFLRHPNYAIVVGEIAVLPLAFGLPLYAIVFSLLNALILHVRVKAENAALKSA
FT                   MILK"
FT   sig_peptide     complement(446279..446335)
FT                   /locus_tag="Rleg_0429"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.700) with cleavage site probability 0.686 at
FT                   residue 19"
FT   gene            complement(446332..447384)
FT                   /locus_tag="Rleg_0430"
FT   CDS_pept        complement(446332..447384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0430"
FT                   /product="chalcone and stilbene synthase domain protein"
FT                   /note="PFAM: chalcone and stilbene synthase domain protein;
FT                   FAE1/Type III polyketide synthase-like protein;
FT                   3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III domain
FT                   protein; KEGG: rec:RHECIAT_CH0000823 probable chalcone
FT                   synthase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54740"
FT                   /db_xref="GOA:C6B1M1"
FT                   /db_xref="InterPro:IPR001099"
FT                   /db_xref="InterPro:IPR011141"
FT                   /db_xref="InterPro:IPR012328"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1M1"
FT                   /inference="protein motif:PFAM:PF02797"
FT                   /protein_id="ACS54740.1"
FT                   /translation="MTDTVKLVSLAVATPEHVIFQKQAVEASARLFADRFEDFRHLARV
FT                   FDSAGIDKRHAARPLAWFDEPHGWQDRMQAFAEVAGGLFVEAASSALRQAGLETGDVDC
FT                   VVTVSSTGFTTPSLDAQLAGRMGFRPDIERVPVFGLGCAAGVSGFAIASRLARSRPGTV
FT                   VLFVSIELCTLAFRLDELTRPNIIATALFGDGAAACVLRSGEDGLAEVESTGEHLFPDT
FT                   LDIMGWKIDDGGFGIVLAQSLPPFAEKELGPAVTAILARNGLRVEDIDRFICHPGGMKV
FT                   LAAMESALSMVPGTLDHERAVLAEYGNMSSPTILFVLERAIRAGLPARAAMIAMGPGFS
FT                   ASCVTLRRVA"
FT   gene            447553..448089
FT                   /locus_tag="Rleg_0431"
FT   CDS_pept        447553..448089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0431"
FT                   /product="Tetratricopeptide domain protein"
FT                   /note="SMART: Tetratricopeptide domain protein; KEGG:
FT                   rec:RHECIAT_CH0000824 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54741"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1M2"
FT                   /inference="protein motif:SMART:SM00028"
FT                   /protein_id="ACS54741.1"
FT                   /translation="MTIMTARIASLLLGGCLAASVVSGPVFAIGDDSSTTPVCKKGEIY
FT                   DQKTKKCVKQQSANVSDENRADYAYSLAKAGRYEEALAVLDTVKDQNTAEVLNYRGYAT
FT                   RKLGRTDEGISYYLQSVKMDPQYAKVREYLGEAYVIKGQLDLAKDQLKTIKAICGTGCE
FT                   EYQDLNAVILDPSKI"
FT   sig_peptide     447553..447639
FT                   /locus_tag="Rleg_0431"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.791 at
FT                   residue 29"
FT   gene            448138..448743
FT                   /locus_tag="Rleg_0432"
FT   CDS_pept        448138..448743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0432"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: Sigma-70 region 4 type 2; sigma-70 region 2
FT                   domain protein; sigma-70 region 4 domain protein; KEGG:
FT                   rec:RHECIAT_CH0000825 RNA polymerase sigma factor protein
FT                   (sigma-24)"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54742"
FT                   /db_xref="GOA:C6B1M3"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1M3"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACS54742.1"
FT                   /translation="MSVARTHFPAYSHARMESPVHPAVSRDRGLAEAAIASEADIRSGL
FT                   TENLARLWRYGLVLSHQRDVADDLVQATCLRALERADQFIPGTRLDRWLFSILHSIWLN
FT                   EIRSRRVRQGQGFVDAGETLTFDGAHDTETQVMAHQVLKQVNALPEAQRTVVFLAYVEG
FT                   LSYREVAGILDIPIGTVMSRLAAARAKLSGAGPEGGRQ"
FT   gene            448740..449543
FT                   /locus_tag="Rleg_0433"
FT   CDS_pept        448740..449543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0433"
FT                   /product="putative transmembrane anti-sigma factor"
FT                   /note="KEGG: rec:RHECIAT_CH0000826 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54743"
FT                   /db_xref="GOA:C6B1M4"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1M4"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000826"
FT                   /protein_id="ACS54743.1"
FT                   /translation="MTTKHTIPSDEDLTAFIDGELTAEEAARIEAIVKEDESTAERLEF
FT                   LARASLPFKQAFAPLLAEAPREKLETMLAAIPPQQSAKSGPTPAFATRRRFLGALAASL
FT                   VAGIAIDRAVIGIGARFSAKDENSEWRAVVADYISLYSAETLAGPVPGREDQAAQLAGL
FT                   DEKLGLSLSPEAVSLPGIDFKRALLLQYDGKPLAQIAYLDPETGPMALCIVRSDAGPKA
FT                   PDLESRKGMNVAYWSNATHAFMLIGRIPVDRVQELAENARSRLSA"
FT   gene            complement(449572..450435)
FT                   /locus_tag="Rleg_0434"
FT   CDS_pept        complement(449572..450435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0434"
FT                   /product="glucose-1-phosphate thymidylyltransferase"
FT                   /note="TIGRFAM: glucose-1-phosphate thymidylyltransferase;
FT                   PFAM: Nucleotidyl transferase; KEGG: atc:AGR_L_532
FT                   glucose-1-phosphate thymidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54744"
FT                   /db_xref="GOA:C6B1M5"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1M5"
FT                   /inference="protein motif:TFAM:TIGR01207"
FT                   /protein_id="ACS54744.1"
FT                   /translation="MKGIVLAGGSGSRLHPMTHAVSKQLLPIYDKPMIYYPLTTLMLAG
FT                   IREVLIISTPHDMPLFQRLLGDGSEWGMSLSYAVQPSPDGLAQAYIIGADFVAGGPSCL
FT                   ILGDNIYFGHGLPELLEEGVSKGDGATIFAYHVHDPERYGVVEFGSDMTAISIEEKPAK
FT                   PKSHWAVTGLYFYDADVVDIAANLKPSARGEYEITDVNKTYLERGKLRVSMMGRGYAWL
FT                   DTGTPESLLEAGGFVRTLEKRQGFKIACPEEIALAKGFITKERFAQIAAQAGKGDYGQY
FT                   LRGLVD"
FT   gene            complement(450432..451325)
FT                   /locus_tag="Rleg_0435"
FT   CDS_pept        complement(450432..451325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0435"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number="1.1.1.133"
FT                   /note="KEGG: atc:AGR_L_531 dTDP-4-dehydrorhamnose
FT                   reductase; TIGRFAM: dTDP-4-dehydrorhamnose reductase; PFAM:
FT                   dTDP-4-dehydrorhamnose reductase; NAD-dependent
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54745"
FT                   /db_xref="GOA:C6B1M6"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1M6"
FT                   /inference="protein motif:TFAM:TIGR01214"
FT                   /protein_id="ACS54745.1"
FT                   /translation="MRIAVTGKSGQVTSALQALNVPGIEIIAIGRPELDLLEPSMVSEI
FT                   IAKIKPDVVVSSAAYTAVDKAESDEAAAFAINRDGAKAIAAATAELSLPVIHLSTDYVF
FT                   DGDKPECYVESDPVGPVSVYGRSKLEGEYAVAAANENHVILRTAWVYSTFGHNFVITML
FT                   RLAETREELSVVSDQLGCPTSAGDIAGAIVKIAGRLSNDSTPDLRGVCHLAGSGETSCA
FT                   GFARYILSIHEEKTGRRVTVKDIATADYPTAAKRPANSRLCCDKLKSLYSVSMPEWRIS
FT                   ARAAVTKLLEEPKEAV"
FT   gene            complement(451328..452382)
FT                   /pseudo
FT                   /locus_tag="Rleg_0436"
FT   gene            complement(452396..452962)
FT                   /locus_tag="Rleg_0437"
FT   CDS_pept        complement(452396..452962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0437"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /EC_number="5.1.3.13"
FT                   /note="KEGG: atc:AGR_L_529 dTDP-4-dehydrorhamnose
FT                   3,5-epimerase; TIGRFAM: dTDP-4-dehydrorhamnose
FT                   3,5-epimerase; PFAM: dTDP-4-dehydrorhamnose 35-epimerase
FT                   related"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54746"
FT                   /db_xref="GOA:C6B1M7"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1M7"
FT                   /inference="protein motif:TFAM:TIGR01221"
FT                   /protein_id="ACS54746.1"
FT                   /translation="MYALKVEQLEIGDVKKVTPARFGDPRGYFSEVFKDFWFRTNVADV
FT                   SFVQDNESLSAQPGTVRGLHFQSPPFAQGKLVRCLRGALLDVAVDIRHGSPTYGKWVSA
FT                   ELSPENGSQLWVPAGFAHGFVTLEPDTIISYKVTALYSAEHDCGVRWNDAEIGIEWPQM
FT                   DGYVLSDKDNKQPRLSELPTYFQFS"
FT   gene            complement(453209..454129)
FT                   /locus_tag="Rleg_0438"
FT   CDS_pept        complement(453209..454129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0438"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   dTDP-4-dehydrorhamnose reductase; KEGG: ret:RHE_CH00763
FT                   GDP-L-fucose synthase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54747"
FT                   /db_xref="GOA:C6B1M8"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR028614"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1M8"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACS54747.1"
FT                   /translation="MNRDVKIYVAGHRGMVGSAIVRRLKAGGYTNIVTRSHAELDLVNQ
FT                   AAVAEFMKAERPDYIFMAAARVGGIHANNVYRAEFLYQNLMIETNVVHAAWQAGVERML
FT                   FLGSSCIYPRDCPQPIREEYLLTGPLEQTNEAYAIAKIAGVKLCESYNRQYGTRYVSGM
FT                   PTNLYGPNDNYDLDSSHVMPALIRKVHEAKIRGDRQLVVWGSGRPMREFLYVDDMADAC
FT                   VFLMEKEVSEGLINIGTGEDITIRELAETIMRVVGFTGEIVYDQTKPDGTPRKLMSVDR
FT                   LSALGWKATTSLGDGIARAYADFAS"
FT   gene            complement(454134..455216)
FT                   /locus_tag="Rleg_0439"
FT   CDS_pept        complement(454134..455216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0439"
FT                   /product="GDP-mannose 4,6-dehydratase"
FT                   /note="TIGRFAM: GDP-mannose 4,6-dehydratase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; KEGG: ret:RHE_CH00762
FT                   GDP-mannose 4,6-dehydratase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54748"
FT                   /db_xref="GOA:C6B1M9"
FT                   /db_xref="InterPro:IPR006368"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1M9"
FT                   /inference="protein motif:TFAM:TIGR01472"
FT                   /protein_id="ACS54748.1"
FT                   /translation="MKRALITGITGQDGSYLAELLIEKGYEVHGIKRRTSLFNTDRIDH
FT                   LYQDPHDTNRRLVLHYGDMTDSSSLVRIVQQVQPDEIYNLAAQSHVAVSFEEPEYTANS
FT                   DALGALRILEAIRILGLEKKTRFYQASTSELYGLVQEIPQRETTPFYPRSPYAVAKLYA
FT                   YWITVNYREAYGIYACNGILFNHESPVRGETFVTRKITRALARIKLGLQDCLYLGNLDA
FT                   KRDWGHAKDYVEMQWLMLQQDEPEDFVIATGVQYSVREFVDAAAHEIGLPISWKGSGAE
FT                   EKGYDENGRCIVAVDPRYFRPTEVETLLGDPSKAKEKLGWEPRITFKQLVEEMMREDLK
FT                   SAERDELVKRHGFSAYDYHE"
FT   gene            455861..456889
FT                   /locus_tag="Rleg_0440"
FT   CDS_pept        455861..456889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0440"
FT                   /product="N-acylneuraminate-9-phosphate synthase"
FT                   /EC_number="2.5.1.57"
FT                   /note="PFAM: N-acetylneuraminic acid synthase domain; SAF
FT                   domain protein; KEGG: rpe:RPE_4236 N-acetylneuraminate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54749"
FT                   /db_xref="GOA:C6B1N0"
FT                   /db_xref="InterPro:IPR006190"
FT                   /db_xref="InterPro:IPR013132"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR036732"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1N0"
FT                   /inference="protein motif:PRIAM:2.5.1.57"
FT                   /protein_id="ACS54749.1"
FT                   /translation="MFRKDVLDESPFVIAEVGQNHQGDLDIAREYIRIYAFEGADAIKF
FT                   QTRNNRYLFSEDAYAAGYDSENAFAETYGAHREKLELKPEWLPILKADCEKHGVKFMST
FT                   PFDEPSLEILQQIDVDLLKVASFDLGNLPFLNRIAKLGKPVVMSIGGGKIEQIRSSVEV
FT                   VLRHHDQLAILHCVSEYPCEYNRLGLDNIEVLIKEFPDCIIGSSDHFNGTLSGPIAYMK
FT                   GARVFEKHVTLNRAWKGTDHSFALEPDGFRKFVRDIKRVRAMMPQKPADEIGNERVFKK
FT                   LGKSIIAYSDIRVGEELTLDKLSGRIFNTHYIPVRESNKVLGKTVKRDIAKGEPIQYSD
FT                   FG"
FT   gene            457037..457849
FT                   /locus_tag="Rleg_0441"
FT   CDS_pept        457037..457849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0441"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   rce:RC1_3770 oxidoreductase, short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54750"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1N1"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACS54750.1"
FT                   /translation="MNVDGIFDVSGDVVLVTGVSGQLGGEYAKAFLARNARVVGLDLRP
FT                   SAGSLVMQDEYPDNFMFCSADVTKKASLEQALQDVTGRFGTPTVLINNAAIDSPPSAPP
FT                   EENGPFEDYPEASWDKVIDVNLKGVYLSCQVFGAAMANAGKGSIINVASIYGLVSPDQS
FT                   LYEYRRKRGEVFFKPVAYSASKSGILNLTRYLATYWAKRNVRVNSLTIAGVFNNQEQDF
FT                   LDVYCSRIPIGRMASVDEYNGAMLFLASPASRYMTGSNLIIDGGWTAI"
FT   gene            457852..459312
FT                   /locus_tag="Rleg_0442"
FT   CDS_pept        457852..459312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0442"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: rce:RC1_3767
FT                   aldehyde dehydrogenase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54751"
FT                   /db_xref="GOA:C6B1N2"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1N2"
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /protein_id="ACS54751.1"
FT                   /translation="MTTLRILNWINGQASHASSEGWLEKFNPHSGELLYHVADSSQDDV
FT                   EQAITAARSAFPAWAELTPVKRGQILMDIVALMKRRSDELAECIALETGKPPQDAKGET
FT                   GGAIMQAEYFAGEGMRLYARSLTSGTPGKYSHTVRQPRGVAGLIVPANTPIANIAWKTF
FT                   PALICGNTVVLKAAEDSPRIAQLFAELTKEAGLPDGVFNVVHGRGEPAGSTLVTDERVD
FT                   IISFTGSTGVGRRIAEVAGKRLARISLELGGKNPFVVCDDADLDQAVHWAALSAFSNAG
FT                   QRCAAGSRMLVFKSVYEEFRDRLTAKARSLKLGVAAGCDLGPLVSLRQQQSVLSAIERA
FT                   KEQGGQVLCGGRTPDAPELAGGYYVEPTVIDGLATTSDLSCKEVFGPVTTLHPVGSMTE
FT                   ALDVANATEYGLTAAVHTRNVDRAMWFAQRVKAGVANVNMGTYGSEPHMPFGGFGSSGN
FT                   GTREPGVEALDVYSELKNISFLVRPGML"
FT   gene            459315..460085
FT                   /locus_tag="Rleg_0443"
FT   CDS_pept        459315..460085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0443"
FT                   /product="acylneuraminate cytidylyltransferase"
FT                   /note="PFAM: acylneuraminate cytidylyltransferase; KEGG:
FT                   rce:RC1_3768 acylneuraminate cytidylyltransferase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54752"
FT                   /db_xref="GOA:C6B1N3"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1N3"
FT                   /inference="protein motif:PFAM:PF02348"
FT                   /protein_id="ACS54752.1"
FT                   /translation="MTTKPRSVAFIPARSGSKRVPNKNVRPLADHPMIAYSIRAAIDSG
FT                   VFDAVICATDSEIYADIARHYGAEVPFLRAAEISTDKSPDIEWVVWMLEQLRAEGREFD
FT                   IFSILRPTSPFRLPETIQRAWQQFTAEPRADSLRAIEKCKQHPGKMWVIRENRMLPLMP
FT                   FSIGTTPWHSSQYAALPEVYAQDASLEIAWSRVPLESNSIAGESIIPFVSQGYEGFDIN
FT                   EPDDWWMAERLLATQSAVLPNISINPYNLLNRPE"
FT   gene            460089..461999
FT                   /locus_tag="Rleg_0444"
FT   CDS_pept        460089..461999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0444"
FT                   /product="Transketolase central region"
FT                   /note="PFAM: Transketolase central region; Transketolase
FT                   domain protein; KEGG: rce:RC1_3769 transketolase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54753"
FT                   /db_xref="GOA:C6B1N4"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1N4"
FT                   /inference="protein motif:PFAM:PF02779"
FT                   /protein_id="ACS54753.1"
FT                   /translation="MGDLVGQAVEGTLYYLPYKEFQRVRAINAPREQRAALFSDMCRLN
FT                   ALYMIGRAGSGHIGSSFSSLDIVSWLLLEGMTGDDVYFSSKGHDAPGYYAALIGAGKLD
FT                   FELTHKLRQIDGLPGHPDVGTPGMVTNTGSLGMGVSKAKGMVIANRLNNRPGRIFVMTG
FT                   DGELQEGQFWESLVSAANSGLQEITVIIDHNKLQSDTFVKNVSDLGDLEAKLRAFGWCV
FT                   ARCDGNDIAAFAATLAAIQDDPRPKVIVADTVKGKGVSFMEHTSLDSDVAMYRFHSGAP
FT                   DASNYRAAAQEIMDRLQANLSSAGITELEFETLERPASAAPSEKAQRLVAAYSKALIAQ
FT                   AKKHSNLVALDADLVLDTGLIPFREQFPDRFVECGIAEQDMVSTAGGMALNGLLPIVHS
FT                   FACFLSTRPNEQIYNNATEKTKIIYVGSLAGVVPGGPGHSHQSVRDISALAAMPGMTLV
FT                   EPSCDAEVGLLLDWCVNEAPGSSYIRLISLPWEIPYSLPADYRPTNGRGLTLAEGEDVA
FT                   IIAYGPVLLSNAIAASKVLAEKHGISAKVINLPWLNHVDAEWLQSTVSACKAIVCLDNH
FT                   YVIGGQGDTIARALAEAGTGIPVKHIGITGVPPSGTNVQVLGAVGLDASAIAETVASVI
FT                   G"
FT   gene            462121..463842
FT                   /locus_tag="Rleg_0445"
FT   CDS_pept        462121..463842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0445"
FT                   /product="Capsule polysaccharide biosynthesis protein"
FT                   /note="PFAM: Capsule polysaccharide biosynthesis protein;
FT                   KEGG: rpe:RPE_4251 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54754"
FT                   /db_xref="GOA:C6B1N5"
FT                   /db_xref="InterPro:IPR007833"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1N5"
FT                   /inference="protein motif:PFAM:PF05159"
FT                   /protein_id="ACS54754.1"
FT                   /translation="MSMHFIRRAIRFAKRVVSSKLSLQQSSAPAAAQQFSDWRRHLGTS
FT                   IDWKRALSSVSKGQEVLIATSVGGLSAATILEGMLGVALTLRGARVRFLLCDAVLPACL
FT                   HIHAGKIRDPAVITEYRLNKEICPGCIGRGRSHYGSLGLPVSYYSDFISEEERRALRKT
FT                   AREMPVSEIRGFRLKDMNLGEHAMAGTLRFFASGNLPATQEAEDVLRRYFEAALITETV
FT                   IQRYHEQFSPEVAVFHHGIYVPQGVIGEVCRAHGTRVANWQVGYRKKTFIFSHKETYHH
FT                   TLINESTDCWTDVPWSEATENEIMSYLKSRWYGSNDWIWFHDQPKHDAELIAKETGIDF
FT                   SKPTISLLTNVFWDAQLHFKANAFRDMLDWVLQSIEYFKGRPDLQLAIRIHPAEVRGAI
FT                   PSRQPLVDEIRKVYPTLPDNVYVIPPDSQVSTYVLCENSDTVVIYGTKTGVELTAMGIP
FT                   VVVAGEAWIRNKGLTMDATSPENYFDLLDRLPVGKRLDADTINRARKYAFHFFFRRFIP
FT                   IEFMEPSSNDAPYEIRINDLQDLLPGRDAGLDVLCNGILDGSEFVYPAEKYIGRTQ"
FT   gene            463839..464504
FT                   /locus_tag="Rleg_0446"
FT   CDS_pept        463839..464504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0446"
FT                   /product="Acetyltransferase (isoleucine patch
FT                   superfamily)-like protein"
FT                   /note="KEGG: rsq:Rsph17025_4339 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54755"
FT                   /db_xref="GOA:C6B2D5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2D5"
FT                   /inference="protein motif:COG:COG0110"
FT                   /protein_id="ACS54755.1"
FT                   /translation="MRPHWDHAFASGGVYQESDNWSKLLDPVFRVGERLYGQYSMRRIW
FT                   AAWKKAALLEPGVRLGGNARLINKHTRDAARIGENTVCRGIIRVERGARVDIGKEVYLG
FT                   DEAIISAMESVTIGRGTLIAHGVQIFDNTSHPIDWRGRERHFKRILGQPVDGSIEIPTA
FT                   PVSIGEHCWLGFGSAVLKGVTIGDRSIVAAGCVVTKDVPPDTLVVSSMATFIDLNKQG"
FT   gene            464519..465313
FT                   /locus_tag="Rleg_0447"
FT   CDS_pept        464519..465313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0447"
FT                   /product="glycosyltransferase-like protein"
FT                   /note="KEGG: dde:Dde_0428 glycosyltransferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54756"
FT                   /db_xref="GOA:C6B2D6"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2D6"
FT                   /inference="similar to AA sequence:KEGG:Dde_0428"
FT                   /protein_id="ACS54756.1"
FT                   /translation="MLATQQMPQYSVMDQFVESICYRAPENRTQWYPPLMRSAESLGKR
FT                   AISADAAEDALAVLRKLEPDDYSEYLSAYYAEGIRRFGANWRYADIVTVLLALAVDLKP
FT                   KSYLEIGVRRGRSVCTVASKAPTCDIYMFDMWVANYAGMENPGESLVSSELDKVSHTGK
FT                   RVFTNGNSHSTLKTFFRQNSDLAFDMITVDGDHTRNGAIEDLCDVLPRLKIGGAVVFDD
FT                   ICHPKHRYLEDVWKELVVNDNRFTSWSCADIGYGVGFALRKW"
FT   gene            465307..466230
FT                   /locus_tag="Rleg_0448"
FT   CDS_pept        465307..466230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0448"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   dTDP-4-dehydrorhamnose reductase; KEGG: dvm:DvMF_1854
FT                   NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54757"
FT                   /db_xref="GOA:C6B2D7"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2D7"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACS54757.1"
FT                   /translation="MVNTSERLLVLGASGFLGTVISTYFSSLGIPVMGIDVVPPQDKHI
FT                   YSDFYQSERMEEILETALARHQPTYLVHVAGNANVGRSIEDPRYDFVNSVDLFSLVLDQ
FT                   VRRVSLGTKVLFTSSAAVYGQPKVLPITEELAPSPISPYGYHKWMCEQLSREYSSLYEV
FT                   SVASIRIFSAYGAGLRKQILWDLCEKCRSDGPVQLGGDGSETRDFIHAKDIARAISCVV
FT                   RGGTFNGEVYNVASGVETSISDLAHHVLSAYGIPFDRLGFSGSSRVGDPKNWRADVSRL
FT                   EALGFSPTIDFVAGVAEYVDWYKKLR"
FT   gene            466227..467411
FT                   /locus_tag="Rleg_0449"
FT   CDS_pept        466227..467411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0449"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   ret:RHE_CH00756 alpha-glycosyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54758"
FT                   /db_xref="GOA:C6B2D8"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2D8"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACS54758.1"
FT                   /translation="MKILIYLTGGTHWIGGVQYTRNLLRAVSLLPAQERPALVLQIGRK
FT                   NAGQGYEEEFSHYPGVVIDGPLERGSAIRSRILDLARRAWKRSTGKDLRQKLLHSDECD
FT                   VAFPAKGPNIPGLAQKVYWVPDFQYKHFPQFFSEDERRSRDAFYGKMFDESGILVLSSE
FT                   AVKADFIRFFPTYSQKPVRILHFSSTLHDEEYALDPVAVCAKHGLPEKFVYLPNQMWQH
FT                   KGFDAAFRALGILKRAGVIIPLVLTGSSEDYRSNDYARQLEEILTEYDLQDQIYRLGVL
FT                   PRSEQLQLFRRAAVVLQPSRFEGWSTTVEDTRALGRPIVLSNIDVHLEQAPPNASYFVV
FT                   GDQKDLADKLGKAWLTAEAGPDFKQEDAARKAANLNSLAYARTFLSIMRQAHRE"
FT   gene            467449..468279
FT                   /locus_tag="Rleg_0450"
FT   CDS_pept        467449..468279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0450"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: sfu:Sfum_3355
FT                   ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54759"
FT                   /db_xref="GOA:C6B2D9"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2D9"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ACS54759.1"
FT                   /translation="MKNQEKITYIKPAGRFAKIDLEEHWRARYMFTMLVWKKIRASFGE
FT                   MYFWFIWVCAKPLLYVMIFSLFKHWSQARTGVEIPYVLYIYSGLILWYYFLETAIDVSL
FT                   NIKANAALVTKIYLPRMITPTVPLLANLMDLAISMIPLILMMIYYGVYPGWQILMIIPT
FT                   LLVVMITAMGTGLIIATITLRLRDFQKIFEFSLYLAMFISPVIFSPSMIPEAFHWVYHM
FT                   NPMVGALIGWREALFGSASFPWGAWVYSCSFAVLALIVGLYLYLRFEHEMIEAI"
FT   gene            468284..469552
FT                   /locus_tag="Rleg_0451"
FT   CDS_pept        468284..469552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0451"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rpe:RPE_4248 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54760"
FT                   /db_xref="GOA:C6B2E0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029439"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2E0"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS54760.1"
FT                   /translation="MAESVIEVFDISKQYEIGSGGGLSMSKLARETALWPYRKMRGQSV
FT                   PPLYRKRQNFWPLRDVSFSVDRGEVVGIIGANGAGKSTLLKILSRIVTPTSGSATIRGR
FT                   VSSLIEVGTGFNANLSGRENVFLNASLHGLSREEVAARFDEIVDFSGVGKFIDTPVKHY
FT                   SSGMYSRLAFSVAAHLDPDLLFVDEVLAVGDMAFQQKCLNRFSEMVGGNRTVLFVSHNL
FT                   SAVSNICSKVLWLDQGRVRYFGPTEEGIAAYYEATMPSTAQTLETRFDRTGTGDFMFNK
FT                   ISFYDSSMQPSERVTTGQELIIGLEYRAKLEMIGDIRDMSLVVIFKNDKGHRLFGLPSD
FT                   VLAHGETPRLTETGEYLVKIPSLPLLPGIYDLDLGCIINRATTDKIVSAKRLIVTESDF
FT                   FGSGKLPPVQQGDLLVRFDNEWR"
FT   gene            469568..470608
FT                   /locus_tag="Rleg_0452"
FT   CDS_pept        469568..470608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0452"
FT                   /product="O-methyltransferase family 3"
FT                   /note="PFAM: O-methyltransferase family 3; KEGG:
FT                   rpe:RPE_4247 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54761"
FT                   /db_xref="GOA:C6B2E1"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2E1"
FT                   /inference="protein motif:PFAM:PF01596"
FT                   /protein_id="ACS54761.1"
FT                   /translation="MNKIFDRTKLWLLDYLLRDDWNDGNNKVAKFDAQKALKGLENMKA
FT                   GRILLKQFVEVLFSSGAMIGRIERILQSMRIPTYLLMHSVLAKCLLLLDVHPKARLAEL
FT                   HAAGMLEEEFGIALNTHLAAVAFEKTRQISKIRELYAEEIFDGISRISLPLSISNEASH
FT                   HENHMDMMFVVAAAKHRGAKRIFEFGTYMGRTTVGLASIDADATVTTLNLDPAEDTRYG
FT                   PYIGKLIKDSPYRDRITQIFSDSKKFDTTPYAKSMDYIFIDADHSYDAVKNDTEKSLEM
FT                   LAPGGVIIWHDYAPKSPGVFGYLQELSLQRSLFRIRNTCLVLYIDGVDADEFEPKSDAG
FT                   FLEDVS"
FT   gene            470623..471375
FT                   /locus_tag="Rleg_0453"
FT   CDS_pept        470623..471375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0453"
FT                   /product="methyltransferase FkbM family"
FT                   /note="TIGRFAM: methyltransferase FkbM family; KEGG:
FT                   rpe:RPE_3384 methyltransferase FkbM family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54762"
FT                   /db_xref="GOA:C6B2E2"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2E2"
FT                   /inference="protein motif:TFAM:TIGR01444"
FT                   /protein_id="ACS54762.1"
FT                   /translation="MTANSHEYPVAVDDQQFLVRCINDVERGRAASFLSKEPETVRWLK
FT                   AEMVPATVFWDVGANVGLFSLYAAILQPTAQILAFEPAAHNYASLCDNIVINGFTNIVP
FT                   FSVALGQGNLAFDELHLSKVEAGSSIHHVGAKSPWAESEPVFRQPCVKVSIDSMVLDHD
FT                   FPPPTLLKIDVDGLELGILDGARTVLNQVKSVLVELDANDPSEISAATNLLEQAGFRLT
FT                   ETSRREKTINRKLPRNHIWMNAALRPLD"
FT   gene            471455..472354
FT                   /locus_tag="Rleg_0454"
FT   CDS_pept        471455..472354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0454"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG: glycosyl
FT                   transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54763"
FT                   /db_xref="GOA:C6B2E3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2E3"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACS54763.1"
FT                   /translation="MEHQLSIVLGTYNRLDQLQRCVESIVSQTKTVFRLYVTDAGSTDG
FT                   TVEYLQSIAGENIIPVLVGKKLGQAKAYNDVFNIVTTPYVCWLSDDNEVIDHGLDRAVS
FT                   IIRTDPSIGMVALKTKDLQGPFVDAPFIGGVSSTGILNVNQGLLPTALLKKIGGFSEEF
FT                   RDYGIDNALTAEVLFAGYKVVYSRKVALQHYRNWSEDPTSENYQWLKQRHEAAKVLYEE
FT                   RYGNQNTQELSGSYRMKTKVARRVKAGAKRYLTSDYVRTSAAVRTCFIILSSRYISILD
FT                   PILTFGRDYHLVQKRRTG"
FT   gene            472699..474471
FT                   /locus_tag="Rleg_0455"
FT   CDS_pept        472699..474471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0455"
FT                   /product="Capsule polysaccharide biosynthesis protein"
FT                   /note="PFAM: Capsule polysaccharide biosynthesis protein;
FT                   KEGG: rpe:RPE_4251 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54764"
FT                   /db_xref="GOA:C6B2E4"
FT                   /db_xref="InterPro:IPR007833"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2E4"
FT                   /inference="protein motif:PFAM:PF05159"
FT                   /protein_id="ACS54764.1"
FT                   /translation="MKYRHPIAALTVPTRPLLSRIRDRLSRHGWYRRFHLAYVRWRARH
FT                   GGLPDWAAWQPQAGLEPVRPPLIDGAKRVLVATGTAGHLPSMTMESLLGMALAIRDASI
FT                   DFLICDAALPACMMCEISWYSDVDKLAKHGPKDRCLTCYRPSAEMLDRAGLNAIGLNSK
FT                   LTDADRFKAKTTSTQMPQSEIAAYIEDGIPIGEHAVAGALRFFSRGDLEKVSGADVILR
FT                   RYLEAAILTYYGTRRLLAEGHYDAVVLNHGIYVPQGIISETARHLGVRVVTWHPAYRRG
FT                   CFIFNHHETYHHGLMTEPVSSWEDMSWNGMQQQQITQYLRSRWVGQQDWVKFHDQPEFD
FT                   TRSIEEEIGIDFRRPTIGLLTNVIWDAQLHYKANAFPNMVDWLIKTIAYFEKRPDLQLL
FT                   IRVHPAELTGTLPSRQPAVDEIRRQFPNLPANVFIIPPESKASTYVAMSHCNAVLIYGT
FT                   KMGVELSAMGIPVIVAGEAWIRGKGVTMDATSEENYLRLLDALPLRERLNDATIERAQK
FT                   YAYHFFFRRMVPLDCIKERKGWPPFAVHIDSLDDLAPGKSPGLDIVCNGIIAGTPFIYP
FT                   AEDLMGAPSDRRAT"
FT   gene            474468..475568
FT                   /locus_tag="Rleg_0456"
FT   CDS_pept        474468..475568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0456"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   bov:BOV_0533 putative mannosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54765"
FT                   /db_xref="GOA:C6B2E5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2E5"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACS54765.1"
FT                   /translation="MRISIDATGLGGPKTGTSVYLIEILSRWSRNTSINHEFTIFASEK
FT                   AVSLCSEAGLDHRFRFVRAPNNRHIRVIWQQLMIPWHMRRLGIDVHWGTAFVLPVASQR
FT                   PMAVTIHDLTFQLFPEVHERLKRFYFPAIMQRSVAKAQAVFAVSRTTETDLKRIIPESR
FT                   GKTTVTLLAARKLGSDSQAPRDQRNSGDYLLFVGTLEPRKNLPRLLAAWQMLDDATRGN
FT                   TRLVIVGATGWMVSDLLQSLKTNDTIDFLGHVSDSSLAELMQGARALLYPSLYEGFGLP
FT                   VVEAMARGIPLLTSNTGATAEIAEGAAILVDPTNVDDIRGGLVRLLTEPELLGALSAQG
FT                   RERAKSFSWERTAQLTLETLEGLKRA"
FT   gene            475565..476308
FT                   /locus_tag="Rleg_0457"
FT   CDS_pept        475565..476308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0457"
FT                   /product="glycosyl transferase family protein"
FT                   /note="KEGG: neu:NE0499 glycosyl transferase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54766"
FT                   /db_xref="GOA:C6B2E6"
FT                   /db_xref="InterPro:IPR025993"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2E6"
FT                   /inference="similar to AA sequence:KEGG:NE0499"
FT                   /protein_id="ACS54766.1"
FT                   /translation="MSDICVSIVSHGQGEIANLLLDDLDSRCSGLNVVLTKNIPEELPI
FT                   RDRRYPFLQIENPSPKGFAANHNQAFRRCDSGLFCVANPDIRLQADPFGHLKAAMSDPR
FT                   VGLVAPLIVNPGGTIEDSARYFPTPFGLLRKALGKSDGRFPIDPNRSSAVDWTAGMFML
FT                   FRSEAFAEVGGFDEGFFLYYEDVDICARLWKAGWKVILLPTVSVVHDARRASHADAKYM
FT                   RWHVSSMMRYFTKHLGRTPDISRMT"
FT   gene            476561..477409
FT                   /locus_tag="Rleg_0458"
FT   CDS_pept        476561..477409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0458"
FT                   /product="HAD-superfamily hydrolase, subfamily IIA"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IIA;
FT                   HAD-superfamily subfamily IIA hydrolase like protein; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; KEGG:
FT                   ret:RHE_CH00830 putative hydrolase, haloacid
FT                   dehalogenase-like family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54767"
FT                   /db_xref="GOA:C6B2E7"
FT                   /db_xref="InterPro:IPR006356"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2E7"
FT                   /inference="protein motif:TFAM:TIGR01460"
FT                   /protein_id="ACS54767.1"
FT                   /translation="MAKRIENFSEISGHYDVVLCDVWGVVHNGVDPFPKAAAALEAARE
FT                   AGLAVVLITNSPRLSWQVVEQLRQIGVPDSAYDRIVTSGDVTRGLIAEGPKTVFLLGHE
FT                   RNSPLLDGLDIERRPAGEAQSLVCTGFFDDETEKPEDYTDMLLDFKARDVPMICANPDL
FT                   IVERGHRIIPCAGAIAAYYEQLGGSTRIAGKPHRPIYEATLAAARELRGDFPVDRVLAI
FT                   GDGMPTDVRGALNYGLDLLYISGGIHAKEYTLNGETDEAILNAYLERENAAPKWWMPRL
FT                   A"
FT   gene            477441..477599
FT                   /locus_tag="Rleg_0459"
FT   CDS_pept        477441..477599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0459"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00831 bifunctional riboflavin
FT                   kinase/FMN adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54768"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2E8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS54768.1"
FT                   /translation="MTVFHRNETREPLPAHLKGGVARRPSMAPKKMSDPIGIGLARNWR
FT                   RASCSPG"
FT   gene            477723..477899
FT                   /pseudo
FT                   /locus_tag="Rleg_0460"
FT   gene            complement(477911..478150)
FT                   /pseudo
FT                   /locus_tag="Rleg_0461"
FT   gene            478291..478515
FT                   /locus_tag="Rleg_0462"
FT   CDS_pept        478291..478515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0462"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: smd:Smed_6262 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54769"
FT                   /db_xref="GOA:C6B2E9"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2E9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS54769.1"
FT                   /translation="MHVARLLVLTPLFALIVTPAYAYLDPGTGSIIIQSVIGAFAVGAA
FT                   SISLFWQRVKSFLCRTGDNQRQKSGRERK"
FT   sig_peptide     478291..478359
FT                   /locus_tag="Rleg_0462"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.946 at
FT                   residue 23"
FT   gene            478512..479879
FT                   /locus_tag="Rleg_0463"
FT   CDS_pept        478512..479879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0463"
FT                   /product="NoeA host specific nodulation protein"
FT                   /note="KEGG: smd:Smed_6261 NoeA host specific nodulation
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54770"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2F0"
FT                   /inference="similar to AA sequence:KEGG:Smed_6261"
FT                   /protein_id="ACS54770.1"
FT                   /translation="MMLSRVSGSFRDPSGHVYEGTEHIYRTVESSAAADYEAARNAGIF
FT                   ESPMIVSTTESTAPSPSKTASYLLEHPRIPLISYPYEWSFSMLKDAALLHLDFHLHLLG
FT                   RGFTLSDATAYNVQFLGPTPVFIDHLSVRRYRDGEYWEGHRQFCEQFLVPLLLRSFFGI
FT                   SHNAWYRGALEGISIADFVKMLRFRQKVSWRVLAHLVLQDKFQRSASAGQAEKAQHRQL
FT                   PRNAYTATLQQLRNWIAGLSPRDTDPTTWANYATANTYSNTEATLKKQFVGDFIRRSGA
FT                   TTVIDLGCNTGDYSEVALHNGAQRVFGFDFDQQALDSAYHRAKNKSLNLLPLFLDARNQ
FT                   SPSQGWLQEERTGFASRAKADAALALAFEHHLAIAHNIPLEQVVDWLISVAPTGVVEFV
FT                   PKDDPTVRTMLALRRDIFPDYNYDHFISLIGRRARVLENLVVSSTGRTLISYSRNG"
FT   gene            479876..481909
FT                   /locus_tag="Rleg_0464"
FT   CDS_pept        479876..481909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0464"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54771"
FT                   /db_xref="GOA:C6B2F1"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2F1"
FT                   /inference="protein motif:PFAM:PF00884"
FT                   /protein_id="ACS54771.1"
FT                   /translation="MTNLAGHTGSWRGHALASALLAVTLFTVALDVYSRNISEFAGSSI
FT                   LQLLPPVLISIVVGCVAFVITGITGFKPVGMSVVLGAATCVIAASQGVTTSVIPPIDGG
FT                   THPYIVSSGRGVVEFILLFVIFLLTAGFAILRLREALMILSGLTFLALLIPIYNLAARD
FT                   RISTSLGPLMTLSRDVNVIHIMFDSLQSDAFKQIAEQQPDLLSEFDGFAYYPDHAGYAN
FT                   WTTLSIAAIQTGRLFFDQHQDGMDPIEEIGEWLRSSSMMSHLADKGWDVSAVQPSNAFC
FT                   FRTKYYCSTLPFLSNSIGQRLGKQRKSNPLIVVDLALLRLAPTLLKPLVYNEGKLLWSD
FT                   ATGPANADSSTANDIALSMDFAKILTEDIAVTDDNPVYKFLHFYPPHKPFILDEDCRIG
FT                   VARTEDWPNYLPQATCAVKQMAGILRALKRLGAYDNSVIIFQSDTGLGMVRPTENADPK
FT                   ITSVVEYSSPQLVGYARPTLLIKPLGATGPLRVSSVQTSHLNTFSLINDATAGRTNLPN
FT                   VTAPKDRSFVVSRIIRAGTTSVSPYEQFIIVGNVADSAAWQYGGMLSRPGVPYLARPIQ
FT                   SATFSIDADEPLNPNQSIRLVGSVSGGNDVEYTFLRRIKDDKLEIIKDWSPDNTATWEV
FT                   DENGKTPCVANILMAARNRVMGPSEHQINVEKVAKISTSACH"
FT   sig_peptide     479876..479965
FT                   /locus_tag="Rleg_0464"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.741) with cleavage site probability 0.699 at
FT                   residue 30"
FT   gene            complement(482016..482941)
FT                   /pseudo
FT                   /locus_tag="Rleg_0465"
FT   gene            complement(482935..483201)
FT                   /locus_tag="Rleg_0466"
FT   CDS_pept        complement(482935..483201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0466"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   oan:Oant_4528 transposase IS3/IS911 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54772"
FT                   /db_xref="GOA:C6B2F2"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2F2"
FT                   /inference="protein motif:PFAM:PF01527"
FT                   /protein_id="ACS54772.1"
FT                   /translation="MKRNRFTDEQIIGILKEHEAGTPVSELCRKHGVSDASIYKWKAKF
FT                   GGMEVSEAKRLKTLEDENTKLKRLLADAMLDNAALKDLLGKKW"
FT   gene            483756..488366
FT                   /locus_tag="Rleg_0467"
FT   CDS_pept        483756..488366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0467"
FT                   /product="Ti-type conjugative transfer relaxase TraA"
FT                   /note="TIGRFAM: Ti-type conjugative transfer relaxase TraA;
FT                   PFAM: MobA/MobL protein; KEGG: rec:RHECIAT_PC0000882
FT                   conjugal transfer protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54773"
FT                   /db_xref="InterPro:IPR005053"
FT                   /db_xref="InterPro:IPR014136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041533"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2F3"
FT                   /inference="protein motif:TFAM:TIGR02768"
FT                   /protein_id="ACS54773.1"
FT                   /translation="MAIMFVKARVISRGAGRRIVPAAAYRHRARMMDEQAGTSFSYRGG
FT                   RAELVHEELALPTQVPEWLRTAIDCRTVAAASEALWNAVEAFEKRPDAQLARELIIALP
FT                   EELTQAENIALVREFVHDNLTSRGMVADWVYHDKDDNPHIHLMMTLRPLKEEGFGAKTV
FT                   QVLDEGGKPLRVVTLDRPKGRIVSKAWAGDKETMKGWKIAWADTANRHLAFAGHEIRLD
FT                   GRSYAEQGLDGIAQRHLGPEKAAHSRRGRQPYYASAGLARRQGVVDRLLSEPEFLLKRL
FT                   GNERSTFDERDIAKALHRYVDDPSDFANIRARLMASDDLVMLKPQEVDPETGNASEPAV
FT                   FTTREILRIEYDMARSAQVLSEHKGFAVPSRYIAAAVKSVEAGDLDKPFKLDAEQINAI
FT                   SHITGDSGIAAVVGLAGAGKSTLLAAARVAWEGEGRRVIGAALAGKAAEGLEDSSGIRS
FT                   RTLAAWELIWANGHETLRRGDVLVVDEAGMVSSQQMARVLKIAEDAGTKVVLVGDAMQL
FT                   QPIQAGAAFRAITERIGFAELAGVRRQRQQWAREASRLFARGEIEKGLDVYAQQGHLIE
FT                   AGTRDEVIGRIVGDWSEARRQAIETSVLKVNGGRLRGDELLVLAHTNQDVKRLNEALRS
FT                   VISDAGALGENRSFRTERGAREFAAGDRIIFLENARFLEPRAPRLGPQYVKNGMLGTVV
FT                   STGDKRGDTLLSVRLDNGRDVVISEDSYRNVDHGYAATIHKSQGATVERTFVLATGMMD
FT                   QHLTYVSMTRHRGRADLYAAKEDFEAKPEWGRKQRADHAAGVTGELVESGQAKFRPNDE
FT                   DADDSPYADVRTDDGTVHRLWGVSLPKALEEGGVSEGDSVTLRKDGVEKVKVQVPVVDE
FT                   QTGQKRYEEREVDRNVWTAKRIETAEARLERIEQESHRPHVFKQLVLRLSRSGAKTTTL
FT                   DFESEASYQAHADDFARRRGIDTLSQTAAGMEEGVSRRLAWIAEKREQVAELWERASVA
FT                   LGFAIERERRVSYNEARIETQTVSDADAGGVRYLIAPTTEFARSAEEDARLAQLSSLAW
FT                   KEREAILRPLLEKIYRDPDAALVALNAMASDVKIEPRRLADDLAAAPDRLGRLRGSDLI
FT                   VDGRAARDERSIATAALTELIPLARAHATEFRRNAERFGVREQQRRAHMSLPIPALSRQ
FT                   VMARLVEIEAVRERGGDDAYKTAFALATEDRSLVQEVKAISEALTERFGWSAFTSKADA
FT                   VAERNMVERMPEDLTGMRGEKLTRPFEAVKHFADEQHLVERRDRSKIVAGANADPEREN
FT                   VPMLAAVTEFKTPIDEEARSRALATPLYRQQRVALAAVASAIWRDPAGAVGKIEELLQK
FT                   GFAAERIAAAVTNDPAAYGALRGSNRLMDRMLASGRERKAAVQATPEVAARLRSLGSAY
FT                   VNVLNAERQAIAEERRRMAVAIPGLSKAAEEVLTRLAAESKSNARKLNASAFFLDPNIR
FT                   QEFAAVSRALDERFGRDAILRQAKDRINRVPPPHRTAFEAMQDRLKILQQAVRIESSDR
FT                   IISERRQRTANRGVDL"
FT   gene            complement(488419..489333)
FT                   /locus_tag="Rleg_0468"
FT   CDS_pept        complement(488419..489333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0468"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /note="PFAM: DNA polymerase beta domain protein region;
FT                   SMART: HEPN domain protein; KEGG: sme:SMa0967 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54774"
FT                   /db_xref="GOA:C6B2F4"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2F4"
FT                   /inference="protein motif:PFAM:PF01909"
FT                   /protein_id="ACS54774.1"
FT                   /translation="MKSNLDHLPERKQRELARVVDILHEEFQDALKDSSAEFKKMGRIL
FT                   KVILFGSYARGDWVDEPHTLKGYRSDYDLLVIVNNRKLSDFATYWYKAADRFLHDPGIK
FT                   TPVSLIVHSRREVNTALHEGQYFFSDIRREGIVLYELDDEPLPEPKPRSKAEEYLIAKE
FT                   HFEERFPFSTDLLDGFTLYVERRRYKHAAFFLHQVIEHAYSAALLTLSNYSPASHNLTF
FT                   LRKLAEGRDRRLVDAWPRDQQRYRAWFNTINEAYVKARYSNHYEVSEEALIWLGEQTAE
FT                   LHVLVKIVCKEHLTRLRTDATDY"
FT   gene            complement(489934..490095)
FT                   /locus_tag="Rleg_0469"
FT   CDS_pept        complement(489934..490095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0469"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54775"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2F5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS54775.1"
FT                   /translation="MPLDDPISDITFDCGRALAKSFRSIDGLAFMHICPIDISAPSLKL
FT                   LQRDSRQN"
FT   gene            complement(490166..490300)
FT                   /locus_tag="Rleg_0470"
FT   CDS_pept        complement(490166..490300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54776"
FT                   /db_xref="GOA:C6B2F6"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2F6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS54776.1"
FT                   /translation="MEIGFVAVAGIAGFVVGSGQGSLVDGLVTAVAAMAVVFIFVTLT"
FT   gene            complement(490944..491017)
FT                   /locus_tag="Rleg_R0007"
FT                   /note="tRNA-Gln2"
FT   tRNA            complement(490944..491017)
FT                   /locus_tag="Rleg_R0007"
FT                   /product="tRNA-Gln"
FT   gene            491357..491530
FT                   /locus_tag="Rleg_0471"
FT   CDS_pept        491357..491530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0471"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54777"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2F7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS54777.1"
FT                   /translation="MAGNPATVLIPLRMSLPAVPDSLRARWKMQPAIRPASASVAVVAA
FT                   MVLCRMVHLNLI"
FT   gene            491527..492828
FT                   /locus_tag="Rleg_0472"
FT   CDS_pept        491527..492828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0472"
FT                   /product="Ppx/GppA phosphatase"
FT                   /note="PFAM: Ppx/GppA phosphatase; KEGG: ret:RHE_CH00788
FT                   exopolyphosphatase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54778"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2F8"
FT                   /inference="protein motif:PFAM:PF02541"
FT                   /protein_id="ACS54778.1"
FT                   /translation="MMEQAGAADHAARSDGDSAPSRRNRRKHRGKRGLQGRPLTPAKPS
FT                   GAPQQERRAEETALGGELRETLNGASANRRGRQESHAHPGHQGDRQAGEHVWPEELYAA
FT                   LDLGTNNCRLLIAQPTRPGQFRVVDAFSRIVRLGEGLAASGRLSDEAMERAIEALRICA
FT                   SKLRNREIRRMRLIATEACRQAVNGEEFLSRVVAETGLALEIIDRETEARLAVSGCSSL
FT                   VGRETRSVVLFDIGGGSSEIAVIRIGDNRFSRLANHITHWTSLPVGVVTLSERHGGHDV
FT                   TPEAFEGMVREVEGMLGSFDCPEIEVAQTGDFHLIGTSGTVTTLAGVHLDLPRYDRRKV
FT                   DGIWLSDDEVSAMQAKLLSWDFASRAANPCIGPDRADLVLAGCAILEAIRRRWPSPRMR
FT                   VADRGLREGLLTDMMADDGVWRRNRNRRGQRVRS"
FT   gene            492843..493562
FT                   /locus_tag="Rleg_0473"
FT   CDS_pept        492843..493562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0473"
FT                   /product="ribosomal RNA methyltransferase RrmJ/FtsJ"
FT                   /note="PFAM: ribosomal RNA methyltransferase RrmJ/FtsJ;
FT                   KEGG: rec:RHECIAT_CH0000875 ribosomal RNA
FT                   methyltransferase/cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54779"
FT                   /db_xref="GOA:C6B2F9"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2F9"
FT                   /inference="protein motif:PFAM:PF01728"
FT                   /protein_id="ACS54779.1"
FT                   /translation="MTKAPIAGNRTGRKLGQRVKNKKMKASSRQWLERHINDPYVQRAQ
FT                   LEGYRARAAFKLLEIDEKHHILRGARRIIDLGAAPGSWSQIAAKVTGSTDDDIRVAAID
FT                   FLEMTQLPGVKILQLDFLDPTAPEKLLEAVGGTPDLVISDMAAPTTGHHRTDHLRTMHL
FT                   CEVAAHFAVEVLGEGGHFLTKTFQGGTERELLAMLKQNFRQVVHVKPNSSRAESVEMFL
FT                   LAKGFKGRKAEGNAEEA"
FT   gene            493720..494103
FT                   /locus_tag="Rleg_0474"
FT   CDS_pept        493720..494103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0474"
FT                   /product="putative lactoylglutathione lyase protein"
FT                   /note="KEGG: ret:RHE_CH00791 putative lactoylglutathione
FT                   lyase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54780"
FT                   /db_xref="GOA:C6B2G0"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2G0"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00791"
FT                   /protein_id="ACS54780.1"
FT                   /translation="MLLYVTLGTNDLYRAGHFYDAVLSPLGYRRQRSSEEEIGYSAEGD
FT                   TRCRFWVVTPFNHRRATSGNGAMVALAAETRADVDAFHAAAIAAGAVDEGEPGLRSYHA
FT                   QFYAAYVRDLDGNKLSAVCENPQ"
FT   gene            complement(494189..495613)
FT                   /locus_tag="Rleg_0475"
FT   CDS_pept        complement(494189..495613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0475"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   ret:RHE_CH00792 efflux transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54781"
FT                   /db_xref="GOA:C6B2G1"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2G1"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACS54781.1"
FT                   /translation="MNRIVPLILAVALFMEQMDSTVIATALPAIAADLNVGPITLKLAL
FT                   TSYMVALAVFIPVSGWMADRFGAKKIFRLAISVFVIGSIFCAISSNLVEFVFARFLQGM
FT                   GGAMMTPVGRLVLVRTTQRSDLVSAMALLTIPALVGPLTGPPLGGFITTYFSWHWIFLI
FT                   NVPVGIIGISLATIFLPEVEATAPPRLDFTGFVLTSLSAAGVVFGLSVVSLPALPPIIG
FT                   VTATLIGLICGVLYVRHAKRHPAPILNLNLFKNPTFRASTLGGMLFRICVGAMPFLTPL
FT                   MLQLGFGLTPFQSGLITFAGAIGAITTKFMAKRVFAAAGFRTTLLGAAMVTTLVTVVTG
FT                   LFTPSTPHLVIIGVLLLGGFSRSFMFTGVNALAFADIDDAEASQATSMSSVMQQVSLAL
FT                   GVAVAAAILESSIYFRGEALQVADFHLAFYIIAGLTVIATIPFIRMDRNAGALVSGHRL
FT                   KTMTAATVEAEQHAVK"
FT   sig_peptide     complement(495518..495613)
FT                   /locus_tag="Rleg_0475"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.616) with cleavage site probability 0.588 at
FT                   residue 32"
FT   gene            495862..496854
FT                   /locus_tag="Rleg_0476"
FT   CDS_pept        495862..496854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0476"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   rec:RHECIAT_CH0000878 putative beta-lactamase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54782"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2G2"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACS54782.1"
FT                   /translation="MTISSGIKRRTLFAAGLGLLGAPVILREKAEAAATGERNHMDGTL
FT                   LPEINQFKLGSYTFTVVRDGTSIVEKPYETFGTNQDPETVKGLLTANFLPADKFMNGYT
FT                   PALIDTGSDVILVDTGFGAAGRARGAGQLTEGLKAAGYSADDVTLVALTHLHGDHIGGL
FT                   MEDGAAAFKNARYVVGQAEYDFWSDKAREGTPAEGGHKAVLANVVPFAEKTTFIKEGDS
FT                   VAPGVTAVLAAGHSPGHMVFHVESEGKRLVLTGDTANHYILSLLRPDWEVRFDMDKAQA
FT                   AATRRKVFEMIASEKIAFLGYHMPFPAVGFVERQDGGYRFVPKSYQFDI"
FT   sig_peptide     495862..495960
FT                   /locus_tag="Rleg_0476"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.949) with cleavage site probability 0.680 at
FT                   residue 33"
FT   gene            497135..498619
FT                   /locus_tag="Rleg_0477"
FT   CDS_pept        497135..498619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0477"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.205"
FT                   /note="KEGG: ret:RHE_CH00794 inositol-5-monophosphate
FT                   dehydrogenase; TIGRFAM: inosine-5'-monophosphate
FT                   dehydrogenase; PFAM: IMP dehydrogenase/GMP reductase; CBS
FT                   domain containing protein; 2-nitropropane dioxygenase NPD;
FT                   SMART: CBS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54783"
FT                   /db_xref="GOA:C6B2G3"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2G3"
FT                   /inference="protein motif:TFAM:TIGR01302"
FT                   /protein_id="ACS54783.1"
FT                   /translation="MARIIETATGADALTFDDVLLQPGHSEVMPGQTNISTRIARDFEL
FT                   NIPIISSAMDTVTESRLAIAMAQAGGLGVIHRNLTPIEQAEQVRQVKKFESGMVVNPVT
FT                   IGPDETLADALGLMKSYSISGIPVVEKSGRLVGILTNRDVRFATDQEQKIHELMTKDKL
FT                   VTVKENVDQQEAKRLLHSHRIEKLLVVDTEGRCVGLITVKDIEKSQLNPNASKDAQGRL
FT                   RAAAAISVGDDGFERAERLIEAGVDLLVVDTAHGHSQRVLDAVSRVKKLSNSVRIMAGN
FT                   VATYDGTRALIDAGADAVKVGIGPGSICTTRIVAGVGVPQLAAIMSAVQAANDQDVPVI
FT                   ADGGIKFSGDLAKAIAAGASAVMIGSLLAGTDESPGEVYLYQGRSFKAYRGMGSVGAMA
FT                   RGSADRYFQAEVRDTLKLVPEGIEGQVPYKGPVSGVIHQLAGGLKAAMGYVGGKDLKDF
FT                   QERATFVRISGAGLRESHAHDVTITRESPNYPGAGL"
FT   gene            498622..499176
FT                   /locus_tag="Rleg_0478"
FT   CDS_pept        498622..499176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0478"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00795 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54784"
FT                   /db_xref="GOA:C6B2G4"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2G4"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00795"
FT                   /protein_id="ACS54784.1"
FT                   /translation="MKAGSGIPLWIVALLAALCLAVLAWTTFGFVVPFKHETGQAVLDT
FT                   YFAGYDESAVFHMQKLLDENETATRLLRAMYFGPELIFPALLTALLFLAFLKLGPGGAW
FT                   FGRSAHPLVGKAIYLLPFIYGIADYGENISSLIAFGNGASAGLATQLLPWMTRLKFASL
FT                   AICFILIARLAVMRWLSSRPD"
FT   sig_peptide     498622..498696
FT                   /locus_tag="Rleg_0478"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.897 at
FT                   residue 25"
FT   gene            499341..499757
FT                   /locus_tag="Rleg_0479"
FT   CDS_pept        499341..499757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0479"
FT                   /product="protein of unknown function DUF1123"
FT                   /note="PFAM: protein of unknown function DUF1123; KEGG:
FT                   rec:RHECIAT_CH0000883 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54785"
FT                   /db_xref="GOA:C6B2G5"
FT                   /db_xref="InterPro:IPR001129"
FT                   /db_xref="InterPro:IPR023352"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2G5"
FT                   /inference="protein motif:PFAM:PF06561"
FT                   /protein_id="ACS54785.1"
FT                   /translation="MTGYQIFWPLLAHVALVYGLYALLGLRRAKMVRAGSIVKSDYREN
FT                   RGEPAESLVVKNCLANQFELPVLFYACCILLYITEADNLVALGLAWAFVALRYAHAAIH
FT                   VTSNDLRYRSPIFAAGYLVLAAMWIWLAAWMLMS"
FT   gene            500049..503138
FT                   /locus_tag="Rleg_0480"
FT   CDS_pept        500049..503138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0480"
FT                   /product="outer membrane autotransporter barrel domain
FT                   protein"
FT                   /note="TIGRFAM: outer membrane autotransporter barrel
FT                   domain protein; autotransporter-associated beta strand
FT                   repeat protein; PFAM: Autotransporter beta- domain protein;
FT                   KEGG: bpa:BPP0822 autotransporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54786"
FT                   /db_xref="GOA:C6B2G6"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR013425"
FT                   /db_xref="InterPro:IPR030895"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2G6"
FT                   /inference="protein motif:TFAM:TIGR01414"
FT                   /protein_id="ACS54786.1"
FT                   /translation="MGERISGAAIQGMVMLRLTGLASTAALVLAVGPGWAQVITGNDTE
FT                   IVDGNDPGGTGAGTQPSPWTINTNLIVGDQNGDDAALVIRNGGIVSNDIGVLGVDPGAA
FT                   GTVTVTGTGSAWTNSDDLYVGHRGVGVLNIEDGGVVDNIFGRIGYFSGASGTVTVTGTG
FT                   STWTNAQDLYIGDSGTGTLTISNGGTVSSTAGLISNDTTAIGEVIVTGTNSIWSNSSYI
FT                   SVGEAGAGTLTISNGGSVTASEGYVGYSSNGNGVVSVTDTGSSWINSGALFVGEFGSGS
FT                   MSVENGGTVSASEVIIADDSGATGTVRIAGSAANGRGVLETGYIERGGGDADLVFDGGI
FT                   LSATGNEANFLRGFNAGEVTIDAGGAFIDTNGFAVGIATDLQGAGGLTKKGSGTLTLSG
FT                   TSSFTGVTTVEAGTLQAGSAGAFVQNGAYAVNGGIFDLGGFDLTMAQLSGSGGEIVIGS
FT                   AELTLDQANNTTYGGILSGSGDFTMLGSGTLRLTGNSSGFAGTTTVSDGRLIVNGSLGG
FT                   ILMMTGGTLAGSGHIGTVTAGAGVTIAPGNSIGTLTIGGNLTLDPSSTYEVEVDPAGTA
FT                   SDLISVTGTAFLNGASVTHVGMNGDYQPFSTYTILTAAGGINGTFGAVTSDYAFLAAEL
FT                   SYDLNNVYLEIERNNVRFSDMARTRNQMAAAEAAENLGTGNDIYDAIVTLPDDEPLIQA
FT                   SYDALSGEIHGSIKTALITQSLVVRQAANERLRSAFSDASAGVIPIQAFWPGGPELIAA
FT                   NPSDAPVFWSTAFGGASETRTDGNAATLNHQTGGLLAGVDAMFDDVRLGLMAGYSNSQF
FT                   DPRHRSSSGSSDDYHLGLYAGTQWGGLAFRTGLAHTWHEIETNRSVAIGSFEDRLEASY
FT                   NAGTLQAFAELGYRFDTAAATFEPFVNLAHIGIRTAGFTEGGGAAALDSSSRMTNTTIT
FT                   TLGLHAEMEVRLGETNATLRGMSGWRHAAGDIVPVSTHAFAGGDAFTVAGVPVAENAFV
FT                   LDAGLDFDLTESAILGIAYSGQIADNAQQHGAKATLSVKF"
FT   sig_peptide     500049..500159
FT                   /locus_tag="Rleg_0480"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.821) with cleavage site probability 0.752 at
FT                   residue 37"
FT   gene            503275..503994
FT                   /locus_tag="Rleg_0481"
FT   CDS_pept        503275..503994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0481"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG:
FT                   rec:RHECIAT_CH0000884 probable transcriptional regulator
FT                   protein, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54787"
FT                   /db_xref="GOA:C6B2G7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041674"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2G7"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACS54787.1"
FT                   /translation="MRVFPFTADEDLHVMPSAANKKNGNDMGAESMDRIGLRRKPKQER
FT                   SIQRLDLILAAAAKIIAEKGVSAMRMTELAAAAKVPIGSVYQYFPEKAAIVKALFDQHA
FT                   SAIQTKMAAMFADVRSLDQALDVVCATIDWYYDSYHDDPVYLGVWMGTETDQDLLQLNI
FT                   EHSGHVAGIFRDAVRQLAPDLCDEEMYARTYLFSHLIGAVIRLAAVSEEALARRMLDEW
FT                   KRVIRASLFTVTVPAAA"
FT   gene            complement(504001..504969)
FT                   /locus_tag="Rleg_0482"
FT   CDS_pept        complement(504001..504969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0482"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: ret:RHE_CH00800 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54788"
FT                   /db_xref="GOA:C6B2G8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2G8"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACS54788.1"
FT                   /translation="MGDNMSAPLDLDQLQTFIAIVDSGSFTKAADRVYKTQSAVSMQMR
FT                   RLEERIGKQLFIKDGRGNRLTVEGEKLLNYARRIIRLNNEAIAAFDDNRLEGTLRIGTP
FT                   DDYADRYMPEIIGRFAKTHPNVELYIVCEPSVDLAERMHKGELDIALVTHNPRERMSDV
FT                   VRTEPLCWVGSANHPIRDDAPVPLAVGRRDCQWRQLACSALDAVGREHQILFTSWSCTV
FT                   VAAAVLAGMAVSVMPESALRTGMKVLSQADGFPALPPVQIGIMKRPGVSLSLMNAITAH
FT                   ITACLDNITPTVVDDSLEADVKSAQARLYPRLKAANMVPSW"
FT   gene            505173..505472
FT                   /locus_tag="Rleg_0483"
FT   CDS_pept        505173..505472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0483"
FT                   /product="protein of unknown function DUF1127"
FT                   /note="PFAM: protein of unknown function DUF1127; KEGG:
FT                   ret:RHE_CH00801 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54789"
FT                   /db_xref="InterPro:IPR009506"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2G9"
FT                   /inference="protein motif:PFAM:PF06568"
FT                   /protein_id="ACS54789.1"
FT                   /translation="MRMTDRTIELDCGKLTPTFPQRLAAGLAPLTSLFRGFRNRMEINT
FT                   LHDLSDAQLRDIGLNRADLTSAFLASTFFEDPSEHLTRSARNRWRLSLFRSYEQ"
FT   gene            complement(505632..506498)
FT                   /locus_tag="Rleg_0484"
FT   CDS_pept        complement(505632..506498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0484"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000887 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54790"
FT                   /db_xref="InterPro:IPR009282"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2H0"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000887"
FT                   /protein_id="ACS54790.1"
FT                   /translation="MLPLFDMMMQAQNGAAMEAIARQFNLAQEQATKAMAALMPAFSAG
FT                   LKRSTSNPYDFVGLMQAVSSGNYARYFEDMNRAFTPEGISDGNNILAQLFGSKEVSRAV
FT                   AAQAAQMTGIGQDIYKRMLPVLADTLMGGLFKQTTGQMASPVNPFVNTAMGETMQKWLE
FT                   STGFAPKPKTTPDPSIFDNPFTQAMQLMFSVPKPEATSQPNPFLDNPFAKAFQEMMGGL
FT                   GQQPAAQTKTKTPEAPKEEAKLNADSYTEMLNAMFDSGLEVQKNYQRNLEAIFETYRPK
FT                   PSSDKSE"
FT   gene            complement(506844..508217)
FT                   /locus_tag="Rleg_0485"
FT   CDS_pept        complement(506844..508217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0485"
FT                   /product="glutamate/cysteine ligase"
FT                   /EC_number="6.3.2.2"
FT                   /note="KEGG: ret:RHE_CH00803 glutamate-cysteine ligase
FT                   protein; TIGRFAM: glutamate/cysteine ligase; PFAM:
FT                   glutamate--cysteine ligase GCS2"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54791"
FT                   /db_xref="GOA:C6B2H1"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011556"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR035434"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2H1"
FT                   /inference="protein motif:TFAM:TIGR01436"
FT                   /protein_id="ACS54791.1"
FT                   /translation="MARDTTDQTPLSSVQDLTDYIAAGNKPREHFRIGTEHEKFAFFRA
FT                   DNSPVPYFGDASISALLTGLQKKSGWEPITDGGNIIGLAEQHGMGAISIEPGGQFELSG
FT                   APLETIHETCKESNQHLATLREIAEPMGIRFLGIGGSPKWTYAETPQMPKSRYEIMTRY
FT                   MPKVGTQGLDMMYRTCTIQVNLDFSSEADMRKKMRVSMKLQSLATALFASSPFTEGKPN
FT                   GLLSWRGDIWRDVDNRRAGLLDFSFRDDFGFRDYAEWALDAPMYFIVREGRYHDCTHVT
FT                   FRQFMNGALKGEVADPAPTMGDWTNHLSTLFPDVRLKRFLEMRGADGGPWRRICALPAF
FT                   WVGLLYDDAALDAADELTKDWTFAEISALRNAVPAEGLKAQFRGHPLFDMAREVVGISR
FT                   AGLKARGKLNREGQDETIFLAPLDEVLAKKATLAEDLLSLYHGRWHGSVEPVFEDYQY"
FT   gene            complement(508365..509102)
FT                   /locus_tag="Rleg_0486"
FT   CDS_pept        complement(508365..509102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0486"
FT                   /product="protein of unknown function DUF558"
FT                   /note="PFAM: protein of unknown function DUF558; KEGG:
FT                   rec:RHECIAT_CH0000889 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54792"
FT                   /db_xref="GOA:C6B2H2"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2H2"
FT                   /inference="protein motif:PFAM:PF04452"
FT                   /protein_id="ACS54792.1"
FT                   /translation="MRANFRMQRLFVDAPLTRGAGVEANADQFNYLANVLRMEDGGEIL
FT                   LFNGRDGEWKATLTFPTRKRILLTATEETRPQPQPCDLHYLFAPLKVGRMDYLVQKAVE
FT                   MGAGLLQPVMTQHVQGKVTNLDKLRANVIEAAEQCGILGIPDVAEPVRLLDLLDRWPSE
FT                   RRIIYCDEGDAGQNPLPVLSAIRERHLALLVGPEGGFSEEERARLRSLDFVTAIPLGPR
FT                   ILRADTAAVAALAVVQAAIGDWN"
FT   gene            complement(509201..510700)
FT                   /locus_tag="Rleg_0487"
FT   CDS_pept        complement(509201..510700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0487"
FT                   /product="phosphate transporter"
FT                   /note="PFAM: phosphate transporter; KEGG: ret:RHE_CH00805
FT                   phosphate ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54793"
FT                   /db_xref="GOA:C6B2H3"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2H3"
FT                   /inference="protein motif:PFAM:PF01384"
FT                   /protein_id="ACS54793.1"
FT                   /translation="MPPRPAVLTKRTLDKDLDKITHAEDVAKHVLRRLVAPGLGLIFVG
FT                   LAMLFAGVYVFDRPGAMLVIAAAALAGYMAMNIGANDVTNNVGAAVGARAMTMGQALVI
FT                   AAIFEVLGATIAGGEVVKTISSNIVDAVQVPPALLGWIMMAALMAAALWINLATWMNAP
FT                   VSTTHAIVGAVIGAGISAVGPEPVNWQVMLEITSSWITSPLIGGLIAAGLLYLVKTLII
FT                   YRDDKVAAAQRWVPVLVAVMAGGFMAYMVLQLSPPGRFPPLTVLLIGIGIGLVSWLAAR
FT                   PLVLAQARELENRNSSLRTLFRLPLIGSAALLSFAHGANDVSNAVGPLSAIVHSVGIGG
FT                   GGGIGHPPLWVMLIGALGISVGLLLFGPRLIRLVGEEITKLNPMRAYCVALSTAFTVIV
FT                   ASWLGLPVSTTHIAVGAVFGVGFFREWYTRHSKRRIAYIRRKAESFDIDEPEEPNIHET
FT                   RRRYLVRRSHFMTIVAAWIVTVPVSAALAAMIYWVMFALFV"
FT   gene            complement(510763..511293)
FT                   /locus_tag="Rleg_0488"
FT   CDS_pept        complement(510763..511293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0488"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: rec:RHECIAT_CH0000891
FT                   putative NTP pyrophosphohydrolase protein, MuT/NUDIX
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54794"
FT                   /db_xref="GOA:C6B2H4"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2H4"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ACS54794.1"
FT                   /translation="MTLFARLASDVQLMFRRPPRQQYGALCYRVKKKSGEVEVLLMTSR
FT                   DTGRWVIPKGWPMTRKCAHEVAMQEAFEEAGVRGAVETETLGAYTYSKALRDGVQVICK
FT                   VQVYALEVTDMAKNFKEKGERRIEWVSFDEAAARVREPELRHLFLAFKQKMTDRLSAKA
FT                   AKQIPDVKQIPAE"
FT   gene            511527..512435
FT                   /locus_tag="Rleg_0489"
FT   CDS_pept        511527..512435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0489"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54795"
FT                   /db_xref="GOA:C6B2H5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2H5"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACS54795.1"
FT                   /translation="MIHHDFVNVVPMRLPPLNAIRAFEAVCRHGSILKAAEELNVVRAA
FT                   VRQQIDTLENHFGSKLFLRDGRRLVPTLQASAFAAAASAAFDILQRAASELEGAVPRRI
FT                   RLGVPSAFAVWWLMPRAADMQASLGDTVDIVPMATVEPLQMHLELDAVIMGGEYRPAAG
FT                   ITALRFMADEFGPVATPSLGATLSSDPAAMGTQTMLISRSVPKLWDEWFAESGTPPVVF
FT                   SRTQEFADLLLALGAARSGLGIALAPRASIEDDLERGHLVAPYGFISRPSGYNFCCRTP
FT                   DVKRPAFAALSGWLLRCGTPA"
FT   gene            512535..513692
FT                   /locus_tag="Rleg_0490"
FT   CDS_pept        512535..513692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0490"
FT                   /product="Adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /note="PFAM: S-adenosyl-L-homocysteine hydrolase, NAD
FT                   binding; KEGG: ahcY; adenosylhomocysteinase protein; K01251
FT                   adenosylhomocysteinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54796"
FT                   /db_xref="GOA:C6B2H6"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2H6"
FT                   /inference="protein motif:PRIAM:3.3.1.1"
FT                   /protein_id="ACS54796.1"
FT                   /translation="MEKSATRIDWIGNSCRLLKATAAEFERTRPFEGLSIGTGIHLEPK
FT                   TVALLTTLRAGGARLVCTGNLNSTQPSTVEFLRTQGISVFATQTTDPAAHHQSLEAVIA
FT                   EKPNLLLDNGGDLFAIAAEKPYANLRGGTEETTSGRIRLLPLRARLNMPILVINDSPIK
FT                   QFAENRHAVGQSLFESYLRFTNRSTNGKRVTVFGYGACGKGTAACFRNAFSTVSVIDID
FT                   PVTTLEAHLDGFTTPLRDAAIRSADIIVTVTGFAGIVTAADLPLVKDGAILMNGGHFPH
FT                   EIDVEAFRRHPDVIGIDRYEADHIETFHLSDGRSFHLLGGGHMANLAGPRPLGNTVESM
FT                   DLGFTLQARCLERIAKGEAGPQSCVVPVPADIDAMVANAYLDLAR"
FT   gene            complement(513711..514706)
FT                   /locus_tag="Rleg_0491"
FT   CDS_pept        complement(513711..514706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0491"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   met:M446_1258 alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54797"
FT                   /db_xref="GOA:C6B2H7"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2H7"
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /protein_id="ACS54797.1"
FT                   /translation="MSVQSTMKALLAEAPNSPLRIADISKPVPGEGQVLVRIKASGVNP
FT                   LDLKIRAGNAAHARHPLPAIVGIDMAGVVEEVGTGVSGFRRGDAVYGMTGGVGGIQGSL
FT                   AEFAAVDAALLAPKPQNLSMREAAALPLISITAWEGLVDRAGVKAGQKVLVIGGGGVGH
FT                   IVAQIAKAAGAEVYVVDGTSKADYLAGLGATPIDRDAETVETYVARHTGGKGFELVYDT
FT                   VGGQGLDTAFRAVSQFGHVVSCLGWGSHALAPLSFKAATYSGVFTLLPLLTGEGRAHHG
FT                   EIMREMTKLAEAGKVMPKLDPRRFTLADTDEAHRLIENRQADGKLVVEID"
FT   gene            514845..515696
FT                   /locus_tag="Rleg_0492"
FT   CDS_pept        514845..515696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0492"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: mms:mma_1919 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54798"
FT                   /db_xref="GOA:C6B2H8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2H8"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACS54798.1"
FT                   /translation="MEWSDLKLFLAIARFGTLGAAARRLGLTQPTMGRRLRALEASLGQ
FT                   TLFQRTTDGFVLTDEGAAVFAGAERIEEEALAMERSLAGGSRQLDGLLRLSSSDWFGAH
FT                   VLSPVLAEFSQVHPKVVVELLTDSRLLSLSRREADLVFRIQPFTEAEIVSRKLIRIEYG
FT                   LYISRGAPHPEAGDGAGARLVTMDEAFGEMPDVGWLRRLLPQADIVTRSNSRDVQAALC
FT                   ANGAGLAVLPRPLGDSLAAIELVDLGEPPPGRDTWVGYHRDMKRLARLRALLDLVIERL
FT                   AR"
FT   gene            complement(515710..516606)
FT                   /locus_tag="Rleg_0493"
FT   CDS_pept        complement(515710..516606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0493"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: ret:RHE_CH00807 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54799"
FT                   /db_xref="GOA:C6B2H9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2H9"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACS54799.1"
FT                   /translation="MTNLGDLEIFAKVVSTGSMSLAGRALGFSPAVVSKRIKRLEDRLG
FT                   TRLLQRTTRQISLTEAGQGFYDRVLGILAGLEEAEFYISGRSAQMHGTLKISAPTSFGR
FT                   MHIAPHLKDFMEAHPELAINLVLTDEFSDIVGGGFDLAIRIAELTDSSLVARRLAPVRR
FT                   LLCASPDYLASHGEPKHIDELKRHRCLPAHNNDTWRLNGPDGALSLRPEGLLVTNSSEV
FT                   IREAVIAGLGIALRSTWDIGEELKAGRLVQVLPAYESSHNVALSAVYPSRQFLPAKVRL
FT                   FIDYLAELYGPVPYWER"
FT   gene            516766..518205
FT                   /locus_tag="Rleg_0494"
FT   CDS_pept        516766..518205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0494"
FT                   /product="D-lactate dehydrogenase (cytochrome)"
FT                   /EC_number="1.1.2.4"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   ret:RHE_CH00808 glycolate oxidase subunit D protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54800"
FT                   /db_xref="GOA:C6B2I0"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2I0"
FT                   /inference="protein motif:PRIAM:1.1.2.4"
FT                   /protein_id="ACS54800.1"
FT                   /translation="MSDAISFLEPRADVLARRAQIVADLTDLLPLECLVHEARELVPFE
FT                   TDAFVSYRRLPLAVALPRTTAEVSAVMRYCNRYGIPVVPRGAGTSLSGGAIPQEDAVVL
FT                   GLSKMNSILEIDLPNRVAVVQAGVTNLNISESVSADGFFYAPDPSSQLACTIGGNIGMN
FT                   SGGAHCLKYGVTTNNLLGVRMVLVDGTVIELGGKALDAAGYDLLGLVCGHEGQLGIVTE
FT                   ATVRLIAKPEGARPVLFGFERSEEAGACVADVIAAGIIPVAIEFMDKPAIEICEAFAHA
FT                   GYPLDVGALLIVEVEGSEAEMDAALKDIVEIARRHAVKTVRECQSATEAALIWKGRKSA
FT                   FGATGRIADYICMDGTVPLSQLSYVLQRTAEIVDHYGLRVANVFHAGDGNMHPLILFNA
FT                   NDPEDAARAEAAGNDILRLCVDAGGCLTGEHGVGIEKRDLMRHQYSEVDLTQQMAARAA
FT                   FDPGWLLNPSKVFPLEGRPAA"
FT   gene            518202..519401
FT                   /locus_tag="Rleg_0495"
FT   CDS_pept        518202..519401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0495"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   rec:RHECIAT_CH0000894 glycolate oxidase protein, subunit E"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54801"
FT                   /db_xref="GOA:C6B2I1"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2I1"
FT                   /inference="protein motif:PFAM:PF02913"
FT                   /protein_id="ACS54801.1"
FT                   /translation="MIDLTPTSEEEAAVIVRAHAESGRPLAICGGNSRSGFGNTVAAEG
FT                   RLRSTGLSGIVAYNPGEMVMTVRSGTSLAEVEAALQESGQMLAFEPMDHRPVMGTSGEP
FT                   TIGGVFAANVSGPRRLIAGAARDSLLGVRFVNGKGEIIKAGGRVMKNVTGLDLAKLVAG
FT                   SHGTLAFLTEVTFRVPPRPKTERTVLLSGLNDAEAANAMAAAMALPVEVSGAAHLPLTV
FT                   TWKFLAGKLPEGEATALRIEGLPGSVDVRIEKLAAAMSGFATVTRLEQPESQKLWQEIR
FT                   DVLPYADGSMRPIWRVSVAPGTGPQLVAALRLEAGVDAFYDWQGGLVWMRMEAGPEAEL
FT                   VRRYIKALGGGHATLIRASGEARATTAAFHPEPEAVTMLSQRVKEKFDPAGIFNPGKMG
FT                   "
FT   gene            complement(519420..519627)
FT                   /pseudo
FT                   /locus_tag="Rleg_0496"
FT   gene            519653..520963
FT                   /locus_tag="Rleg_0497"
FT   CDS_pept        519653..520963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0497"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: protein of unknown function DUF224
FT                   cysteine-rich region domain protein; 4Fe-4S ferredoxin
FT                   iron-sulfur binding domain protein; KEGG: ret:RHE_CH00810
FT                   glycolate oxidase subunit F protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54802"
FT                   /db_xref="GOA:C6B2I2"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012257"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2I2"
FT                   /inference="protein motif:PFAM:PF02754"
FT                   /protein_id="ACS54802.1"
FT                   /translation="MQTNFTPTQLLDPDVAESEQILRKCVHCGFCTATCPTYVTLGNEL
FT                   DSPRGRIYLIKDMLENGRPADTEVVTHIDRCLSCLACVTTCPSGVDYMHLVDHARAHIE
FT                   KTYKRPFMNRLTRAILAAVLPYPGRFRLALNLARLGRPFAGLMRGGALKPFAAMLALAP
FT                   RRIPAASDFAKPGTHRPETERRGRVAILSGCAQPVLDPGINAAAIRLLTRLGVEVVVPE
FT                   SEVCCGSLVHHMGRAEQALESARANVDIWTREIEGQGLDAIIITASGCGTTIKDYGHML
FT                   RLDPAYAAKAARVSALAKDVTEYLATLDLPAHMPKGITVAYHSACSMQHGQRITLAPKQ
FT                   LLKAAGFTVRDPAEGHFCCGSAGIYNIMQPEISAVLKARKVKNLEATKADIIATGNIGC
FT                   ITQIATGTGIPILHTVELLDWAYGGAVPEKLTGLPLG"
FT   gene            521006..521446
FT                   /locus_tag="Rleg_0498"
FT   CDS_pept        521006..521446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0498"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000896 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54803"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2I3"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000896"
FT                   /protein_id="ACS54803.1"
FT                   /translation="MWRGMIVLAGLLGAAGTAHANSRYFCSADDKEARFTLESGFESAA
FT                   GHKLNHFRGALIVKDPAQEAVFGKRVFESQHLTNHWSRNGELLMEVFDGGEDDTGGATL
FT                   DLVVIAGERGKPAANFSGSYSLTIEGGEKPYAVEGKVSCGTK"
FT   sig_peptide     521006..521068
FT                   /locus_tag="Rleg_0498"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 21"
FT   gene            complement(521474..522148)
FT                   /locus_tag="Rleg_0499"
FT   CDS_pept        complement(521474..522148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0499"
FT                   /product="lipid A oxidase (involved in formation of
FT                   2-aminogluconate) protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000897 lipid A oxidase
FT                   (involved in formation of 2-aminogluconate) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54804"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2I4"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000897"
FT                   /protein_id="ACS54804.1"
FT                   /translation="MTSALRSSASLLAGIAFLTICSAVSASAEDLQFSIYGGYQTAPHS
FT                   GVDLSDGTHFTAGWEGKSFGSPPYYGGRVTWWLENFNKPNWGISLDYTHDKVYADDDTL
FT                   AKAGWSHFEFTDGLNLLTVNGLYRFQDPTRRWTPYLGAGIGVNIPHVEVIRPEGKTWAY
FT                   EFGGVTLQAQAGVDFKVTERWSTFVEYKGTYSRVDVPIDSGVDLKTNIFTNAVNVGVSF
FT                   HW"
FT   sig_peptide     complement(522062..522148)
FT                   /locus_tag="Rleg_0499"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.930 at
FT                   residue 29"
FT   gene            complement(522269..522961)
FT                   /locus_tag="Rleg_0500"
FT   CDS_pept        complement(522269..522961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0500"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   ret:RHE_CH00813 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54805"
FT                   /db_xref="GOA:C6B2I5"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2I5"
FT                   /inference="protein motif:PFAM:PF03734"
FT                   /protein_id="ACS54805.1"
FT                   /translation="MIKLMPGLAAAGLVLSLMSTSAFAAPAGSAPDNARAPAQIVRVAQ
FT                   MPKYVKPQFKRKKVRLATTEAAGTVIIDTNNKYLYLVEGNNRATRYGIGVGRDGFGWSG
FT                   VVKIGRKAEWPGWTPPAEMRRREAAKGHMIPAFQEGGEDNPLGARAMYLYQGGRDTIFR
FT                   IHGTNQPWTIGLNMSSGCIRMMNEDVSHLYDRAPVGTKVIVIGPGNRQGKVAFEDRGID
FT                   VLRTMFGG"
FT   sig_peptide     complement(522887..522961)
FT                   /locus_tag="Rleg_0500"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 25"
FT   gene            complement(523202..523951)
FT                   /locus_tag="Rleg_0501"
FT   CDS_pept        complement(523202..523951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0501"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   ret:RHE_CH00814 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54806"
FT                   /db_xref="GOA:C6B2I6"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2I6"
FT                   /inference="protein motif:PFAM:PF03734"
FT                   /protein_id="ACS54806.1"
FT                   /translation="MMKQLVLAAALFGIFSTAAIADDRYATRPPVVLSPDLTAPWINQL
FT                   GGGRVRPVVYQRPVVQPQQRGLFQRRIIRRAPQVSPQTVSAINPGIPSIRRPIEPQYLP
FT                   QVVDYDTTEKPGTIVIDTNNRFLYLVMQGGKARRYGVGVGKPGFEWAGAHKITRKTEWP
FT                   DWTPPSEMISREAAKGHYLPARMDGGAENPLGARAMYLGSTLYRIHGTNAPWSIGSAVS
FT                   SGCIRLRNEDVVDLYDRVNVGTRVIVM"
FT   sig_peptide     complement(523886..523951)
FT                   /locus_tag="Rleg_0501"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 22"
FT   gene            524200..524829
FT                   /locus_tag="Rleg_0502"
FT   CDS_pept        524200..524829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0502"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /EC_number="3.2.2.20"
FT                   /note="PFAM: methyladenine glycosylase; KEGG:
FT                   rec:RHECIAT_CH0000900 DNA-3-methyladenine glycosylase I
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54807"
FT                   /db_xref="GOA:C6B2I7"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2I7"
FT                   /inference="protein motif:PRIAM:3.2.2.20"
FT                   /protein_id="ACS54807.1"
FT                   /translation="MSATGIIIGEDGRSRCHWHANLPDYLRYHDEEWGRPVTDDIRLFE
FT                   KICLEGFQSGLSWLTILRKRENFRAAFSGFDFDKVALFGEEDVARCLGDAGIIRHRGKI
FT                   VSTINNAKRAIELRGEFGSLAHYFWRYEPGHNERPAVVDREHIVANPTTPTSVVISKDL
FT                   KKRGWTFVGPTTVYAFMQAMGLVNDHLEGCFCRPEVEAMRTALVRP"
FT   gene            524826..525332
FT                   /locus_tag="Rleg_0503"
FT   CDS_pept        524826..525332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0503"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000901 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54808"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2I8"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000901"
FT                   /protein_id="ACS54808.1"
FT                   /translation="MKDHAVRTLIAAAALFLLTVSAMAQTPQLDPGEKLEKLQFPAVTM
FT                   QLKGWTKFGNGHVYTLPVRAGQHMKISFSTKSKFAFLAIFDLSKPDDEAFFGTDEDGMS
FT                   FETTIKENATWLLRPYYSKVSPRRGLGAPFSILIEPLAAAPQQPKPPAEPERPSLFPKA
FT                   PPKPQ"
FT   sig_peptide     524826..524900
FT                   /locus_tag="Rleg_0503"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            complement(525352..526056)
FT                   /locus_tag="Rleg_0504"
FT   CDS_pept        complement(525352..526056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0504"
FT                   /product="Haloacid dehalogenase domain protein hydrolase"
FT                   /note="PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: rec:RHECIAT_CH0000902 putative hydrolase
FT                   protein, HAD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54809"
FT                   /db_xref="GOA:C6B2I9"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2I9"
FT                   /inference="protein motif:PFAM:PF00702"
FT                   /protein_id="ACS54809.1"
FT                   /translation="MTTRPLTTIGFDADDTLWQNEQYYRLTEAHFTGLLADFAEGPKIS
FT                   ERLLEAEKRNLRHYGFGIKGFTLSMIETAIEITEGKIPAGVIAKILDTGRELLSHPVET
FT                   MPHVRDTLEALAGKYLLVMITKGDLFDQERKLAQSGLGDFFDAVEIVSDKTAVTYRRIF
FT                   AKVGDGPERAMMVGNSLKSDIVPAIAAGSYGVFVPHELTWVLEHVDEPKEAPRFRKIDH
FT                   LGELRDLIDRLG"
FT   gene            526294..527343
FT                   /locus_tag="Rleg_0505"
FT   CDS_pept        526294..527343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0505"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: ret:RHE_CH00818
FT                   oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54810"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2J0"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ACS54810.1"
FT                   /translation="MRYNQLGNTGLFVSEICLGTMTFGEAKQGTAWGAIADVDQNAADR
FT                   IVERSLASGVNFIDTADVYSTGESERLLGQALKNLDIQRKDVVIATKVYGVMGDKPNDR
FT                   GASRGHIMDSVEASLKRLQTDHIDLYQIHATDTVTPIEETLRAFDDLVSRGLVRYIGVS
FT                   NWQAWRISKALGLSERRGFARFETVQAYYSIAGRDLERDIVPMMQEEKLGLMVWSPLAG
FT                   GLLSGKYGPGAPGNGEGRRASFDFPPVDKDKAWACVAVMREVAEKHGVSVATVALAYIL
FT                   AKPFVTTVIIGAKRVDQLDQNLAAVKLKLDEGDIKKLDEVSALAPEYPGWMLARQGAGR
FT                   RPADFEPKD"
FT   gene            complement(527408..527767)
FT                   /locus_tag="Rleg_0506"
FT   CDS_pept        complement(527408..527767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0506"
FT                   /product="protein of unknown function DUF305"
FT                   /note="PFAM: protein of unknown function DUF305; KEGG:
FT                   rec:RHECIAT_CH0000904 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54811"
FT                   /db_xref="InterPro:IPR005183"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2J1"
FT                   /inference="protein motif:PFAM:PF03713"
FT                   /protein_id="ACS54811.1"
FT                   /translation="MSLKIITLTAMLAIIAAPVLAKDKPMDMSKPMGNHDAASHAFSEA
FT                   NAKMHKDMMIDYSGDADADFVRGMIPHHQGAIDMARIELQYGKDPDIRKLAEAVIRAQE
FT                   AEIAEMNAWLKAHGK"
FT   sig_peptide     complement(527702..527767)
FT                   /locus_tag="Rleg_0506"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            complement(527843..528208)
FT                   /locus_tag="Rleg_0507"
FT   CDS_pept        complement(527843..528208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0507"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000905 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54812"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2J2"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000905"
FT                   /protein_id="ACS54812.1"
FT                   /translation="MRMLALITMFLGWLVYSAMSAWAGCPTCASMNAPVVVENGMHHQM
FT                   AGMDRHEAADTADPLKDPCATGNSAHMPLCVACLLLPATVTVMDGGKSIFGYPAPALAR
FT                   ALDDDKPTPQPPPPRLS"
FT   sig_peptide     complement(528137..528208)
FT                   /locus_tag="Rleg_0507"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.948 at
FT                   residue 24"
FT   gene            complement(528266..529021)
FT                   /locus_tag="Rleg_0508"
FT   CDS_pept        complement(528266..529021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0508"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000906 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54813"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2J3"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000906"
FT                   /protein_id="ACS54813.1"
FT                   /translation="MITEALLYAATLPLTGKPHRKFIRYSVNLWSRAGRCAADWAEHEE
FT                   MSRKAILAATADLRQKRTAVVLGSGLLRDVPIEVLARDFDTVVLVDLVHLASVRLWLSA
FT                   KFHRNVQLIERDLSGYDDLAAGREPEPLGFLRAVPYLDLVVSANLLSQIGRGVKRRHGA
FT                   EAGRMPEDTVERLIAAHLTGLSGLPCRNCLVTDIAYAVIDRNGKTHEEADLLHGVLPPP
FT                   AKAAWTWPVAPLGEESKDYRIEHNVMAAW"
FT   gene            529158..530678
FT                   /locus_tag="Rleg_0509"
FT   CDS_pept        529158..530678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0509"
FT                   /product="histidyl-tRNA synthetase"
FT                   /EC_number="6.1.1.21"
FT                   /note="KEGG: rec:RHECIAT_CH0000907 histidyl-tRNA synthetase
FT                   protein; TIGRFAM: histidyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (G H P and S); Anticodon-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54814"
FT                   /db_xref="GOA:C6B2J4"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR033656"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2J4"
FT                   /inference="protein motif:TFAM:TIGR00442"
FT                   /protein_id="ACS54814.1"
FT                   /translation="MNDKQKKPQKLKARLPRGFVDRTAGDIRAVNEMTAKIREVYEHYG
FT                   FDPLETPLFEYTDALGKFLPDSDRPNEGVFSLQDDDEQWMSLRYDLTAPLARHVAENFN
FT                   EIQLPYRTYRAGYVFRNEKPGPGRFRQFMQFDADTVGAPGVQADAEMCMMMADTLEALG
FT                   IKRGDYLIRVNNRKVLDGVLEAIGLGGDDKAGQRLNVLRAIDKLDKFGPEGVALLLGPG
FT                   RKDESGDFTKGAGLDKEQIDKVLFFVGITDYAESVARLAELVAGTARGGEGVDELNFIG
FT                   ALVTSAGYGPDRIKIDPSVVRGLEYYTGPVYEAELTFDVTNEKGEKVVFGSVGGGGRYD
FT                   GLVSRFMGQPVPATGFSIGVSRLMTALKNLGKLGASEVIEPVLVTVMDGDVEAMGRYQK
FT                   MTQELRAAGIRAEMFQGNWKKFGNQLKYADRRGCPVAIIQGGDERATSVVQIKDLIEGK
FT                   RLSGEIEDNASWREARVAQETVPEADLVAKVREILAAQAEDRKRAANV"
FT   gene            530721..531842
FT                   /locus_tag="Rleg_0510"
FT   CDS_pept        530721..531842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0510"
FT                   /product="tRNA synthetase class II (G H P and S)"
FT                   /note="PFAM: tRNA synthetase class II (G H P and S); KEGG:
FT                   ret:RHE_CH00822 ATP phosphoribosyltransferase regulatory
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54815"
FT                   /db_xref="GOA:C6B2J5"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR004517"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2J5"
FT                   /inference="protein motif:PFAM:PF00587"
FT                   /protein_id="ACS54815.1"
FT                   /translation="MPLINLPEFANDLIAEFDARNAERIDTPVIQPAEPFLDIAGEDLR
FT                   RRIFMTESETGASLCLRPEFTIPVCLRHIETATGTPKRYAYLGEVFRQRRDGANEFYQA
FT                   GIEDLGDIDLSNADARAIGDATGILARLLPGRRLAVTLGDQAVFEAVVQALGLPLGWQK
FT                   RLIHAFGNMTQLEALLASLVSPQFVTGLDDDIARLVASDDEQALVAYLEREMQKTGYST
FT                   NAGRSALEIARRLKEKLILSETRLDDAAFRVLEEFLSLDVPLINASAALSGFADAAGLK
FT                   LGNALARFNGRVAALSNAGVDLSCLDYRAAFGRPLDYYTGLVFEVTVEGSTAVLAGGGR
FT                   FDRLLTFLGATDRIPAVGFSFWLDRIETERAAA"
FT   gene            531839..532534
FT                   /locus_tag="Rleg_0511"
FT   CDS_pept        531839..532534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0511"
FT                   /product="ATP phosphoribosyltransferase"
FT                   /EC_number="2.4.2.17"
FT                   /note="KEGG: ret:RHE_CH00823 ATP phosphoribosyltransferase
FT                   catalytic subunit; TIGRFAM: ATP phosphoribosyltransferase;
FT                   PFAM: ATP phosphoribosyltransferase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54816"
FT                   /db_xref="GOA:C6B2J6"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2J6"
FT                   /inference="protein motif:TFAM:TIGR00070"
FT                   /protein_id="ACS54816.1"
FT                   /translation="MTITIALPSKGRMKEDASAIFERAGMTISAVGNDRSYRGRVEGWD
FT                   DVEIAFLSASEISREIGNGTVDFGVTGEDLMREGFAEVDKRVEFCARLGFGHADVVVAV
FT                   PEIWLDVDTMADLVDVAADFRARHSRRLAIATKYWRLTQQFFSSQHGIQLYRIVESLGA
FT                   TEGAPASGSADIIVDITSTGSTLRANHLKVLQDGVILHSQACLVRARKESHAGEPAVQA
FT                   IIDAVRAAL"
FT   gene            complement(532614..533030)
FT                   /locus_tag="Rleg_0512"
FT   CDS_pept        complement(532614..533030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0512"
FT                   /product="DoxX family protein"
FT                   /note="PFAM: DoxX family protein; KEGG: ret:RHE_CH00824
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54817"
FT                   /db_xref="GOA:C6B2J7"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2J7"
FT                   /inference="protein motif:PFAM:PF07681"
FT                   /protein_id="ACS54817.1"
FT                   /translation="MSNNVIILIARILLSFMFILSGFMKLTDPAGTAGMIAGAGLPAAT
FT                   LLAYVAGLFELLAGLAVLTGLQVRIAGWLLAAFCVFTGIAFHLPYASGTELVNILNQIM
FT                   VMKNITLAGAYILLATVGAGAYSLDARRGAYATA"
FT   gene            533345..534055
FT                   /locus_tag="Rleg_0513"
FT   CDS_pept        533345..534055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0513"
FT                   /product="Glutathione S-transferase domain protein"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   ret:RHE_CH00825 glutathione S-transferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54818"
FT                   /db_xref="GOA:C6B2J8"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2J8"
FT                   /inference="protein motif:PFAM:PF00043"
FT                   /protein_id="ACS54818.1"
FT                   /translation="MADLSAFPITTRWPAKNPDIIQLYSLQTPNGVKVSVALEELGLAY
FT                   EPHYISFAANDQKSPEFESLNPNGRIPAIIDPNGPDGKPIGLFESGAILLYLAEKTGKL
FT                   IPADAAGRYETIQWVFFQMAGIGPMFGQFGHFHKFAADKVANNSYPVERYRDESKRLLG
FT                   VLDDRLKGRQWIMGDQYTIADITTFTWVRGADIFYGGREVLEYAKFPAVSDWLERCIAR
FT                   PASARGLNIPVKPE"
FT   gene            complement(534119..534565)
FT                   /locus_tag="Rleg_0514"
FT   CDS_pept        complement(534119..534565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0514"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000912 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54819"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2J9"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000912"
FT                   /protein_id="ACS54819.1"
FT                   /translation="MFKIARANAAVPLTPGSFDDANQNHEMLAQFSVSEAWTGDFSSGM
FT                   LRLGEWSAMLHGLAARECGLLSLIRCYDAKDRSHILELFEQAATLCSSFCFSTTIIMPN
FT                   GLRQPLFCMGESNGLEQKYSGSMVGVFVFPRFKLEGTKQITSRR"
FT   gene            complement(535298..536941)
FT                   /locus_tag="Rleg_0515"
FT   CDS_pept        complement(535298..536941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0515"
FT                   /product="chaperonin GroEL"
FT                   /note="TIGRFAM: chaperonin GroEL; PFAM: chaperonin
FT                   Cpn60/TCP-1; KEGG: ret:RHE_CH00828 chaperonin GroEL"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54820"
FT                   /db_xref="GOA:C6B2K0"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2K0"
FT                   /inference="protein motif:TFAM:TIGR02348"
FT                   /protein_id="ACS54820.1"
FT                   /translation="MASKEIKFGRTAREKMLRGVDILADAVKVTLGPKGRNVIIDKSFG
FT                   APRITKDGVSVAKEIELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGN
FT                   KAVAAGMNPMDLKRGIDLAVADVVKDLQAKAKKISTSEEVAQVGTISANGDKQVGLDIA
FT                   EAMQKVGNEGVITVEEAKTAETELEVVEGMQFDRGYLSPYFVTNPEKMIADLEDVFILL
FT                   HEKKLSNLQSMLPVLEAVVQTGKPLLIVAEDVEGEALATLVVNKLRGGLKIAAVKAPGF
FT                   GDRRKAMLEDIAILTGGTVISEDLGIKLESVTLDMLGRAKKVSISKENTTIVDGSGAKT
FT                   DIEGRVAQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRIDDA
FT                   LNATRAAVQEGIVPGGGIALLRSSTKITVKGANDDQEAGINIVRRALQSLVRQIAENAG
FT                   DEASIVVGKVLDKNEDNYGYNAQTSEYGDMIAMGIVDPLKVVRTALQNAASVASLLITT
FT                   EAMIAELPKKESAGGGMPGGMGGMGGMDMM"
FT   gene            complement(537014..537310)
FT                   /locus_tag="Rleg_0516"
FT   CDS_pept        complement(537014..537310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0516"
FT                   /product="chaperonin Cpn10"
FT                   /note="PFAM: chaperonin Cpn10; KEGG: smd:Smed_6083
FT                   co-chaperonin GroES"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54821"
FT                   /db_xref="GOA:C6B2K1"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2K1"
FT                   /inference="protein motif:PFAM:PF00166"
FT                   /protein_id="ACS54821.1"
FT                   /translation="MASTNFRPLHDRVVVRRVESEAKTKGGIIIPDTAKEKPQEGEIVA
FT                   VGSGARDESGKVVALDVKAGDRILFGKWSGTEVKIDGEDLLIMKEADIMGIIG"
FT   gene            537705..538553
FT                   /locus_tag="Rleg_0517"
FT   CDS_pept        537705..538553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0517"
FT                   /product="HAD-superfamily hydrolase, subfamily IIA"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IIA;
FT                   HAD-superfamily subfamily IIA hydrolase like protein; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; KEGG:
FT                   ret:RHE_CH00830 putative hydrolase, haloacid
FT                   dehalogenase-like family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54822"
FT                   /db_xref="GOA:C6B2K2"
FT                   /db_xref="InterPro:IPR006356"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2K2"
FT                   /inference="protein motif:TFAM:TIGR01460"
FT                   /protein_id="ACS54822.1"
FT                   /translation="MAKRIENFSEISGRYDVVLCDVWGVVHNGVDPFPKAAAALEAARE
FT                   NGLAVVLITNSPRLSWQVVDQLRQIGVPDSAYDRIVTSGDVTRGLIAEGPKTVFLLGPE
FT                   RDKALLEGIGVERRPAGEAQSLVCTGFFDDETEKPEDYTDMLLDFKARDVPMICANPDL
FT                   IVERGHRIIPCAGAMAAYYEQLGGKTRIAGKPHRPIYEATLAAARELRGDFPVDRVLAI
FT                   GDGMPTDVRGALNYGLDLLYISGGIHAKEYTLNGETDEAILNAYLERENAAPKWWMPRL
FT                   A"
FT   gene            538585..539568
FT                   /locus_tag="Rleg_0518"
FT   CDS_pept        538585..539568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0518"
FT                   /product="riboflavin biosynthesis protein RibF"
FT                   /note="TIGRFAM: riboflavin biosynthesis protein RibF; PFAM:
FT                   FAD synthetase; Riboflavin kinase; KEGG:
FT                   rec:RHECIAT_CH0000917 riboflavin kinase/FMN
FT                   adenylyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54823"
FT                   /db_xref="GOA:C6B2K3"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2K3"
FT                   /inference="protein motif:TFAM:TIGR00083"
FT                   /protein_id="ACS54823.1"
FT                   /translation="MTVFHRNETREPLPAHLKGGVIAIGNFDGVHRGHQSVLSRALEIS
FT                   KARGIPALVLTFEPHPRTVFRPQTPVFRLTPAPLKARILETLGFSAVIEYPFDYEFSQR
FT                   SADDFIHSILKDWLGASEVVTGFDFHFGRGREGGPAFLMNAGHTYGFGVTLIDAFRDEN
FT                   ADVVSSSHIRALLKEGNVSEVAGMLGYRYTVEAEVIDGEKLGRQLGFPTANMRLPPEVD
FT                   LAAGIYAVRFRRQDGTLHDAVASYGRRPTVTENGAPLLETYLFDFSGDLYGQLCSVSFF
FT                   GYLRPELKFDGLDPLVAQIKRDEEEARALLAGVKPLGALDRKLCFS"
FT   gene            539856..542747
FT                   /locus_tag="Rleg_0519"
FT   CDS_pept        539856..542747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0519"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /note="TIGRFAM: isoleucyl-tRNA synthetase; KEGG:
FT                   rec:RHECIAT_CH0000920 isoleucyl-tRNA synthetase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54824"
FT                   /db_xref="GOA:C6B2K4"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2K4"
FT                   /inference="protein motif:TFAM:TIGR00392"
FT                   /protein_id="ACS54824.1"
FT                   /translation="MTDTAEKIDYSKTLYLPETDFPMRAGLPQKEPELVKRWQEMGLYK
FT                   KLRASAAGREKFVLHDGPPYANGNIHIGHALNKILKDVINRSFQMRGYDANYVPGWDCH
FT                   GLPIEWKIEEKYREKGKNKDEVPVNEFRRECREFAAGWIKVQAEEFKRLGIEGDFDNPY
FT                   TTMNFHAESRIAGELLKIAASGQLYRGSKPIMWSVVERTALAEAEVEYQDYESDTIWVK
FT                   FPVVEGPVALKDAFVVIWTTTPWTIPGNRAVSFSPRISYGLYEVTAAENDFGPRPGEKL
FT                   IFADKLAEESFAKAKLQYKRLSDVSAADFAAMTCAHPFKGLGGGYEFRVPLLDGDHVTD
FT                   DAGTGFVHTAPSHGREDFDAWMSAVRALEARGIDTKIPFPVDDGGFYTSDAPGFEGARV
FT                   IDDNGKKGDANDRVIRELIARGALFARGRLKHQYPHSWRSKKPVIFRNTPQWFVYMDKT
FT                   LADGTTLRSRALGAIDDTRFVPAAGQNRLRAMIEGRPDWVLSRQRAWGVPIAVFADDDG
FT                   DVLVDEAVNARILEAFEHEGADAWFAEGAKERFLGNDHDHSRWTQVMDILDVWFDSGST
FT                   HTFTLEDRPDLKWPADLYLEGSDQHRGWFHSSLLESAATRGRAPYNAVLTHGFTMDEKG
FT                   EKMSKSKGNVTAPQEVMKDAGADILRLWVMTSDYADDLRVGKTIIQTNVDAYRKLRNTI
FT                   RWMLGTLAHDKGEEIALADLPELEQLMLHRLAELDELVRENYDAFDFKKIARALIDFAN
FT                   VELSAFYFDVRKDALYCDAPSSLRRRASLHVIRQIFDCMVTWLAPMLPFTTEEAWLSRN
FT                   PSAVSVHLEQFAPVAKEWRNDALAEKWKKIRTVRSVVTGALEIERKDKRIGSSLEAAPV
FT                   VHIADPELLKALEGQDFTEVCITSAIEIKVGEGPGDAFRLAEVPQVSVVPKLAEGEKCA
FT                   RSWRITRDVGSDPEYPDVSARDAAALRELAALT"
FT   gene            542881..543510
FT                   /locus_tag="Rleg_0520"
FT   CDS_pept        542881..543510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0520"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000921 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54825"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2K5"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000921"
FT                   /protein_id="ACS54825.1"
FT                   /translation="MLATHWFRMGACLSVVVAGCSLVSGCASSPTYGTDKTAMEQLTDD
FT                   LGQSVSLTGPDPKNKGVKYTPRPTLVLPAQAQKETLVAPQQTVANKDNPQWLESPEETR
FT                   ARLVSEADANEDNPNYRSPLASSAIEGGRRTTEAQTKAYREARALQKGSYVDQRRYISD
FT                   PPPGYRTVDDPAKLDDVGEPELKKQKKRKKDAAVANTGKQWWNLLQ"
FT   sig_peptide     542881..542982
FT                   /locus_tag="Rleg_0520"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.760 at
FT                   residue 34"
FT   gene            complement(543564..544001)
FT                   /locus_tag="Rleg_0521"
FT   CDS_pept        complement(543564..544001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0521"
FT                   /product="CMP/dCMP deaminase zinc-binding"
FT                   /note="PFAM: CMP/dCMP deaminase zinc-binding; KEGG:
FT                   rec:RHECIAT_CH0000922 cytosine deaminase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54826"
FT                   /db_xref="GOA:C6B2K6"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2K6"
FT                   /inference="protein motif:PFAM:PF00383"
FT                   /protein_id="ACS54826.1"
FT                   /translation="MEMALEEARAAGERGEVPIGAVVVIDDIAVSRSGNRTRELKDVTA
FT                   HAEIAAIRLACEALGQERLAGADLYVTLEPCTMCAAAISFARIRRLYYGAEDPKGGGVD
FT                   NGVRFYGQPTCHHAPEVYSGFNEVQSANLLRRFFSQRREAP"
FT   gene            544092..546188
FT                   /locus_tag="Rleg_0522"
FT   CDS_pept        544092..546188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0522"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="PFAM: RNA-binding S4 domain protein; pseudouridine
FT                   synthase; SMART: RNA-binding S4 domain protein; KEGG:
FT                   rec:RHECIAT_CH0000923 probable RNA-pseudouridine synthase
FT                   protein, ribosomal large subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54827"
FT                   /db_xref="GOA:C6B2K7"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2K7"
FT                   /inference="protein motif:PFAM:PF01479"
FT                   /protein_id="ACS54827.1"
FT                   /translation="MTPKDKPKRPGAKPLSRDIRSKAGPKADGDKPAKPAVARAIAAET
FT                   DSDAKAERISKVMARAGVASRRDIERMIMEGRVTLNGRVLDTPVVNVTLADRIEVDGVP
FT                   IRGIERTRLWLYHKPTGLVTTNADPEGRSTVFDNLPEELPRVMSIGRLDINTEGLLLLT
FT                   NDGGLARALELPATGWLRRYRVRAHGEIDQDALDKLKDGIAVDGVLYGSIEATLDRTQG
FT                   SNVWITMGLREGKNREIKNVLGALGLDVNRLIRISYGPFQLGDLPESHVVEVRGRTLRD
FT                   QLGPRLIEEAKANFDAPIYNTTAVAAEEEAEPAAPEKRERPRRDEDKRERALSRLDTKR
FT                   DDRHGGARKEDDRRDGGRRDDEKPKRPQPLGQRRSANVWMAPGARPLGEKAAAKAAKNA
FT                   QTARRRGEQAPAKNDRIEDRPRTQVNRVREEDGEWIRSSEQPRGKDEGEGFGRKRGFGD
FT                   RPAREDRGSGDRPARGDRPFGDRPPRGDRPFGDKPRGDRKPRADGDERPRAARSPAGEG
FT                   RSERPRGDRPFGDRPSRGDRPFGDKPRGDRKPRADGDERPRAARTSPGEGRSERPRSDR
FT                   PSGDRPSRGDRPFGDKPRGDRRPREDGDERPRAARSFAGEGRSERPRGDKPSGDRPSGD
FT                   RPRGKGFAAKPSGAKPGGAKSFSGKPKGTKPGGDRPGGDRPAGGPSRGGAKGKGMTRGA
FT                   DRRR"
FT   gene            546169..546729
FT                   /locus_tag="Rleg_0523"
FT   CDS_pept        546169..546729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0523"
FT                   /product="methyltransferase"
FT                   /note="TIGRFAM: methyltransferase; PFAM: Protein of unknown
FT                   function methylase putative; KEGG: rec:RHECIAT_CH0000924
FT                   putative methylase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54828"
FT                   /db_xref="GOA:C6B2K8"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2K8"
FT                   /inference="protein motif:TFAM:TIGR00095"
FT                   /protein_id="ACS54828.1"
FT                   /translation="MRIVGGEFRGRPLAVPKSNEIRPTADRTRESLFNILSHAYPECVD
FT                   GTRILDLFAGTGAVGLEAVSRGCRHALFVENSVEGRALLWENIDALGLHGRTRILRRDA
FT                   TDLGSVGNLDPFDVLFADPPYGKGLGEKAMAAAVEGGWLRPGAIAVLEERADIVVSVHP
FT                   SYVFLESRIFGDTRVHFFRYQPQ"
FT   gene            546742..547623
FT                   /locus_tag="Rleg_0524"
FT   CDS_pept        546742..547623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0524"
FT                   /product="Patatin"
FT                   /note="PFAM: Patatin; KEGG: rec:RHECIAT_CH0000925 putative
FT                   hydrolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54829"
FT                   /db_xref="GOA:C6B2K9"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2K9"
FT                   /inference="protein motif:PFAM:PF01734"
FT                   /protein_id="ACS54829.1"
FT                   /translation="MQQAEIISPKLPAISDVPTVAVAFGGGGARGLAHIHVIETLDELG
FT                   IRPVAVSGSSIGAIMAAGMAAGMSGAEIREHALTTVGNKTAVVARIWGLRPATVRDAVA
FT                   KGIRIGQFNLERILKAFLPSELPARFEDLLVPMKVITTDYYGQCEVIIEQGELFPALAA
FT                   SSAIPAVFMPVRLRDRVMIDGGISNPVPYECLMDLADIVVGIDVVGAPEGDGTHIPNRM
FT                   ESIFGSGQLMMQTAISLKLKLRPPHIFLRPTVGRTGVMDFLKAREVLAMSVGVKDDLKF
FT                   ALDREIEARLKR"
FT   gene            complement(547636..548088)
FT                   /locus_tag="Rleg_0525"
FT   CDS_pept        complement(547636..548088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0525"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54830"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2L0"
FT                   /inference="similar to AA sequence:KEGG:Avi_7626"
FT                   /protein_id="ACS54830.1"
FT                   /translation="MKKIIAIVAGVLLASMASADDDPQQAIPARLKVMFERPDKPLDIA
FT                   PVVVQGDWAIVGWRQDGRGGRALMKKTHHGWSIYLCSGDSLKDTATLETIGLSAVDAAG
FT                   LAAKLKNAEAGLDSSALALFSSFEGTMMMNEASNGAGHAGHEGHAQ"
FT   sig_peptide     complement(548029..548088)
FT                   /locus_tag="Rleg_0525"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 20"
FT   gene            complement(548102..549475)
FT                   /locus_tag="Rleg_0526"
FT   CDS_pept        complement(548102..549475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0526"
FT                   /product="Propeptide PepSY amd peptidase M4"
FT                   /note="PFAM: Propeptide PepSY amd peptidase M4;
FT                   PepSY-associated TM helix domain protein; KEGG: cysJ;
FT                   sulfite reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54831"
FT                   /db_xref="GOA:C6B2L1"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2L1"
FT                   /inference="protein motif:PFAM:PF03413"
FT                   /protein_id="ACS54831.1"
FT                   /translation="MSTITAAEPAEHAADGVSLYRAIWRWHFFAGLLVIPFLLNLAVTG
FT                   SLYLFKDEINSTFFGYRYSVQPAGEALSPERIAEIAASAVPGSTATSYKDPVLPERSAI
FT                   VTLSSDAGSMLVFVNPYDGKVLDVVGSTDEFNYVVKRIHSLAYFGTITNRLIEIAGGFA
FT                   MVLVVTGIYLWWPRRQTGGVISVRGTPGRRVFWRDLHAVTGAFAGILIFFLAMSGMPWS
FT                   GYWGANANAWLTEHGLGYPVQLWGDVPKSRKVTEDILPNSGWIVEKAPVPLSDIAAAQS
FT                   ARPIGLEKAVETAKRLGMAPGFDLAIPSDETGVYTASLFPDDLADERTLHIDQYSGKPL
FT                   IDIGFDQYPFLGKAIEWGINVHQGQEWGRFNQLLMLATCLAIVLSCVTAIVMWWKRRPI
FT                   GRLGVPPMPPKPSIYYGLWVIVGIFAVTFPMSGLAIVAMIAFDQIVVRFVPLLKRVLA"
FT   gene            complement(549565..549972)
FT                   /locus_tag="Rleg_0527"
FT   CDS_pept        complement(549565..549972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0527"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54832"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2L2"
FT                   /inference="similar to AA sequence:KEGG:Arad_3792"
FT                   /protein_id="ACS54832.1"
FT                   /translation="MIRRTRQIEQWALRILCAVALVFVGFAHQVPLAAAGEFDPAELAQ
FT                   YVLPDGTLPTLCVTTTDTSGQEQHDKAHSHGCEACRISASILLPAPTDIAGSAIHFAAT
FT                   VELPIRAEAFHRQLFPPNTGPRAPPSDPIPA"
FT   sig_peptide     complement(549865..549972)
FT                   /locus_tag="Rleg_0527"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.393 at
FT                   residue 36"
FT   gene            complement(550064..551878)
FT                   /locus_tag="Rleg_0528"
FT   CDS_pept        complement(550064..551878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0528"
FT                   /product="potassium efflux system protein"
FT                   /note="TIGRFAM: potassium efflux system protein; PFAM:
FT                   sodium/hydrogen exchanger; TrkA-N domain protein; KEGG:
FT                   rec:RHECIAT_CH0000928 glutathione-regulated
FT                   potassium-efflux transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54833"
FT                   /db_xref="GOA:C6B2L3"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2L3"
FT                   /inference="protein motif:TFAM:TIGR00932"
FT                   /protein_id="ACS54833.1"
FT                   /translation="MSASNAFFSETILLLGGAVVAAPIFKKLGLGTVLGYLAAGIVIGP
FT                   VFHGITDGEQILAVAELGVVFLLFIIGLELKPTRLWQMRRDIFGLGAAQVVLTGLALTA
FT                   LAWFSQVLDWRGSIVAGFGLALSSTAFAMQILEGDGDVNTRYGQRSFSMLLFQDLAIVP
FT                   LLALITILDGGDKGSNAPLFDFAIAVGAVAAMIVMGRYLLTPLFQIIARTGAREAMIAA
FT                   ALFVVMGSASLMQLAGLSMAMGAFLSGVMLAESSYRHELEADIEPFRGVLLAIFFIAVG
FT                   LSLELDVLADNALFVIVAVPIVMAVKAIVIYGICRISGSSHDDAIRIAFLLPQGGEFGF
FT                   VLFTTAGAAGLMSTSTASLLVAIVTLSMALTPIGSALSKRLLNGDEQEELDEDFEGAGA
FT                   DVLMVGFSRFGQIAAQILLAGGRSVTVIDFSADRIRQASSFGFRIYFGDGARKDVLRSA
FT                   GIDRAKIVLVCTQKKEITDKVVELVQADYPHTRLYVRSYDRIHSIELRNKGIDYELRET
FT                   LESGLLFGRRTLEALGVSEVDAYEIGEDIRKRDEARLVLQVSEGLQAGRDMLFSHPVRP
FT                   EPLVKPKRAADPFEHDPLAGTADATADA"
FT   gene            551998..553344
FT                   /locus_tag="Rleg_0529"
FT   CDS_pept        551998..553344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0529"
FT                   /product="peptidase U62 modulator of DNA gyrase"
FT                   /note="PFAM: peptidase U62 modulator of DNA gyrase; KEGG:
FT                   rec:RHECIAT_CH0000929 modulator of DNA gyrase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54834"
FT                   /db_xref="GOA:C6B2L4"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2L4"
FT                   /inference="protein motif:PFAM:PF01523"
FT                   /protein_id="ACS54834.1"
FT                   /translation="MSSEIDSSTLLSRASQLIDLARKAGADAADAVVVRSRSQSVSVRL
FT                   GKVEGTESSESDDFSLRVFIGKRVASVSANPGFDLQALAERAVAMAKVSPEDPFACLAD
FT                   EASLSRSYPDLQLLDTTEVSSEMLREAGLAAEAAALAVKGVTNSSGAGASAGMGGLVLA
FT                   TSHGFEGSYMASRFGHSVSVIAGEGTGMERDYDYDSRLYYAELDDPAEIGRRAGERVIK
FT                   RINPRQVPTGKDITVIFDPRVARGFVGHIAGAINGAAVARKSSFLRDKMGQQILKSGLS
FT                   ITDDPLIVRGPSSRPFDGEGVSGERLVMIEDGVLKHWFLSTSTARELDLETNGRGVRGG
FT                   TAVSPSSTNLALEPGDISPEDLIRSVGNGFYVTELIGHGVNMITGEYSRGATGFWIENG
FT                   ELTFPVSEVTIASNLKEMFMRLTLANDIDRKFGVAAPTFAIEGMTLAGR"
FT   gene            553527..554336
FT                   /locus_tag="Rleg_0530"
FT   CDS_pept        553527..554336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0530"
FT                   /product="inositol monophosphatase"
FT                   /note="PFAM: inositol monophosphatase; KEGG:
FT                   ret:RHE_CH00842 inositol monophosphatase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54835"
FT                   /db_xref="GOA:C6B2L5"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2L5"
FT                   /inference="protein motif:PFAM:PF00459"
FT                   /protein_id="ACS54835.1"
FT                   /translation="MSDMEKARWQSDLTLIADAAKEAGAVAFGFFNQSPEVWWKNEDRS
FT                   PVSAADFAANKTLETILRKARPDYGWLSEETDDDADRLSRETLFIIDPIDGTRAFLGGQ
FT                   KVWCVSVAVVHRGRPVAGVLYAPALEEFYEAVEGGVALKNGVPFTVSAAGPEEMSRLAI
FT                   GEDLLKTFPTEFRDRVTREKYIPSLAYRIAMVADGRLDGTFVKGNSHDWDLAAADLILV
FT                   CAGGGLVDIEGRPIVYNRAEVTHNVLCAAPTPRISEFLAAFAGRRDS"
FT   gene            554398..554643
FT                   /locus_tag="Rleg_0531"
FT   CDS_pept        554398..554643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0531"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00843 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54836"
FT                   /db_xref="InterPro:IPR025226"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2L6"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00843"
FT                   /protein_id="ACS54836.1"
FT                   /translation="MTDSGDKKQLLHLVFGGELESLDDVQFRDLQGLDIVGIFPDYATA
FT                   LTAWKSKAQQTVDNAHMRYFIVHMHRLLDPQEKPKG"
FT   gene            554817..556136
FT                   /locus_tag="Rleg_0532"
FT   CDS_pept        554817..556136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0532"
FT                   /product="Three-deoxy-D-manno-octulosonic-acid transferase
FT                   domain protein"
FT                   /note="PFAM: Three-deoxy-D-manno-octulosonic-acid
FT                   transferase domain protein; KEGG: rec:RHECIAT_CH0000932
FT                   3-deoxy-D-manno-octulosonic acid transferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54837"
FT                   /db_xref="GOA:C6B2L7"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2L7"
FT                   /inference="protein motif:PFAM:PF04413"
FT                   /protein_id="ACS54837.1"
FT                   /translation="MSSRMARFGLNAYRLAGTVASPVVGLYITYRTAKGKEDRARRLER
FT                   FGYPSANRPQGPLIWFHAASVGETNAVIPLIREIRRRDIHVILTTGTITSAKLAAERLG
FT                   LEAIHQYVPLDLKPSVSRFLDYWQPDCAIIAESEIWPATVLELGRRRIPQILINARMSD
FT                   RSFARWRRRPAIAEALFENLALVIAQSDVDAERFRDLGAVPVITSGNLKVDTDAPPYDS
FT                   AVFARYKKQIGERKTWAAISTFDGEENAAAIVHRALRERDRQLTIIVPRHPERSDEIEA
FT                   ALVKQGLKVARRTRDDVLSADVDIFLGDTIGEMGLYLRLTEIAFVGRSLFAEGGQNPLE
FT                   PAMLGCAILSGGHVQNFRDAYQKLARSGSARMVRDTEMLAKGVHYLLINDDARRNMIEA
FT                   GITAVHEMRGALTATVKGLEPYINPLTVKARLLPKAVAQV"
FT   gene            556146..556868
FT                   /locus_tag="Rleg_0533"
FT   CDS_pept        556146..556868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0533"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 1; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: ret:RHE_CH00845 phosphoglycolate
FT                   phosphatase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54838"
FT                   /db_xref="GOA:C6B2L8"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2L8"
FT                   /inference="protein motif:TFAM:TIGR01549"
FT                   /protein_id="ACS54838.1"
FT                   /translation="MSAVASIKGILFDKDGTLLDYDESWLPVNRELARIAARGDELLAN
FT                   RLLSACGMDPVTGHIVPDSLLAAGNTRQIASGLVAAGSMVDVDELTVRLDDLFSSAAEF
FT                   SVPVTDLAGFFERLHRRGFKLGVASSDNERSIRQTAERFGFARYIDYIAGYDSGFGVKP
FT                   EPGMVLGFCAATGLLPEEVAMVGDNNHDLHMGLNAGTGLRIAVLTGTGSRETLAAAADH
FT                   VLDDITAIETLLPDLQPA"
FT   gene            557052..558095
FT                   /locus_tag="Rleg_0534"
FT   CDS_pept        557052..558095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0534"
FT                   /product="tetraacyldisaccharide 4'-kinase"
FT                   /EC_number="2.7.1.130"
FT                   /note="KEGG: ret:RHE_CH00846 tetraacyldisaccharide
FT                   4'-kinase; TIGRFAM: tetraacyldisaccharide 4'-kinase; PFAM:
FT                   Tetraacyldisaccharide-1-P 4'-kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54839"
FT                   /db_xref="GOA:C6B2L9"
FT                   /db_xref="InterPro:IPR003758"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2L9"
FT                   /inference="protein motif:TFAM:TIGR00682"
FT                   /protein_id="ACS54839.1"
FT                   /translation="MISEAPPFWWRKADWRAWLLLPLSFLYGRIASHRMAHARRASVPI
FT                   PVICVGNFTVGGAGKTPTALTIARAAKAKGLKPGFLSRGYGGSLDVTTVVDPDHHRAIA
FT                   VGDEPLLLAQEALTVISRRRVEGAARLVAEGADLIIMDDGFQSARLAIDYALLVIDATR
FT                   GLGNGHIVPGGPVRAPIRQQLRSATALLKVGGGNAADRIVRMAARAAKPYFTASLKVRG
FT                   DNTLAGTKVLAFAGIADPAKFFRTVESRGAEIVVAKSFGDHEHLTEEEIDDILTTAERQ
FT                   GLLIVTTSKDFVRLSGHQGKAARLVEKSRVIEVDMVFEDHLAPSLIIDRAIVACRERRL
FT                   REMKAGA"
FT   gene            complement(558179..559084)
FT                   /locus_tag="Rleg_0535"
FT   CDS_pept        complement(558179..559084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0535"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: sil:SPO2668 LysR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54840"
FT                   /db_xref="GOA:C6B2M0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2M0"
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /protein_id="ACS54840.1"
FT                   /translation="MELGWLEDFMELAAVRNFSTAAAARHVTQPAFSRRIRALENWIGA
FT                   ALIDRSSYPVRLTNAGETFLESSRELMREIYRVRDECRQQARAGIEVLTFSALHTIALS
FT                   IFPDLLTSVEQRTGPFITRMHATDFYDCVESLALGRCDIAFCYSHEFGPPVLQTGQFSS
FT                   KVIRIDPFHLVSKADQRGNPVIDLATWPGNEDMPLVAYSSDCFLGKVQTQLMLDMQKTG
FT                   RSFRVTYENSMSESVKRMILAGKGIGWLPESSATREIERNELCIVDARQAEVTLNVLAI
FT                   RKQGSGSAALERFWSNLQGL"
FT   gene            559252..560106
FT                   /locus_tag="Rleg_0536"
FT   CDS_pept        559252..560106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0536"
FT                   /product="aminotransferase class IV"
FT                   /note="PFAM: aminotransferase class IV; KEGG: dsh:Dshi_3150
FT                   aminotransferase class IV"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54841"
FT                   /db_xref="GOA:C6B2M1"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2M1"
FT                   /inference="protein motif:PFAM:PF01063"
FT                   /protein_id="ACS54841.1"
FT                   /translation="MRQVYVNGDYLPETEARISVFDRGFLFADGVYEVTLVLDRKLVDF
FT                   AGHMRRLRHSLGELDMAFALTNEKLLDIHRELIRRNDIEEGLVYLQVTRGAADRDFLFP
FT                   ADATPRTVVVFTQKKSLVDSPLAERGLHVITVEDLRWRRCDIKTVQLLYPSMAKMEAKS
FT                   RGADDAWMVRDGFVTEGSSNNAYMVTLEGTVVTRDLSTDILRGITREAVLQCAQDLQLR
FT                   IEERPFTVEEVENAAEAFSTSSSGLVSPVVRINERVVGKGTPGPMAARLRQLYLERSRA
FT                   SAI"
FT   gene            complement(560208..560318)
FT                   /pseudo
FT                   /locus_tag="Rleg_0537"
FT   gene            complement(560318..560548)
FT                   /locus_tag="Rleg_0538"
FT   CDS_pept        complement(560318..560548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0538"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000936 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54842"
FT                   /db_xref="InterPro:IPR018661"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2M2"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000936"
FT                   /protein_id="ACS54842.1"
FT                   /translation="MNLFEGHGNREAKIRYLDGDFQILSPGSYVVCAMTGKQIPLDELR
FT                   YWSVARQEPYADVISAIDADKRAGVLPNQRR"
FT   gene            complement(560667..562469)
FT                   /locus_tag="Rleg_0539"
FT   CDS_pept        complement(560667..562469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0539"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /note="TIGRFAM: DNA mismatch repair protein MutL; PFAM:
FT                   MutL dimerisation; DNA mismatch repair protein domain
FT                   protein; ATP-binding region ATPase domain protein; KEGG:
FT                   rec:RHECIAT_CH0000937 DNA mismatch repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54843"
FT                   /db_xref="GOA:C6B2M3"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2M3"
FT                   /inference="protein motif:TFAM:TIGR00585"
FT                   /protein_id="ACS54843.1"
FT                   /translation="MAIRQLSETLINQIAAGEVIERPASAAKELIENALDAGATRIEIA
FT                   TSGGGKALLRVSDNGSGMDAADLELAVRRHCTSKISETLEDIRTLGFRGEALPSIGSVA
FT                   RLSIASRRRDSTGGHEIAVAGGKIAHMRPAAANPGTIVEVRDLFFATPARLKFLKTEKA
FT                   EAGAITEIVKRMAIAFPAVRFVLSGSDRTTLEFPATGDDHLARMAQVLGKEFRDNAIAL
FT                   DAVREEIALTGFAGVPTFNRGNSAHQYAFVNGRPVQDKLILSAIRGAYAETIPSGRYPV
FT                   AVLAITLDPALVDVNVHPAKSDVRFRDPSLVRGLIVGAIREALARDGSRAATTGASDML
FT                   RSFRPGFQPNNQRPQTAWSAETSPSQPYQPATGFGERPQASFDGLSMPTARAEPQFSPQ
FT                   PAVAEPNTRYPLGAARAQIHANYIVAQTEDGLVIVDQHAAHERLVFEAMRKALHSKRLA
FT                   SQVLLIPEIVDIPEEDCDRLMQHAAELSELGLAIERFGPGAIAVRETPAMLGEVDAHGL
FT                   IRQLADEIAEWDTASGLSAKLEYVAATMACHGSVRSGRRLRPEEMNALLREMEVTPGSG
FT                   QCNHGRPTYIELKLSDIERLFGRS"
FT   gene            562653..564374
FT                   /locus_tag="Rleg_0540"
FT   CDS_pept        562653..564374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0540"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000938 probable two-component
FT                   sensor histidine kinase protein; TIGRFAM: PAS sensor
FT                   protein; PFAM: response regulator receiver; PAS fold domain
FT                   protein; PAS fold-4 domain protein; SMART: response
FT                   regulator receiver; PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54844"
FT                   /db_xref="GOA:C6B2M4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2M4"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ACS54844.1"
FT                   /translation="MSAGFEKADTSSEIDGAPAEADLQTALFDVVCDSLSAAFIIYDKN
FT                   DHLVFASRQILEFFPLPSEMLKPGTRLRDFLGAMYDTGIRQQYDVRQGGSLSREDWLSQ
FT                   KIASHWRERFDAVERHGADRWVRFVKRRLPGGYGVSIISDISESKKREEQWRSDLERVQ
FT                   LTEDILDNLPFPLFVKDRNLTYVAVNLAFCEKYQTSADEVLGRKSGDLFSEEIAKRFEE
FT                   SDRHVLETGEMSVSRQRQISRDGIERDIVSRKHRIGKPGRYFLVSTMQDLPRDGADLDE
FT                   FGQASAITASSNQSYRRAYVPVPSGIERREPAAMEAIVPENFSGRKVLVVTADLAAETA
FT                   ALRTLTKYGFESCSVRGEDEEERFLEIATSSGISLDLLIIDNQMGMRCLELAEQYGIPA
FT                   LVMDGFQIANELTFQIARHFNRNSRNAAGSDADWEISTSDDAIGLQVLVAEDNDINQIV
FT                   FSQILEGLGYRHMLAATGDEAVRLWAEHRPQIVLMDISLPGFNGFEAARLIRQMEETGG
FT                   SIRTPIIGVLTQAFERDRAECVKSGMDDVIMKPVSPDMLETIFQKYLMNEAMRAQN"
FT   gene            564528..565892
FT                   /locus_tag="Rleg_0541"
FT   CDS_pept        564528..565892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0541"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="KEGG: ret:RHE_CH00850 putative sensory box/GGDEF
FT                   family protein; TIGRFAM: diguanylate cyclase; PFAM: EAL
FT                   domain protein; GGDEF domain containing protein; SMART: EAL
FT                   domain protein; GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54845"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2M5"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACS54845.1"
FT                   /translation="MMKSADIAFLTVGQNELQAMAYTDPLTGLGNRNRMRDKVLQISAE
FT                   RASDPAPFTIGIVNLDSFKPINDLFGSTAGDEILCQVAHRLRACIPDGALVTRHDGDEF
FT                   AFVLPLIFERASAEKFGQMIREVLSAPYDLGDRNVRLSASLGFSIYPFAGEDCEELLKS
FT                   AETALYRSKRRGRGQITVYSREIAQEMKRATQLEQALRNAIISDAIDVHFQPIVSLSNN
FT                   QVVGFEALARWNDPDLGFVSPGVFVPLAEERGFIDALSEALLRKAAEAALSWPRELFLS
FT                   FNLSSAQLMDPGTSSSVLSILGRVGFDPHRLELEITETAVMSSADTAHRIIADLRAAGV
FT                   RISLDDFGTGQSSLGRLRDFIFDKIKIDRAFVSRINSDRASEHIIKAILTMCEGLELEV
FT                   VAEGIEDYAEAVKLRTLGCGMGQGYHFGRPADGIATLRFLHENYYDPTMVERVSA"
FT   gene            complement(565964..566569)
FT                   /locus_tag="Rleg_0542"
FT   CDS_pept        complement(565964..566569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0542"
FT                   /product="PRC-barrel domain protein"
FT                   /note="PFAM: PRC-barrel domain protein; KEGG:
FT                   rec:RHECIAT_CH0000940 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54846"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2M6"
FT                   /inference="protein motif:PFAM:PF05239"
FT                   /protein_id="ACS54846.1"
FT                   /translation="MTRKLLTTVAAGALFATAFAPAAFSQAAPQPADPAAPTQAAPADP
FT                   AAPKPMTPDVTKPAGDAAQAPAAAPTADTAQAGYLTEQSPDQVSANTYIGQSVYNGNNE
FT                   SIGSVNDLILKKDGGFVAAIVGVGGFLGIGEKNVAVPMEKITVAQNTQDGSVKLTTSET
FT                   AESLKAAPEFKTLAMQSAEKAPAATGTDTTATGSTTPK"
FT   sig_peptide     complement(566486..566569)
FT                   /locus_tag="Rleg_0542"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.841 at
FT                   residue 28"
FT   gene            complement(566803..567690)
FT                   /locus_tag="Rleg_0543"
FT   CDS_pept        complement(566803..567690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0543"
FT                   /product="SMP-30/Gluconolaconase/LRE domain protein"
FT                   /note="PFAM: SMP-30/Gluconolaconase/LRE domain protein;
FT                   KEGG: rec:RHECIAT_CH0000941 probable gluconolactonase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54847"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="InterPro:IPR039096"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2M7"
FT                   /inference="protein motif:PFAM:PF08450"
FT                   /protein_id="ACS54847.1"
FT                   /translation="MTDIYEFEGKTLCNTNSVLGEGPTYDPDSNTVWWFNILGKELHEL
FT                   NLSTAAKKVHPLPVMASVLARIDAGRQLIATEEGLFVRDVASGNLTFYAALENDRPENR
FT                   SNDGRTHPSGALWIGTMSKRAENQAGAIYHVASGKVTKIFNGISIPNSICFSPDGTVGY
FT                   YTDSRINRLMRVMVDPLTGLPSGEPIVLVDSMDDPGSIDGSVVDADGYLWNARWGAGVV
FT                   DRYSPDGLRISRYMVPAVQPSCPAFIGVNADRLAVTTAWEGLDEDARSAQPSAGALLEL
FT                   GIDVKGVFDPVYVI"
FT   gene            complement(567687..568328)
FT                   /locus_tag="Rleg_0544"
FT   CDS_pept        complement(567687..568328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0544"
FT                   /product="KDPG and KHG aldolase"
FT                   /note="PFAM: KDPG and KHG aldolase; KEGG: ret:RHE_CH00853
FT                   2-dehydro-3-deoxy-6-phosphogalactonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54848"
FT                   /db_xref="GOA:C6B2M8"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031338"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2M8"
FT                   /inference="protein motif:PFAM:PF01081"
FT                   /protein_id="ACS54848.1"
FT                   /translation="MNRIPFPDMKRPLIAILRGIRPDETESVVGALIDNGLTAIEIPLN
FT                   SPEPFKSIEIAAKMAPAEVLIGAGTVLTVEAVDSLHAAGGKLLVTPNVEPEVIIRARDY
FT                   GMVTMPGVFTPTEALAAARAGATGLKFFPASVLGPSGITAIRAILPPELTIAAVGGVSD
FT                   KNFGDYTKAGIFAFGLGTSIYKPGMTASEVAERAKATIYAYDAAIGSVNV"
FT   gene            complement(568342..569259)
FT                   /locus_tag="Rleg_0545"
FT   CDS_pept        complement(568342..569259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0545"
FT                   /product="2-dehydro-3-deoxygalactonokinase"
FT                   /EC_number="2.7.1.58"
FT                   /note="PFAM: 2-keto-3-deoxy-galactonokinase; KEGG:
FT                   ret:RHE_CH00854 2-dehydro-3-deoxygalactonokinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54849"
FT                   /db_xref="GOA:C6B2M9"
FT                   /db_xref="InterPro:IPR007729"
FT                   /db_xref="InterPro:IPR042257"
FT                   /db_xref="InterPro:IPR042258"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2M9"
FT                   /inference="protein motif:PRIAM:2.7.1.58"
FT                   /protein_id="ACS54849.1"
FT                   /translation="MANPAYVAVDWGTSSFRLWLISRDGTVLAERRSGEGMTSAAKIGF
FT                   SAVLAGHLAAIEAPENLPVIVCGMAGARQGWVEAGYIDVPAPLASILTGAVSVPGESRD
FT                   IRILPGLAQRDIARPDVMRGEETQLLGALGRASAGAQAVCMPGTHSKWVHVTDSKVTGF
FT                   STFMTGELFDVISKHTILSHAVAGAEEQPADAAAFEAAVSAAFARPALASNLLFAARSG
FT                   QLLHGISAAAAQARLSGTLIGLEIAGALQDAANGTTITLVASGRLQALYEQAVKTLSLA
FT                   FTAIDADAAVRRGLSAAAEAIWPN"
FT   gene            complement(569259..570032)
FT                   /locus_tag="Rleg_0546"
FT   CDS_pept        complement(569259..570032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0546"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   ret:RHE_CH00855 3-oxoacyl-(acyl carrier protein) reductase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54850"
FT                   /db_xref="GOA:C6B2N0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2N0"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACS54850.1"
FT                   /translation="MTMMPAAQFPEFKNRAVLVTGGGSGIGAAIVEGFARQGAKVSFID
FT                   IAEAAGRELAERLSRETTHPVSFHHADLRDIAAIRRTVDSVIASSGPIRVLVNNAAWDD
FT                   RHEFDAVTEAYWDNNQAVNLKHVFFTSQAVVPSMRAAGGGAIINMSSIAFKLNMGGFPA
FT                   YAAAKAAVVGLTKSMAGRLGPENIRVNCILPGMVVTERQMQHWLTEESIARSVEDQCLK
FT                   VALKPDAIVGPCLFLASDCAAAMTAQSLIVDGGVL"
FT   gene            570135..570932
FT                   /locus_tag="Rleg_0547"
FT   CDS_pept        570135..570932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0547"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: Transcriptional regulator IclR; regulatory
FT                   protein IclR; SMART: regulatory protein IclR; KEGG:
FT                   ret:RHE_CH00856 IclR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54851"
FT                   /db_xref="GOA:C6B2N1"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2N1"
FT                   /inference="protein motif:PFAM:PF01614"
FT                   /protein_id="ACS54851.1"
FT                   /translation="MNSNGDGAAQARETGTLGKLMVLLDLVTHADAPLRFTDILALAGQ
FT                   PRGTLHRQLSHLVEEGLLELDGDGRYAPGLRLLDFAARSWARNEFRLIAEPHLRDLQQA
FT                   TGETVHLGVLRGQSIIYLDKVEGRQPVRMYSQIGNASPCYCTGVGKAALSLLPAESLVD
FT                   LIAGLSFTSFTASTHVSAETLLAEIREIADQGYAFDREEHEAGIRCVAAPVWSEDRTFM
FT                   GGISITGPAYRLSMELLHQWTVPVQLAAVRIMEGMRVRLGPRR"
FT   gene            571190..571924
FT                   /locus_tag="Rleg_0548"
FT   CDS_pept        571190..571924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0548"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: Autoinducer-binding domain protein; regulatory
FT                   protein LuxR; Bacterio-opsin activator HTH domain protein;
FT                   SMART: regulatory protein LuxR; KEGG: rec:RHECIAT_CH0000947
FT                   putative transcriptional regulator protein, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54852"
FT                   /db_xref="GOA:C6B2N2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR005143"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036693"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2N2"
FT                   /inference="protein motif:PFAM:PF03472"
FT                   /protein_id="ACS54852.1"
FT                   /translation="MAPLSQTSTEEDDYVQEIAGLKTQFDIFRFMKRVTEAYRSRAFMV
FT                   LNLPPITSFDLQGSTVITSWPAELLALYDQEGLMVNSPVLRRLRTSARPFFYDMSRQNL
FT                   SRDDGKSILVASLFERFKMMRCAYFPTHEPSGLRGAISFAGDREPFSPAEMRELCYISI
FT                   HIFDRLAEIRNLDTRMTDTLTDREIDCLNWTAAGKTSAEIAEILTLSEHTVNHYLNRAT
FT                   KKLDTVNRTQAVAKALRIGLIK"
FT   gene            572458..573624
FT                   /locus_tag="Rleg_0549"
FT   CDS_pept        572458..573624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0549"
FT                   /product="protein of unknown function DUF59"
FT                   /note="PFAM: protein of unknown function DUF59; KEGG:
FT                   ret:RHE_CH00859 ATP-binding protein (Mrp protein-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54853"
FT                   /db_xref="GOA:C6B2N3"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2N3"
FT                   /inference="protein motif:PFAM:PF01883"
FT                   /protein_id="ACS54853.1"
FT                   /translation="MADVTKEQVLETLKTVRGPDLEHDIVELGMVSDVFISDGKVYFSI
FT                   TVPADRAKELEPMRLAAERVIKEMPGVKGALVTLTADKKAAAAAPAARPAANPPHGHAG
FT                   HDHGSHAHAPQQPPRAGKIGVPGIGAIIAVASGKGGVGKSTTAVNLALGLLANGLRVGI
FT                   LDADIYGPSMPRLLKISGRPTQIDGRIINPMENYGLKVMSMGFLVDEETAMIWRGPMVQ
FT                   SALLQMLREVAWGELDVLVVDMPPGTGDVQLTMAQQVPLAGAVIVSTPQDLALIDARKG
FT                   LNMFRKVEVPVLGIVENMSYFIAPDTGTRYDIFGHGGARKEAERIGVPFLGEVPLTMNI
FT                   RETSDAGTPLVASEPNGVVAGIYRGIAAKVWEQVAGQPQRPAPTIVFE"
FT   gene            574069..575046
FT                   /locus_tag="Rleg_0550"
FT   CDS_pept        574069..575046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0550"
FT                   /product="Mg2 transporter protein CorA family protein"
FT                   /note="PFAM: Mg2 transporter protein CorA family protein;
FT                   KEGG: ret:RHE_CH00860 magnesium/cobalt transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54854"
FT                   /db_xref="GOA:C6B2N4"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2N4"
FT                   /inference="protein motif:PFAM:PF01544"
FT                   /protein_id="ACS54854.1"
FT                   /translation="MITAYCSNCKSVEIGDLSHAASFPEDVVWIDMIEPTRDEELYVEK
FT                   VLGIEVPTRDDLKDIEPSARLYVENDAVFMTASLLWKADTDVPTLTDVAFILAGNRLVT
FT                   IRYAHPKSFALFIAALHRLPENWRSGAALLAKLLETIVDRTAEILEIAVSRLDILSMHV
FT                   FGERARKVRKPSNYLEEKLRDIAGHHRMISKVRDSLGSLARLLTFFHTIPAIQQDREAK
FT                   ELCRTVSRDIQSLSEHASFVAANITFLLDASLGLINIEQNSIIKIFSIASVVFLPPTLV
FT                   ASVYGMNFQVMPELTWAAGYPYSLALMVISAVIPFFFFRWKGWL"
FT   gene            575065..576963
FT                   /locus_tag="Rleg_0551"
FT   CDS_pept        575065..576963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0551"
FT                   /product="K potassium transporter"
FT                   /note="PFAM: K potassium transporter; KEGG:
FT                   rec:RHECIAT_CH0000951 potassium transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54855"
FT                   /db_xref="GOA:C6B2N5"
FT                   /db_xref="InterPro:IPR003855"
FT                   /db_xref="InterPro:IPR023051"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2N5"
FT                   /inference="protein motif:PFAM:PF02705"
FT                   /protein_id="ACS54855.1"
FT                   /translation="MSEESHPNERHMTPRKLFYLALGSVGVVYGDIGTSPLYAFREALK
FT                   PVAHDGVTRFEVISLISLMIWALTIIVTIKYVLFLLRADNDGEGGTLSLLALLMKTANG
FT                   HTAILMLLGLMGAALFLGDAMITPALSVLSAVEGLKLVTPRLADYIVPISVVILALLFV
FT                   VQSRGTGAVARFFGPITAVWFLVMAAAGISHISDDYGILAAFNPYYAVSFLLHEGFYGV
FT                   VVLGAVFLTVTGAEALYADLGHFGRRPIQWAWFMLVFPALTLNYLGQGALVLGNPATMS
FT                   DPFYLMFPKWALLPVVILATAATIIASQAVITGAFSMVRQGINLGFLPRMEILFTSETN
FT                   TGQIFVPSVNAVLFIGVIFLVLSFKTSDALATAYGISVTGAMVVTSIMAFEFVRARWNW
FT                   SLPVAVIALAPLVVLEMIFLGANLLKIHDGGYIPIMIATAFTVVMWTWRRGTAILMEKT
FT                   RHTDIPLASFVSSIERKSEHSPAQVPGTAIFLTSDPESAPAALLHNLKHNHVLHDRNVI
FT                   LTIRTINKPRVPSHDRYKIEQISERFSRVELLFGFMESQNVSQALATLRKTGLKFDIMS
FT                   TSFYLGRRKLVPDAKSGMPYWQDRLYIALANAAANPSDYFRLPANRVVELGSHVII"
FT   gene            577228..578457
FT                   /locus_tag="Rleg_0552"
FT   CDS_pept        577228..578457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0552"
FT                   /product="cell wall hydrolase SleB"
FT                   /note="PFAM: cell wall hydrolase SleB; KEGG:
FT                   rec:RHECIAT_CH0000952 putative cell wall hydrolase protein
FT                   involved in spore germination"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54856"
FT                   /db_xref="GOA:C6B2N6"
FT                   /db_xref="InterPro:IPR011105"
FT                   /db_xref="InterPro:IPR042047"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2N6"
FT                   /inference="protein motif:PFAM:PF07486"
FT                   /protein_id="ACS54856.1"
FT                   /translation="MECSSVPCPESVLRRKSPSRSKLRLFPENWVSPVIFGLAGWLIFP
FT                   SVASHADLAAMLAGLDHEGGNWRMVLTNSPAGSIHQAELAFAEPMVTGSIAADAGMVLP
FT                   DGRKVAFNAKDKGTAKDRGHEDTPDEDRVNRSAKKGRVVAVEKMQPPKDFSAGSILERT
FT                   KMLFTPSFDLKDRSAFVKPKIQGKEIEIATSFYKKQPVVTDNGVPAMLASLVTNNKADV
FT                   LATAYAPAAPDYARQSPFDSILAEPDSGRFVPEIGPRDHAWAASVLAPSVFSAREQQCL
FT                   ASGIYFEARGESVKGQAAVAQVILNRVRNPSYPKTICGVVYQNEDWRNRCQFSFACDSI
FT                   KDRVNSEYHWRVARDVAMAVTSGKIWLLQVGSATHYHAVYVRPKWAKTMEKVGRIGLHV
FT                   FYRTYGGGWS"
FT   gene            578729..579067
FT                   /locus_tag="Rleg_0553"
FT   CDS_pept        578729..579067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0553"
FT                   /product="ATP synthase protein, subunit I"
FT                   /note="KEGG: rec:RHECIAT_CH0000953 ATP synthase protein,
FT                   subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54857"
FT                   /db_xref="GOA:C6B2N7"
FT                   /db_xref="InterPro:IPR016989"
FT                   /db_xref="InterPro:IPR032820"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2N7"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000953"
FT                   /protein_id="ACS54857.1"
FT                   /translation="MADDREESLEKRRAQLGAKLATKGVETGEDEAREARAEVSRKGYA
FT                   QAMKLSSEFISAIVVGALLGYLLDRFVGTAPWGLIVLLLLGFCAGVLNVLRSAGVVAHP
FT                   LDDKDDKK"
FT   gene            579130..579882
FT                   /locus_tag="Rleg_0554"
FT   CDS_pept        579130..579882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0554"
FT                   /product="ATP synthase F0, A subunit"
FT                   /note="TIGRFAM: ATP synthase F0, A subunit; PFAM:
FT                   H+transporting two-sector ATPase A subunit; KEGG:
FT                   rec:RHECIAT_CH0000954 ATP synthase protein, subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54858"
FT                   /db_xref="GOA:C6B2N8"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2N8"
FT                   /inference="protein motif:TFAM:TIGR01131"
FT                   /protein_id="ACS54858.1"
FT                   /translation="MSNDPTHQFLIQKIVPIEIGGIDFSFTNASLFMAVSAAAAAGFLY
FT                   FATSNRAIVPGRSQSVAEMSYEFIANMLKEGAGKQGMKFFPLVFSLFMFVLTANLLGMF
FT                   PYFFTVTSQIIVTFALAILVIGTVLVYGFYKHGFHFLNVFVPSGVPGLLLPLVVTIEII
FT                   SFLSRPISLSVRLFANMLAGHITLKVFAGFVASLGTMGALGIGGAVLPLIMTVALTGLE
FT                   FLVAFLQAYVFAVLTCMYLNDAIHPGGH"
FT   gene            579950..580177
FT                   /locus_tag="Rleg_0555"
FT   CDS_pept        579950..580177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0555"
FT                   /product="H+transporting two-sector ATPase C subunit"
FT                   /note="PFAM: H+transporting two-sector ATPase C subunit;
FT                   KEGG: rec:RHECIAT_CH0000955 ATP synthase protein, subunit
FT                   C"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54859"
FT                   /db_xref="GOA:C6B2N9"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2N9"
FT                   /inference="protein motif:PFAM:PF00137"
FT                   /protein_id="ACS54859.1"
FT                   /translation="MEAEAAKYIGAGLACFGMAGTALGLGNIFGSYLSGALRNPSAADS
FT                   QFGRLVFGFAVTEALGIFSLLVALLLLFAV"
FT   gene            580255..580878
FT                   /locus_tag="Rleg_0556"
FT   CDS_pept        580255..580878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0556"
FT                   /product="H+transporting two-sector ATPase B/B' subunit"
FT                   /note="PFAM: H+transporting two-sector ATPase B/B' subunit;
FT                   ATPase F0 complex subunit 8; KEGG: rec:RHECIAT_CH0000956
FT                   ATP synthase protein, subunit B'"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54860"
FT                   /db_xref="GOA:C6B2P0"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2P0"
FT                   /inference="protein motif:PFAM:PF00430"
FT                   /protein_id="ACS54860.1"
FT                   /translation="MFFVTPAYAEEAPAAATGTDAHAAPAAGEVHTETGVAEGEHARGP
FT                   FPPFDSTTFASQLLWLVITFGVFYLLMQKVIAPRIGTILDQRHTRISQDLEEAGRLKAE
FT                   ADAAVRTYEGELAAARAKSNAIGSAARDAAKAKAEEERRAVEASLSEKIKAAELRIGEI
FT                   KAKAFADVGTIAEETAAAVVDQLIGGTVAKADVAAAVAAAKKEA"
FT   gene            580882..581373
FT                   /locus_tag="Rleg_0557"
FT   CDS_pept        580882..581373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0557"
FT                   /product="H+transporting two-sector ATPase B/B' subunit"
FT                   /note="PFAM: H+transporting two-sector ATPase B/B' subunit;
FT                   KEGG: ret:RHE_CH00867 F0F1 ATP synthase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54861"
FT                   /db_xref="GOA:C6B2P1"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2P1"
FT                   /inference="protein motif:PFAM:PF00430"
FT                   /protein_id="ACS54861.1"
FT                   /translation="MEFAFDATFFAFVGLVLFLALVVYLKVPGMMARSLDDRADQIRNE
FT                   LAEAKRLREEAQHLLAEYQRKRKEAEAEAAHIVAAAEREAEMLTAEAKKKTEEFVANRT
FT                   ALSEQKIKQAEVEAMKAVRSAAVDLAIAAAETVLAKRADTKIQSELFGNAVGQVKTRLN
FT                   "
FT   gene            581407..581652
FT                   /locus_tag="Rleg_0558"
FT   CDS_pept        581407..581652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0558"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54862"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2P2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS54862.1"
FT                   /translation="MSRPFLLSITRSRAGYLPQINRLQTFGQTRCGPLLSPGASPSSGC
FT                   RHLLPAGGEKGYAAAFSVPRLSLAGHVPSPRLRGEG"
FT   gene            complement(581854..582972)
FT                   /locus_tag="Rleg_0559"
FT   CDS_pept        complement(581854..582972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0559"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   ecl:EcolC_3640 transposase IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54863"
FT                   /db_xref="GOA:C6AZA4"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZA4"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACS54863.1"
FT                   /translation="MKIRPEVLDHWPEVRERLPAGFDLEATARLRGAFTRVREIKNAET
FT                   LLRLALAYGGLGMSLRETCAWAEAGGIARLSDPSLLERLCKAAPWLGDIVAALIAEQAK
FT                   VPTGRFAGYRLRVLDGTSICHPGADRTTWRLHVGYDLATAQVDQLELTDIHGAENLQRL
FT                   TYAPGDIVLADRYYARPRDLRPVIDAGADFIVRTGWNSLRLLQTNGEPFDLFAALAAQQ
FT                   EQEGEVQVRVHEGMTGTPPPPPLALRLIVRRKDPQQAQAEQERLLKAARKHGKKPDPRS
FT                   LEAAKYILLLTSLPATTFPPADILTLYRFRWQIELAFKRFKSLAGLDSLPAKKPELARA
FT                   WLYARLIVAIIAEQIAGQVPDSPPSGCGNPTG"
FT   gene            complement(583112..583801)
FT                   /locus_tag="Rleg_0560"
FT   CDS_pept        complement(583112..583801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0560"
FT                   /product="Ribonuclease H"
FT                   /EC_number="3.1.26.4"
FT                   /note="PFAM: ribonuclease HII/HIII; KEGG:
FT                   rec:RHECIAT_CH0000958 ribonuclease HII protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54864"
FT                   /db_xref="GOA:C6B2P4"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2P4"
FT                   /inference="protein motif:PRIAM:3.1.26.4"
FT                   /protein_id="ACS54864.1"
FT                   /translation="MKPRTSPDSPLLFDTAPLVPDFRLELKARKAGHWPVAGADEAGRG
FT                   PLAGPVVAAAVILDPRRIPEGLNDSKQLSAQRREELFVQILATATVSIASSSSTRIDET
FT                   DIRKASLDAMRRAICSLAIPASYVLTDGLDVPPGLDCPGQAVVKGDARSVSIAAASIVA
FT                   KVTRDRMMARAHSVFPDYGFAAHVGYGTAQHRAGIERHGPCSLHRMSFRPLRKTEGAPE
FT                   TDELLSE"
FT   gene            complement(583964..585121)
FT                   /locus_tag="Rleg_0561"
FT   CDS_pept        complement(583964..585121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0561"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: ret:RHE_CH00869 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54865"
FT                   /db_xref="GOA:C6B2P5"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR040086"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2P5"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACS54865.1"
FT                   /translation="MREQSLAGQAAFAPANTADIADAMIVSSGLRVEVDRRRGRGAGLN
FT                   PTGRFEAQQRETVDDGWQTWEELPPFKTEVQVEKPRTAITRNESPDIPFDRSINPYRGC
FT                   EHGCIYCFARPTHAYMGLSAGLDFETKLFAKPDAAKLLERELAKPGYKVRVIAIGTNTD
FT                   PYQPIEKEWRIMRGILEVLNKANHPVSIVTKSAMILRDLDILQEMAAKNLVRVGISVTT
FT                   LDRKLARTMEPRAATPPRRLETIHTLAEAGIQTAVLAAPLIPALNDHELERILESAKAA
FT                   GAAEASYVILRLPLEVSPLFRDWLLQHYPDRYRHVMSLVRSMRGGKDYDAEFGKRMKGA
FT                   GPYAWQIARRFEMAARRFQLTRRSMPLRDDLFVPPDGSGVQLSLL"
FT   gene            585222..585779
FT                   /locus_tag="Rleg_0562"
FT   CDS_pept        585222..585779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0562"
FT                   /product="putative glycosyltransferase protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000960 putative
FT                   glycosyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54866"
FT                   /db_xref="GOA:C6B2P6"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2P6"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000960"
FT                   /protein_id="ACS54866.1"
FT                   /translation="MLAKICAAHYKWSMLTVVLECQDQESELAQTLSVLVAGAVEGLVS
FT                   DVVVLDHGSRDGTSRVADAAGCRFHSQWDIKDIVRSARGEWLLFVEPGARPQAGWIDEI
FT                   AEYVALNKLPARFTASRAYRRPFFQRVGRAVPPLELGFLLPKKQALAIAKSGMRLTEFV
FT                   KGQKPRKLASELIPSWVARAAR"
FT   gene            585961..586296
FT                   /locus_tag="Rleg_0563"
FT   CDS_pept        585961..586296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0563"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00871 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54867"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2P7"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00871"
FT                   /protein_id="ACS54867.1"
FT                   /translation="MARGRIYGVRSMIYGLIAVILPTLVIAHPHSAASQMMRSCAGRPE
FT                   IVNFLDKNFAEKLTAVGLINENAILEVYAAESGTWTLIVTDVHGISCVLLSGDSWDTMP
FT                   VLPGLAT"
FT   gene            complement(586330..586881)
FT                   /locus_tag="Rleg_0564"
FT   CDS_pept        complement(586330..586881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0564"
FT                   /product="molybdenum cofactor biosynthesis protein B"
FT                   /note="TIGRFAM: molybdenum cofactor biosynthesis protein B;
FT                   molybdenum cofactor synthesis domain protein; PFAM:
FT                   molybdopterin binding domain; KEGG: ret:RHE_CH00872
FT                   molybdenum cofactor biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54868"
FT                   /db_xref="GOA:C6B2P8"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR012245"
FT                   /db_xref="InterPro:IPR013484"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2P8"
FT                   /inference="protein motif:TFAM:TIGR02667"
FT                   /protein_id="ACS54868.1"
FT                   /translation="MAGLDEKRPFIAVGIAVLTISDTRTPETDKSGDTLAARIREAGHR
FT                   LVDRGIVPDDREKIAARVKAWTENQDIDVVITTGGTGFTGRDVTPEALEPLFEKRMDGF
FT                   SAIFHRISYEKIGTATIQSRATAGVANATFIFVLPGSPGACRDAWDGILKGQLDYRSAP
FT                   CNFVEIMPRLDEHLKRGATK"
FT   gene            complement(586881..587792)
FT                   /locus_tag="Rleg_0565"
FT   CDS_pept        complement(586881..587792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0565"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /note="TIGRFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   kinase; PFAM: GHMP kinase; GHMP kinase domain protein;
FT                   KEGG: ret:RHE_CH00873
FT                   4-diphosphocytidyl-2-C-methyl-D-erythritol kinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54869"
FT                   /db_xref="GOA:C6B2P9"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2P9"
FT                   /inference="protein motif:TFAM:TIGR00154"
FT                   /protein_id="ACS54869.1"
FT                   /translation="MMSSENRSHFSASCSSFSEEARAKINLALHVTGQRPDGYHLLDML
FT                   VTFADHGDRLDFMRSPTDALTLSGRFGETLAGDGGTNLVLKARDLLREVVGPLAFPVRI
FT                   HLEKNLPIASGIGGGSADAAATLRGLMRLWGTTLSAETLAALALKLGADVPMCLESRPL
FT                   IARGIGEKIEPVPDLPAFAMVLANPLKGVATPEVFRRLATKNNPALSLALSGSQAADWL
FT                   AAIAAARNDLEPPARGLVPEIAAISAMLQARGALLTRMSGSGATCFGIFASMTAAEGAA
FT                   AALHDKRPDWYFQATETVSGGA"
FT   gene            complement(587844..589676)
FT                   /locus_tag="Rleg_0566"
FT   CDS_pept        complement(587844..589676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0566"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG:
FT                   rec:RHECIAT_CH0000964 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54870"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2Q0"
FT                   /inference="protein motif:PFAM:PF00515"
FT                   /protein_id="ACS54870.1"
FT                   /translation="MRQRLAIRLLTSAALAAVLSLSGVGGANAEDAAKTDDAGTAVHFD
FT                   ADSVTTFSGAFLAARTADVDHDYETAIELYKKALQIEPGNPEIRQRLMISLLLNGDIKD
FT                   GVKYANDLKGDPSVERITTIVRGMDAVRRDDYKSAEAILKYKGPNDLDRMMNDLLLAWA
FT                   RVGAGRGKEALTMVEKMKGPDWFRIFQNYNAGAIAIVTGDVKSARQHLNDAVLDKEGGA
FT                   TAPDTFMRAVMALARLEATQGNKQKALDAVSVGDNLLPNYAPLNALRDSIEKNEKQDQQ
FT                   VKTAEEGAAGVLFSVGGALNRDGAEDIVSLYLQTANALDPNSADTLVLLGGIAEKQNQM
FT                   DRAIALYKKVPENSPMRRISELQLGLALAQGGKVDEARKHLQALITSDPKDIRSYLAYG
FT                   SVLSDAKDYQAMATNYDKAVETIGPIPGRANWSVFFQRGIAYERLKKWDQAEPNFRKAL
FT                   ELNPDQPQVLNYLGYSWIDMNRNLDEGLGMIKKAVDLRPDDGYIIDSLGWAYFRLNRFD
FT                   DAVDELERAAQIKAGDATINDHLGDAYWRVGRKLEAVYQWNRALASEPEAAEIPKIKDK
FT                   VANGLPPASDDAKAADKKQPDPAPVTPPPVDKKS"
FT   sig_peptide     complement(589587..589676)
FT                   /locus_tag="Rleg_0566"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 30"
FT   gene            complement(589810..590826)
FT                   /locus_tag="Rleg_0567"
FT   CDS_pept        complement(589810..590826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0567"
FT                   /product="Farnesyltranstransferase"
FT                   /EC_number="2.5.1.29"
FT                   /note="PFAM: Polyprenyl synthetase; KEGG: ret:RHE_CH00875
FT                   octaprenyl-diphosphate synthase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54871"
FT                   /db_xref="GOA:C6B2Q1"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2Q1"
FT                   /inference="protein motif:PRIAM:2.5.1.29"
FT                   /protein_id="ACS54871.1"
FT                   /translation="MGVVIPLEESKNKLASIKPLVDLTRADMERVNQLILSKAGSDVQM
FT                   IPEVANHLISSGGKRLRPMLTLASASLFDYRGENHVKLATSVEFMHTATLLHDDVVDES
FT                   DLRRGKSTARMIWGNQASVLVGDFLLGQAFRMMVDVGSLDALDVLSSAACVIAEGEVLQ
FT                   LSVAKNMETTEDDYLSVIRAKTAALFAAAAEVGPIVAEAGRSGRNALKSYGMNLGLAFQ
FT                   LVDDALDYGGKAADLGKNVGDDFREGKITLPVILAYRRGTEDERAFWRDAIEAGNSTDA
FT                   NLEKALGLITKYGTLSDTIGRAIHYGTIARDALAPLPDTVWKSALMEVIDFCIERVN"
FT   gene            590935..591162
FT                   /locus_tag="Rleg_0568"
FT   CDS_pept        590935..591162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0568"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000966 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54872"
FT                   /db_xref="GOA:C6B2Q2"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR018551"
FT                   /db_xref="InterPro:IPR036675"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2Q2"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000966"
FT                   /protein_id="ACS54872.1"
FT                   /translation="MHELIRANDPVLLSFAESLMKDAGIHCFIADQGMSVLEGSLGMLS
FT                   RRLLVDEEMADQARRILTDAGLGGELRERK"
FT   gene            591169..591939
FT                   /locus_tag="Rleg_0569"
FT   CDS_pept        591169..591939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0569"
FT                   /product="methyltransferase small"
FT                   /note="PFAM: methyltransferase small; KEGG:
FT                   rec:RHECIAT_CH0000967 putative methyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54873"
FT                   /db_xref="GOA:C6B2Q3"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2Q3"
FT                   /inference="protein motif:PFAM:PF05175"
FT                   /protein_id="ACS54873.1"
FT                   /translation="MTATDTVDAFHRGGFHVVQPKGRGHRSGMDAMLLAALVADDRPVR
FT                   VADLGAGAGAAGLAVASRLANTQVVLFERSAEMADYARRSILLPDNAHLAGRVSVVEAD
FT                   VTLTAKARNDAGLTDESFHHVIMNPPFNDAGDRRTPDALKAEAHAMTDGLFESWIRTAG
FT                   AIIIPGGQLSLIARPQSIAEIVAACGRRFGGIEITAIHPRQGENAVRILVTGIKGSRAR
FT                   LSLRAALIMHEEGSHKFSPLVDDFNNGRAAYARL"
FT   gene            complement(591970..593310)
FT                   /locus_tag="Rleg_0570"
FT   CDS_pept        complement(591970..593310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0570"
FT                   /product="Mn2+/Fe2+ transporter, NRAMP family"
FT                   /note="TIGRFAM: Mn2+/Fe2+ transporter, NRAMP family; PFAM:
FT                   natural resistance-associated macrophage protein; KEGG:
FT                   ret:RHE_CH00878 manganese transport protein MntH"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54874"
FT                   /db_xref="GOA:C6B2Q4"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2Q4"
FT                   /inference="protein motif:TFAM:TIGR01197"
FT                   /protein_id="ACS54874.1"
FT                   /translation="MDALNPNAKNGWRHERGEASLSDVYRTVGTGRHSSRWRRAAAFAG
FT                   PGYMVAVGYMDPGNWATSLAGGSKFGYALLTVALLSNLMAIVLQSLCARLAIASGRDLA
FT                   QACRDAFPKYVSLPLWAFAEIAIIATDIAEVIGTAIGLNLLMGIPLELGVLITALDVFV
FT                   ILFLQKLGFRWVEAFIIALLGVIAVCFGVQILLADPQWGAVLTGFFPTTEIVTNPEMLY
FT                   LALGILGATVMPHNLYLHSGIVQTRAYGHTVPEKREALTFATIDSTVALCFALLINASI
FT                   LILAAAAFNAHGKTDVVELGDAYSLLSPLLGLAIAPTLFGIALLCCGLNSTVTATLAGQ
FT                   IVMEGFLKIRLKPWVRRLITRAIAIVPAAIVTIWYGDQGTAELLILTQVVLSLQLSFAV
FT                   FPLVMFTANKAKMGELVAPRWLSGVAYLIAIVIAGLNVKLLFDFVTG"
FT   gene            593480..594340
FT                   /locus_tag="Rleg_0571"
FT   CDS_pept        593480..594340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0571"
FT                   /product="peptidase S49"
FT                   /note="PFAM: peptidase S49; KEGG: ret:RHE_CH00879 protease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54875"
FT                   /db_xref="GOA:C6B2Q5"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2Q5"
FT                   /inference="protein motif:PFAM:PF01343"
FT                   /protein_id="ACS54875.1"
FT                   /translation="MAGFLRKLLPKRFRKDGITIPVVRLQGAIISGGGQFRPTLNLANV
FT                   SPVLEKAFAMKDAPAIAISINSPGGSPVQSRLIFTRIRELAREKQKKVLVFVEDVAASG
FT                   GYMIALAGDEIIADATSIVGSIGVVSGGFGFPELLKKIGVERRVYTAGENKVILDPFQP
FT                   EKEKDIEYLKSLQLEIHQVFISMVRERRASKLRDDATVFSGLFWSGTRGLELGLIDGLG
FT                   DMRQELKRRYGQKTKLELVTAGRGLFGRRIPGVSPVSLEDAASGLATGLVEAAEERALW
FT                   SRFGL"
FT   gene            594359..594550
FT                   /locus_tag="Rleg_0572"
FT   CDS_pept        594359..594550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0572"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000970 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54876"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2Q6"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000970"
FT                   /protein_id="ACS54876.1"
FT                   /translation="MPQLITILILVFSAWWLYRRFVSDARKLAEKSRRAEKERQTGAIG
FT                   TLVKDPATGEYRLKREGE"
FT   gene            594938..595873
FT                   /locus_tag="Rleg_0573"
FT   CDS_pept        594938..595873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0573"
FT                   /product="glycyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="KEGG: ret:RHE_CH00881 glycyl-tRNA synthetase subunit
FT                   alpha; TIGRFAM: glycyl-tRNA synthetase, alpha subunit;
FT                   PFAM: glycyl-tRNA synthetase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54877"
FT                   /db_xref="GOA:C6B2Q7"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2Q7"
FT                   /inference="protein motif:TFAM:TIGR00388"
FT                   /protein_id="ACS54877.1"
FT                   /translation="MNPKRSFQALILTLHNYWADKGCAVLQPYDMEVGAGTFHPATTLR
FT                   ALGPKPWKAAYVQPSRRPSDGRYGENPNRLQHYYQYQVILKPNPPNLQELYLGSLAAIG
FT                   LDPLLHDIRFVEDDWESPTLGAWGLGWECWCDGMEVSQFTYFQQVCGIECSPVAGELTY
FT                   GLERLAMYVQGVDNVYDLNFNGRDGDEKISYGDVFLQAEQEYSRHNFEFANTEMLHRHF
FT                   VDAEKECRALLDAGAPGDNANQRLHKCVFPAYDQCIKASHVFNLLDARGVISVTERQSY
FT                   ILRVRTLAKACGEAFLLTDAGGVNLSKEAA"
FT   gene            595968..597791
FT                   /locus_tag="Rleg_0574"
FT   CDS_pept        595968..597791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0574"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000973 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54878"
FT                   /db_xref="GOA:C6B2Q8"
FT                   /db_xref="InterPro:IPR018702"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2Q8"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000973"
FT                   /protein_id="ACS54878.1"
FT                   /translation="MASVSLLKSGILYFKLLYENSAPRMLRLLAWPILCAMLFVLTSCS
FT                   NFDKEFTVYSANTTIEVYTDGSAFVSEHFDILVKKAENYGGVYVDIPQRFTDASGGVHW
FT                   RDFELAAARRDGIDEYYFKENNVPGYSVYIGAEHCKSCSADLLTGVTKIQIAYWLGRLV
FT                   RQEGDHEVLFLPAYMGRVHGQGAKKTLTLKLPPGGTVRPSQQDRAAGYDITRSAPNEIL
FT                   VSIPVGKADRKLPDIEIEYPAGTFVTVTSGERVQWWLSDHFLPFISILGPLIAGLFVLM
FT                   RLGQGWRLPAPSIAGDSKKTESISPALAAYVFWNWKPDTAKAAFMASVCHLATKRLLRI
FT                   SGLGENAEASDLSARQVRKKGKVARARWYGLPAVTRSVFGRIEGERPVNDRRTVVYALY
FT                   GFERDLHQIVAEEYWKVRGGADRAALTTSATILVLGIATAYLSGLLIFSAAICGILLIV
FT                   FLVVTMFRHPERFPVATGTSEQFKQAISLFVGLPAILIVALCYIGTTEVIGEQQPYLVA
FT                   ILLHIAGIIAVLAMLRMPTSKQRQIRNHILSLHRYFHGEIDGPPMSIECYEHHLPFAVA
FT                   LGVEQRWTERFNLWRESEKMDAYAPDWRISS"
FT   gene            597906..598457
FT                   /locus_tag="Rleg_0575"
FT   CDS_pept        597906..598457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0575"
FT                   /product="LemA family protein"
FT                   /note="PFAM: LemA family protein; KEGG:
FT                   rec:RHECIAT_CH0000974 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54879"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2Q9"
FT                   /inference="protein motif:PFAM:PF04011"
FT                   /protein_id="ACS54879.1"
FT                   /translation="MYVILAIIVVIALYLVFIYNGLVRARQMAEEAWSGIDVQLKRRAD
FT                   LIPNLIETVKGYAAHEKSTLEEVVELRNKAQAVPSGDVAGRAQAEGLLGQALGRVIALA
FT                   EAYPDLKANQNFAELQASLETMEGELQMARRYYNGAARDLNVKVESFPSNLVAGQFGFA
FT                   KREYFEITNEADRAVPTVKF"
FT   gene            598618..599880
FT                   /locus_tag="Rleg_0576"
FT   CDS_pept        598618..599880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0576"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.19"
FT                   /note="KEGG: rec:RHECIAT_CH0000975 3-phosphoshikimate
FT                   1-carboxyvinyltransferase protein; TIGRFAM:
FT                   3-phosphoshikimate 1-carboxyvinyltransferase; PFAM: EPSP
FT                   synthase (3-phosphoshikimate 1-carboxyvinyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54880"
FT                   /db_xref="GOA:C6B2R0"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2R0"
FT                   /inference="protein motif:TFAM:TIGR01356"
FT                   /protein_id="ACS54880.1"
FT                   /translation="MTRTAKLTIIPPGRPLSGRAMPPGSKSITNRALLLAGLAKGTSRL
FT                   TGALKSDDTRYMAEALRAMGVTIDEPDDTTFVVTGSGRLLPPKAPLFLGNAGTATRFLT
FT                   AAAALVDGTVIVDGDEHMRKRPIGPLVEAMRTLGIDVSAETGCPPVTVKGTGRFQADRI
FT                   RIDGGLSSQYVSALLMMAAGGDRPIDIELVGEDIGALGYIDLTTAAMKAFGAKVEKTSP
FT                   VTWRVEPTGYHAADFIVEPDASAATYLWAAEVLTGGAIDLGVPSDAFSQPDARAYDMIA
FT                   KFPHLPSEIDGSQMQDAVPTLAVLAAFNETPVRFVGIANLRVKECDRIQALSTGLNRIV
FT                   SGLAREEGDDLIVQSDPALVGQHLPAEIDSFADHRIAMSFALAGLKIDGITILDPDCVG
FT                   KTFPAYWRTLAALGVTYQDKD"
FT   gene            599919..601853
FT                   /locus_tag="Rleg_0577"
FT   CDS_pept        599919..601853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0577"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00885 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54881"
FT                   /db_xref="GOA:C6B2R1"
FT                   /db_xref="InterPro:IPR018702"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2R1"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00885"
FT                   /protein_id="ACS54881.1"
FT                   /translation="MGRRFFGFCFALLLMLAAPAAFAAEVIDSFASDITLEKSGAMTVT
FT                   ETITVNAEGNQINHGIFRDFPLYFTDAAGRRRSVDFDMVSVQRDGDNEPWHTESISGGI
FT                   RIYAGSADVTVTPGRHRYVFTYRTNRQIRYFDDHDELYWNVTGNGWIFPIRSATATVKL
FT                   PPDVGATETTFFTGPEGATGKNARVSESGAGLVFSTTAPLDAYEGLTFAIRMPKGSIDP
FT                   PSADMESTWWLKDNRNYFIGFGGLLLVLAYYTRSWLKVGRDPARGVVVPRWDAPDGISP
FT                   ALVNYIDNKGFSGEGWTALSATALNLAVRGYVKLEDLKNSIVIQGTGKPLGKEKFQAGE
FT                   IELLKVAGGAGSTLTIDKANGERVKSVGQAFRSAIEKEHRGKYYNSNLGYTAGGIVLSA
FT                   AALVILFVFGSLAPDTIALMLIPIAISVFVAVFAAGLVRSLHRGKSLFGKIIAIISAAI
FT                   GVFVGISILATMVLALASSLVELHETPMLFAVGGIVLLNILYVFIMGAPTPLGAKMMDG
FT                   IDGLRQYLTLAEKDRMNTAGAPEMSPRHFETLLPYAVALGVEKPWSRTFETWLAAAAAG
FT                   AAAAYAPAWYAGNFNSGSFSDRIGGFSSSMASTIASTIPAPPPSSSSSGFSGGGSSGGG
FT                   GGGGGGGGW"
FT   sig_peptide     599919..599990
FT                   /locus_tag="Rleg_0577"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            601919..603196
FT                   /locus_tag="Rleg_0578"
FT   CDS_pept        601919..603196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0578"
FT                   /product="phosphoribosylamine/glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="KEGG: rec:RHECIAT_CH0000977
FT                   phosphoribosylamine-glycine ligase protein; TIGRFAM:
FT                   phosphoribosylamine/glycine ligase; PFAM:
FT                   phosphoribosylglycinamide synthetase; protein of unknown
FT                   function DUF201"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54882"
FT                   /db_xref="GOA:C6B3G1"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:C6B3G1"
FT                   /inference="protein motif:TFAM:TIGR00877"
FT                   /protein_id="ACS54882.1"
FT                   /translation="MKVLLIGSGGREHALAWKLAQSPLMSEFYAAPGNPGIAEHAVLVP
FT                   VDIEDHEAVVAFCKDKAIDFVVVGPEAPLVAGLADRLRADGLAVFGPSAAAAQLEGSKG
FT                   FTKDICARYGIPTGAYQRFNNGPKAKAYIRAEGVPIVVKADGLAAGKGVTVAMTLDEAL
FT                   AAVDDCFEGAFGAAGAEVVVEAYLDGEEASFFCLCDGKHALPLATAQDHKRVGEGDTGV
FT                   NTGGMGAYSPAPVMTAEMVERTMKEIIEPTMRGMAESGHPFSGVFFAGLMITKKGPELI
FT                   EYNVRFGDPECQVMMMRLKSDLLPLLLATANGTLDQVKAEWNEDPALTVVMASKGYPGA
FT                   YDKNTPILSLPDAGKGEKVFHAGTGLKDGALVATGGRVLNVTASGGTVAEAKSRAYALL
FT                   DRVRWENGFCRRDIGWRAIEREMGSE"
FT   gene            603296..603757
FT                   /locus_tag="Rleg_0579"
FT   CDS_pept        603296..603757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0579"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000978 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54883"
FT                   /db_xref="UniProtKB/TrEMBL:C6B3G2"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000978"
FT                   /protein_id="ACS54883.1"
FT                   /translation="MRQIFLGAAILLMAGPVMASSIEVVGKTAPRAESSIVTESCAHCP
FT                   PLQAELTKKDYTVPELKPGVLQASEVRDVGGEKKIYRTEGWMGGSPVVFVSKATPESMI
FT                   AAAPPAAPVDGIDMNATTAAVIGDDARPVEAGMTEQPAALNASEFKLRF"
FT   sig_peptide     603296..603355
FT                   /locus_tag="Rleg_0579"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 20"
FT   gene            604186..606006
FT                   /locus_tag="Rleg_0580"
FT   CDS_pept        604186..606006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0580"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Cache sensor"
FT                   /note="PFAM: chemotaxis sensory transducer; Cache type 2
FT                   domain protein; histidine kinase HAMP region domain
FT                   protein; SMART: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; KEGG: ret:RHE_CH00888
FT                   methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54884"
FT                   /db_xref="GOA:C6B3G3"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="UniProtKB/TrEMBL:C6B3G3"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACS54884.1"
FT                   /translation="MKKLKIAHQLFALIGVLMAAFAVATYFEIRTSEQAIYDERFDMLR
FT                   TQVESGISVLNTFYEREKAGQMTHEAAQTEAFEILKRVSFQPSGYLFGFDYNVVQLFHP
FT                   SPVNLGKDMSGQVDKTGAKFSQALVDNGKAGGGRTFYYWTKPGQPEDQVFLKGGYSKAF
FT                   EPWKIVVGTGVYLDDLQQKVNATIWKALTASLIVFVCGIAAAVFFIRGISHPLKDIHNA
FT                   LQSVAEEDVSISIPHTGMNNEVGMMAKATQSLQEKIRERHAMSDREAAQQLALESEREN
FT                   NLRQQQDETTLQARVVATIGQALEMIARGDLTVRCADLGQKYAALRDNFNDALSHLEAA
FT                   MAKVSAKGTDIGTSKEEIRRASNELSQRTERQAASLEETSAALDELTVAVRQTADGAHE
FT                   ASKRVHSVSTEATHSDAIVTQAIEAMSGIEKSSSEITKIIGVIDEIAFQTNLLALNAGV
FT                   EAARAGESGKGFAVVAQEVRELAQRSAAAAKEIKDQIARSSSQVDHGVRLVGEAGEALK
FT                   RISDQIKAANEIVAKIAHSASEQDTTLRSISSSMNQLDAATQQNAAMAEETTASAETLA
FT                   TDTDELIDLIRGFRVSAPQHRQAEPMRRAS"
FT   sig_peptide     604186..604260
FT                   /locus_tag="Rleg_0580"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.656 at
FT                   residue 25"
FT   gene            606268..608091
FT                   /locus_tag="Rleg_0581"
FT   CDS_pept        606268..608091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0581"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Cache sensor"
FT                   /note="PFAM: chemotaxis sensory transducer; Cache type 2
FT                   domain protein; histidine kinase HAMP region domain
FT                   protein; SMART: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; KEGG: ret:RHE_CH00888
FT                   methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54885"
FT                   /db_xref="GOA:C6B3G4"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="UniProtKB/TrEMBL:C6B3G4"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACS54885.1"
FT                   /translation="MKNLKISKQLILLVVGLMVAFAIATSLQIRSSVNAIYNERYDMLR
FT                   AEVQSAVSVLKIYQAKVTAGEMTLEDAQKQAYATVNAMKYDPDGYFFGYSYDIQMMFHY
FT                   DAAKIGQVNKGQPDSKGKLYREELVKLGQQGGGLVEYYSTAKPGQPAGDFRKTAYAQAF
FT                   DPWKVVVVTGVYMDDLDAQINSTILTALSGSIVLFFLAMAAAYVVIRGISGPLNNVHAA
FT                   LKAVAEEDVSIAIPHTGMNNEVGMMAKATQSLQEKIRERHAMSDREAAQQLALESEREN
FT                   NLRQQQDEATLQARVVTTIGQALEMIARGDLTVRCADLGQKYAALRDNFNDALSHLEAA
FT                   MAKVSAKGTDIGTSKEEIRRASNELSQRTERQAASLEETSAALDELTVAVRQTADGAHE
FT                   ASKRVHSVSTEATHSDAIVTQAIEAMSGIEKSSSEITKIIGVIDEIAFQTNLLALNAGV
FT                   EAARAGESGKGFAVVAQEVRELAQRSAAAAKEIKDQIARSSSQVDHGVRLVGEAGEALK
FT                   RISDQIKAANEIVAKIAHSASEQDTTLRSISSSMNQLDAATQQNAAMAEETTASAETLA
FT                   TDTDELIDLIRGFRVSGESAAPAMHQGRRAA"
FT   sig_peptide     606268..606342
FT                   /locus_tag="Rleg_0581"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.787 at
FT                   residue 25"
FT   gene            complement(608170..608658)
FT                   /locus_tag="Rleg_0582"
FT   CDS_pept        complement(608170..608658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0582"
FT                   /product="protein of unknown function DUF523"
FT                   /note="PFAM: protein of unknown function DUF523; KEGG:
FT                   rec:RHECIAT_CH0000979 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54886"
FT                   /db_xref="InterPro:IPR007553"
FT                   /db_xref="UniProtKB/TrEMBL:C6B3G5"
FT                   /inference="protein motif:PFAM:PF04463"
FT                   /protein_id="ACS54886.1"
FT                   /translation="MQSKILVSACLMGQAVRYDGRAKPLLHPVIETWRAEGRLVTICPE
FT                   MSAGMTVPRPPAEIAEAATGEDVLAGTARVVELTGADVTEEFLLAAENAVALARQAGCH
FT                   YALLIDGSPSCGSGFIYDGTFSGRKEAGNGVTAAALKAAGVEVFSDREIERLIERIGQ"
FT   gene            complement(608717..610831)
FT                   /locus_tag="Rleg_0583"
FT   CDS_pept        complement(608717..610831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0583"
FT                   /product="glycyl-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="KEGG: rec:RHECIAT_CH0000980 glycyl-tRNA synthetase
FT                   protein, beta subunit; TIGRFAM: glycyl-tRNA synthetase,
FT                   beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54887"
FT                   /db_xref="GOA:C6B3G6"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/TrEMBL:C6B3G6"
FT                   /inference="protein motif:TFAM:TIGR00211"
FT                   /protein_id="ACS54887.1"
FT                   /translation="MPNLLLELRSEEIPARMQRKAAGDLKKLVTDALVEAGLSYEGARE
FT                   YWTPRRLALDIHGLTARSADVREERKGPRTDANEKAIEGFLRGAGLSSVSEAQVVSDPK
FT                   KGDFYVAVISKPGRATEEIVSDVMPGIIRDFPWPKSMRWGKASSKPGALRWVRPLQSIV
FT                   CTFGPEHEETTVIPFEIDGITASNITYGHRFHAPEAITVRRFDDYAANLEKAKVILDAE
FT                   RRKDIILHDARDIAFANGLELVEDEGLLEEVSGLVEWPQVLMGSFEEDYLSIPSEIIRL
FT                   TIKTNQKCFVTRPQGGETLSNKFILVSNIQASDGGKEIVHGNGKVVRARLSDALHFWKR
FT                   DQGNLPDLETLEASAAKFGLDLKKPLDQRMAKLDALDVTFHAKLGTQGARVARIRTLAK
FT                   ELADITGADAALIDRAAVLAKADLRTEAVGEFPELQGLMGRKYAVLQGEDASVAAAIED
FT                   HYKPQGPSDRVPEDRVAITIALADKLDTLIGFWAIDEKPTGSKDPFALRRAALGVVRIL
FT                   LERRIRLPLLATTKDGDLLSFFHDRLKVYLRDQGARHDLIDAVLTSDADDLLMVARRVE
FT                   ALTAFITSEDGKNLLSGTKRATQLLAAEEKKGTVIADGVSPALLTLDAEKELFAAISGA
FT                   SKDASDAVAGEDFRSAMEALSKLRGPVDRFFEDVLVNDEDAAIRANRLALLRLIREATG
FT                   TVADFSKISG"
FT   gene            611051..613360
FT                   /locus_tag="Rleg_0584"
FT   CDS_pept        611051..613360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0584"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="PFAM: RNA binding S1 domain protein; SMART:
FT                   Resolvase RNase H domain protein fold; RNA binding S1
FT                   domain protein; KEGG: rec:RHECIAT_CH0000981 probable
FT                   transcriptional accessory protein (RNA binding S1 domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54888"
FT                   /db_xref="GOA:C6B3G7"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:C6B3G7"
FT                   /inference="protein motif:PFAM:PF00575"
FT                   /protein_id="ACS54888.1"
FT                   /translation="MAADLRFLAARISAEINARPEQAKAAIELLDEGSTVPFIARYRKE
FT                   VTGGLDDTQLRNLAERLVYLRELEARRDAIVESITGQGKMTDELMTKVAGAETKAELED
FT                   LYLPYKPKRRTRAEIARERGLGPLAETILADRAREPAVLAEGFVTADVPDVKTALEGAR
FT                   DIIAEGIAENADLLGRLRAHMRQAALLKAKVVDGKQATGEKFSDYFDHSERWATAPGHR
FT                   ALAMLRGWNEEVLTLTIEADAETTSPNKPVERMIVAAYEIGTSRPGDRWLMEVASWTWR
FT                   VKLSMSLSLDLMRELRERAEEEAIHVFARNLKDLLLAAPAGSRATMGLDPGIRTGVKVA
FT                   VVDGTGKVVATSTVYPFQPRNDVRGAQVELASLIRKHNVELISIGNGTGSRETEKLVAD
FT                   MLAELPAPKPTKVIVSEAGASVYSASATAAAEFPDLDVSLRGAVSIARRLQDPLAELVK
FT                   IEPKSIGVGQYQHDVDQQKLSRSLDAVVEDAVNAVGVDLNTASAPLLSRVSGLGPSIAD
FT                   AIVRHRDSEGRFETRKDLLKVARLGGRTFEQCAGFLRIPNGKEPLDSSSVHPEAYGVAK
FT                   KIVAACGRDLRALMGDSAVLKSVDPRQFIDEKFGLPTVRDIIAELEKPGRDPRPSFKTA
FT                   TFAEGVNEISDLKPGMVLEGTVTNVAAFGAFVDIGVHQDGLVHVSQLADRFVKDPHEVV
FT                   KAGDVVKVRVVEVDAKRKRIALSMKRDDGSSAPPPRGDSRANQGSRPQNESRPAAAKPE
FT                   SQGAFGAALAEAMKRK"
FT   gene            613494..614753
FT                   /locus_tag="Rleg_0585"
FT   CDS_pept        613494..614753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0585"
FT                   /product="Cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /EC_number="2.1.1.79"
FT                   /note="PFAM: Cyclopropane-fatty-acyl-phospholipid synthase;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   ret:RHE_CH00892 cyclopropane-fatty-acyl-phospholipid
FT                   synthase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54889"
FT                   /db_xref="GOA:C6B3G8"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6B3G8"
FT                   /inference="protein motif:PRIAM:2.1.1.79"
FT                   /protein_id="ACS54889.1"
FT                   /translation="MASAFLSIVEKIIRKGSLKLTIANGETHTIGDGTGETVVARLADQ
FT                   EAEDAIRRDPAMKLGEMYMQGRFILEQGNIYDFLSLVKQNTTNEIFDFKMAALLLGRIA
FT                   KQQLKSRVPVNRNKHNVAHHYDLSAKLFDLFLDEDWQYSCAYFEPPGIGLDEAQLAKKR
FT                   HIAAKLLLEPNQRILEIGSGWGGMGMYLTEATDGAEFTGITLSEEQLKVSRTRAEKRGL
FT                   ADRVRFELQDYRTMTGRKFDRIVSVGMFEHVGIGHYGNFFRKVSDLLDDNGVMVLHSIG
FT                   RPKPSFGTNAFIEKYIFPGGYIPSVGEVVPPLEKAGLLVKDIEILPLHYAYTLRHWRER
FT                   FVARKAEAVALYDEQFFRMWEFYLAGSEIGFRWDELFILQIQIAKNQFAVPDNRNYIAR
FT                   NEAKLKEFEAGRAPLEKVTF"
FT   gene            614821..615402
FT                   /locus_tag="Rleg_0586"
FT   CDS_pept        614821..615402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0586"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: ret:RHE_CH00893
FT                   phosphoglycerate mutase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54890"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:C6B3G9"
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /protein_id="ACS54890.1"
FT                   /translation="MSSAFPEIYLVRHGETEWSLSGRHTGRSDIPLTANGEAAARKLAD
FT                   RLAGLSFSAVWSSPSERARKTCTLAGFGSGAVMKDDLAEWDYGAYEGITTKAILADRPG
FT                   WQLFRDGCPKGEFAANVGARADAVIHALRQTAGTILIFSSSHFLRVLAARWLGLPPEDG
FT                   SRFVLDTASISVLGYEHDLTEPVIRRWNQR"
FT   gene            615531..616343
FT                   /locus_tag="Rleg_0587"
FT   CDS_pept        615531..616343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0587"
FT                   /product="MltA-interacting MipA family protein"
FT                   /note="PFAM: MltA-interacting MipA family protein; KEGG:
FT                   rec:RHECIAT_CH0000984 putative outer membrane scaffold
FT                   protein, MipA family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54891"
FT                   /db_xref="InterPro:IPR010583"
FT                   /db_xref="UniProtKB/TrEMBL:C6B3H0"
FT                   /inference="protein motif:PFAM:PF06629"
FT                   /protein_id="