(data stored in ACNUC7421 zone)

EMBL: CP001627

ID   CP001627; SV 1; circular; genomic DNA; STD; PRO; 294782 BP.
XX
AC   CP001627; ABJS01000000-ABJS01000529;
XX
PR   Project:PRJNA20097;
XX
DT   23-JUN-2009 (Rel. 101, Created)
DT   12-DEC-2013 (Rel. 119, Last updated, Version 3)
XX
DE   Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132505, complete
DE   sequence.
XX
KW   .
XX
OS   Rhizobium leguminosarum bv. trifolii WSM1325
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Rhizobiaceae;
OC   Rhizobium/Agrobacterium group; Rhizobium.
OG   Plasmid pR132505
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-294782
RX   PUBMED; 21304718.
RA   Reeve W., O'Hara G., Chain P., Ardley J., Brau L., Nandesena K., Tiwari R.,
RA   Copeland A., Nolan M., Han C., Brettin T., Land M., Ovchinikova G.,
RA   Ivanova N., Mavromatis K., Markowitz V., Kyrpides N., Melino V., Denton M.,
RA   Yates R., Howieson J.;
RT   "Complete genome sequence of Rhizobium leguminosarum bv. trifolii strain
RT   WSM1325, an effective microsymbiont of annual Mediterranean clovers";
RL   Stand Genomic Sci 2(3):347-356(2010).
XX
RN   [2]
RP   1-294782
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kiss H., Brettin T., Detter J.C., Han C.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Ovchinnikova H., Reeve W.G.;
RT   "Complete sequence of plasmid5 of Rhizobium leguminosarum bv. trifolii
RT   WSM1325";
RL   Unpublished.
XX
RN   [3]
RP   1-294782
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Last F.I., Brettin T., Detter J.C.,
RA   Han C., Larimer F., Land M., Hauser L., Kyrpides N., Ovchinnikova G.,
RA   Reeve W.G.;
RT   ;
RL   Submitted (20-MAY-2009) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B310, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 5924ca74c4d10738ed0fc9e225d34664.
DR   BioSample; SAMN00000703.
DR   EnsemblGenomes-Gn; EBG00001458798.
DR   EnsemblGenomes-Gn; EBG00001458799.
DR   EnsemblGenomes-Tr; EBT00001612909.
DR   EnsemblGenomes-Tr; EBT00001612910.
DR   EuropePMC; PMC5739047; 29220487.
DR   RFAM; RF00489; ctRNA_p42d.
DR   RFAM; RF00490; S-element.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4024173
CC   Source DNA and bacteria available from Wayne G. Reeve
CC   (W.Reeve@murdoch.edu.au)
CC   Contacts: Wayne G. Reeve (W.Reeve@murdoch.edu.au)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name  :: Rhizobium leguminosarum trifolii WSM1325
CC   GOLD Stamp ID          :: Gi01547
CC   Greengenes ID          :: 267555
CC   Oxygen Requirement     :: Aerobe
CC   Cell Shape             :: Rod-shaped
CC   Motility               :: Motile
CC   Sporulation            :: Nonsporulating
CC   Temperature Range      :: Mesophile
CC   Biotic Relationship    :: Symbiotic
CC   Symbiotic Relationship :: Mutualistic
CC   Diseases               :: None
CC   Habitat                :: Host, Root nodule
CC   Phenotypes             :: Nitrogen fixation, Non-Pathogen
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..294782
FT                   /organism="Rhizobium leguminosarum bv. trifolii WSM1325"
FT                   /plasmid="pR132505"
FT                   /strain="WSM1325"
FT                   /mol_type="genomic DNA"
FT                   /note="biovar: trifolii"
FT                   /db_xref="taxon:395491"
FT   gene            122..1300
FT                   /locus_tag="Rleg_6287"
FT   CDS_pept        122..1300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6287"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bbt:BBta_6668 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6287"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61039"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAD1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS61039.1"
FT                   /translation="MRATGRYGLAIALLAWVIGIASPPAVAAPNIVSGLEVGLGDCVTA
FT                   DVPGGRGLLDAVASSAISAGINLLGNALAEAGKDETRKAMGSRNLGGGMTPFPQCIQIV
FT                   LGRFRTDAASTGSNWLESINKGGDAKLAANGIWLADKPDFFLEAMIVPSEDRAAVAIRP
FT                   LLAAMNEPQESSFFGTKTRSVVALFAFSKPGESPSLETNPSAAIEIGAMEPGDIIRYPV
FT                   GTPGKPSTPYESAWFTLSDADARGPMTLTAVISETKAGNPLLSFLGTVLNDEAVKSAAS
FT                   DNAKVMLLPAARQQANTAAAIESQNAAADQIDTSFADAVTKLELCHGAGADLNKAAEAR
FT                   AALRAYLAASAAMPAHPAKIDGAAIDILDLTSPETIAQSCSQLFERLTGKVL"
FT   sig_peptide     122..205
FT                   /locus_tag="Rleg_6287"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 28"
FT   gene            1484..2256
FT                   /pseudo
FT                   /locus_tag="Rleg_6288"
FT   gene            complement(2547..2873)
FT                   /locus_tag="Rleg_6289"
FT   CDS_pept        complement(2547..2873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6289"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sal:Sala_0113 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6289"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61040"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAD2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS61040.1"
FT                   /translation="MPGTMTAGGKTLPSIQATFEDALAKLPDGDIDGHFGNRPWGVTVK
FT                   RSEDGKRIWLYGEELSGTDIVSFNLYRLAGPGPILKPCEMSSAKVIEFVLGFVPSTAKA
FT                   ASRP"
FT   gene            3237..3734
FT                   /locus_tag="Rleg_6290"
FT   CDS_pept        3237..3734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6290"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61041"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAD3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS61041.1"
FT                   /translation="MADFSHKTDIEIDQWIRNFEKRCQTEAPLYLELLEERGHRAGRRA
FT                   GLDLEKSLAALKRAAISGTCISYGDLAKASGVEWSKARHQLNGKNGHLDRLLEICHARK
FT                   LPLLTAICVNQGSLQEGELEENALKGFSEGARRIGRSFSDDLDFHLACREECWNWGRMQ
FT                   LG"
FT   gene            3803..5080
FT                   /locus_tag="Rleg_6291"
FT   CDS_pept        3803..5080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6291"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: glo:Glov_1418 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6291"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61042"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAD4"
FT                   /inference="similar to AA sequence:KEGG:Glov_1418"
FT                   /protein_id="ACS61042.1"
FT                   /translation="MQLSRLELYKRVSARPLSKLAAELGTTGTALAAVCKKYQVPYPGS
FT                   GYWTRKSLGLPVELPALPEAPDEVIEITPAISKPRRPRTPKDQPSKDRAPKKARRMEHH
FT                   PLLFGVEGHLRKSREVKDGEFLRPYKRLLPDLISSEVALPRTLRIANALYLALDERGYR
FT                   IHIAPQSDDIGRILVSEQEVELKDRKYGRYYSSGIWGPDRATIFYIDSVPIGLAITEMT
FT                   ERVTMRYINGDYYREDSKLVRSMKPWQMTHSWTTEQDMPSGRLRIIAYSAKKGVEWSAR
FT                   WQDAQEQPLEKAMSTIVETLLASHDDILQLMIAEDAAEARRKKERAEEWERYERREDAR
FT                   KVAQALSDSRQQLAETIEKWAKAMAVERFFADAEERLNKLDNERRQRLEERLELARAMM
FT                   GSIDPLDFIENWKAPDERYRSKYRED"
FT   gene            5370..5573
FT                   /locus_tag="Rleg_6292"
FT   CDS_pept        5370..5573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6292"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="PFAM: Cold-shock protein DNA-binding; Ribonuclease B
FT                   OB region domain; SMART: Cold shock protein; KEGG: cspA;
FT                   cold shock protein ; K03704 cold shock protein
FT                   (beta-ribbon, CspA family)"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6292"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61043"
FT                   /db_xref="GOA:C6BAD5"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAD5"
FT                   /inference="protein motif:PFAM:PF00313"
FT                   /protein_id="ACS61043.1"
FT                   /translation="MATGTVKFFNDDKGFGFITPENGGQDVFVHVSALQRGGSLREGDK
FT                   VSFEVGQDRKTGKSKAENVSVL"
FT   gene            5643..6431
FT                   /locus_tag="Rleg_6293"
FT   CDS_pept        5643..6431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6293"
FT                   /product="protein of unknown function DUF88"
FT                   /note="PFAM: protein of unknown function DUF88; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6293"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61044"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="InterPro:IPR025605"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAD6"
FT                   /inference="protein motif:PFAM:PF01936"
FT                   /protein_id="ACS61044.1"
FT                   /translation="MTGTSDTLALLIDGDNASPKIVSGLLAEIATYGTASVRRIYGDWT
FT                   KPNLNGWKECLLEHSIQPVQQFAYTTGKNATDGAMIIDAMDLLYTGRFSAFCIVSSDSD
FT                   FARLASRIREQGVTVYGFGERKTPRPFITACDKFVYFDVLNANSVESDLRQDARPAAAA
FT                   KAKAIPAKVPAKPRLDAAALKMLENAVIASADEDGRANLARVGAHLAKQSSDFDARNYG
FT                   FARLTDLVEASGIVDVERSGDSPKIVTVRMKGKARPRSNG"
FT   gene            6529..7896
FT                   /locus_tag="Rleg_6294"
FT   CDS_pept        6529..7896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6294"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_1186 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6294"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61045"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAD7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS61045.1"
FT                   /translation="MMPQRGLSREELFALVWEKPTSEIAKELGLSDVAIGKLCTKLQVP
FT                   KPPRGYWARMQAGQRPRRPALAAFREELEAKRRDELREKTAESLSKLQRRFLELALAEL
FT                   NSKGAGLAPPLGARPLVNLDRDVAAQVLLLIQGRGQVWVEEGRIATRWGPSVRNSVGRL
FT                   VERLLPLAREQLLVFETESKRTSFRADGPVIFIRLTKRLQARVVGLANIVRDQDLQHVV
FT                   MPLVAADHAWSTHHLYSPESHLFLDSWLCVSAREIWVEWNRKSWREEDPPERHATNRIG
FT                   LSDVMPVDFLPGSDKALSPVISGVAIKPYADRLRAVQEAERVHEMMSTAAYAMQKEVPG
FT                   EFLSVVDRLWFGEERPFQAARDAFRHVETELERWETELEAERSALARSILGIVPGDIAT
FT                   SESRGKLLRLSVTSVTLYSSGGCVSFMVSGIRFRKDGTLGKLQETLSLSFADERQT"
FT   gene            8146..8316
FT                   /locus_tag="Rleg_6295"
FT   CDS_pept        8146..8316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6295"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6295"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61046"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAD8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS61046.1"
FT                   /translation="MTNLKDITDGYEAQARCYTIGSATGKRATILSKSRRKQKIRICQC
FT                   IQERSNGEKKW"
FT   gene            8310..9365
FT                   /locus_tag="Rleg_6296"
FT   CDS_pept        8310..9365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6296"
FT                   /product="putative transcriptional regulator, XRE family"
FT                   /note="PFAM: CBS domain containing protein; SMART: CBS
FT                   domain containing protein; KEGG: eum:ECUMN_2971 conserved
FT                   hypothetical protein from bactreriophage origin; putative
FT                   CBS domain"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6296"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61047"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAD9"
FT                   /inference="protein motif:PFAM:PF00571"
FT                   /protein_id="ACS61047.1"
FT                   /translation="MVDLADELRGVLKDLKGAKTATPVTIRTFLSWFGMQRRTASNVEY
FT                   INSQLKAAGVRTVPNYLDIWVDTPITFELTAKRRGDGPDSTAPAPAVENSTDITFTDSK
FT                   SADDPSFRIGKIESANRAPISVRPTASLQEAITLMLARNFSQLPVMTTDREVKGVISWE
FT                   SIGARNITKTDGTQAQHFMDDAQEISASASLFAGIKIILDHNYVLIRASDKRIAGIVTS
FT                   TDITHQFEETSTPFLLLAEIENHLRALISKKLTVIDIKKACSDEFLPKDFKNVADLTFG
FT                   NYIRILENDENWAKLGLQLDRATFCRELIEVNSIRNDVMHFDPDPLTSENISTLRNVAK
FT                   MLDLIRSFGGF"
FT   gene            9828..11744
FT                   /locus_tag="Rleg_6297"
FT   CDS_pept        9828..11744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6297"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nar:Saro_3943 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6297"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61048"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAE0"
FT                   /inference="similar to AA sequence:KEGG:Saro_3943"
FT                   /protein_id="ACS61048.1"
FT                   /translation="MRGKHKRFVAAKEIKRPLPKLTIPTDVQTFEDYFARLQILQNRAD
FT                   THIYFDTSFLVWLTGVSSDGRAELLSWLHAIGQSRIHIPVWAAHEYFRHHVTGLISNQL
FT                   QVVAGNLRTAANDSYAALRPYLDTPVRGEHRSLAEIHTNVRKTLIDVKRLAGFASKWST
FT                   EHYQSHVNDVFKMINDYGVQSGSVFDNLHDIEILEKSRYTGRIPPGFKDQKKKERDGVG
FT                   SNSFGDLEFWREILRHSKDVRAKSVIILSNDRKNDWLMGAQPAPTIDREDEVIAAKRSW
FT                   NPIPRAHPMLLFEAHASAGVEELVLTDTVYLATYFKKAGIPCQSFFNAAVDVELPEPSE
FT                   FDKDVRKGLKATAAMVGSEPRGKNDDIPAGTLFKDGPNVLVAPLKLNLAFTTSGKLEHP
FT                   PGKALVKAVLDDNTESRGIINFLQLELFKAADTGTLVWLARALVSRSQAGDSLAVAHCS
FT                   DLLGMIDELPSGTATCLYLGFLAGAYFDGDDLRAPPSAPIFQALLGLQDRPFAAQPIAV
FT                   ITGKFRKLHKKPLYSPDPAMPALPVTVQLKDVSGGRSSIFGLQIGGLGVLDAAQSEEEL
FT                   TLSHLLDGQGSATVRSIAERASQLLGFPVAQLLNTAELDRQVEFSPTIGLIAPSETVLL
FT                   IDE"
FT   gene            11749..13344
FT                   /locus_tag="Rleg_6298"
FT   CDS_pept        11749..13344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6298"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nar:Saro_3944 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6298"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61049"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAE1"
FT                   /inference="similar to AA sequence:KEGG:Saro_3944"
FT                   /protein_id="ACS61049.1"
FT                   /translation="MTETPEIGTEIPKKADPYFGGFILETLTIGMYGDSKSAIREYLQN
FT                   SFDSLLLAIEKKITQVSEARIDITMSDSMLVIRDNGMGIGSARAVSVLTSVGASLKDFR
FT                   SQAGFRGIGRLAGIVFCTNLKFVTKAQGETVQTTVTFNAKQLRQQMSPSHGAKYTLTEL
FT                   LEKNITASQSDGHKPDEHYFEVRLEGLVNPPKECLDSSLMSDFVGQVAPVGYRDDFSFA
FT                   AQILKAGEERRFPSASQKDATKKSLLDQVRVLIKRGDEETDVRKPYRNQAAVGKDDVPI
FT                   YDIKIFDPPSRRWWAWIALKKEPGVYKDDRVRAMRVRMRNIQIDGTELMGKQFSSVEGA
FT                   ASFGRFNDWYAGEIFVDPTFVIPNARRDGFEEDDNWIKMQGELADLCADLGRQAYDISR
FT                   RAQLSIRTLARNTKEIEEKGKSIAAAGTDTDKVIELSNAVNKLQRKVGRALRHADLETS
FT                   SQLRSLENKLLDVKTRAVRNLGVSQQVDLSEVREQAQLDIISELMAAFREKLDPPTYSM
FT                   VAKIASELLGSDDF"
FT   gene            complement(13365..14933)
FT                   /locus_tag="Rleg_6299"
FT   CDS_pept        complement(13365..14933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6299"
FT                   /product="HSP90 family molecular chaperone-like protein"
FT                   /note="KEGG: nar:Saro_3947 HSP90 family molecular
FT                   chaperone-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6299"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61050"
FT                   /db_xref="GOA:C6BAE2"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAE2"
FT                   /inference="similar to AA sequence:KEGG:Saro_3947"
FT                   /protein_id="ACS61050.1"
FT                   /translation="MTTEATTRLNRSAILAAKADGQSEPLEEITIGRDVLELVSSAMYI
FT                   DPMTIYREYVQNSADAIDDARSRGLISAEEAGKVLITIDPMTRSIRIRDNGSGLSNEDF
FT                   SRKMAALGASGKRGTNARGFRGVGRLAGLGYAQELVFRSRTASDDSVAELTWDCKRLKA
FT                   ALREGDGDIQSLIRSVAILRKKPKADYPDRFFEVELRGVVRLRSDKLMSPAAVDEYLGQ
FT                   VAPVPFAPEFRFGSEIRDILAPVVGLGDLEIWIEGSERQIFRPHRDVLTPADHPPIQFN
FT                   RLSVSEISAIDGELAAIVWVLHHDYQGALPNGVGVKGLRLRAGNVQIGEHNLLEELFSE
FT                   VRFNAWAVGEIHVVDRKIVPNGRRDHFEQNAHYHNLTNQLAPIAREISRLCRTSSIKRK
FT                   WLRDVELQLQSVHQLTDVIAQGTISDEERARFETRANDGIARAEKTLSSGVLDDEDVVE
FT                   KSAELSELRTRLSTVAAEAGTPVEFHQLDEQERAIFKRFCDLVYRCSTNTVVAKSLVDK
FT                   ILQQL"
FT   gene            complement(14930..16561)
FT                   /locus_tag="Rleg_6300"
FT   CDS_pept        complement(14930..16561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6300"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   nar:Saro_3946 radical SAM domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6300"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61051"
FT                   /db_xref="GOA:C6BAE3"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAE3"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACS61051.1"
FT                   /translation="MANKKILLIEPGYKNKYPPLGLMKIAQYHGPRGKRDNVRFIKGED
FT                   RSVMNEAWDRIYVTTLFSFEYLKISQSIDFALEVANGQADKVFVGGIAASLMHERFLDE
FT                   RRWHGIRFIKGLLSDAPAVSLQLDEFAEELYSSDTNGRPIEDLVPDYDILSQIDYRYPV
FT                   RDAYFAYTSRGCIRKCHFCGVPKLEGMQRDTESLTDLVRAIDEHYGPKKDLILMDNNVV
FT                   ASARFKEIIAEIRDLGFVPGAKLMRPGAKVAVQRRVDFNQGVDARILCKDPMYLRELST
FT                   ICLKPLRIAFDHLGVKKPYEHAVRYAAEYGLTELSNYMLYNFHDGPEDLFERMRLNVTL
FT                   NEELGIRIWSFPMRYQPTNRPNRGHIGEKWSRYQLRSMQIVLQATHGIVSGAPDFFKHA
FT                   FGDTFEDYARILMMPHDFIFNRTWYERYDQDHKLYEFQAEFSSLDNYERAELMELLSSR
FT                   DPREFVTLSDFAANDKVRRILRFYIPVSKDELTTIWATQKELVRLEAMSDLGLAEDERV
FT                   EDAGLDYEEESIAITAELAPKQRAVA"
FT   gene            complement(16554..17579)
FT                   /locus_tag="Rleg_6301"
FT   CDS_pept        complement(16554..17579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6301"
FT                   /product="DGQHR domain protein"
FT                   /note="TIGRFAM: DGQHR domain protein; KEGG: nar:Saro_3945
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6301"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61052"
FT                   /db_xref="InterPro:IPR017601"
FT                   /db_xref="InterPro:IPR017642"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAE4"
FT                   /inference="protein motif:TFAM:TIGR03187"
FT                   /protein_id="ACS61052.1"
FT                   /translation="MAESMWLNCSTGVSVDRPVLLGFAPAKLLHRYSFADVLNEDTGLG
FT                   YQRRFNSQHSQDFRRYIRQTGASTIPLTLNLRPDEKGWKVENVGPGQARLEIELDAGKI
FT                   MAQVDCQHRLGCLEDLDIQLPFMCYVGLSLKEEMEVFSTINSKAKGLSNSLLDFHDAHL
FT                   AGDLAKDRPEIFIALHLNNDPDSPWCRQLDLGGESTSGMTRRASLRTMQKAIKRFLNST
FT                   RSLKTRSPETVTQIVMSFWRAVAEVLPAQWSTPRKHILTKGVGVYALMDIAADLYNEAE
FT                   DGAKLDRGYFVNRLADFAYDIDWSTTGRLKGLGGEGGVNEAVEYIRETRKRSHLKVVSN
FT                   G"
FT   gene            complement(17678..18691)
FT                   /locus_tag="Rleg_6302"
FT   CDS_pept        complement(17678..18691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6302"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ecm:EcSMS35_4320 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6302"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61053"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAE5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS61053.1"
FT                   /translation="MNAMDKHPLKAGEPILIRGVEVPVETGSLPQKHLQFFVENPRVYS
FT                   ILRSDGEEPSQADIERKLLDMDHVKALIQDIKRDGGLTDPVVVRAGTLEVLEGNSRLAA
FT                   YRALAKNDPVKWGYMKVRLLPQDIDEALIFALLGQYHIKGKKDWAPFEQAGFLYRRHKT
FT                   HDVDTGKLAIEIGLSKRKVEHLIAVYQFMLDHDEADTAKWSYYDEYLKSSKIRKARLAN
FT                   VAFDSLVVGKIKSDEIAKAVDIRDRLPIICSAPKALQKFVNGTEGFEDAFDHAVEAGAD
FT                   NTPLKKITKFRNWLALPETESALNHAQDETRKKILFELGKLSGRVDTLAQKLNPKK"
FT   gene            complement(18688..20169)
FT                   /locus_tag="Rleg_6303"
FT   CDS_pept        complement(18688..20169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6303"
FT                   /product="helicase domain protein"
FT                   /note="PFAM: helicase domain protein; SNF2-related protein;
FT                   SMART: helicase domain protein; DEAD-like helicase; KEGG:
FT                   mxa:MXAN_7274 SNF2/helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6303"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61054"
FT                   /db_xref="GOA:C6BAE6"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAE6"
FT                   /inference="protein motif:PFAM:PF00271"
FT                   /protein_id="ACS61054.1"
FT                   /translation="MLRIQKAASLDAKRSAFPHQMEAFAAVKDLPYAAVFHEQGLGKTK
FT                   IGLDLALFWLANDVADSVLIVTKKSLIENWRNEIADHSHLRPRILGQDRNANFYAFNSP
FT                   ARLYLMHYEAIVSERKRLELFLKTRKVAAILDEAHKIKNPEAEISQAAHVLASGFVRRV
FT                   IMTGTPVANRPYDLWSQIKFLDLGESLGDEFAAFKRDLDLSNELRNDDRRAQAFADELE
FT                   AVFEKVRPFSVRETKKTAGLKLPDKTIRNLECELEPRQAEIYAQFRDELAAIVVRQGRP
FT                   VLDDAEDILKRLLRLVQVASNPAMVDQAYRSVPGKMRALDELVTSAIDAREKIVVWTNF
FT                   TMNAEALCRHLGEFGAVLVHGGIEIAKREEALTAFKTDPQTRVLVATPGAAKEGLTLTV
FT                   ANHAVFYDRSFSLDDYLQAQDRIHRISQDKPCFVTNLIGMDTVDAWVDALLSAKHLAAQ
FT                   LGQGDIDREEYDKRADYAFADMIREVLRLNTQEKE"
FT   gene            complement(20177..20596)
FT                   /locus_tag="Rleg_6304"
FT   CDS_pept        complement(20177..20596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6304"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6304"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61055"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAE7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS61055.1"
FT                   /translation="MGETAVHARLVDALIVYAEIELGQRSNLCLRNDAVRPVRGERPPR
FT                   INGYVPDLYATDVPTTATLIGEAKTKADLETDHTRVQIQAFLGYLSQTPNGIFVLSVPL
FT                   SAAATARRLLSQLKAPFIEAQTRTVVIDRMRAVVC"
FT   gene            complement(20601..21647)
FT                   /locus_tag="Rleg_6305"
FT   CDS_pept        complement(20601..21647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6305"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6305"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61056"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAE8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS61056.1"
FT                   /translation="MSSNSGGRIKLVNAGTHQNIAVDTIELDRSNPRIRKFLEMYGDNP
FT                   SPEAIYLALGAGNEEEPGSSSSTTFEKLKQSILTNGGIIQPVILNRRADGTLVCVEGNT
FT                   RVALYKSFLDDGVKGSWTHIPSLVHDEIDEASVHAIRLQIHLVGTRPWDPYSKAKYLYE
FT                   LRTQEHLPFATIVDYCGGRQSEVLESINAYADIEKYYRPVVGEDGEFDTTRFSGFVELQ
FT                   KAGIKQAINQAGFDCFDFARWIHGGKLHPLQKVRVLPRVLRNEKAREIFLKDGIKKAEA
FT                   VLEKPDLTKTLQEAQLGQLARALVTQIAALRYDEHQRIEADPGGETAQALIDAQAELSK
FT                   LVLSLKLG"
FT   gene            21800..24466
FT                   /locus_tag="Rleg_6306"
FT   CDS_pept        21800..24466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6306"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_0239 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6306"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61057"
FT                   /db_xref="GOA:C6BAE9"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAE9"
FT                   /inference="similar to AA sequence:KEGG:Ppro_0239"
FT                   /protein_id="ACS61057.1"
FT                   /translation="MSEHEAQIEAVANESLESFAMISGTARDHLEAARAPSIQIADNSW
FT                   TNPNADQNRRRIDQENAETHRLLIEEPAIARVRVTDEDGATTDYYICRTSPVPLTNKGI
FT                   KLASYRSPVGRLASLPVGSDHTLFRDGRPVTVEVVEFARFQPRVVDGQWDAHNAVVAGG
FT                   DYGPLSIESFRRWLERILPDVDASVLDALLEEENAAAIIRAGLHRSVITRMDLRDQPLL
FT                   DQYQDEIFRLPLNSRLLLLGAPGTGKTTTLIKRLGQKLDIAFLEEDERRAIGATSPSRE
FT                   SDYARDWIMFTPTELLKLYVKEAFNREEIPAPDDRISTWSDYREELARNTFPILRSTSN
FT                   SSSYVLKDNALTLGPGSQDDAIAWFEDFDQWQRAAFWDEMRSSATALSEQAAPDVAQVG
FT                   ARLSSAIGPQGSESTQVFVSLLPIAEDIRAMVEARKAATDTELKKSLNLQVNRDRGFLD
FT                   SFGAFIEGLSDVTDDADDQDEDEEETNQPRVGRAAAMNHYLRVLRTQARARARRRNVPK
FT                   ASRTGRIIDWLAGRMPADPDLQRIGESLVVQSALRWFVNPVRRYVDGVPQRYRRFRRIR
FT                   QAEGLWFAPDGHAVTDLHPLEADLILLAMMRSSDELVRRARRLDTPENPAQRILTRMSE
FT                   LYRTQVLVDEATDFSPIQLACMSMLARPVSRSFFACGDFNQRVTAWGTRSLEQMKWVLP
FT                   DIDNRYVSIAYRQSKKLHALARQLVALDGDSAAEVALSDFADNEGVSPVLGTGMSDLAE
FT                   TARWLANRIIEIEETVRELPSIAVLVNSEVDVRPIADALGEVLLDNNIRVIPCPDGQVR
FT                   GREGAVRVFNVEHIKGLEFEAVFFVGVDTLAANLPDLFDKYLYVGATRAASYLGLTCDQ
FT                   FLPDRVKHLEPLFEQKW"
FT   gene            complement(24512..25636)
FT                   /locus_tag="Rleg_6307"
FT   CDS_pept        complement(24512..25636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6307"
FT                   /product="protein of unknown function DUF1612"
FT                   /note="PFAM: protein of unknown function DUF1612; KEGG:
FT                   atc:AGR_pAT_23 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6307"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61058"
FT                   /db_xref="InterPro:IPR011670"
FT                   /db_xref="InterPro:IPR021068"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAF0"
FT                   /inference="protein motif:PFAM:PF07756"
FT                   /protein_id="ACS61058.1"
FT                   /translation="MTYDLAKISMTALMRPAFDAGVALTRLDERIARSPVGAGFLERSQ
FT                   FTDACASLWIDGELVHLEDLVLHDATRDIRTPTHELTIARDVLRTRRRIAAQSPDWASS
FT                   VEGIRSLRKTSEIRSGGGDEAGTARVIRPAVAAGPEGKGEDSDEAKNLPGVDYAAIDAV
FT                   LARSEAAIEDAKRPSRAAEKDPLVYDLDWDEEERLEKWRAVLRQAQELPAVLQAIVALD
FT                   AWNEILVLQHAPWLGRLLCASILRKAGIMTGAHLVAINLGLKTIPVDRRRHRDRETRLL
FT                   AIAQGLIAAAEIGLKEHDRLALARKMMERKLEGRRTSSKLPELVGLVMARPLVSAKMVA
FT                   KTLGVTPQAARRIVGELGLREMTGRGRFRAWGIL"
FT   gene            25826..26116
FT                   /locus_tag="Rleg_6308"
FT   CDS_pept        25826..26116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6308"
FT                   /product="prevent-host-death family protein"
FT                   /note="TIGRFAM: prevent-host-death family protein; KEGG:
FT                   rec:RHECIAT_PC0000869 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6308"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61059"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAF1"
FT                   /inference="protein motif:TFAM:TIGR01552"
FT                   /protein_id="ACS61059.1"
FT                   /translation="MSQTSYKISEARKNFAEVLERANQGEEIIIMRGSEIYARIGPADG
FT                   GKRPFGLLRQRGLPDDLFDEVDAEQVAIDAGDWNDDVGVWQGGPSEREPQP"
FT   gene            26113..26490
FT                   /locus_tag="Rleg_6309"
FT   CDS_pept        26113..26490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6309"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_PC0000870 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6309"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61060"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAF2"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_PC0000870"
FT                   /protein_id="ACS61060.1"
FT                   /translation="MKILLDSHAVYWWTIGSERLSGMARSLTEDKANSVLVSAVSFYEL
FT                   DNKMRLKKLDLRPQELRAAVADSGLQTLAITDLHAELAASFDWDHRDPWDRILAAQTRL
FT                   EHCAFVSLDTAFDAVLHERVW"
FT   gene            26502..26831
FT                   /locus_tag="Rleg_6310"
FT   CDS_pept        26502..26831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6310"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sme:SMa2255 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6310"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61061"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAF3"
FT                   /inference="similar to AA sequence:KEGG:SMa2255"
FT                   /protein_id="ACS61061.1"
FT                   /translation="MMIFADVQEAAERLEELIELARQDEVYVCRDGRPVARLTAFSSSP
FT                   VLGSDQPTKSLGDGVAAASASRIAEAGRPSSLDDVWAIAATGRPKDVDLTSAHDDFYDA
FT                   DGAPR"
FT   gene            26828..27970
FT                   /locus_tag="Rleg_6311"
FT   CDS_pept        26828..27970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6311"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG:
FT                   ret:RHE_PA00002 site-specific integrase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6311"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61062"
FT                   /db_xref="GOA:C6BAF4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAF4"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ACS61062.1"
FT                   /translation="MSVTHSASVTSRAEALDTIAAVLPIDRRDKLAELLTDQDVETLRH
FT                   LVNAGMGDNTLRALTSDLAYLEAWSLAATGSALPWPAAEALLLKFVAHHLWDPQRREND
FT                   PEHGMPADVEDVLRFRGFLRSLGPHAPDTVRRRLANWSTLTKWRGLDGAFTSPALKSAI
FT                   RLAVRAVPRPRRRKSAKAVTGEVLARLLATCRSDSLRDVRDRAILMVAFASGGRRRSEV
FT                   AGLRREQLTVEAPVTGEDDIPLPSLTIHLGRTKNSGASQDEVVYLTGRPVDALNAWLTA
FT                   AKVDGGSVFRAIDRWGNVSRRALDPKAVNDIVKRRVAEAGLEPGEFSAHGLRSGYLTEA
FT                   ANRGIPLPEAMEQSRHRSVQQASSYYNNATRRSGRAARML"
FT   gene            28089..28337
FT                   /locus_tag="Rleg_6312"
FT   CDS_pept        28089..28337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6312"
FT                   /product="Rv0623 family protein transcription factor"
FT                   /note="PFAM: Rv0623 family protein transcription factor;
FT                   KEGG: rru:Rru_A1269 transcription factor"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6312"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61063"
FT                   /db_xref="InterPro:IPR011660"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAF5"
FT                   /inference="protein motif:PFAM:PF07704"
FT                   /protein_id="ACS61063.1"
FT                   /translation="MSLSIKDPEAHRLAQAISHATGESMTRVVTEALRERFAKIERRKG
FT                   RASVEELLAIADRAAAHVKRPYVDHAEFLYDENGLPK"
FT   gene            28334..28720
FT                   /locus_tag="Rleg_6313"
FT   CDS_pept        28334..28720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6313"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; KEGG:
FT                   nha:Nham_4577 PilT protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6313"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61064"
FT                   /db_xref="GOA:C6BAF6"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAF6"
FT                   /inference="protein motif:PFAM:PF01850"
FT                   /protein_id="ACS61064.1"
FT                   /translation="MIIDTSALVAILYREPEAASFVKIIHDAELTRISVANYVELSMVV
FT                   EGQLGPDGMRQAEAFFRRAGIIIEPVTLEHCELARQAFLDFGQGRHKAGLNFGDCFAYA
FT                   LAKASGEPLLFKGNDFAQTDVRAA"
FT   gene            28723..29323
FT                   /pseudo
FT                   /locus_tag="Rleg_6314"
FT                   /note="SNP /replace=A; SNP /replace=C; SNP /replace=A; SNP
FT                   /replace=G; SNP /replace=T; SNP /replace=C; SNP /replace=G;
FT                   SNP /replace=G; SNP /replace=T; SNP /replace=G; SNP
FT                   /replace=C; SNP /replace=G; SNP /replace=G; SNP /replace=T;
FT                   SNP /replace=C; SNP /replace=G; SNP /replace=C; SNP
FT                   /replace=G; SNP /replace=T; SNP /replace=T; SNP /replace=C;
FT                   SNP /replace=G; SNP /replace=A; SNP /replace=T; SNP
FT                   /replace=A; SNP /replace=T; SNP /replace=T; SNP /replace=A;
FT                   SNP /replace=G; SNP /replace=C; SNP /replace=A; SNP
FT                   /replace=T; SNP /replace=G; SNP /replace=G; SNP /replace=T"
FT   gene            complement(29391..30698)
FT                   /locus_tag="Rleg_6315"
FT   CDS_pept        complement(29391..30698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6315"
FT                   /product="replication protein C"
FT                   /note="PFAM: replication protein C; KEGG: ret:RHE_PC00234
FT                   plasmid replication protein RepCc"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6315"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61065"
FT                   /db_xref="InterPro:IPR005090"
FT                   /db_xref="InterPro:IPR021760"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAF7"
FT                   /inference="protein motif:PFAM:PF03428"
FT                   /protein_id="ACS61065.1"
FT                   /translation="METGSVTTPFGRRSMTLGMLASQVMAGEIKPDQSVDKWKLFRALC
FT                   EAKPLLGIGDRALAVLNALLSFYPKNELAQGNGLIVFPSNIQLSLRTHGMAEQTVRRHL
FT                   AALVDAGLLLRKDSPNGKRYVRRDRAGEVDEAFGFSLAPLLARADEIEQLAAEVMAERL
FT                   HVQRLRERITLCRRDIAKLIEAAVEEEIPGDWQGLYREFRDLIEGLPRSPTTAQLELLL
FT                   DELTGLRTNILNQLEIQVKSTKQRGNADYIERHIQNSNPESISEVEPGFETKQGATAEP
FT                   DNDRGTVTAAKGRGETGHPFAQTEEEQSRRPGVRNDGGGLKAFPLGLVLQACPEILAYG
FT                   PDGAIRNWRDLMAAAVIVRSMLGVSPSAYEEAANVMGPENAATVMACILERGGHINSAG
FT                   GYLRGLTRRSEKGEFAIGPMLMALLRANAPAGRKVG"
FT   gene            complement(30898..31887)
FT                   /locus_tag="Rleg_6316"
FT   CDS_pept        complement(30898..31887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6316"
FT                   /product="plasmid partitioning protein RepB"
FT                   /note="KEGG: ret:RHE_PC00233 plasmid partitioning protein
FT                   RepBc; TIGRFAM: plasmid partitioning protein RepB;
FT                   parB-like partition protein; PFAM: ParB domain protein
FT                   nuclease; RepB plasmid partition; SMART: ParB domain
FT                   protein nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6316"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61066"
FT                   /db_xref="GOA:C6BAF8"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR011111"
FT                   /db_xref="InterPro:IPR017819"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR037972"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAF8"
FT                   /inference="protein motif:TFAM:TIGR03454"
FT                   /protein_id="ACS61066.1"
FT                   /translation="MSPKGRDILKSMVGAVEPTRPDVPSVQQPHRPSGAVKAMNLSLGR
FT                   LGEEAAAAKALRESLASGDKVLEIDPAAVEMSFIRDRIPVDKDAEFERLKQSIQESGQQ
FT                   VPILVRPDPARAGHYQAAYGHRRLRAAAEIGVPVKAVVRKLTDEELILAQGQENGPRVD
FT                   LSFIERALFARRMDEHGFSRDMISKALATDKPETSRLLQVAQTIDPEIILAIGPAPKVG
FT                   RPRWLAFAEKFRETGGQKKAQAAIRAADFVTLETNSRFDVIWKAVEEKSAPQRAEQTLR
FT                   TQGGAPLALVARSGKTFRITVKSAAFSEFLAQRLVGLAAEFEEENEGK"
FT   gene            complement(31884..33101)
FT                   /locus_tag="Rleg_6317"
FT   CDS_pept        complement(31884..33101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6317"
FT                   /product="plasmid partitioning protein RepA"
FT                   /note="TIGRFAM: plasmid partitioning protein RepA; PFAM:
FT                   Cobyrinic acid ac-diamide synthase; regulatory protein
FT                   MerR; KEGG: ret:RHE_PC00232 plasmid partitioning protein
FT                   RepAc"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6317"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61067"
FT                   /db_xref="InterPro:IPR017818"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAF9"
FT                   /inference="protein motif:TFAM:TIGR03453"
FT                   /protein_id="ACS61067.1"
FT                   /translation="MPTKAAIVEKAKRASRVSIDETIAQDSTMLSSQLQVLFERLFSPD
FT                   ARKSLRRFSSTETAKLLGVTDSYVRHLAAQVESINPEKTAAGRRVFSLEEIHAMRHHLG
FT                   RTKPSYLPMRRPGDHLQVIAVTNFKGGSGKTTTSIHLAQFLALRGYRVLAVDLDPQASM
FT                   SAMLGYQPEFDVGENETLYGAIKYDETRRDVADIVRQTYFPGLDLIPGNLELHEFEHDT
FT                   PKALADTNRDDKDMFFMRVGNALHSLEQSYDVVIIDCPPTLGFLTLSALCAATSVLITV
FT                   HPQMLDVASMNQFLTMTSDLLAVVKQAGGNLDYDWMRYLVTRYESNDGPQAQIVAFLRS
FT                   LFGERVLTSMMVKSTAVSDAGLSKQTIYEAGRDTMHRQTYDRGVESVDSVNAEVEQLIR
FT                   SAWSRT"
FT   gene            complement(34404..35489)
FT                   /locus_tag="Rleg_6318"
FT   CDS_pept        complement(34404..35489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6318"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_PC00229 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6318"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61068"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAG0"
FT                   /inference="similar to AA sequence:KEGG:RHE_PC00229"
FT                   /protein_id="ACS61068.1"
FT                   /translation="MAKSSSDPRDEINAPLAHGALNLPLVAIDDYNNELRDKDGFVGDN
FT                   ANKKTFQQKLDDWRKRIRKVGDDPIGKTATEKLSKKKIDAILKGDDLAAAALVMGAVED
FT                   FAQDFADVIAKFLKDKGWGKTERIVVGGGFRRSHFGELTIARTMVILKAAGVDVEVVPI
FT                   VHHPDEAGLIGAIHLMPRWMFKGHEAILAVDIGGTNVRAGVVKFGKDDVPNFADASVWE
FT                   STIWRHADDEPSRTATIERLAAMLRDLIGKAEKANLKPAPIIGIACPGIIKADGSIERG
FT                   GQNLPGGNWESDSFNLPAALMKAIPEIGDDSTFVMMHNDAVVQGLSQIPFMSDVSRWAV
FT                   LTIGTGLGNAHFTNREGTKVR"
FT   gene            35635..36393
FT                   /locus_tag="Rleg_6319"
FT   CDS_pept        35635..36393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6319"
FT                   /product="HAD-superfamily hydrolase, subfamily IIB"
FT                   /EC_number="3.1.3.12"
FT                   /note="KEGG: ret:RHE_PC00228 trehalose-phosphatase protein;
FT                   TIGRFAM: HAD-superfamily hydrolase, subfamily IIB;
FT                   trehalose-phosphatase; PFAM: trehalose-phosphatase;
FT                   Haloacid dehalogenase domain protein hydrolase type 3"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6319"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61069"
FT                   /db_xref="GOA:C6BAG1"
FT                   /db_xref="InterPro:IPR003337"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAG1"
FT                   /inference="protein motif:TFAM:TIGR01484"
FT                   /protein_id="ACS61069.1"
FT                   /translation="MQDDAATQEMLSLVLEEPDRWAMFLDIDGTLLNLAPTPDAIEVPE
FT                   ALPGQLHRLSNKLGGALALVTGRSLAYADALFKPFAFPTAGLHGAEIRNAAGMQTVEAT
FT                   PEFQALKHALTAEAEHYPGVLIEDKGAAVAAHYRLAPEYEKVLEDRMHHYAELAGPNWA
FT                   LQLGKMVFELRPARSSKGDALERFFQSDPFKNRSPITIGDDLTDESMFAIANARGGVSV
FT                   RVGAIGAPSCATSRLSSSALVRNVIAALAA"
FT   gene            36592..37476
FT                   /locus_tag="Rleg_6320"
FT   CDS_pept        36592..37476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6320"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; SMART: helix-turn-helix- domain containing
FT                   protein AraC type; KEGG: ret:RHE_PC00227 AraC family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6320"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61070"
FT                   /db_xref="GOA:C6BAG2"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAG2"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ACS61070.1"
FT                   /translation="MEPDLEVVQIRPGESFATKAHGYPYHTVRWHFHPEYELHLVVATT
FT                   GRYFVGDFIGEFEPGNLVLAGPNLPHNWISDVPKGSSIPLRCQLIQFSENFISGTMKVL
FT                   AELGPFDPVLEASRRGVLFGADTSRQVAPLMNEVQQAHGVRRIELFMMIVGLLSRAQDS
FT                   QLLASPSYLPDPSGYMSAGINKALAYIRENLTKSFDEADLATIADQSTGAFSRAFRRHT
FT                   GMSLVQYVKRLRINLACQILMSDDHASITDICFEVGFNNLSNFNRQFLAEKGMTPSRFR
FT                   RLLGDNINVAKAA"
FT   gene            37700..38764
FT                   /locus_tag="Rleg_6321"
FT   CDS_pept        37700..38764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6321"
FT                   /product="putative sugar ABC transporter, substrate-binding
FT                   protein"
FT                   /note="KEGG: ret:RHE_PC00226 putative sugar ABC
FT                   transporter, substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6321"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61071"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAG3"
FT                   /inference="similar to AA sequence:KEGG:RHE_PC00226"
FT                   /protein_id="ACS61071.1"
FT                   /translation="MKFSTKAAGAAVFVLSLLGGTSAFAQTAVADATVAFLMPDQGSTR
FT                   YEEHDHPGFVAEMKKLCASCKVLYQNADADIAKQQQQFNSAITQGAKVIVLDPVDSAAA
FT                   ASLVQLAQSQGVKVIAYDRPIPKGKADFYVSFDNKAIGKAIAESLVQHLKAQNVPTDGG
FT                   GILQINGSPTDAAAGLIKDGIHQGLASGGYKTLAEFDTPNWQPANAQQWAGGQITRFGK
FT                   QIVGVVAANDGTGGGAIAAFKAAGVDPVPPVTGNDATIAALQLIIAGDQYNTISKPSEI
FT                   VAAAAADVAVKLLAGETIKAEMTLYDTPAQLFVPAVVTAENLKAEIIDKKINTAEELCT
FT                   GRYADGCKKLGITK"
FT   sig_peptide     37700..37777
FT                   /locus_tag="Rleg_6321"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.954 at
FT                   residue 26"
FT   gene            38836..39657
FT                   /locus_tag="Rleg_6322"
FT   CDS_pept        38836..39657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6322"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ret:RHE_PC00225 sugar ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6322"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61072"
FT                   /db_xref="GOA:C6BAG4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAG4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS61072.1"
FT                   /translation="MSETSHTPDPSRQPVLSLRGISKNFGAVSALTDIDLDVYAGEVVA
FT                   LVGDNGAGKSTLVKILAGVHQPSSGTIFFESKPANLSSPSAALDLGIATVFQDLALCEN
FT                   LDVVANIFLGKELNPFQLDEVAMEIAAWKLLNELSARIPSVREPVASLSGGQRQTVAIA
FT                   RSLLLEPKLIMLDEPTAALGVAQTAEVLDLIERVRERGLAVIMISHNMEDVRAVADRIV
FT                   VLRLGRNNGTMLPDASNEQLVSAITGASNNSVSRRASRRQAQSQQNEEGRP"
FT   gene            39654..40913
FT                   /locus_tag="Rleg_6323"
FT   CDS_pept        39654..40913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6323"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   ret:RHE_PC00224 sugar ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6323"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61073"
FT                   /db_xref="GOA:C6BAG5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAG5"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACS61073.1"
FT                   /translation="MMKTIQNEPAAPALLDRSDERVRHDDSLTGSIRAFGDRIRSGDLG
FT                   SLPVIVGLAIIWTVFQALNPVFLSSSNLVNMLFDCSTVGVISLGIVCILMVGEIDLSVG
FT                   SVSGFASALVGVFWVNQGWPVVLAVLAAMIVGVLIGSLYAFLFNRFGMPSFVSTLSGLL
FT                   AVLGLQLYILGATGSINLPYGSWLVSFGQIMVMPDPIAYLLVALAGIAFFFASYRTSAR
FT                   RRAAGLSAKSARGLLLRAVIITLALEAVAFYLNQSRGIPWMFGLFVGLTSAMNYALTRT
FT                   KWGRSMHAVGGNREAARRSGINVSRIYTSAFVMCALLAATGGVLSAARLATASQQAGTG
FT                   DVNLNAIAAAVIGGTSLFGGRGSAYSALLGIIVIQSIASGLTLLDLSSSLRYMITGAVL
FT                   AVAVIVDSLARRSRISHGRA"
FT   gene            40940..41668
FT                   /locus_tag="Rleg_6324"
FT   CDS_pept        40940..41668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6324"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: ret:RHE_PC00223 ribitol
FT                   2-dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6324"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61074"
FT                   /db_xref="GOA:C6BAG6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAG6"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACS61074.1"
FT                   /translation="MGQDLSGKVAAVTGAASGIGLECAKALLAAGVRVVLVDRNEEALR
FT                   EICSKLDANAIPLVIDLTDPKSVERMMPEILEKTGQLDIFHANAGSYIGGEVLGGDPDA
FT                   WDRMLNLNINAAFRSVHAVLPHMVERKTGDIILTSSVAGMIPVVWEPIYTASKHAVQAF
FT                   VHTLRRQVAKHGLRVGAVAPGPVVTALLSDWPQEKLDEALAAGGLMEANEVAEAVLFML
FT                   TRPRNITIRDLVILPQRADI"
FT   gene            41721..42485
FT                   /locus_tag="Rleg_6325"
FT   CDS_pept        41721..42485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6325"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; Male sterility domain; NAD-dependent
FT                   epimerase/dehydratase; KEGG: ret:RHE_PC00222 short chain
FT                   dehydrogenase/reductase family oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6325"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61075"
FT                   /db_xref="GOA:C6BAG7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAG7"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACS61075.1"
FT                   /translation="MIFDRFRLNGQVALVTGGTRGIGLAIAEALGEAGAKVIITGRTRN
FT                   LAAEDQLSRVGVDCDFIAVDLMKESAADELVAETLSRAGRLDILVNNAGIAIHGDSGEF
FT                   SDAIWREIMTVNVDAVFRACRAALAPMRRQGGGAILNIGSISGIVSNIPQNQVAYNTSK
FT                   AAVHMMTKSLASEVAAENIRVNAIAPGYIETDLSRGGIDNPDWFPTWRSMTPMGRVGQP
FT                   EEVAGAALFLCSAAASYVTGEVLVIDGGYTTR"
FT   gene            complement(42662..43057)
FT                   /locus_tag="Rleg_6326"
FT   CDS_pept        complement(42662..43057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6326"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; 3-demethylubiquinone-9
FT                   3-methyltransferase; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6326"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61076"
FT                   /db_xref="GOA:C6BAG8"
FT                   /db_xref="InterPro:IPR028973"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAG8"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACS61076.1"
FT                   /translation="MQLANYLFFANGCEQALAFYTECGLGQVTQLKRHGADGMSAAPEA
FT                   MRGKVMHARFEGPDVLFFASDNHDAEPMRGSAHMLIMEDRDSTASLFARLAEGGKITTP
FT                   LAVQPWGSYYGKLTDRFGVQWMLDCLN"
FT   gene            complement(43144..43569)
FT                   /locus_tag="Rleg_6327"
FT   CDS_pept        complement(43144..43569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6327"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6327"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61077"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAG9"
FT                   /inference="similar to AA sequence:KEGG:Avi_0654"
FT                   /protein_id="ACS61077.1"
FT                   /translation="MPITLTVPEGLLSLEGQAQAFAGLTDALLDAAGLTGNTFMTANVI
FT                   GTINVLPREHVLAAGKPIAAAFIELKLPEIALVSAETRQAFFEKAADVVEQAAEGRLRR
FT                   EHIWSNIIYAPEGAWGIASRSYSNADLVAAIQGGATQ"
FT   gene            43691..44290
FT                   /locus_tag="Rleg_6328"
FT   CDS_pept        43691..44290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6328"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: transcriptional
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6328"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61078"
FT                   /db_xref="GOA:C6BAH0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAH0"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACS61078.1"
FT                   /translation="MRYSAEHKQETRTRVIAAAGRVFRQEGYGGAGIDSLTKAAGVTNG
FT                   AFYGHFKSKGEAFRTAVLTGLEELRQGIAGLKASQPKDWLATFVGYYLGYKRTCDLGES
FT                   CALPSLSPDVVRADDETRSAYTVELKRLIEEIAVGLPEGEVSGQPQTRREDQAILLLAM
FT                   LSGGVTLARAASDPALSKRIADVIAKAALTAIDPGN"
FT   gene            complement(44405..45427)
FT                   /locus_tag="Rleg_6329"
FT   CDS_pept        complement(44405..45427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6329"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein; KEGG:
FT                   bid:Bind_3301 integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6329"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61079"
FT                   /db_xref="GOA:C6BAH1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAH1"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACS61079.1"
FT                   /translation="MSAPKVRTKWRPTLALIVYAVLLAVMALPILIVIWFRAVEASSNR
FT                   MAPAEIGALAVVVMLTLGVAYVLTRTITGPIDALIARTEEIARGGKGAIRPLESYGTRE
FT                   IAVLSQSFLDLAGKLVDRTEYVRSFAAHVSHELKSPLTAIRGAAELLRDDDAEKPMTKV
FT                   QRLHFLDNIVADAVRLDALLQRLRELAQAETPVAEGKSSVTDILSSLRGRFPALRVSGS
FT                   GDTEISVALPQEAAGIVFANLADNALQHGATLLEIRVSTDARTAVILVRDDGSGISEVN
FT                   RQRIFQPFYSTRREQGGTGMGLSIVGAMLSSHGGTIRLLRATGAGTEFEITIPLQILSG
FT                   "
FT   sig_peptide     complement(45344..45427)
FT                   /locus_tag="Rleg_6329"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.969) with cleavage site probability 0.629 at
FT                   residue 28"
FT   gene            complement(45427..46131)
FT                   /locus_tag="Rleg_6330"
FT   CDS_pept        complement(45427..46131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6330"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: bra:BRADO3955 OmpR family two-component
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6330"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61080"
FT                   /db_xref="GOA:C6BAH2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAH2"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACS61080.1"
FT                   /translation="MAPRILVVDDEPHIRDVICFALERAGLAWMAARNGTEAMAAFRRG
FT                   NIDLIILDIGMPEMDGLEVCRQIRKTSGLPILFLSARDEEIDRILGLEIGGDDYVTKPF
FT                   SPRELVARVKAILKRSSNGAEPDRRHATLVAGELSLDRRGRTVMFGENTIAMTALEFAI
FT                   LDALLSRPDMVFSREQLMEAAYGAGTYVADRTIDSHIRNIRAKFLVAGGQGIIATVRGI
FT                   GFKLGREIGRKA"
FT   gene            complement(46179..47675)
FT                   /locus_tag="Rleg_6331"
FT   CDS_pept        complement(46179..47675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6331"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:blr7618 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6331"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61081"
FT                   /db_xref="GOA:C6BAH3"
FT                   /db_xref="InterPro:IPR025231"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAH3"
FT                   /inference="similar to AA sequence:KEGG:blr7618"
FT                   /protein_id="ACS61081.1"
FT                   /translation="MDTTDTLTEAMPIRRGSSRIVGLFALVALADFLIFGEMPGINLFL
FT                   FALAVCAGILLLAGKIRAPSIAALLFGFSVLASAPLLEAPSLTGIALCLSALIAVALVG
FT                   ARLMPRNLTGLPLVFLRFTLIIPLRLADDFRKYLKAPAKRFSFTVVWQGVGLWIMPLAL
FT                   AAVFVFLFAAANPLIEIALRSIRFAVLLQFLDLWRIGFWMMIAAVIWALLRPRLKRRTA
FT                   RSQAGRAFVIVPTRNAPLGQASLLRSLFLFNALFAVQTLLDLVYLWGGADLPDHMSHAE
FT                   YAHRGAYPLIATALLAAGFVLLAMRRGGPGDQSSLIRGLVHAWIGQNVLLCLSSMLRLG
FT                   LYVEAYSLTELRVAAGLWMGLVAIGLVLILLRILFNRSNEWLIAANLASLIAVLYISAF
FT                   IDLPDVIARFNVAHSQEISHDGPPLDIYYLSTLGPSAIPALDLHIRALPEYRTDKISEA
FT                   QLIRGSLVWKFEHRPRDWRSWSFRSSRLETYLLSPAAIAR"
FT   gene            complement(48261..48449)
FT                   /locus_tag="Rleg_6332"
FT   CDS_pept        complement(48261..48449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6332"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: smd:Smed_3631 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6332"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61082"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAH4"
FT                   /inference="similar to AA sequence:KEGG:Smed_3631"
FT                   /protein_id="ACS61082.1"
FT                   /translation="MTEHIEPRQVETDDLTKVWSVTEFCARHRIDAEEQALLLKLFGPF
FT                   ATASELLHNAKRAPRFR"
FT   gene            complement(48645..49358)
FT                   /locus_tag="Rleg_6333"
FT   CDS_pept        complement(48645..49358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6333"
FT                   /product="autoaggregation protein"
FT                   /note="KEGG: ret:RHE_PC00209 autoaggregation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6333"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61083"
FT                   /db_xref="InterPro:IPR010221"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAH5"
FT                   /inference="similar to AA sequence:KEGG:RHE_PC00209"
FT                   /protein_id="ACS61083.1"
FT                   /translation="MASPIHATDDSATFKETDIISGNLLSNDSSDNGHLFLRAFDGASV
FT                   GAKAGNSQVTEIQGDYGTFFVKPDGSYTYVLSDAAKIGFANGESYQEKVSYKISDGSGH
FT                   TDVGLFTLNIQGVTQVKPIAVDDHYSFNEGSAIGGNVLDNDIAGDNGKLFLRQFDGTNV
FT                   SAKSGLDAVTDIVGDHGIFHVKPNGEFTYTLTEDLAAGQNVTETVQYYKISDGEGHTDA
FT                   GILTLNITGTDAHLA"
FT   gene            complement(49629..49730)
FT                   /locus_tag="Rleg_6334"
FT   CDS_pept        complement(49629..49730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6334"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6334"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61084"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAH6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS61084.1"
FT                   /translation="MHKRLSHQPATAEIFAWIGYVSNIGLGEHNCNA"
FT   gene            49812..49964
FT                   /locus_tag="Rleg_6335"
FT   CDS_pept        49812..49964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6335"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6335"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61085"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAH7"
FT                   /inference="similar to AA sequence:KEGG:Arad_8722"
FT                   /protein_id="ACS61085.1"
FT                   /translation="MNNTHTATVVAAANPREDIEAVRSAPRNWKPFPCLLTRRELQALI
FT                   AEQLG"
FT   gene            50004..50240
FT                   /locus_tag="Rleg_6336"
FT   CDS_pept        50004..50240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6336"
FT                   /product="ribosomal protein S21"
FT                   /note="TIGRFAM: ribosomal protein S21; PFAM: ribosomal
FT                   protein S21; KEGG: ret:RHE_PC00208 30S ribosomal protein
FT                   S21"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6336"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61086"
FT                   /db_xref="GOA:C6BAH8"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAH8"
FT                   /inference="protein motif:TFAM:TIGR00030"
FT                   /protein_id="ACS61086.1"
FT                   /translation="MQVLVRDNNVDQALRVLKKKMQREGLFREMKERRAYEKPSERRVR
FT                   EKAQAISRQRKATRKKMQREGLLPGPKRTAAAR"
FT   gene            50301..50495
FT                   /locus_tag="Rleg_6337"
FT   CDS_pept        50301..50495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6337"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6337"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61087"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAH9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS61087.1"
FT                   /translation="MDELNSLTVSEERIEDCRDVVEPDLQDLIQRTLTSGFSLEEILIA
FT                   VSELVAEDFAMVMKTPSVH"
FT   gene            50603..51082
FT                   /locus_tag="Rleg_6338"
FT   CDS_pept        50603..51082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6338"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding; KEGG: ret:RHE_PC00206 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6338"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61088"
FT                   /db_xref="GOA:C6BAI0"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR038725"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAI0"
FT                   /inference="protein motif:PFAM:PF01243"
FT                   /protein_id="ACS61088.1"
FT                   /translation="MANSDEATRVWELIDKIGFCMLTTRSGDDLRARPMSAYTAQLENA
FT                   IYFLTDVSSHKDDEIARWPNVCLAFADTKGQKYVSVSGTAEVQNDRAKIRELWATPAKA
FT                   WWDNPDDPSIRILKMTPSSAEYWDSPGTIISYIKMAAAAVSNSKPDMGDNAEVKL"
FT   gene            complement(51303..52172)
FT                   /locus_tag="Rleg_6339"
FT   CDS_pept        complement(51303..52172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6339"
FT                   /product="Domain of unknown function DUF1814"
FT                   /note="PFAM: Domain of unknown function DUF1814; KEGG:
FT                   smd:Smed_5454 domain of unknown function DUF1814"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6339"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61089"
FT                   /db_xref="InterPro:IPR014942"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAI1"
FT                   /inference="protein motif:PFAM:PF08843"
FT                   /protein_id="ACS61089.1"
FT                   /translation="MAKEIRNVGASVRARLLHLAKASGQSFDLVLTRFALERLLFRLSQ
FT                   SPHANRFVLKGAMLIMSWFDDPHRGTRDLDLLGFGDPSPDPMLETFLEILAQEADDGVT
FT                   FDPDTLHVDRIREALDYGGLRLRVIATISGARINLTIDIGFGDALEPGVEILDYPSMLD
FT                   FPMPRLRAYARETVIAEKFQAMVMLGRVDSRMKDFYDIWILSRSFDFSDDRLARAIAAT
FT                   FKRRETSIPTNLPDALTDAFGKDQQKQRQWRAFIEGVAHNPGDLTDVIAEIAAFLMPHA
FT                   VAAARLDQ"
FT   gene            complement(52165..52782)
FT                   /locus_tag="Rleg_6340"
FT   CDS_pept        complement(52165..52782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6340"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: smd:Smed_5453 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6340"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61090"
FT                   /db_xref="InterPro:IPR025159"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAI2"
FT                   /inference="similar to AA sequence:KEGG:Smed_5453"
FT                   /protein_id="ACS61090.1"
FT                   /translation="MPSSDTQRQIARTVLTERGIARLRELRNAGVTGATMSRMERDGEV
FT                   LRLARGLYQLPDAELDVNHSMAEVAKRAPKAVICLVSALAFHGLTDQLPRQIWLAIGRK
FT                   DWAPKPDGPAMRIVRFTESLLNESVETHVIEGVPVKVFGIAKTIADCFRYRNKIGLSIA
FT                   MEGLQEALRQRRTSPGEIANQAERGGVGSVIRPYLEALTANG"
FT   gene            complement(53201..54112)
FT                   /locus_tag="Rleg_6341"
FT   CDS_pept        complement(53201..54112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6341"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: ret:RHE_PC00205 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6341"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61091"
FT                   /db_xref="GOA:C6BAI3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAI3"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACS61091.1"
FT                   /translation="MKTDLGDLNAFVAVARAGGFREGARVSGSSASFLSEAVRRLEGQL
FT                   GVRLLNRTTRSVVPTEAGKGLLARLGPALSEVEAALDVVNGFRDRPAGALRLNVPVSAA
FT                   RLVLPAIVPPFLAAYPDIRLEVVTDESFVDVIAAGCDAGIRYDERLEQDMIAIPIGPRI
FT                   QRFAIAASPDYLDRRGRLQHPSELLAHACILGRFDSGAMTAPWEFERDGEIVRVDPTGP
FT                   LIVRVGGATDLAVDAAIAGTGIVCLFEDWLRPHFDRGALEPILEPWWQRFSGPFLYYPG
FT                   RRLVPAPLRAFIDFVKASANQT"
FT   gene            54212..55087
FT                   /locus_tag="Rleg_6342"
FT   CDS_pept        54212..55087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6342"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: ret:RHE_PC00204
FT                   putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6342"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61092"
FT                   /db_xref="GOA:C6BAI4"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAI4"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ACS61092.1"
FT                   /translation="MSTIDQSGTFNLGGRSVKRLGYGAMQLAGPGVFGPPKDHGAALAV
FT                   LREAVASGVNHIDTSDFYGPHVTNQIIREALHPYRDDLVIVTKIGARRGADGSWIPAFS
FT                   REELTEAVHDNLRNLGLDVLDIVNLRIMFDVHGPAEGSIEAPLTVLADLQRQGLVRHVG
FT                   LSNVTSKQITEGRGITEIVCVQNQYNLAHRADDALIDDLAYHGIAYVPFFPLGGFSPLQ
FT                   SSTLSDVAAGLNATPMQVALAWLLHRAKNILLIPGTSSVGHLRENLAAAGLVLPDGALK
FT                   QLDGVAGSAA"
FT   gene            complement(55122..57281)
FT                   /locus_tag="Rleg_6343"
FT   CDS_pept        complement(55122..57281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6343"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; peptidase C39
FT                   bacteriocin processing; ABC transporter transmembrane
FT                   region; SMART: AAA ATPase; KEGG: rce:RC1_2728 colicin V
FT                   secretion"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6343"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61093"
FT                   /db_xref="GOA:C6BAI5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAI5"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS61093.1"
FT                   /translation="MSSKALQAGFFSNSRIRLIRQNEVSECGLACLAMMASFYGHDVDL
FT                   ATMRRRFTPSFRGAPLSSLIKIADQVGLLPRAVKLPLEELPNLALPAILHWNMNHYVVI
FT                   ERVSGDKALIHDPAGRSEWLQMSEVSDHFTGVALELRPNEAFEKITERTVLRWSQLWTR
FT                   INGLGSSFLQVIVLSVVLQIYVLALPYYLQVGIDNALPALDHDLLAVLALGFGLFTAFN
FT                   TSASFLRSFVILAAGSALGFGIASNIARKLFRLPLDWFQKREVGDILSRFQSVTPIQKM
FT                   LTEGVAGTLVDGLLALTTLAIMFFYSAKLAMIALTAFFLYFVVRLISFSFERRAQEGSI
FT                   IAHGKEQTALIETIRGIQTFRLYNSETMRHAMWQTLLTDAVNANIRSSRIGIWQTTGNA
FT                   LLFGLENVVTIYLAIGFIMNGGFSVGMVFAYLAYKGQFLDKAGNLVDQGMAFLMLRLHL
FT                   ERLADIALEEDDRSFAAGSMAVTELKGRMELKSVSYRYSPTDPFVLQEIDLSVEAGEHV
FT                   AITGPSGMGKSTLLKVMLGLLLPQSGEVAVDGLPLQQFGHKSFRDQIAAVLQDDNLFAG
FT                   SIADNITLFAEQADPAAIADAARASAIHDEIMKMPMQYETLVGDMGSSLSGGQKQRVLL
FT                   ARALYRKPKMLFLDEGTSHMDAANEARVNHSIRSLGITRIVVAHRQETIAAADRVLYMD
FT                   GEGLRPLAPPTEVISLQLGESLSTR"
FT   gene            complement(57291..58454)
FT                   /locus_tag="Rleg_6344"
FT   CDS_pept        complement(57291..58454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6344"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   rce:RC1_2734 HlyD family secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6344"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61094"
FT                   /db_xref="GOA:C6BAI6"
FT                   /db_xref="InterPro:IPR003997"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAI6"
FT                   /inference="protein motif:PFAM:PF00529"
FT                   /protein_id="ACS61094.1"
FT                   /translation="MAVPMGWHVTGYLMAGILIVVLIFLSIASYSRIVTATGIIQPDKG
FT                   VAVVMPSRPGVIMKMMVADGDQVEEGQELVAVRSEDYLVSGESASEKVAEMLDRQNASI
FT                   SEQLAEVKNDEIAQTAQFSAQISGYQTQIDKLQSQIALQKELITSIEKDVERIRGLVDK
FT                   GIVPRRDVTLREDSLTERRQQMAVLESTLTERRSDLSDAERMLDQVKARSNEKVAALQS
FT                   QREDINRGLATNEQSRAYVIRSPIGGTVSALTAKIGEPLNTQQALMSVVPLNATLHAQL
FT                   DVPNAAVGFVEVGQEVRLAIDTFPYQSFGTIAGRVKSLSKSPINRGSGASTNLNYLVTV
FT                   DLERQSITAFGKQQALFPGMTLSARIATARQSLLEWLFEPLFALQRR"
FT   gene            complement(58589..58798)
FT                   /locus_tag="Rleg_6345"
FT   CDS_pept        complement(58589..58798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6345"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mex:Mext_0452 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6345"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61095"
FT                   /db_xref="GOA:C6BAI7"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAI7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS61095.1"
FT                   /translation="MEHVSGGGVSSGVRGAIDGAAALAGGGALGYAAAIGAGVGISAFG
FT                   VGALAVGGAALGVYGVYRLARAFA"
FT   gene            complement(59040..59231)
FT                   /locus_tag="Rleg_6346"
FT   CDS_pept        complement(59040..59231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6346"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6346"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61096"
FT                   /db_xref="GOA:C6BAI8"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAI8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS61096.1"
FT                   /translation="MTAFSKLIVQEVALSAVLAAGAVIGIPKLTDPNAAANYPLAIGVF
FT                   LAMVATFVAYELFVKKSS"
FT   gene            complement(59228..59863)
FT                   /locus_tag="Rleg_6347"
FT   CDS_pept        complement(59228..59863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6347"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6347"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61097"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAI9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS61097.1"
FT                   /translation="MVDVQSVNADTSGYYIHPLEDFEIDAVNGAGSWVGHVDRGLIGGT
FT                   YAAGGTFATTGSLGKAGIAGTAGFAAGASGSIYNGGLSGGGNSSGRVICTHFFRRGMLD
FT                   RDLWRADLEFTYQSLSQTTVRGYQYWAIPYVHLMRRSPLAEKIMYPLARARALEIAYQA
FT                   GRRPKGSLGGKVVRLIGEPLCFLIGSVVKQKDWAPLWVEKTEATGGQS"
FT   gene            complement(59960..61849)
FT                   /locus_tag="Rleg_6348"
FT   CDS_pept        complement(59960..61849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6348"
FT                   /product="peptidase S9 prolyl oligopeptidase active site
FT                   domain protein"
FT                   /note="PFAM: peptidase S9 prolyl oligopeptidase active site
FT                   domain protein; peptidase S15; KEGG: bpt:Bpet2621 putative
FT                   peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6348"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61098"
FT                   /db_xref="GOA:C6BAJ0"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002471"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAJ0"
FT                   /inference="protein motif:PFAM:PF00326"
FT                   /protein_id="ACS61098.1"
FT                   /translation="MLSSSRFYADRRATWGYEPSFDGALIAWWGSKRGARAVFVGEFSG
FT                   GELNIIATFKGALSHFGWRQYADLLVLTEKDRLWEVDPRRPGTRTDVTPRDFQTWQVIV
FT                   DPRHAADNQFLVSYDRSPAVADLYATSADGRDKRLLEQNNGSTESWLLNEAQVPCIRVE
FT                   LTASGMRRYLHRINADKPWREMATLEPDDTLVIWRTDRSGNAFEALSNRQRDKIALVSL
FT                   DPVTGGETVLVEDGDVDVSDALRFTPTEPADVAVIRDGYPRYIALSERGTIFTELVLDR
FT                   NGHADVEISGSSKAGALLTVAISYDERPYQHYLLNLADKSKTLLSAPAEKRKSAFSAVT
FT                   KPVYFTAGDGEEIPALLTLPAGSPHPVPTVVMAHGGPARHDSWGYNIEKSFLASRGYAT
FT                   LSVNYRGSTGFGKRYQSLGYRQFGRKMQDDIADAGRWLLAQGIAAEGKLAVAGESYGGF
FT                   MAALAMADDKLFSAAIIDYAILDLPYQMQNNPVGWGLFLGQVIRYFGNPDDPGDLTQMQ
FT                   EFSPLHNAKKLRGSFLLTAGMEDPVVGCQQTKAFEKALRETGRDVTALYFDREGHGYAG
FT                   WQTKLVRAREIELFLSRKLGGKAKKIDPLAFLSKHWIQGRFGNGARNMLARRV"
FT   gene            complement(61996..62910)
FT                   /locus_tag="Rleg_6349"
FT   CDS_pept        complement(61996..62910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6349"
FT                   /product="protein of unknown function DUF344"
FT                   /note="PFAM: protein of unknown function DUF344; KEGG:
FT                   ret:RHE_PC00203 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6349"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61099"
FT                   /db_xref="GOA:C6BAJ1"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022486"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAJ1"
FT                   /inference="protein motif:PFAM:PF03976"
FT                   /protein_id="ACS61099.1"
FT                   /translation="MSQTPQDQLSRIKAEIADSFDEELEMQMEEDRLDDLVAEGMSEPA
FT                   EQTLERKIYFRELFRLQHELVRLQDWVQHKKLKVVVLFEGRDSAGKGGAIKRVTQRLNP
FT                   RVCRTVALPAPTERERHQWYFQRYVPHLPTGGEMVLFDRSWYNRAGVERVMGFCTDEEL
FT                   EEFFRSVPEFERMLVRSGIVLIKYWFSITDEEQEFRFKMRIHDPLKQWKLSPMDMESRV
FT                   HWEEYTKAKEEMLARTHTEDAPWWVVQAVDKKRARLNCIAHLLEQIPYEDVPKPEIQLP
FT                   DRIRHADYNRAPVPPEMLVPERY"
FT   gene            complement(63022..63873)
FT                   /locus_tag="Rleg_6350"
FT   CDS_pept        complement(63022..63873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6350"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6350"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61100"
FT                   /db_xref="GOA:C6BAJ2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAJ2"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACS61100.1"
FT                   /translation="MSSTHSPSSAVPNELGIQLRAWRDTRGKSQLDLSLDTGISQRQIS
FT                   FIESGRSTPGRHNLLHLADALDVPLRERNTLLLAAGYAPIYAEGGIDDVEMKGVTGALR
FT                   RMLVQHEPFPAVVMDRYWNVVMTNDATQGFFNNFIDMAAREKPRNLLHLMFDPAGLRPF
FT                   IPNWEETAESLMARVFRESVGRVIDMHTKALIDALLAYPNVDSAWKVSTTADSTPVIPL
FT                   SFVKDGQVFSFFSLVTTVGTAQTITTQELRIECMFPLDDATEVEYAKLMKQAAARWRQT
FT                   GK"
FT   gene            complement(63946..64335)
FT                   /locus_tag="Rleg_6351"
FT   CDS_pept        complement(63946..64335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6351"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6351"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61101"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAJ3"
FT                   /inference="similar to AA sequence:KEGG:Arad_0564"
FT                   /protein_id="ACS61101.1"
FT                   /translation="MTTMNFTKREPPEWLLAFWKEIDDKTFGGGFDCLAQDATCNLGVA
FT                   DWKGRDSIRENLRAFIDTGFSALHDVAEYWDGGSLKIFRGTVTMTPDDEAQPVVKPVMT
FT                   HFFYMDEREPAKVGCWYGSVGPVAF"
FT   gene            64657..65577
FT                   /locus_tag="Rleg_6352"
FT   CDS_pept        64657..65577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6352"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; FAD dependent oxidoreductase; KEGG:
FT                   met:M446_0008 FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6352"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61102"
FT                   /db_xref="GOA:C6BAJ4"
FT                   /db_xref="InterPro:IPR000103"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAJ4"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ACS61102.1"
FT                   /translation="MNDVVDTVVVGGGAAGLSAALFLGRAGRSTLVFDGGKSRIFSVEE
FT                   VREHLGFDGMPTAAFMAQARAEAVRYGADIRSEHVHSIVPREDGLFWVEATGSRVAART
FT                   IVLATGVIDDLPPLSGLPEAWGRDVRVCPCFDGYEVRGKRFVVFGLPERLAHMASWVWM
FT                   WSRDVTIVSRHRFNEADAERLRLLDINIIPDEITGLVHRDGKLVGVSTASGGGEIACDA
FT                   TWIAAEIRAASGLAASLCEVDEIGLARTDKDGRTSRSGVFAVGNADNAVAHLAHASAAG
FT                   TAVGPVVTMYLLEQILAERRNTKAA"
FT   gene            complement(65608..67260)
FT                   /locus_tag="Rleg_6353"
FT   CDS_pept        complement(65608..67260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6353"
FT                   /product="putative oxidoreductase protein"
FT                   /note="KEGG: ret:RHE_PC00202 putative oxidoreductase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6353"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61103"
FT                   /db_xref="GOA:C6BAJ5"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAJ5"
FT                   /inference="similar to AA sequence:KEGG:RHE_PC00202"
FT                   /protein_id="ACS61103.1"
FT                   /translation="MSEIVYDALVIGSGAAGSFAVKELTAQGLSVLLLEAGPAVGPKDF
FT                   DPVRKKAPASSINIWERARATLKGQPIQARAAFFTERFSHFFVNDRKNPYTTPKGEPFL
FT                   WIRGRQGGGRLHSFGRVLLRWTDDDFKIRSRAGKGVDWPVSYDELAPFYDEVEAYLGLY
FT                   GNKDNVATLPDGIYAKPASLTPAEQIFKQAVENRWPERHVVSWRYIAPDADRMPRPLRD
FT                   AKATGELTIRYDAVVRRITTDEKTGRATGAEYIDRNTGAVSTVRAATVVLSASPIESVR
FT                   LLLNSASAKHPDGLGNSSGALGRYFMDQLPCLAFGSFSKAKGWAPDESAPTDPFYNPSG
FT                   GIFIPRFGESDAARGDFDYQGSVGRAPVSVDTDARLAFFGFGRMLPYADNRITLDVRRR
FT                   DAWNIPVPHIRCVMQEEEQALLRRQEETLIALIKEVGGDLEFIGSPTGLKEMGKGAFPE
FT                   ADVFSRFMFRKWFRKTMCMGAAIHETGGARMGETREASVLNPYNQLWDAPNLIVTDASA
FT                   FPGSGIAGTTLTVMVLTIRACRNLVDQYRTGRL"
FT   gene            complement(67344..68426)
FT                   /locus_tag="Rleg_6354"
FT   CDS_pept        complement(67344..68426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6354"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; Transport-associated
FT                   OB domain protein; SMART: AAA ATPase; KEGG: ret:RHE_PC00201
FT                   sugar ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6354"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61104"
FT                   /db_xref="GOA:C6BAJ6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAJ6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS61104.1"
FT                   /translation="MQSAVSVKDLKIAYGDHTVIEKMSIDIASREFLVLLGPSGCGKST
FT                   LLNAIAGLQDITSGEVWISGRNVSWEEPKDRGIGMVFQSYALYPRMSVRKNLSFGLRVA
FT                   GLPKAEIEARVSRTAALLQLDKLLDRRPAELSGGQRQRVAIGRALVREVDVFLFDEPLS
FT                   NLDAKLRNELRVEIKKLHQRLGNTMIYVTHDQVEALTLADRIAIMRDGVIQQLASPAEI
FT                   YRRPANLFVAGFIGAPAMNFIEGRIEPGNGAPLFRSKEFTVDLSGYSFRADAAEGPATL
FT                   GFRPEHLVLDGATSGLPTIPGRVSVVEPMGSDAVVWFDWADQSLSLRLMGDVTLEPGDP
FT                   VAPGLDIAKASLFGTDGSRL"
FT   gene            complement(68434..69318)
FT                   /locus_tag="Rleg_6355"
FT   CDS_pept        complement(68434..69318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6355"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ret:RHE_PC00200 sugar ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6355"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61105"
FT                   /db_xref="GOA:C6BAJ7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAJ7"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS61105.1"
FT                   /translation="MARLHPNGPKPAQITAGRIGLYAFLVVAALFFLLPLYTMVVTSLK
FT                   SMPEIRLGQIFALPATLDFSAWATAWSGACMGTVCVGIRSGFWNSVAITLPSVALSVFI
FT                   GAVNGYALSLWRPRGANLLFGLLMAGGLIPYQIFLYPMVRAMANIDLYNSLAGIILVHV
FT                   IFGLPLVTLLFRNYFLSVPEELCKAARVDGAGFWRIFFEIMLPIAVPMVVVVSMLQFTG
FT                   IWNDFLLGLVFAGRDNLPMTVQLNNIVNTTMGERTYNVNMAATILTAIVPLAIYFLSGR
FT                   WFVRGIAAGAVKG"
FT   gene            complement(69318..70205)
FT                   /locus_tag="Rleg_6356"
FT   CDS_pept        complement(69318..70205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6356"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ret:RHE_PC00199 sugar ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6356"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61106"
FT                   /db_xref="GOA:C6BAJ8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAJ8"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS61106.1"
FT                   /translation="MSIKRKPNLSATIALLPTWFVAVVVFIGTMAWSIRLSFTNSTLFP
FT                   SSTYVGLAQYSKLFSSAKWLASLQNVLIFGVLYVAGCLLLGFLLAAALDRKIRFESAFR
FT                   TIFLYPYAMSFVVTGLIWQWMLNPTLGIQASVRSLGWESFVLDWVVNRDMAIYALVLAG
FT                   VWQGAGLVMVIALAGMRGIEGEQWKAARIDGIPVWRIYVSIILPQLGPALAAAGMLLAM
FT                   GVIKTYDIVVAMTNGGPGNATEVPAKFIMDNLFGRQNLGLATAGATVLVLGVIIAVAPF
FT                   RYIMHMRDKAKGAA"
FT   sig_peptide     complement(70110..70205)
FT                   /locus_tag="Rleg_6356"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.918) with cleavage site probability 0.352 at
FT                   residue 32"
FT   gene            complement(70308..71540)
FT                   /locus_tag="Rleg_6357"
FT   CDS_pept        complement(70308..71540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6357"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: ret:RHE_PC00198 sugar ABC transporter,
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6357"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61107"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAJ9"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACS61107.1"
FT                   /translation="MKTMMKLFLAGVAFAGLFASAHAEDKPTIEIMSSWTSGGEAAALN
FT                   VIKTEFEKRGGVWKDSSIAGFGAADAAFQNRIVAGDAPGAKQGVIGLAAADFINQGLFN
FT                   PIDDVAAAGKWADALPKSIHDLITYNGKVYLAPTGAHGESWLFYSKEAFEKAGISQEPK
FT                   TWDELFADLDKLKAAGMVPVAWGGQPWQQTKVFNMILLSQVGIDGFLKIYVDKDKSPAS
FT                   VEGVKKTLEILGKLRGYVDAGAAGRNWNDATAMLITAKAGVQFMGDWAKGEFTVAGKEP
FT                   GKDYGCMIVPESKGMVYIADSLWFPKTGKAETDKAQKLLAEVVMDPAVQVEFALKKGSV
FT                   PMRADVDKSKLDVCAQKGVELMAAGAIVPDQAIVLTPQQVGALDDFVDEYWSGGSDDTV
FT                   STAGNFFAIFE"
FT   sig_peptide     complement(71469..71540)
FT                   /locus_tag="Rleg_6357"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 24"
FT   gene            complement(71599..72549)
FT                   /locus_tag="Rleg_6358"
FT   CDS_pept        complement(71599..72549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6358"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: ret:RHE_PC00197 putative myo-inositol catabolism
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6358"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61108"
FT                   /db_xref="GOA:C6BAK0"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAK0"
FT                   /inference="protein motif:PFAM:PF01261"
FT                   /protein_id="ACS61108.1"
FT                   /translation="MATDRLRFGVDLVTFFHPGFWGVDSHEAIVGYARAEPRDFWDKIL
FT                   DSVQASGVAGVELTFSPFNWQDAIKTYGSVDAFAAELARRGLTLCSGFFAELEAAGDFA
FT                   EPEAQRALIDKAERYADFLKACGSDIMVIGAPLRQTLGAQPVQFHDFDRAKVIADFLNR
FT                   LGATLYARGVRLALHTEAHSIFAAARDVDLMMLLTDPAYVHMCPDTAHIIVAGSDPVQL
FT                   VDRHHERMIIAHWKDAIGPMPADTPIDKHIHERHQPYFCSFGLGRVDWPSWIRLLRDRA
FT                   YEGWAILELDAAPDPVRDIANGLTLVRQALLPIYR"
FT   gene            72772..73842
FT                   /locus_tag="Rleg_6359"
FT   CDS_pept        72772..73842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6359"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; SMART: regulatory
FT                   protein LacI; KEGG: ret:RHE_PC00196 LacI family
FT                   transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6359"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61109"
FT                   /db_xref="GOA:C6BAK1"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAK1"
FT                   /inference="protein motif:PFAM:PF00356"
FT                   /protein_id="ACS61109.1"
FT                   /translation="MNKNKDVVGEEPSGALMADVARLAGVAISTVSRALANPGRVNEKT
FT                   RARINAAARQLGYTPNAMARGLRVGKSNVIMIILPGSLYYGASQVIPQVLQSINQSLIQ
FT                   GGYNLMIANLDRDEISERHILDLAFGGSVRGAIILSSKLPEVDGRSLANSGLPIVSMLL
FT                   DMSDAGLQSVVTNDREAVRDVTAELIRLGHRRFFYLAGPEGNYHDVERYGGVLEALEAA
FT                   GLSEEAVRRSGGHLDYQHGFDIGVQAADDFAELTEKPTAVIATSDDMAISFVSRIQGAG
FT                   LRIPGDLSVVSFDGSPVCEFCSPPLSTIKQPVEEMGRAAVDLLLDAIDQRQNTAAVRTV
FT                   IRSSLILRESIAAPKS"
FT   gene            74045..74323
FT                   /locus_tag="Rleg_6360"
FT   CDS_pept        74045..74323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6360"
FT                   /product="transcriptional regulator, CopG family"
FT                   /note="PFAM: CopG domain protein DNA-binding domain
FT                   protein; KEGG: xac:XAC2429 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6360"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61110"
FT                   /db_xref="GOA:C6BAK2"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAK2"
FT                   /inference="protein motif:PFAM:PF01402"
FT                   /protein_id="ACS61110.1"
FT                   /translation="MASPTSLKLDDELKGRVQQLAEARRRSSHWIMREAIAQYVEREEK
FT                   REALRQETLDAWHEFKATGLHVTGAEVESWLSTWGTDDELSAPECHK"
FT   gene            74311..74601
FT                   /locus_tag="Rleg_6361"
FT   CDS_pept        74311..74601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6361"
FT                   /product="addiction module toxin, RelE/StbE family"
FT                   /note="TIGRFAM: addiction module toxin, RelE/StbE family;
FT                   PFAM: plasmid stabilization system; KEGG: xac:XAC2428
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6361"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61111"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAK3"
FT                   /inference="protein motif:TFAM:TIGR02385"
FT                   /protein_id="ACS61111.1"
FT                   /translation="MPQVVFSPAAIRDLERLREFLRLKNPSAAKRAGETILKGLRALGV
FT                   HPHIGRLIEDLPEQYREWLIDFGDSGYVARYRIDGDILMILAVRHQKEAGF"
FT   gene            74766..75209
FT                   /locus_tag="Rleg_6362"
FT   CDS_pept        74766..75209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6362"
FT                   /product="biotin/lipoyl attachment domain-containing
FT                   protein"
FT                   /note="PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; KEGG: ret:RHE_PC00192 acetyl-CoA carboxylase,
FT                   biotin carboxyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6362"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61112"
FT                   /db_xref="GOA:C6BAK4"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAK4"
FT                   /inference="protein motif:PFAM:PF00364"
FT                   /protein_id="ACS61112.1"
FT                   /translation="MDLSKIKTLIDFVGRSNIAELTVTEKDVTVRIFRTSPGQEAAAEP
FT                   AQKAGSTTSFADDAGSDASSRLEKTSYAVKAPVFGVLHRTPAPGEPPFIAIGDEVEEGQ
FT                   TLFIIEAMKVFNTIAAPRSGRITHLTEIDEGEVETGDLLAEIA"
FT   gene            75209..76594
FT                   /locus_tag="Rleg_6363"
FT   CDS_pept        75209..76594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6363"
FT                   /product="acetyl-CoA carboxylase, biotin carboxylase"
FT                   /note="TIGRFAM: acetyl-CoA carboxylase, biotin carboxylase;
FT                   PFAM: Carbamoyl-phosphate synthase L chain ATP-binding;
FT                   biotin carboxylase domain protein; protein of unknown
FT                   function DUF201; Carbamoyl-phosphate synthetase large chain
FT                   domain protein; KEGG: ret:RHE_PC00191 acetyl-CoA
FT                   carboxylase, biotin carboxylase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6363"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61113"
FT                   /db_xref="GOA:C6BAK5"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAK5"
FT                   /inference="protein motif:TFAM:TIGR00514"
FT                   /protein_id="ACS61113.1"
FT                   /translation="MPETTERSATDRFDTVLIANRGEIAARIQRACHELGLKTVAICSE
FT                   ADRQAPYGSTADSFLCIGPSTAAKSYLNQDAILLAARLAGAGAIHPGYGFLSENAAFAD
FT                   AIEKAGLTFIGPTASSIAIMGDKIAAKRAMMAAGVPCVPGPDTALPDDPATIERIALEI
FT                   GYPVIIKAAGGGGGRGMRVVPKADLLHEAIALTREEARKAFGSPSLYIEKFLEHPRHIE
FT                   IQVICDDHGNAVWLGHRDCSMQRRHQKVVEEAPAPGIAPDIIQPVGLACVKACLQIGYR
FT                   GVGTFEFLYEDGAFYFIEMNTRLQVEHPVTELTSGVDIVQAQIRAAQGHVLDLTQGDVT
FT                   CEGHSFECRINAEDPENFLPSAGVVTHLALPTGPGIRVDTHIHAGYKVSPYYDSLIAKL
FT                   IVHAPTRAEAMARMREALAGTEVEGISTNIPFLRALFEDGAFARGETDIHYLEQWLKLR
FT                   RGA"
FT   gene            76591..77028
FT                   /locus_tag="Rleg_6364"
FT   CDS_pept        76591..77028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6364"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_PC00190 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6364"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61114"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAK6"
FT                   /inference="similar to AA sequence:KEGG:RHE_PC00190"
FT                   /protein_id="ACS61114.1"
FT                   /translation="MSAIDFSDPATIALLTEALTAAGVDGLEISRPGGQLRIVVAGKGG
FT                   SRISSTGATSPAPGLAPGSASAVVKAPMAGRFCVEHPAASAVPQDLPRSVSDADIVGFV
FT                   GVGHILLPLRAGRSGVLTRLLAEPGALVSFGDPLFEIELQS"
FT   gene            77025..77732
FT                   /locus_tag="Rleg_6365"
FT   CDS_pept        77025..77732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6365"
FT                   /product="Allophanate hydrolase subunit 1"
FT                   /note="PFAM: Allophanate hydrolase subunit 1; SMART:
FT                   Allophanate hydrolase subunit 1; KEGG: ret:RHE_PC00189
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6365"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61115"
FT                   /db_xref="GOA:C6BAK7"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAK7"
FT                   /inference="protein motif:PFAM:PF02682"
FT                   /protein_id="ACS61115.1"
FT                   /translation="MIVTTNRHASQREIVPATKSLARVSSIGARSFLLEAPGDFDLIAQ
FT                   RRIWALSQTVKDWADLAENIPGMTNLLVIFKETPEDPDAVVARLLEAWENARSIDLNGK
FT                   TVEIPVHYGGEFATDLPALCNLSGLSDREVVRIHHEATYRVFALGSAPGFGYLHGLDPR
FT                   IYMPRKTVPSLKMPKGCVTIGGMQTGVAMLTGPNGWNSIGFAALEMFDPMLPSPAMMAP
FT                   GDTVRFLPARIEL"
FT   gene            77729..78724
FT                   /locus_tag="Rleg_6366"
FT   CDS_pept        77729..78724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6366"
FT                   /product="urea amidolyase related protein"
FT                   /note="KEGG: ret:RHE_PC00188 hypothetical protein; TIGRFAM:
FT                   urea amidolyase related protein; PFAM: Allophanate
FT                   hydrolase subunit 2; SMART: Allophanate hydrolase subunit
FT                   2"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6366"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61116"
FT                   /db_xref="GOA:C6BAK8"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAK8"
FT                   /inference="protein motif:TFAM:TIGR00724"
FT                   /protein_id="ACS61116.1"
FT                   /translation="MIEIMESGPFNTVQDLGRPGYRDIGVSASGAMDPLAVRIGNILVG
FT                   NDENAAAIEVQTFPFSLRFERRIAFAVTGADGNSHLDGSELLAWCAYIAEPGQLLELKQ
FT                   PPLLARSYISLGGGLDIPVVMGSRSTSLRGSFGGNAGRPLAKGDRIAVGEDAEMIMLPA
FT                   SGLAVVEPAVALREVFPAAVDGTLPIRALPAGEHDLFAGDGEAFWSQTWRISSRSDRTG
FT                   YRLSGEPIKPTASIEMRSHGVVPGVIQVPPGGEPIVQMSDANTAGGYPKIAGVIECDLW
FT                   RLGQARIGARLKFVRSTHAEARSVEQAVAGYVEDVRQTSRLVKRALKAMA"
FT   gene            78762..79529
FT                   /locus_tag="Rleg_6367"
FT   CDS_pept        78762..79529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6367"
FT                   /product="LamB/YcsF family protein"
FT                   /note="PFAM: LamB/YcsF family protein; KEGG:
FT                   ret:RHE_PC00187 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6367"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61117"
FT                   /db_xref="GOA:C6BAK9"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAK9"
FT                   /inference="protein motif:PFAM:PF03746"
FT                   /protein_id="ACS61117.1"
FT                   /translation="MKIDLNSDMGEGFGPYRLCDDEAMMKLVSSANIACGFHGGDPDTM
FT                   GRMVRLAKLNGVGIGAHPGLPDRPGFGRREIPFPADELRQQMLYQLGALMAIAKAEGVT
FT                   VSHISFHAAMGNMVNRDPVLADLMMDAIATVDAGLVVFVTSGSEIQQAARRARLKTLAL
FT                   FLADRAYDAGGRLVARGLAGAVIKDEASVRARVRKFLLEGTVETIDGAVIAMPARSILV
FT                   HSDTPGALELAGIVRGEIEATGAALAPAAELAD"
FT   gene            79590..80792
FT                   /locus_tag="Rleg_6368"
FT   CDS_pept        79590..80792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6368"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   ret:RHE_PC00186 aspartate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6368"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61118"
FT                   /db_xref="GOA:C6BAL0"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAL0"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ACS61118.1"
FT                   /translation="MSVIADRLKNVSISASAAMTQRARELAAKGIKVVSLSSGEPDFPT
FT                   PAHAIEAAYGAALAGDTKYPPMDGTPVLKSAIIRKFKRDNNLDYDASQIVVSGGGKQVI
FT                   FNAMLATCNPGDEVVIPTPSWVSYADIVKFAGGVPVAVPCHEQTGFKLHPEDLEAAITP
FT                   RTKWLFLNFPNNPTGAACSRAEMAAIAEVMLRHPNVWIMTDDIYEHLVYDDFQFCTIAE
FT                   VEPRLYDRVLTMNGVSKAYAMTGWRLGFCAGPKELISAVSNVNGQNGGGIATLTQAAAT
FT                   AALDGPQDLLKERAAIYKERRDFVLDRLSEVEGLRCHRPEGAFYIYPNISGLIGKTSKG
FT                   GRKIETDVDFVMALVDEHHVATVQGAAYGMSPFFRISYATSMEKLGEGCARIAQFCRDM
FT                   R"
FT   gene            complement(80888..81793)
FT                   /locus_tag="Rleg_6369"
FT   CDS_pept        complement(80888..81793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6369"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: ret:RHE_PC00185 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6369"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61119"
FT                   /db_xref="GOA:C6BAL1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAL1"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACS61119.1"
FT                   /translation="MDIRRLKSFIVIVDSGSITRAADLLHIAQPALSQQLAALEEHFGH
FT                   KLLIRSQQGVSMTDAGHAVYRHAQIILRQMEQAQADASAAGNSLAGRVSVGLVPFSSAA
FT                   TLSVDLLAETRKRHPGILLHLTESVGQTYSQMIMNGRLEMALLHGTGPIKGVRFEPILS
FT                   EEFFLVAHRDFAIEADAKPVPVNSLDGMPLLLPPAYNFVRRAVDTAFTRTRTNLKVVAE
FT                   VEIVRTLARAVGSGLGATIMPKAIADRIVSESSEPLICRLVSPRIEETLSLCVSDQNPL
FT                   SEPALAVRDILLELTARLKR"
FT   gene            82040..82819
FT                   /locus_tag="Rleg_6370"
FT   CDS_pept        82040..82819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6370"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR;
FT                   NAD-dependent epimerase/dehydratase; KEGG: ret:RHE_PC00184
FT                   short chain dehydrogenase/reductase family oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6370"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61120"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAL2"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACS61120.1"
FT                   /translation="MPFSDYKTALVTGASSGIGAAVVERFRRENIEVHAVARSAEALQQ
FT                   LAARTGCLAHVIDVTDRQAMAELTRRVEFDILVNNAGVDRPKKFLEADEGDIDLIVDVN
FT                   LRAVLHICRLVVPGMVARDRGHVINISSIAGAYNFGGNSSYHATKAGVSMLSNQLRIDA
FT                   FGKRVRVTEICPGRVATDIFNHVHGDDPSIRERFIDGFELPQATDIADAIAFAIAAPVA
FT                   VNIGHMEITPTLQVMGGLQTAKPQPAAKLDQSGEPNP"
FT   gene            82816..83523
FT                   /locus_tag="Rleg_6371"
FT   CDS_pept        82816..83523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6371"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: ret:RHE_PC00183
FT                   amino acid ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6371"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61121"
FT                   /db_xref="GOA:C6BAL3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAL3"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ACS61121.1"
FT                   /translation="MSGFDLSAILGNPEYTAMLLHGIEMTFIIYAGSWSMAMALALLLL
FT                   ALRLSPFRFGDPLVAAYVSYHRNVPTLVQLMLWYFGIFTLMPSGVAEWLAVHNAEAIFA
FT                   VIGLGLCQAAYFSEDLRSGVRSVSPGQMQAARALGHGYVSAMRFVIMPQGVRNALPPLI
FT                   NHSVSLFKNSSLAVVIGASELTHAVKEIENLSFRTFEIYLIGTVLYLFFSLVIMSIGAY
FT                   LSMRTDPARSARA"
FT   gene            83520..84278
FT                   /locus_tag="Rleg_6372"
FT   CDS_pept        83520..84278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6372"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: ret:RHE_PC00182
FT                   amino acid ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6372"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61122"
FT                   /db_xref="GOA:C6BAL4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAL4"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ACS61122.1"
FT                   /translation="MIHDMIAIVQDYWLLLLIGQYPNGPLGGLANTLILSALSIALAFP
FT                   VSILFALARLSRSPLLRWPVTALVYFTRGVPLLMLILWSYFLVPLLTGADVPSFVTMLT
FT                   TLVVYQSAFLSEVVRAGIVALGPGQMDAGRALGHGYLGAMRFIILPQALYNMIPSIIST
FT                   FVSTIKDTTLGYVINVPDLTFAASQVNNQLLTQPFQVFLILAIVYFAICWTLTYFANRL
FT                   ERSITRRRAGLSNLPAAALVAPSKIISEQP"
FT   gene            84275..85039
FT                   /locus_tag="Rleg_6373"
FT   CDS_pept        84275..85039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6373"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ret:RHE_PC00181 amino acid ABC transporter
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6373"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61123"
FT                   /db_xref="GOA:C6BAL5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAL5"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS61123.1"
FT                   /translation="MTMSVSAQELQTIRLSQVCKSYGDYPVLKDIDAQVSRGEVVVICG
FT                   PSGSGKSTLIRTINRLEEINSGSITLDGQNIHAAMRAKELNALRSRIGFVFQNFNLFPH
FT                   LSVVENVSMSPIRVKGVAPDVAKDKALKLLDRVGLADKARAYPGQLSGGQQQRVAIARA
FT                   LAMEPPVMLFDEPTSALDPEMVGEVLAVMKSLASEGMTMLCVTHEMGFARDVADRVWFI
FT                   DAGQILEMATPEDFFKNPSHPRAQRFLADLRH"
FT   gene            85071..85907
FT                   /locus_tag="Rleg_6374"
FT   CDS_pept        85071..85907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6374"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   SMART: extracellular solute-binding protein family 3; KEGG:
FT                   ret:RHE_PC00180 amino acid ABC transporter
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6374"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61124"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAL6"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ACS61124.1"
FT                   /translation="MNWKCLTLTAAFAGMAAALPAKADQLDNIMSAKTLRCATFADVPP
FT                   FASPDPKTREMAGFDVDLCGAIAKELGVKAEIKPVSVEARVPEVKLGRVDITVANLAYT
FT                   LSRAEQIQFSDPYYLAKEMLIVPADDAGKKKADYAGQRIASTKGSTSEMSIKLNKSDPL
FT                   TFQDTASAYLAVQQGKARGMVANTMTTTKFVNESKSKGKAMRMIEEPMLYQPIGIGMAK
FT                   DQPALTAKINEILRKLDTSGEINKIWDKWLGPDTEYKMTRTDKVVSLSELKFDPIP"
FT   sig_peptide     85071..85142
FT                   /locus_tag="Rleg_6374"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 24"
FT   gene            85999..86673
FT                   /locus_tag="Rleg_6375"
FT   CDS_pept        85999..86673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6375"
FT                   /product="Dimethylmenaquinone methyltransferase"
FT                   /note="PFAM: Dimethylmenaquinone methyltransferase; KEGG:
FT                   atc:AGR_L_1159 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6375"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61125"
FT                   /db_xref="GOA:C6BAL7"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAL7"
FT                   /inference="protein motif:PFAM:PF03737"
FT                   /protein_id="ACS61125.1"
FT                   /translation="MIHIKDIAERPSKADIDAVSKFSPATIHEAQGRRGALSSRLKPVD
FT                   YRMKLCGPAFTVKCAPRDNIMLQLAINYAKPGDIIVVSAGEYEEAGSFGDVLANACLAK
FT                   GIGGLVTDTGVRDTLQLRELGFPVFSLSVCIKGTVKETIAAVNDTIIVGGEIIHPGDII
FT                   AGDADGLVVVRRQEAQEVARLSQSREDAEAGYIAAYKQGKSVIEVSNLEPVLKAKGLVV
FT                   DI"
FT   gene            86844..88028
FT                   /locus_tag="Rleg_6376"
FT   CDS_pept        86844..88028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6376"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_PC00178 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6376"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61126"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAL8"
FT                   /inference="similar to AA sequence:KEGG:RHE_PC00178"
FT                   /protein_id="ACS61126.1"
FT                   /translation="MHLSMWTYPWDIQDQGLAALAAELRGRAGLNTVSLATSYHAGRFL
FT                   QPRSPQQKAYFPEDGTVYFRPDESLWQDKLIRPLMAGNVTERGDMLETLVQGREATGLK
FT                   VSCWTVCLHNTRLGMLHPDHVTRNAFGNPNYYNLCPSSPAARAYAVTLVRDITTNYRPD
FT                   MVELESPNFMGFAHEYHHEKDGVGLNAEDDFLLSLCFCDHCTARATKAGVPVEGARGSV
FT                   ARFIAELCERAIPERQFPDFPAAGIDAFRDHPDLHAYLTWRSEPVTSLIDEIKAAADPA
FT                   TRIVLIDLKDGWLGGVDLAAVGKLCDGAILCCYDMEPDAVGDVIRTGRAAIGPGKFLAV
FT                   GLRVFYPEVSGPAILAARAKAAVDAGADGVNFYNYGLIPAKRLDWVKAAVDAIA"
FT   gene            complement(88044..89057)
FT                   /locus_tag="Rleg_6377"
FT   CDS_pept        complement(88044..89057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6377"
FT                   /product="Succinylglutamate desuccinylase/aspartoacylase"
FT                   /note="PFAM: Succinylglutamate
FT                   desuccinylase/aspartoacylase; KEGG: ret:RHE_PC00177
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6377"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61127"
FT                   /db_xref="GOA:C6BAL9"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAL9"
FT                   /inference="protein motif:PFAM:PF04952"
FT                   /protein_id="ACS61127.1"
FT                   /translation="MHSGLVNPIDFSREGRQAGHLAIPYSIDRSPYYQIRIPILCLRNG
FT                   EGPSLLLMAGNHGDEYEGELQLGRLMRLLDVAEIRGAVTILPMANLPAVMAAKRCSPFD
FT                   GGNLNRAFPGDPSGSPTARLAHFLEHELFPRHDVVLDLHSGGTSMAHLPCTLIERQADT
FT                   ARFERSASLIRAMGAAHAFVADNGPTAPTSMGAAARAGTIGLSGEFGGGGTVTQETMGF
FT                   TAAAIDRLLVTLGIVKHPVLSRVPLAEPGPLQLLSLSRHSQGIHANHRGWFEPAVALGA
FT                   TVAAGEFAGWYHDLERLEQPEEELRFAESGIVISHRLHCDSQAGDCLIQVAEPIAS"
FT   gene            complement(89088..89432)
FT                   /locus_tag="Rleg_6378"
FT   CDS_pept        complement(89088..89432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6378"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: ret:RHE_PC00176
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6378"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61128"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035709"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAM0"
FT                   /inference="protein motif:PFAM:PF01042"
FT                   /protein_id="ACS61128.1"
FT                   /translation="MIQRYQKGSRMSQAVSYGGLVYIAGQVAENRKADIKDQTRDVLGK
FT                   IDALLQEAGIDRSRLIAVNVFLPAIVDFEAMNSVYDDWIDIENPPARACTEARLADPDL
FT                   RVEMTAVAAL"
FT   gene            complement(89469..90779)
FT                   /locus_tag="Rleg_6379"
FT   CDS_pept        complement(89469..90779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6379"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_PC00175 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6379"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61129"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR026956"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAM1"
FT                   /inference="similar to AA sequence:KEGG:RHE_PC00175"
FT                   /protein_id="ACS61129.1"
FT                   /translation="MSDLHIATENVLIDEQVRGFPPGNPPLPLAAIGKQGWKPYDGRMA
FT                   LPLISLDRQAFTGNVELMMAYVMSHGADIAPHAKTPMSMALAEALLAAGAWGTTVADIR
FT                   QAAVLLKAGQRRLILANEIGGAAAARRLAALLGHYPDAELHIFVDSTALVEALRSAWQE
FT                   RVDLPPLGLLVEFGAGRAGARGVAAAEAILEAILAAETPAFRLTGIAAYEGAAATADAE
FT                   ETMRRIDALMAVTSDFLPKLRARIGDERSLLVTAGGSVFFDLVIARLSAAVAADPACRL
FT                   VLRSGAIFFHDHGIYERGLAGLDARGGFRIGGETISAAAGFRPALRVWAEVLSRPEPRL
FT                   AICGMGMRDVAMDQGLPRPLALYRNGARLADLESADVFRLNDQHAFVALADGSDVAVGD
FT                   VIECGISHPCTCLDRHAILYGLDPDHSVTAAYLTSFG"
FT   gene            complement(90772..91728)
FT                   /locus_tag="Rleg_6380"
FT   CDS_pept        complement(90772..91728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6380"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: ret:RHE_PC00174
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6380"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61130"
FT                   /db_xref="GOA:C6BAM2"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAM2"
FT                   /inference="protein motif:PFAM:PF04909"
FT                   /protein_id="ACS61130.1"
FT                   /translation="MTELYDGPVIDPHHHLWDLSLQRHPWLQKARASGEEMVFGSLAPI
FT                   LRDYGIDDYRADAARQNVIATVHVEAGWSVACPLDESRWLDGLDRSSGVARRYIAGVPL
FT                   DGPDAMRLLETEAANPNVVGIRDILSWHPEAAKSFAPRPNRMDDPSWRAGLAHATRLGL
FT                   VFDLMLYPWQMNEALELVRAFPQTLFVLNHGGSPADRTEDGMALWRRGLRALGSLPNLR
FT                   LKISDLVAYDNKWTLESLRPVIEHCLACFGPARAMFASDFPVAGLHASFDEVYQVFRAV
FT                   ASELSYDEQRALFFATANDTYRLGIADPAEIRSGCDV"
FT   gene            complement(91725..92666)
FT                   /locus_tag="Rleg_6381"
FT   CDS_pept        complement(91725..92666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6381"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   ret:RHE_PC00173 sugar ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6381"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61131"
FT                   /db_xref="GOA:C6BAM3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAM3"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACS61131.1"
FT                   /translation="MNIIRSAFRNPPLLTFLLVALVWIVASFTLRGFGAYGHLRYLLEL
FT                   AAVIGIAAAGQTLVILMGGIDLSVGAVITVTAILLPLISPAWDPTGLAGIAAALAIAAA
FT                   IGLMNGAGAAYLRVPPIIMTLAMATFLQGLLVIVAGGSAVTVSNPAVILLGQARPLGIP
FT                   SGIILWLVVSIVVLLLVHRMPIGARFLALGANPLAARLSGVSVTRDTLIVHTLSGFFAG
FT                   LAGILVLGMNRQGYVGIGDPYLLTSIAAVVLGGSSILGGRGTYAGTIPGAILLVTTTAL
FT                   ITVVNASPGWRSIMFGTLILALLLVSGREARR"
FT   sig_peptide     complement(92568..92666)
FT                   /locus_tag="Rleg_6381"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.943) with cleavage site probability 0.602 at
FT                   residue 33"
FT   gene            complement(92663..93625)
FT                   /locus_tag="Rleg_6382"
FT   CDS_pept        complement(92663..93625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6382"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG: bms:BRA0994
FT                   ribose ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6382"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61132"
FT                   /db_xref="GOA:C6BAM4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAM4"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACS61132.1"
FT                   /translation="MSTSSSSRLYGSIQLRRNRGLAGLYLVVAAFLILYALLFPGILSI
FT                   GGFSKFTQNWFPLALVTMAQALLMLNGGITLAIGPLVSLGAVIAATTMQGALGVPGGIL
FT                   AVALAGLLIGAAIGVIVTYLRLPAIIVTLAGSFIIGGVALILLPRPGGFIPDWLSTVLA
FT                   GHTPVAFLLLVVILVLWKAFLATPLGLGIYAAGDNPVGAFRSGVPVERVKVAAFALSGL
FT                   LAALTGLFVAAQTGSGDPVIGTPFTLNSIAAAVLGGVGFLGGKGTMRGAICGSLLLSVM
FT                   INVMFFLGFPPVAQYVAQGLIIVGAVAVPELLGAWRARR"
FT   sig_peptide     complement(93515..93625)
FT                   /locus_tag="Rleg_6382"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.618) with cleavage site probability 0.391 at
FT                   residue 37"
FT   gene            complement(93622..95136)
FT                   /locus_tag="Rleg_6383"
FT   CDS_pept        complement(93622..95136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6383"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ret:RHE_PC00172 sugar ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6383"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61133"
FT                   /db_xref="GOA:C6BAM5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAM5"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS61133.1"
FT                   /translation="MTEERPLLEARQVFRGFFGNPVLKGVDIALLPGRVHALLGENGAG
FT                   KSTLINLLSGALQPDSGSILVDGKPVERFSPAAARGAGIAVVQQELSLTASLSIAENIG
FT                   LGAFPRRFGLIDYRALHRGVSDVCDMVGLTEPLDMPVADLALGRRQMVEIAKALFRKPR
FT                   VLILDEPTSSLSAHEAGILARLIETLRDRGTALLYISHRLNEVQALCSHVTVLKDGLVT
FT                   ADQSLSGIDGEGLVRLMVGRETGDLFPPRSVTAPGAICISVEGFSAGMVRDIDFSARAG
FT                   EIVGIGGLVGQGQEDLLLGLYGAIPASADRAEVSGKPALPANVGEANAAGIVYVPADRK
FT                   HEGLVLPHSIASNLILPSLGRLARKGLRDRSAENGLVADLARRLTIKGDTARPVQALSG
FT                   GNQQKVALAKWLPLDPSVLLLNDPTRGVDIETKREIYLMLRAFATEGRLVILASSDTPE
FT                   LVHLCDRVVVLREGVVAAVLSQDEISEGAIVGAAMGITTTTQGEAA"
FT   gene            complement(95171..96310)
FT                   /locus_tag="Rleg_6384"
FT   CDS_pept        complement(95171..96310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6384"
FT                   /product="sugar ABC transporter, substrate-binding protein"
FT                   /note="KEGG: ret:RHE_PC00171 sugar ABC transporter,
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6384"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61134"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAM6"
FT                   /inference="similar to AA sequence:KEGG:RHE_PC00171"
FT                   /protein_id="ACS61134.1"
FT                   /translation="MYIILDTNGKPSTLPHTKKGIDMKNLENGISASLRRQLLAGAAAA
FT                   AALLVFSAGTASAAANCIKGDRKAPYTIGWANIYSVPTWMKQTEGTITAEVEELKKAGL
FT                   VKDLMITDAQGNAQTQIQHIQSMIDANVDAIVVIAGSSNALDRVISDACDKGIAVVNFD
FT                   SLVNTDKVTAKINTDSNEWGATAAKWMVGQLGGKGKIIIMNGPAGISVSDDRRKGAQPV
FT                   LDANPGLQVITETNTEYNVAPAQEAMTSLLFANPEIDGVLSLGGALSAGSVLAFERQGR
FT                   DQVPTTGENARQFLELWKEKGLKGWATMQPNWLGALSVYTAVQALEGKDVPAFVKVPLP
FT                   VIDDSTIGSYLARADKFPADGYIYSDYDKALFDKLLAAK"
FT   sig_peptide     complement(96134..96310)
FT                   /locus_tag="Rleg_6384"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.919 at
FT                   residue 59"
FT   gene            96464..97249
FT                   /locus_tag="Rleg_6385"
FT   CDS_pept        96464..97249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6385"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; SMART: regulatory protein IclR; KEGG:
FT                   ret:RHE_PC00170 IclR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6385"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61135"
FT                   /db_xref="GOA:C6BAM7"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAM7"
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /protein_id="ACS61135.1"
FT                   /translation="MDAVQDEAAGKRARGLDRAFEILDFLRQKRQALKPNEIAAQIGAP
FT                   RSSVYELVNLLLQNGILEFTGGEGRVYLGRKLYFLGAAYENHFDFTRECEAALEQLADE
FT                   TRETAQFCMLDGNRYTVVRMREGARPFRISTDVGQSVPIPWTASGRLLVAHLSDQDILN
FT                   FIPPQDFRLPNGEWLEPQTFIAEVRQAEREGLFTFNSIVDSFTHCFAVPVRGEEGHAAA
FT                   TLCLVTPRDDGIANRDRYLDCLKKAAAGLDHAPTRPKRG"
FT   gene            97654..99006
FT                   /locus_tag="Rleg_6386"
FT   CDS_pept        97654..99006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6386"
FT                   /product="monooxygenase protein"
FT                   /note="KEGG: ret:RHE_PC00169 monooxygenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6386"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61136"
FT                   /db_xref="GOA:C6BAM8"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAM8"
FT                   /inference="similar to AA sequence:KEGG:RHE_PC00169"
FT                   /protein_id="ACS61136.1"
FT                   /translation="MTRKIRLGAFLPGGGQHVASWRHPDQPADGATSFEFHKRLALTAE
FT                   RGLFDAYFLADGLAVGFGGAREGGNARVAGFEPVTLFSALAPFTTHLGFIATSSTTYEE
FT                   PYTTARKFASLDLISEGRAGWNVVTTTGDLTAQNFNRDTQLPHADRYRRAAEHVDVVRK
FT                   LWESFEDDAFIRDKQSGVFFDPAKLHDTDHRGEHFSVRGPLNISRSPQGHPVIVQAGQS
FT                   EDGRGLAAATAEVIFTAHQHIETAQEFYRDIKARARALGRNPDHILVMPGVSAFVGRTE
FT                   AEAREKYDRLTSLIVEEDGIGLLNGLTGGTLDLHGYDLDGPLPPAPPTEGMKSRQALIR
FT                   QIADENNFTIRQLYQWIASARGHYTIVGTPEQIADTLQKWFENEAADGFNILPPWLPTA
FT                   LDDFVDLVIPELQRRGLFRTAYEGKTLRENLGLPFPTNRWAAEQADLQAAE"
FT   gene            99017..99868
FT                   /locus_tag="Rleg_6387"
FT   CDS_pept        99017..99868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6387"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ret:RHE_PC00168 aliphatic
FT                   sulfonate ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6387"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61137"
FT                   /db_xref="GOA:C6BAM9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAM9"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS61137.1"
FT                   /translation="MSYEINQVLPRSFGRLKNSESHISTLALQVRGVLASLLPRYGLLI
FT                   GFLVFWQVSSTRGWVNPAIFPPLDVILSALWTNLANGALLDDIAISLQRSGTAFAFAVV
FT                   IGIPLGLFMGQVRAVEQALDPILQLFRQTSALALYPVFILLLGLGETSKIFVIFWATLF
FT                   PVLLATIGGVKEVDKKLIEMARTYGAGPLTIFRRVILPASVPAIFVGLRLSATTALLLL
FT                   IAAEMIGANKGIGFQVMNAQYNFQIPLMFAAILLLAFLGLAANALLVLLQRRLCRWSQP
FT                   SR"
FT   gene            99909..100892
FT                   /locus_tag="Rleg_6388"
FT   CDS_pept        99909..100892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6388"
FT                   /product="aliphatic sulfonate ABC transporter
FT                   substrate-binding protein"
FT                   /note="KEGG: ret:RHE_PC00167 aliphatic sulfonate ABC
FT                   transporter substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6388"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61138"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAN0"
FT                   /inference="similar to AA sequence:KEGG:RHE_PC00167"
FT                   /protein_id="ACS61138.1"
FT                   /translation="MTFHPRHLLLPAVIALGLTSPAAAADTVKLRYLASQGGLAAHELA
FT                   AELGYFDGTGITLENVGYAQGGPASLIALASGDVEIGSAATSAVLNSIIGGNDFVAAYP
FT                   SNGINNEVQSTFYVLEDSPIKSIKDIAGKSIAVNTLGAHLDYTIREALHSVGLPADAAN
FT                   QLVVPGPQLEQVLRSKQVDIAAFGYWQTTFEGAALKNGGLRPIFDDTDVLGDIAGGFVV
FT                   LRRDFAREHPEAAKIFVEQSARALDYAREHPEETKKILAKALSERGENADIAQYFRGYG
FT                   VRAGGLPIERDIQFWIDVLVREGKLKQGQLAAKDILLTVDAKPASN"
FT   sig_peptide     99909..99983
FT                   /locus_tag="Rleg_6388"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.759 at
FT                   residue 25"
FT   gene            100902..101672
FT                   /locus_tag="Rleg_6389"
FT   CDS_pept        100902..101672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6389"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ret:RHE_PC00166 aliphatic sulfonate ABC transporter
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6389"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61139"
FT                   /db_xref="GOA:C6BAN1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAN1"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS61139.1"
FT                   /translation="MSIAEDTRRGEVTIRHLSKSYRLNGTPLQVLRDINLHVRSGESLA
FT                   IVGASGSGKTTLLRVLAGLEDSDTGEVLVDGKAVRGVGTERAVIFQEPRLLPWLTVLDN
FT                   VSFGLETSGLSREQARGRARHYVKLVGLQQFEAAYPRQLSGGMAQRVGIARALAVQPEI
FT                   LLLDEPLGALDAMTKIGMQQELARIWRDEDVTTILVTHDLEEAIYLADRILILPREKGG
FT                   EPRLIEIDLPRPRDRSAPEFVRHREELLNLFGLH"
FT   gene            complement(101763..103577)
FT                   /locus_tag="Rleg_6390"
FT   CDS_pept        complement(101763..103577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6390"
FT                   /product="Chloride channel core"
FT                   /note="PFAM: Chloride channel core; CBS domain containing
FT                   protein; SMART: CBS domain containing protein; KEGG:
FT                   ret:RHE_PC00165 chloride channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6390"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61140"
FT                   /db_xref="GOA:C6BAN2"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAN2"
FT                   /inference="protein motif:PFAM:PF00654"
FT                   /protein_id="ACS61140.1"
FT                   /translation="MAQHPPNNRPHDFTGGLSRREAGDFTTDRRVLLLVGMSIIVGTAG
FT                   AFAAWCLVSLIALVTNVIWFGQIGIQPASLAAVPRSLWVVLVPPLGGLVIGLMARFGSE
FT                   KIRGHGIPEAIEAILIGGSRMSPKVAVLKPLSSAISIGTGGPFGAEGPIIMTGGAIGSL
FT                   FAQFFHMSAAERKTLLVAGAAAGMTAIFGSPIAAVMLAVELLLFEWKPRSFIPVAVAAC
FT                   VSICWRPLLFGVGPLFPTHFQVALPWWGIFACAAMGIISGLQSGLLTTLLYRIEDLFEA
FT                   LPIHWMWWPALGGLVIGLGGLIEPRAMGVGYDIIDGLLNNRLLAPAVMSILLVKTIIWL
FT                   FALSSGTSGGVLAPLLIFGGALGWLVGLVMPGNDPGFWALLGMAAMMGGTMRAPLTGTF
FT                   FAMEITGDVSTLVPLLAATVVAYAVTVLLLRRSILTEKIARRGQHITREYGVDPFELSR
FT                   ASEIMISDVDTLPVAMTMGEACDFFASQRKTHRIYPVVDATGRLAGVVSRADALLWQGN
FT                   PDLASQTLAENVTDDSVPVGHPDDTVAFIADLMLSTGDGRIPIVDPTSGKLCGLIARKD
FT                   LLRLRSSYRSAELDRRPYLTASSKSKSR"
FT   gene            103780..104214
FT                   /locus_tag="Rleg_6391"
FT   CDS_pept        103780..104214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6391"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: ret:RHE_PC00164 MarR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6391"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61141"
FT                   /db_xref="GOA:C6BAN3"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAN3"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACS61141.1"
FT                   /translation="MKKTAPPLRQEDYEALADLRFALRQFMDFSASAAQSEGLPPQQHQ
FT                   ALLAIKGQRGDAMTIGMLAERLIIAPHTATELVGRLSDAGLVERHADPADRRRQTVLLT
FT                   DKADALLTRLSAVHLSEIREMAPKLIELLLELQKTASNTK"
FT   gene            complement(104250..105158)
FT                   /locus_tag="Rleg_6392"
FT   CDS_pept        complement(104250..105158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6392"
FT                   /product="homocysteine S-methyltransferase"
FT                   /note="PFAM: homocysteine S-methyltransferase; KEGG:
FT                   ret:RHE_PC00163 homocysteine S-methyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6392"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61142"
FT                   /db_xref="GOA:C6BAN4"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR017226"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAN4"
FT                   /inference="protein motif:PFAM:PF02574"
FT                   /protein_id="ACS61142.1"
FT                   /translation="MSTMRILDGGMSRELLRLGAELKQPEWSALALINAPDIVRKVHQE
FT                   FIAAGSEVVTTNSYALVPFHIGEDRFWKEGPALIRLAGRLAREAADAVTDRKVLVAGSL
FT                   PPIFGSYEPQNFQPSRVQDYLEVLVENLSPFVDIWLGETLSLIAEAEAVRKAVATSGKP
FT                   LWISFTLADNEVAIRGGEPKLRSEERVEDAASWVVSSGAEALLFNCSKPEVMQAAVETA
FT                   ARVFRTMDARIEIGVYANAFEGEQGEAAANEGLHKTRNDLNDDAYSRYACSWAEAGATI
FT                   IGGCCGIGAAHIHRLKKTLLD"
FT   gene            complement(105280..105969)
FT                   /locus_tag="Rleg_6393"
FT   CDS_pept        complement(105280..105969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6393"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: ret:RHE_PC00162
FT                   amino acid ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6393"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61143"
FT                   /db_xref="GOA:C6BAN5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAN5"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ACS61143.1"
FT                   /translation="MNFTWISSYWPLLLTGAWQTVCLLVISVVFGFAIAIGLAFAQVSG
FT                   GRLTRLLARSYCTFFRGTPLLIQLWLLYYGVGSLLPMVPGIRQSLFWPILREGFFFAAV
FT                   SFTLNYAAYEAEVLRGALLAVPKGELEAGRAFGLSPWMLIRRIWLPRAIRIALPTIAGE
FT                   IVMQLKATPLAFTVTVMDLYAVANKVRQDTLLVYEPLLVVTLFYLALTAVIARVFRGLE
FT                   AQVPVRR"
FT   sig_peptide     complement(105844..105969)
FT                   /locus_tag="Rleg_6393"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.984) with cleavage site probability 0.973 at
FT                   residue 42"
FT   gene            complement(105982..106707)
FT                   /locus_tag="Rleg_6394"
FT   CDS_pept        complement(105982..106707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6394"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: ret:RHE_PC00161
FT                   amino acid ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6394"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61144"
FT                   /db_xref="GOA:C6BAN6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAN6"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ACS61144.1"
FT                   /translation="MATTQQGILDLLSPYPPGWGGVLLAGAVSTVAISACAFAIGLLLG
FT                   TGGALGKLSGNRMLRLLLDLYTTLIRAVPELILIVGLYYAGTDGLNRLLAALELPPVNV
FT                   NGFVAAVAVLGFVQGAYMTEVLRGAILAIPVGQIEAAKAFGMGPVLRFRRVLLPALLPN
FT                   ALPGLANLWMSVTKDSALVAVVGYQELALATRLAGASTKHYFVFFLASALLYLAITLVS
FT                   NVVFKLIEARVRRGQPRLA"
FT   gene            complement(106720..107493)
FT                   /locus_tag="Rleg_6395"
FT   CDS_pept        complement(106720..107493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6395"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   SMART: extracellular solute-binding protein family 3; KEGG:
FT                   ret:RHE_PC00160 amino acid ABC transporter
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6395"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61145"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAN7"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ACS61145.1"
FT                   /translation="MKLLPTLFAGAALVLSAVTAQAEVRFGVMNESYPPFFAKDASGQW
FT                   QGWEIDLMNAVCEQMKEKCSIVEISWDGLIPALQSKKFDVIWSSMSNTAERSKVIDFTD
FT                   KYYNTPSTLIGPKDQKPGATAEDVKGKTIGIQVSTIQSEYYKKYFAEAAEEKTYQTLDE
FT                   AFQDLASGRIDYVFGDSLALDAFLKSDGGKDCCAKMGDVADDKEILGAGVSGGLRKEDT
FT                   ELKAKLNTAIAAVRASGQYDAINKKYFDFDIYGAK"
FT   sig_peptide     complement(107425..107493)
FT                   /locus_tag="Rleg_6395"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.960 at
FT                   residue 23"
FT   gene            complement(107546..108325)
FT                   /locus_tag="Rleg_6396"
FT   CDS_pept        complement(107546..108325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6396"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ret:RHE_PC00159 amino acid ABC transporter
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6396"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61146"
FT                   /db_xref="GOA:C6BAN8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAN8"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS61146.1"
FT                   /translation="MADQPFPALRVEDLHKSFGSQEVLKGISAQAEKSDVISIIGSSGS
FT                   GKSTFLRCINFLETPDRGRIAVNGEEIALKMGRGGRLQPRSWRQIERLRTGLGMVFQSF
FT                   NLWAHRTVLENVIEAPVHVMGISRREAIEKAEALLHKVGLFDKRHAYPAFLSGGQQQRA
FT                   AIARALCVDPAVMLFDEPTSALDPELVGEVLKVIRDLAEEGRTMLIVTHEMRFARDVSS
FT                   RVLFLHQGRIEEEGPPEQIFGAPVSARCREFTGLSAH"
FT   gene            108489..108953
FT                   /locus_tag="Rleg_6397"
FT   CDS_pept        108489..108953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6397"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; SMART:
FT                   regulatory protein AsnC/Lrp family; KEGG: ret:RHE_PC00158
FT                   AsnC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6397"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61147"
FT                   /db_xref="GOA:C6BAN9"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAN9"
FT                   /inference="protein motif:PFAM:PF01037"
FT                   /protein_id="ACS61147.1"
FT                   /translation="MEQLDRFDRDILDIVQRDCQLKAETIAERIGLSVSAVQRRLKRLR
FT                   EEGIIKAEVAVVDRKATGTAMVFIVGMEIERDNYDALAKFRLWAEKQDHIQQVYYVTGA
FT                   VDLIAIVTARDVEHYDDIAALIMADNPQIRRMHTNVVLRDVKLGLFVPLD"
FT   gene            109076..110461
FT                   /locus_tag="Rleg_6398"
FT   CDS_pept        109076..110461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6398"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: ret:RHE_PC00157 two-component sensor histidine
FT                   kinase protein; PFAM: Cache type 2 domain protein;
FT                   histidine kinase dimerisation and phosphoacceptor region;
FT                   ATP-binding region ATPase domain protein; SMART:
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6398"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61148"
FT                   /db_xref="GOA:C6BAP0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR017171"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAP0"
FT                   /inference="protein motif:PRIAM:2.7.13.3"
FT                   /protein_id="ACS61148.1"
FT                   /translation="MTLRHQIIALAIVPLVISILAITTFITWQSANLAKNSIDTFEQNM
FT                   LKTKEAEILNLTNLALSAIQTIYDNAGADDEAAKQKVAAILTSLDYGKDGYFFVYDYDG
FT                   NNIVHPRQSFRHGHNWLDLTDPDGDKVIAELIATARAGGGLHQYKWQKPSTGQIADKLS
FT                   FVVSLDKWQWVVGTGVYLDDVFAQSAAANAGMRANIKRTFIIVALIAVPSVLVVFTTCM
FT                   LLTFHERRMADSRLKALTQRVIDTQEEERARLARELHDGISQNLVGVRYAMDLAGRKVR
FT                   TNVDDAALTIDRGVEALNGAIKEIRRLSHDLRPRVLDDLGLTAALEALCYHFAERTGIE
FT                   TKIDASSFTDTLKAEANTALYRVAQEAFNNVERHSGASKLAVKVWSDNGRARMTVTDNG
FT                   TGFDGAKDGLSGRSGLGLRNMQERMAHFRGLLLINSSETGTTLTAMLPKSANRPAGKRA
FT                   EAA"
FT   sig_peptide     109076..109180
FT                   /locus_tag="Rleg_6398"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.716) with cleavage site probability 0.288 at
FT                   residue 35"
FT   gene            110458..111102
FT                   /locus_tag="Rleg_6399"
FT   CDS_pept        110458..111102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6399"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: response regulator receiver; regulatory
FT                   protein LuxR; Sigma-70 region 4 type 2; LexA DNA-binding
FT                   domain protein; SMART: response regulator receiver;
FT                   regulatory protein LuxR; KEGG: ret:RHE_PC00156
FT                   two-component response regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6399"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61149"
FT                   /db_xref="GOA:C6BAP1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAP1"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACS61149.1"
FT                   /translation="MTERPKIRVLLIDNHPLVLDGLKAVLETFDHIEVAGTAGLAQTGL
FT                   EIGRQVLPQVVLMDINMPKLSGIDAIELFRNELPQARVVMLSMHDSREYISSSVMHGAA
FT                   GYILKDVSTDEIVSAIETVAGGGTYFSSGVFDALMGERAEEGSDPLTPRERDILGLIVA
FT                   GRSNKEIAETLGITSATAETHRKNLKKKLGIATTAGLIRYALDHGIVSKTG"
FT   gene            111374..111571
FT                   /locus_tag="Rleg_6400"
FT   CDS_pept        111374..111571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6400"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_PC00155 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6400"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61150"
FT                   /db_xref="GOA:C6BAP2"
FT                   /db_xref="InterPro:IPR021741"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAP2"
FT                   /inference="similar to AA sequence:KEGG:RHE_PC00155"
FT                   /protein_id="ACS61150.1"
FT                   /translation="MEKPRSKAALWLLVIPYLGLLWPPFYNVREPSLFGFPFFYWYQLL
FT                   WVPITAALTWIAYRSTRHDD"
FT   gene            111561..113036
FT                   /locus_tag="Rleg_6401"
FT   CDS_pept        111561..113036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6401"
FT                   /product="Na+/solute symporter"
FT                   /note="PFAM: Na+/solute symporter; KEGG: ret:RHE_PC00154
FT                   monocarboxylic acid permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6401"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61151"
FT                   /db_xref="GOA:C6BAP3"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAP3"
FT                   /inference="protein motif:PFAM:PF00474"
FT                   /protein_id="ACS61151.1"
FT                   /translation="MTTDINGTALAVFIFFFVLVTVMGFVASRWRKPETLASIDEWGLG
FT                   GRNFGTWITWFLVGGDFYTAYTVIAVPALVYTVGAYGFFALPYTIVVYPFVFMVMPVLW
FT                   KRAKDFGYVTAGDVVHGQYGSRGLELAVAATGVIATMPYIALQLVGMTAVLKALGLHGE
FT                   LPLAIAFIVLALYTYSAGLRAPALIAFVKDIMIYIVVIAAVALIPSKLGGYANVFASAD
FT                   AAFQAKGSGNLLLGGNQYVAYATLALGSALAAFMYPHTLTGIFASNSGKTIRKNAIMLP
FT                   AYTLLLGLLALLGYMGHAANLKLDSANDVVPTLFKTLFSGWFSGFAFAAIAIGALVPAA
FT                   VMSIGAANLFTRNFWKAYVDPDVSDAGEAKVAKITSLVVKIGALLVIIFLPTQFALDLQ
FT                   LLGGIWILQTLPALVFGLYTNWFRAPALLAGWFVGFGGGTFLVWDAGWKPLHLISLGGE
FT                   PFTVYTGLLALAANIAVAVVVNALLPAKAPARA"
FT   gene            complement(113127..115193)
FT                   /locus_tag="Rleg_6402"
FT   CDS_pept        complement(113127..115193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6402"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SMART: chemotaxis
FT                   sensory transducer; histidine kinase HAMP region domain
FT                   protein; KEGG: ret:RHE_PC00153 methyl-accepting chemotaxis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6402"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61152"
FT                   /db_xref="GOA:C6BAP4"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAP4"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACS61152.1"
FT                   /translation="MHSETPRLCIRTRYDKQSWLPRHPSNKPHREGRVHMKNIMSFGVV
FT                   ARLALGFSVLLLLMVGLTIYSTEKVAQINDKLGTINDVNSVKQRFAINYRGSVHDRAIA
FT                   IRDVTLVTSDDERKTAEALIEKLAASYAENEKRMADMVASPAGATEQEKTILGEIADIQ
FT                   AKTNPLVAQIIALQEKGDGEAARKILLEQARPAFVAWLGAINKFIDYQEALNKSIGGEV
FT                   RSTASGFKPLALTALGIAAVLSLVAAAVTARTIVGPLAKLQLSLKAMADGNLNGDRRLE
FT                   ARGDEIGKLARAVAGLRDAISAKAEREADAEAKRAVSERHRLEQDADERRTLAEQTDKA
FT                   VGQLGDALQALADGDLTQQIGTPFIPSLEKLRADFNSAVEKLRAAMQKVAQNASAIAGG
FT                   AQEIRSASDDLAKRTEQQAASVEETAAALEEITTTVADSSNKAQEAGQLVRKTKDSAER
FT                   SGSVVRDAVDAMGKIESSATEIGSIIGVIDEIAFQTNLLALNAGVEAARAGDAGKGFAV
FT                   VAQEVRELAQRSAKAAKEIKELINASNGHVKSGVALVGETGKALKEIAEQVQQVDGNVG
FT                   AIVGASQEQATGLKEINTAVNRMDQGTQQNAAMVEEATAAAHNLAKEADALFQLLGQFN
FT                   IGGAVAPKRVSPPAAAAPRAQPAPSPARQMIAKVGKSFQTNGNAALAGDWEEF"
FT   gene            complement(115614..116750)
FT                   /locus_tag="Rleg_6403"
FT   CDS_pept        complement(115614..116750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6403"
FT                   /product="Alkanesulfonate monooxygenase"
FT                   /EC_number="1.14.14.5"
FT                   /note="PFAM: Luciferase-like monooxygenase; KEGG:
FT                   ret:RHE_PC00151 putative FMNH2-dependent aliphatic
FT                   sulfonate monooxygenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6403"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61153"
FT                   /db_xref="GOA:C6BAP5"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAP5"
FT                   /inference="protein motif:PRIAM:1.14.14.5"
FT                   /protein_id="ACS61153.1"
FT                   /translation="MISRGAFLPLVLFQSHTEPQHRMSNNSEFLWYIPNDVKAGHRGDS
FT                   AVENHNSLDTLTSQARALEEHGWKGALIGTGWGRPDTFTVAASLAARTTTFEPLIAIRP
FT                   GYWRPANFASAAATLDHLTGGRVRINIVSGKDNLAAYGDSEGDQAHRYARTKEFMRLVR
FT                   RLWTEENVTSAGENFRVAESTVVPRIQVRDDRRHPKFYFGGASEAAERVAATEADVQLF
FT                   WGEPLEGVRERIARLKALSGELDRDLPPLEFGLRITTLVRDTTEQAWTDAEAKVAEMAR
FT                   SKGSGWHDHQRVLAVGQQRLLDLHERGDVLDDNLYTAPGKFGGGGAGTTWLVGSAEDVA
FT                   RSLRKYQDLGITHFVLSDTPYLSEIKRQGDQLLPLLRS"
FT   gene            complement(116747..118120)
FT                   /locus_tag="Rleg_6404"
FT   CDS_pept        complement(116747..118120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6404"
FT                   /product="nitrilotriacetate monooxygenase component A"
FT                   /note="KEGG: scl:sce5568 nitrilotriacetate monooxygenase
FT                   component A"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6404"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61154"
FT                   /db_xref="GOA:C6BAP6"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAP6"
FT                   /inference="similar to AA sequence:KEGG:sce5568"
FT                   /protein_id="ACS61154.1"
FT                   /translation="MSISKRQMRLGAFIMATGHHIAAWRHPEAQADAGLNIDHYRELAQ
FT                   TAERGKFDLVFVADSPAGWDRAKDPEALRRTAQGAHFEPLTLWAALSQVTKHIGFVATA
FT                   STTYEDPYLLARRFASLDYISKGRAAWNVVTTGADVSKNFSIAGHPAHADRYERAEEFV
FT                   DLVKGLWDSYEDDAFIRDKESGVYLDPDKVHLVDHKGKFFSVAGPLNVGRPVQGYPVIV
FT                   QAGASEPGRELAARTAEMIFTANQTFEDAQEFYSDVKGRLARYGRRPDELLISPGIFPV
FT                   LGGTEAEARANYDHLQSLVHPSIAWNILARHYKGVDLSGYSLDDPAPPLPDNTELNKSR
FT                   LKLVSDLVSRNNLTLRQFYLAVATARGHRTVVGTPEQIADAMQSWFENGAADAFNIMPP
FT                   ILPTALTDFVDQVVPILRKRGLFRHEYEGTTLRENLGLQRPPNGFVVQAGQQQAQAAV"
FT   gene            complement(118156..118905)
FT                   /locus_tag="Rleg_6405"
FT   CDS_pept        complement(118156..118905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6405"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: scl:sce0167 ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6405"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61155"
FT                   /db_xref="GOA:C6BAP7"
FT                   /db_xref="InterPro:IPR001579"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017875"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAP7"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS61155.1"
FT                   /translation="MAPHPGKLKPANKAVHVRDLARRFATKTILDGVDLDIEEGEFVAL
FT                   LGRSGSGKSTFLRALAGLDHGVEGTGTLETPESLSVVFQDARLLPWRTVIQNVTLGLTG
FT                   ASGQEAGRKALAEVGLAGRETAWPNQLSGGEQQRVALARSLVREPALLLADEPFGALDA
FT                   LTRLKMHDLLRELCARHRPAVLLVTHDVDEAISLADRILVLDEGRLIEDLKIDLPTPRD
FT                   HGDPSFAQTRIHLLSRLGVELPGRKAA"
FT   gene            complement(118881..119771)
FT                   /locus_tag="Rleg_6406"
FT   CDS_pept        complement(118881..119771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6406"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mlo:mll9180 permease of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6406"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61156"
FT                   /db_xref="GOA:C6BAP8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAP8"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS61156.1"
FT                   /translation="MATTWDADEAKQSRSSGGRIVRAGSGLVKPAGSTGPRARRRLGPG
FT                   PAIPFGLQIGPALLVLTWVVGSALGWIDPRILSAPWTVAEAFVRLIEQGRLQDNFVTSA
FT                   TRALLGLSIGLLIGTILALIAGLSRIGEALIDGPVQIKRAIPTLALIPLLILWFGIGES
FT                   MKVTTIALAVIVPIYIHTHNALRSIDSRYVELAETLRMSQKDFILQVVLPGALPGFLLG
FT                   LRFAVTLCWVSLVVVEQINATSGLGYMIDLARNYGQTDVILVGLVVYVLLGLVSDGLVR
FT                   LLERRALSWRRTLAN"
FT   gene            complement(119806..120831)
FT                   /locus_tag="Rleg_6407"
FT   CDS_pept        complement(119806..120831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6407"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mlo:mll9181 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6407"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61157"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAP9"
FT                   /inference="similar to AA sequence:KEGG:mll9181"
FT                   /protein_id="ACS61157.1"
FT                   /translation="MTLAKTFKIALFSLLGLSAIHGPAAAEADAPLLPKVPPGTVLTIG
FT                   DPVTQKALEVSGLGKELSFEVKWANISGGPQTSEAFRAHALDVGSVAEIPSIFANWNNL
FT                   PVRNIAYRERRDPIANPIYRFGIAPGAAVKTLADFRGKRIAFSPGQAQGTLVLRALRAA
FT                   GLKSGDVTLVELPSTSDVYPKALASKQVDIAPLGGVYIRRYITQYGPDGATLVEHGLRD
FT                   DPSHLYAPQWVLDDPAKAAALAEYVGLWARATEWVNRNPDLWIKEYYVGQQGLSQEDGE
FT                   YLVKLTGEQVVPSDWSEVKKRHQETIDLLADELGNKPLNVEQIFDNRFEKLGAAALAKS
FT                   Q"
FT   sig_peptide     complement(120751..120831)
FT                   /locus_tag="Rleg_6407"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.670 at
FT                   residue 27"
FT   gene            complement(121156..121494)
FT                   /locus_tag="Rleg_6408"
FT   CDS_pept        complement(121156..121494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6408"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_PC00150 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6408"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61158"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAQ0"
FT                   /inference="similar to AA sequence:KEGG:RHE_PC00150"
FT                   /protein_id="ACS61158.1"
FT                   /translation="MIIRYALFEGEIHPGKEREFREFVRQRLVPLWTKFPGAEEIRVLD
FT                   GMERDEGAPIYAMALAIRYPDMDTVNAALLSDVRSQSREVTGELLQLFTGKVHHHVFSA
FT                   NEYAPHSA"
FT   gene            complement(121590..122687)
FT                   /locus_tag="Rleg_6409"
FT   CDS_pept        complement(121590..122687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6409"
FT                   /product="putative sugar ABC transporter, substrate-binding
FT                   protein"
FT                   /note="KEGG: ret:RHE_PC00149 putative sugar ABC
FT                   transporter, substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6409"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61159"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAQ1"
FT                   /inference="similar to AA sequence:KEGG:RHE_PC00149"
FT                   /protein_id="ACS61159.1"
FT                   /translation="MKRRTLLQATVATVAVMLSMPAWADSMADAKAVVEKYASKVSAWD
FT                   GPTSGPKGAAGKNIVILAGDMKNGGILGVVNGVQEAAGALGWTVKALDGAGSIGGRTAA
FT                   FGQAMALKPDGIIINGFDAVEQKPAMEAAKAAGIPMVSWHAASAVGPVPEVGVFANVTT
FT                   DAMEVSKSAADWAFADAAGKPGVIIFTDSTYAIAIAKADRMKKEIEDLGGTVLEYVDTP
FT                   IAETSQRMPQLTTSLLQKYGAKWTHSLAINDLYYDFMGPSLASAGIAGDGKPVNVAAGD
FT                   GSESAYQRIRAKQFQAVTVAEPLNLQGWQLVDELNRAFAKAPWSGYVSPLHVVTSQNVE
FT                   FDGGPKNSFDPDNGYRDQYKKIWGK"
FT   sig_peptide     complement(122613..122687)
FT                   /locus_tag="Rleg_6409"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            complement(122739..123779)
FT                   /locus_tag="Rleg_6410"
FT   CDS_pept        complement(122739..123779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6410"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   ret:RHE_PC00148 sugar ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6410"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61160"
FT                   /db_xref="GOA:C6BAQ2"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAQ2"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACS61160.1"
FT                   /translation="MQSIESTALEPTKSEMAGLSTGQKIGRLIPVYGLVILTVGLIVIF
FT                   SILLPDTFPTVLNVRSIVSDKAIIALLSLAAMIPMASGRIDLTVGYGIVLWHILAISLQ
FT                   TAYGLPWPVAVVIVLALGVLTGCINGLLVEVAKIDSFIATLGTGTVLYALALWHTGGRQ
FT                   VVGVLPDGFYALNGTMLFGLPITGFYVLLIAICMWIVLEYLPIGRYLYAIGANPKAAAL
FT                   NGIPVRKFVIGAFVTSGLLAALTGVLLASKLRIGQASVGLEYLLPALVGAFLGSTTIKP
FT                   GRVNVWGTLIGVIILAVGISGIQQFGGSFFVEPLFNGVTLLIAIGIAGYAQRKRGAVRR
FT                   ITPASK"
FT   gene            complement(123798..125294)
FT                   /locus_tag="Rleg_6411"
FT   CDS_pept        complement(123798..125294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6411"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ret:RHE_PC00147 sugar ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6411"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61161"
FT                   /db_xref="GOA:C6BAQ3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAQ3"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS61161.1"
FT                   /translation="MEAKRLLEFQSITKSFGGTQALRDVSIDLREGEILALLGENGAGK
FT                   STLIKTLAGIYRPDSGDILFRGQSYHHRPPKPNERQPVAFIHQDLGLIEWMTVGENMGL
FT                   SQGFSMRRGLIDWNRTQARANEALKLVGCDFDPTTRVSALSRTEKSLVAIARALAVEAD
FT                   VLVLDEPTASLPADEVDRLFNAIRPLKDRGVGMIYVSHRLDEIFRIADRVAVLRDGCMV
FT                   GQKPVSETTPEELVTMIIGRSGDSLFSKTAITPGKAIVEVRDLVCAGTGPISFDIREGE
FT                   LLGLAGLRGAGQERIGRALFGCEPFNGSVLLHDEAPDLSSPRGAMASGIGLIARDRTEE
FT                   SVALSLSIRENTYLNPGAVGRGLLSFLSPRGEADLAHKIGHSVGLRPNDPDLPVEALSG
FT                   GNQQKVVVGRWLATGRKLLVAEDPTAGVDIGARAEIYRLITQALEAGLAVVVVSTDFEE
FT                   IAHICHRALVFSRGKIVSELTGSALTTEAVITAASASEAA"
FT   gene            complement(125400..126293)
FT                   /locus_tag="Rleg_6412"
FT   CDS_pept        complement(125400..126293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6412"
FT                   /product="2-hydroxy-3-oxopropionate reductase"
FT                   /EC_number="1.1.1.60"
FT                   /note="PFAM: 6-phosphogluconate dehydrogenase NAD-binding;
FT                   NADP oxidoreductase coenzyme F420-dependent; KEGG:
FT                   ret:RHE_PC00146 6-phosphogluconatedehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6412"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61162"
FT                   /db_xref="GOA:C6BAQ4"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAQ4"
FT                   /inference="protein motif:PRIAM:1.1.1.60"
FT                   /protein_id="ACS61162.1"
FT                   /translation="MQDDYRADVAVIGAGIMGTAIVTRLIETGHKVSVYDLDTEKVAAL
FT                   QAKGARAAGSVEEAVSWSAFCVLSLNHANIVRAVVFGEKGVAAAANADKVLIDMSSIDP
FT                   ADTADMAMRLRRETGMAWVDCPLSGGVPGALSGRLTIMAGGSAEDFERARVVMRHLAAN
FT                   YTLMGVSGAGQTTKLINQLFCAVLFQAVAEAVKLAEAGGVDPAAIPAALAGGRADSRIL
FT                   QEFMAKFAARDFSPTGRIDNMLKDLDSLQVFALKTKTPLPMTGSVVEIHRLLCAAGLGP
FT                   KDSAEMMRLLDGFQTD"
FT   gene            complement(126283..126840)
FT                   /locus_tag="Rleg_6413"
FT   CDS_pept        complement(126283..126840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6413"
FT                   /product="carbohydrate kinase, thermoresistant glucokinase
FT                   family"
FT                   /EC_number="2.7.1.12"
FT                   /note="KEGG: ret:RHE_PC00145 gluconate kinase protein;
FT                   TIGRFAM: carbohydrate kinase, thermoresistant glucokinase
FT                   family; PFAM: shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6413"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61163"
FT                   /db_xref="GOA:C6BAQ5"
FT                   /db_xref="InterPro:IPR006001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAQ5"
FT                   /inference="protein motif:TFAM:TIGR01313"
FT                   /protein_id="ACS61163.1"
FT                   /translation="MDFDKKAPPLAVVVMGVSGCGKSSVGEHLAARNGMLFLEGDQLHP
FT                   AGNVEKMAQGIPLTDDDRLPWLDRIGEEIRTAQHASQGLVISCSALKKSYRDRLRQAAD
FT                   GRLAFVFLEGSRDLLLSRMQARQGHFMPATLLDSQLQTLEPPTGEANVVTVAIDDALDD
FT                   IVALACKGLSGMAVKGGDYHAG"
FT   gene            complement(126854..127618)
FT                   /locus_tag="Rleg_6414"
FT   CDS_pept        complement(126854..127618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6414"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   ret:RHE_PC00144 gluconate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6414"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61164"
FT                   /db_xref="GOA:C6BAQ6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAQ6"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACS61164.1"
FT                   /translation="MKNLFDLTGRRALITGSSQGIGYALAEGLAQYGAQVIINGRTPES
FT                   VNRAVESLKDQGLSAHAAIFDVTSKDAAKAGIDAIEADIGPLDILINNAGMQFRTPLED
FT                   FPADKWELLLTTNISSVFYVGQAAAKPMIARGQGKIINIASVQSELARPGIAPYTATKG
FT                   AVRNLTRGMCADWAKYGLQINAIAPGYFKTPLNQALVDNPEFSSWLEKRTPAGRWGNVD
FT                   ELVGAAVFLSGRGSSFINGHTLYVDGGITTCL"
FT   sig_peptide     complement(127538..127618)
FT                   /locus_tag="Rleg_6414"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.642) with cleavage site probability 0.641 at
FT                   residue 27"
FT   gene            127755..128696
FT                   /locus_tag="Rleg_6415"
FT   CDS_pept        127755..128696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6415"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; KEGG: ret:RHE_PC00143 D-2-hydroxyacid
FT                   dehydrogensase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6415"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61165"
FT                   /db_xref="GOA:C6BAQ7"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAQ7"
FT                   /inference="protein motif:PFAM:PF02826"
FT                   /protein_id="ACS61165.1"
FT                   /translation="MPKVEILMTGAYPEWDMVDLEANYRIHRLWEAADRHELISRVGKD
FT                   IRAIATRGELGASAELMAQLPKLEIVSCYGVGTDAIDLSYARANGIRVTNTPDVLTEDV
FT                   ADIAIGLLLATARQVPQADVFVRSGQWGSVAMPLVTRVSGKKVGIAGMGRIGKAIARRA
FT                   AAFGCEISYFARHDHQDVAYTYEPDLIALADWADFLIVIVPGGEATMKIINAEVLKALG
FT                   PNGILINVSRGTTVDEEALIAALQDRTIQAAGLDVFLNEPKIDARFLTLQNVVLQPHHG
FT                   SGTVETRKAMGKLVRDNLAAHFAGSALPTPVV"
FT   gene            128707..129738
FT                   /locus_tag="Rleg_6416"
FT   CDS_pept        128707..129738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6416"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   Alcohol dehydrogenase zinc-binding domain protein; KEGG:
FT                   ret:RHE_PC00142 L-idonate 5-dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6416"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61166"
FT                   /db_xref="GOA:C6BAQ8"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAQ8"
FT                   /inference="protein motif:PFAM:PF08240"
FT                   /protein_id="ACS61166.1"
FT                   /translation="MKAIVIHAAKDLRIEEREPEVAGAGQVEIAIEAGGICGSDLHYYN
FT                   HGGFGTVRLREPMILGHEIAGTVKALGSDVADLAVGDRVAVSPSRPCNHCQYCLKGQQN
FT                   HCLNMRFYGSAMPMPHIQGGFRQRLVAERWQCHKVADGISIHEAAFAEPFAVTLHAANR
FT                   AGSLLGKRVLVTGCGPIGMLAIVAARVLGAREIVATDVTDSVLAIARTSGADRTINVAT
FT                   HASDLAAYSAEKGYFDVMFEASGNERAVRSGLETLKPRAVLVQLGLGGDVSIPQNMIVA
FT                   KEIEMRGTFRFHEEFALAVELINARRVDLKPLLTGVFKIEEAVAAFELAGDRSKSMKVQ
FT                   IAF"
FT   gene            complement(129815..130891)
FT                   /locus_tag="Rleg_6417"
FT   CDS_pept        complement(129815..130891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6417"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; regulatory protein LacI; SMART:
FT                   regulatory protein LacI; KEGG: ret:RHE_PC00141 LacI family
FT                   transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6417"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61167"
FT                   /db_xref="GOA:C6BAQ9"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAQ9"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ACS61167.1"
FT                   /translation="MKNEDEPKVKRLKPGDAQKLTMAEVAKYVGVSAMTVSRAFRQDAS
FT                   VSEETRKRIMEAVDALGYVLDLSAGSLSSRRSGFIAALVPSINNSNFSDTARGMTDALE
FT                   NTGLQLLLGYTDYSSEKEEELIEAMLRRRPEGIILTGGSHTARARRMLAKAGIPVVETW
FT                   ELPEDPINQVVGFSNSEAMALLVRTLASQGYRKFGYIGGTTARDTRGSQRRSGFQRTVE
FT                   ELGLGPGRMISFGVPPITMEQGGQAIVSLLERWPDTEVVLCVSDLSAFGAIMECTRRGM
FT                   KVPRDIAIAGFGDYEISSICHPRITTINVDCYGIGRQAAARLLDTLHTGEATGDEITLT
FT                   GYKVVLRESTDRNGAPTA"
FT   gene            131118..132044
FT                   /locus_tag="Rleg_6418"
FT   CDS_pept        131118..132044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6418"
FT                   /product="Gluconolactonase"
FT                   /EC_number="3.1.1.17"
FT                   /note="PFAM: SMP-30/Gluconolaconase/LRE domain protein;
FT                   KEGG: ret:RHE_PC00140 gluconolactonase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6418"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61168"
FT                   /db_xref="GOA:C6BAR0"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="InterPro:IPR039096"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAR0"
FT                   /inference="protein motif:PRIAM:3.1.1.17"
FT                   /protein_id="ACS61168.1"
FT                   /translation="MFGQIDGTGFEVLDPRFESCFVGHTRVERLWTGGRWLEGPAWFAA
FT                   GRYLVFSDIPNNRMMRYDDASGQTSVFRSPSNNSNGNTVDNQGRLITCEHLTRRVTRTD
FT                   FDGRVTLLADRIAGKRLNSPNDVTVKSDGTVWFTDPSYGILHDYEGDYGAEEIGGCHVY
FT                   RHDPATGTTDQVTSDFVKPNGLAFSPDETLLYVADTGATHLPGGPRHIRKLAVSNEGRL
FT                   TDLGVFAECSAGLFDGFRVDRKGRIWTSAGDGVHAYDPDGTLIGKIHIPEGVSNVTFGG
FT                   EKLNRLFITASTSLYAVYLTANGTRLG"
FT   gene            complement(132109..134229)
FT                   /locus_tag="Rleg_6419"
FT   CDS_pept        complement(132109..134229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6419"
FT                   /product="von Willebrand factor type A"
FT                   /note="PFAM: von Willebrand factor type A; SMART: von
FT                   Willebrand factor type A; KEGG: ret:RHE_PC00139
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6419"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61169"
FT                   /db_xref="GOA:C6BAR1"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR021908"
FT                   /db_xref="InterPro:IPR022156"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAR1"
FT                   /inference="protein motif:PFAM:PF00092"
FT                   /protein_id="ACS61169.1"
FT                   /translation="MTVDKELDKLSRLTPPAATPEARTRALAAAMQAFDTAENNATAAQ
FT                   GNAKGWRQSSIINWIWSPAMNKKFLAGSALATLLVIPAAGYLAIELTRNGLPIIDQTEI
FT                   AGNLSKSEASKQPAATTGQPVAVAPQIPAGNVSLAEQSVAVAQALQDKEAPALAKPDAS
FT                   QTSEYDANAALTNKPEGSAAALGATKRAAPAAPGIVPQRQFAEPMAAIAPSPVPPAEGR
FT                   MQMQLDPNRERFANAAANPIKSVATDPVSTFSADVDSASYAFVRRSLTGGAMPDPLSVR
FT                   VEEMINYFPYDWPGPNNADQPFKATVTVMPTPWNRDTELMHVAIKGYDIAPATTPRANL
FT                   VFLIDVSGSMDEPDKLPLLKSAFRLMVNRLKADDTVSIVTYAGNAGTVLAPTRVAEKSK
FT                   ILSAIDRLEPGGSTGGAEGIEAAYDLAKQGFVKDGVNRVMLATDGDFNVGPSSDGDLKR
FT                   IIEEKRKDGIFLTVLGFGRGNLNDSLMQTLAQNGNGSAAYIDTLAEAQKTLVEEAGSTL
FT                   FPIASDVKFQVEFNPERIAEYRLIGYETRALNREDFNNDRVDAGDIGSGHSVTAIYEIT
FT                   PKGSPAVMNDDLRYGAADKVPAEASDSAHHGELAFVKMRYKRPGEDKSALITTPVNDGN
FT                   AVATVDAAPQDVRFSVAVAAFGQKLSHVAAVDTYSYQAIADLAAASRGTDTFGYRSDFL
FT                   GLVRLADGLSQR"
FT   gene            complement(134226..134750)
FT                   /locus_tag="Rleg_6420"
FT   CDS_pept        complement(134226..134750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6420"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; Sigma-70
FT                   region 4 type 2; sigma-70 region 4 domain protein; KEGG:
FT                   ret:RHE_PC00138 RNA polymerase sigma-E factor"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6420"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61170"
FT                   /db_xref="GOA:C6BAR2"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAR2"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACS61170.1"
FT                   /translation="MDAELIERAQGGDREAFGQLVSRHYDFVHATAWRWSGSSTDADDI
FT                   AQEVCVKLGAAIRSFRGASRFRTWLYTLTLNAARDHRRKLAREEQTFRAYAVEPQPDAP
FT                   AANDDELSSELWAAVRALPDRQCDAVLLVYGEGLSHSAAADVMGCSEATVSWQVHEARK
FT                   RLKAVLGKEEV"
FT   gene            134975..135886
FT                   /locus_tag="Rleg_6421"
FT   CDS_pept        134975..135886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6421"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: ret:RHE_PC00137 lipase/esterase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6421"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61171"
FT                   /db_xref="GOA:C6BAR3"
FT                   /db_xref="InterPro:IPR002168"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAR3"
FT                   /inference="protein motif:PFAM:PF07859"
FT                   /protein_id="ACS61171.1"
FT                   /translation="MSAQPPAPTERGILQFLAICDSFYPPDAVLASIEQQRHWYDTLCA
FT                   RFDRPLPPEMIFADGMLQRIPIRRYRPRKISTRTSLLYLHGGGFVVGSLESHHAICAEI
FT                   ADFAGAELVSVDYRLAPEYRWPAQTDDGFTVLKHLLSANSKVVLIGDSAGANLAAGLAL
FT                   RARDEGLSGVVGQVLIYPALGGDLAAGSYVEMAAAPGLTTADVGYYREILQAPAGNEIA
FT                   EPLQAASLAGLPPAFITVAHFDPLRDDGRHYAARLTAEGVEVWFREEPQMVHAWLRARH
FT                   MSDGARDGFRAVCEAVRRLAIA"
FT   gene            complement(135890..137893)
FT                   /locus_tag="Rleg_6422"
FT   CDS_pept        complement(135890..137893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6422"
FT                   /product="peptidase S15"
FT                   /note="PFAM: peptidase S15; X-Pro dipeptidyl-peptidase
FT                   domain protein; KEGG: ret:RHE_PC00136 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6422"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61172"
FT                   /db_xref="GOA:C6BAR4"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR005674"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013736"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAR4"
FT                   /inference="protein motif:PFAM:PF02129"
FT                   /protein_id="ACS61172.1"
FT                   /translation="MTSRGFTTIENEWITLEDGTRLAARIWMPDGASEDPVPAVFEFLP
FT                   YRKRDGTSLRDESTYPVFAAAGIAGVRVDIRGSGESDGVIDGEYTESELANACELIAWI
FT                   ASQPWSNGAVGMMGISWGGFNSLQVAALRPPALKAVISIASTVDRYNDDIHYKNGCHLS
FT                   AQLSWAATMLGYQSRPPDPALVGERWKEMWLERLAGEPFFMEEWLAHQRRDVFWRHGSI
FT                   SEDFSSVEIPALVIAGWADGYRNTPLMAVEGLGGKAKALIGPWVHKYPHFAWPKPRTDF
FT                   HGEAIAWWNKWLRGEDNGIDRLPQARAYILDAIRPAPRRDSDPGFWVAKDVWSPPQMQC
FT                   FYVEQFGKLTEGMPIPHAPEHPVYLRSPLDTGTASGEYFTLKPDAEMAIDQRSDDAGSL
FT                   VFDTMPLAGDHDYLGRPVLTLALRSRAACGNLCARLVDVHPDGTATRVAFGVVNLTHRD
FT                   GNVDPKPLKPGETVPIRLVLDACGYRFRKGHRIRLSLSTAYWPMILPPPDDDGIEVDIA
FT                   ALGLGLPMLGEHQRIDIKEPANPDPLPKYIEHAAAATKRQVVRDLSVNRTEYHIHEDTG
FT                   LTEHPETGLSTRQLREELWSISPDNPLSMTGTSTWTCDMRRPGWFVRTVATGRVACTRT
FT                   DWIISAVVTAFEDDVQIFEKVFAEKRIARDLM"
FT   gene            complement(137945..139576)
FT                   /locus_tag="Rleg_6423"
FT   CDS_pept        complement(137945..139576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6423"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ret:RHE_PC00133 peptide ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6423"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61173"
FT                   /db_xref="GOA:C6BAR5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAR5"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS61173.1"
FT                   /translation="MPELLSVRNLKIEATSYPPGEPPKRVTIVDGVSFDLQKGKVLGLI
FT                   GESGAGKSTIGLSALAYGRGGAEITGGEVRLDGADILVLGKDGIRKIRGARVCYVAQSA
FT                   AAAFNPAHRLGDQVIEASVKHRLMTKDEARKRALYLFGVLGLPNPETFGERFPHQVSGG
FT                   QLQRAMTAMALCSNPELIVFDEPTTALDVTTQIDVLAAIKHAIEETHTAALYITHDLAV
FT                   VAQISDDIMVLRYGKQVEYGSVQQIIEAPREDYTRALVNVRQAYREEAADQSAALLKVE
FT                   NVSAEYSNGFKVLHDVSLHVPKGQTLAVVGESGSGKSTLARVITGLLPPSSGRIVFDGK
FT                   PLMPGLKSRPNDDLRRIQLIYQMADTAMNPRQTVRDIIGRPLTFYYGLRGAEKTARVKE
FT                   LLDQIEMGKGFVDRYPAELSGGQKQRVAIARALAAKPELILCDEPTSALDPLVAEGILK
FT                   LLLRLQQEEQLSYVFITHDIAIVRAIADSVAVMHRGKLVRFGPKSTALSPPFDDYTDLL
FT                   LKSVPEMEIGWLERVLATRRMESAGN"
FT   gene            complement(139569..140396)
FT                   /locus_tag="Rleg_6424"
FT   CDS_pept        complement(139569..140396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6424"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ret:RHE_PC00132 peptide ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6424"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61174"
FT                   /db_xref="GOA:C6BAR6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAR6"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS61174.1"
FT                   /translation="MRLRDIPITAWIGMAGIAIAFIFALFAPWLAPYGETQVVGDVWQL
FT                   PDNQYIFGLDNLGRDIFSRLIYGARTTLTVASAATVISFSLGIILSFTAAVSRGIIDTV
FT                   FSRFNDLMMSIPTLIFALVVLAVLPQNIVVLILVMAILDSTRVYRLGRAVALDVAVMEF
FT                   VEAATLRGEGKLWIIFREILPNTLSPLLAEFGLRFAFSILFLSTLSFLGLGIQPPAADW
FT                   GGMVKDNKDGIIFGISAALVPGTAIATLAVCVNLVVDWLLKRTSSLKGGRGDA"
FT   gene            complement(140393..141397)
FT                   /locus_tag="Rleg_6425"
FT   CDS_pept        complement(140393..141397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6425"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ret:RHE_PC00131 peptide ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6425"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61175"
FT                   /db_xref="GOA:C6BAR7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAR7"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS61175.1"
FT                   /translation="MTNPAPSILPGLGFRQRFPLLALILERFVLSLVLLFAVSILIFGG
FT                   LEALPGDFATTYLGQSATPQAVANIRQDLGLNRPVTTRYVEWLGNAVQGDFGTSWASKN
FT                   SVSEQIGKRLGNSLFLAGFAAVISVPLAVGLGMLSVHFRNRLPDKIINIISLAAISLPE
FT                   FFIGYLLILLFAVNLGMATFPATVYDSMGFVERLKAIALPTATLVLVVLAHMMRMTRAA
FT                   ILSVMSSAYMETAELKGLSAFRSIVKHAAPNALAPIINVIALNLAYLVVGVVVVEVVFV
FT                   YPGMGQYMVDAVTVRDMPVVQACGLIFAAVYIFLNMTADILAIIANPRLRHPR"
FT   gene            complement(141495..143084)
FT                   /locus_tag="Rleg_6426"
FT   CDS_pept        complement(141495..143084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6426"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: ret:RHE_PC00130 peptide ABC transporter,
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6426"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61176"
FT                   /db_xref="GOA:C6BAR8"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAR8"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ACS61176.1"
FT                   /translation="MNDYTKYLASRVTAGGLSRREFMGRAMAAGITLAVADKLFTESAQ
FT                   AAEPKRGGHLKLGLEGGAATDSNDPAKFLSQVMFCIGRCWGDMLVESDPLTGAAVPALA
FT                   ESWEPSKDAATWTFKIRKGVKFHDGKELTIDDVVATLKRHTDAKSESGALGVLGSIKEI
FT                   KADGGNLVLTLSEGNADMPLLLSDYHLVIQPNGGVDDPLASIGTGPYKMTSFEPGVRAT
FT                   FERNKDDWRTDRGYVDSIEIIGMNDATARIAALSSGQVHYINRVDPKTVNLLKRAPNVE
FT                   ILSTAGRGHYVFIMHCDKAPFDNNDLRLALKYAMDREAMVQKILGGYGKVGNDFPINST
FT                   YALFPEGIEQRVYDPDKAAFHYKKSGHSGSVLLRTSEVAFPGGVDAAVLYQESCKKAGI
FT                   EIEVKREPGDGYWTNVWNVQPFSTSYWGGRPTQDQMYSTAYLSTADWNDTRFKRPDFDK
FT                   LLLQARSELDEVKRKDMYRTMAMTVRDEGGVILPMFNDFVNASTKQVKGYVHDIGNDMS
FT                   NGYVATRVWLDA"
FT   gene            complement(143203..143985)
FT                   /locus_tag="Rleg_6427"
FT   CDS_pept        complement(143203..143985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6427"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   ret:RHE_PC00129 carnitinyl-CoA dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6427"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61177"
FT                   /db_xref="GOA:C6BAR9"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAR9"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ACS61177.1"
FT                   /translation="MSEPIRTRQDGGVLEVVIDRPKANAIDLATSRALGLIFRNFRDDP
FT                   ALRVAIVSGAGEKFFCAGWDLKAAASGDAVDGDYGVGGFGGLQELRDLNKPVICAVNGI
FT                   CCGGGLEIALSADLILAAEHATFALPEIRSGTVADAASIKLPKRIPYHIAMDMLLTGRW
FT                   LDVHEAHRWGFINEVLPAERLMERAWELARLLESGPSLVHAAIKEIVREAEGSTFQTAM
FT                   NKITKRQFATVDRLYSSEDQLEGARAFAEKRSPIWKGK"
FT   gene            complement(143992..146046)
FT                   /locus_tag="Rleg_6428"
FT   CDS_pept        complement(143992..146046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6428"
FT                   /product="CoA-binding domain protein"
FT                   /note="PFAM: CoA-binding domain protein; KEGG:
FT                   ret:RHE_PC00128 acyl-CoA synthetase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6428"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61178"
FT                   /db_xref="GOA:C6BAS0"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAS0"
FT                   /inference="protein motif:PFAM:PF02629"
FT                   /protein_id="ACS61178.1"
FT                   /translation="MTPRPLDRLLRPQTIAVFGGREARRVIEQCDRMGFAGEIWPVHPK
FT                   LDEVLGRPCYRSVSDLPSAPDAAFVGVNRMQTVEIVRSLSAAGAGGAVCYASGFSEATG
FT                   ELGDGAELQQALLEAAGDMPILGPNCYGLINGLDGALLWPDQHGMQRIARGVAILTQSS
FT                   NIAINLTMQTRGLPIAYVVTAGNQAQTSLADVACALIDDPRVTAVGLHVEGFGNLSALE
FT                   RLATMARRSRKPVVVLKVGRSEQAKCAAVSHTASLAGSDAVADAVLARLGLGRVQTLPA
FT                   LLETLKLLHVAGPLASHSISSMSCSGGEASLMADAAVGRNVEFPALQPQQLPRLRRVLG
FT                   EMVTLSNPLDYHTFVWGDLARQTEAFSAMFEGGYALNLVVLDFPRDDRCDASEWAMTAD
FT                   AVIAAAAATGALAGLLATLPENMPEPIADRLMANGIITFCGIDEAITAADVAAGIGQAW
FT                   DRPPPLPLLDVPSIDGEIETLTEADAKAELAAFGLPVPQGLLASSPGQAAEQAERLGFP
FT                   VVLKALGIAHKTEAGAVALNLKNIKAVSNAAAAMPPNAGYLVEKMIDPPVAELIVGAIR
FT                   DPVFGLSLTLGAGGIFVELLEDSVILPLPATKTDIHAAISRLKLAKLIYGYRGRPKGDL
FT                   EAAVGAVLATADYVVKNAAWLEELDINPLMVLPEGRGVAVVDALIRRRR"
FT   gene            complement(146051..147211)
FT                   /locus_tag="Rleg_6429"
FT   CDS_pept        complement(146051..147211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6429"
FT                   /product="Butyryl-CoA dehydrogenase"
FT                   /EC_number="1.3.8.1"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: ret:RHE_PC00127
FT                   acyl-CoA dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6429"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61179"
FT                   /db_xref="GOA:C6BAS1"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAS1"
FT                   /inference="protein motif:PRIAM:1.3.99.2"
FT                   /protein_id="ACS61179.1"
FT                   /translation="MHFGLSEEQEMIVETVRAFVETEIYPHENEVERSGIVPPELGDEI
FT                   RRKCIDLGFYACNFPEEVGGAGLDHVTFTLVERELGRGSLGLTVFFGRPSGILMACEGE
FT                   QRERYLLPAVRGEKIDALAITEPDAGSDMRGMKCAARRDGSDFVLNGTKHFISHADVAD
FT                   FVIVFAATGEEETPKGIKKKITAFLVDRGTPGFEILGGYDSVSHRGYHNSTLSFTDCRI
FT                   PASQVLGEVHRGFEIANKWLYGTRLTVAATCVGRARRVFDMTLPYAAERKQFGKPIGAN
FT                   QGVSFKLADMITEIDAADWLTLAAAWRLDAGLSADRQIASAKLYSSEMLARVTDEAIQI
FT                   FGGMGLMDDLPLARFWRDARVERIWDGTSEIQRHIISRDLLRPLGA"
FT   gene            complement(147222..148712)
FT                   /locus_tag="Rleg_6430"
FT   CDS_pept        complement(147222..148712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6430"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase NAD-binding"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase NAD-binding;
FT                   3-hydroxyacyl-CoA dehydrogenase domain protein; KEGG:
FT                   ret:RHE_PC00126 bifunctional 3-hydroxyacyl-CoA
FT                   dehydrogenase/thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6430"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61180"
FT                   /db_xref="GOA:C6BAS2"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR026578"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAS2"
FT                   /inference="protein motif:PFAM:PF02737"
FT                   /protein_id="ACS61180.1"
FT                   /translation="MTGINKAACIGGGVIGGGWIARFLLAGIDVDVFDPHPEASRIVGE
FT                   VLANAEKAYAMLTGAPLPPRGRLTFCAKLEEAVAGADWIQESVPERLDLKRRVLTEIDA
FT                   AARSDALIGSSTSGLLPSDLQRDMTHPERLFVAHPYNPVYLLPLVEIVGGEKTSAATIR
FT                   AAIERLAPLGMKGVHIAKEIEAFVGDRLLEALWREALWLIHDDICTVETLDDVIRYSFG
FT                   LRWAQMGLFQTYRIAGGEAGMRHFLAQFGPCLAWPWTKLTDVVDLDDALIEKIGRQSDE
FT                   QAAGLSIRELERIRDENLVGILQALKGGDGGKGWGAGKLLKDFEQSLWAQGGRAATSFD
FT                   PSKPLRLVETKVGPAWVDYNGHMTEHRYLQVFGDTSDALLRLIGVDLAYVEAGQSYYTV
FT                   ETHIRHLGEAKLGQAIHSTCQILSVDEKRLHVFHTLYDTATGEALATAEHMLLHVDSKA
FT                   GKATPAPAVILDKVKAVAGAHANLAVPEGAGRHVGQRR"
FT   gene            complement(148720..149622)
FT                   /locus_tag="Rleg_6431"
FT   CDS_pept        complement(148720..149622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6431"
FT                   /product="protein of unknown function DUF849"
FT                   /note="PFAM: protein of unknown function DUF849; KEGG:
FT                   ret:RHE_PC00125 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6431"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61181"
FT                   /db_xref="GOA:C6BAS3"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAS3"
FT                   /inference="protein motif:PFAM:PF05853"
FT                   /protein_id="ACS61181.1"
FT                   /translation="MPLAMNRDVFITCAVTGAGDTVSRSSHVPITPKQIADSAIDAAKA
FT                   GAAVVHCHVRDPETGAASRRNDLYREVTDRIRSADVDVVLNLTAGMGGDLIFGDVESPL
FT                   PLNPNGTDMAGATERVSHIAECLPEICTLDCGTMNFNLGDYVMTNTPAMLRAMAKKMTG
FT                   LGVRPEIEAFDTGHLWFAKQLAEEGLIEDPVLIQLCMGIPWGAPDDLNTFMAMVNNVPQ
FT                   SWTFSAFSIGRNAMAYPAAAVLAGGNVRVGLEDNLFVGKGQLATNAELVEKAVQVVEGM
FT                   GARIIGPEDVRKKLKLTKR"
FT   gene            149723..150721
FT                   /locus_tag="Rleg_6432"
FT   CDS_pept        149723..150721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6432"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; SMART: helix-turn-helix- domain containing
FT                   protein AraC type; KEGG: ret:RHE_PC00124 AraC family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6432"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61182"
FT                   /db_xref="GOA:C6BAS4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAS4"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ACS61182.1"
FT                   /translation="MILLQRSTERLDIDLLVLPDANLILIASVIEPLRGANRISGSELY
FT                   RWRLLTPDGAPVPTTSNIAVPAQGAFKATTEDTPLFVLASYNWRRSATPALKMQLSQAA
FT                   RYRTVIAGIESGTWLLAEASLLDGLPATVHWEDYEDFALAYPEVRAVKDRFVIDGKRLT
FT                   TSGSLPTVDLMLEVIRQRQGYSLALEVSRLFRYEQPSFHADEQLSAASAGLRMHDPRVT
FT                   QAVRLMEEHIEQPLVLTRLARRVGISARHLQYLFQQSIGAPPHVHYLALRLNAARRKVI
FT                   ETTASFADIAAATGFNSASAFARSYRASFSESPSETRRRLRRRITSSQAPV"
FT   gene            complement(150696..151571)
FT                   /locus_tag="Rleg_6433"
FT   CDS_pept        complement(150696..151571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6433"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: ret:RHE_PC00123 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6433"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61183"
FT                   /db_xref="GOA:C6BAS5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAS5"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACS61183.1"
FT                   /translation="MHEPIESDLLRTFLVVAETSNFSAAAQRIGRTQSAVSSQIKKLEQ
FT                   TIGETLFERGARGVLLTRQGMQLVPYARRIIDLLNEAAATIRSKPLDGPVRIGIPEEYS
FT                   QTVLPAALAAFAVRHPAVEVTVSCDYTVRNLAALERDELDLAVVFDWSDETKGEVICID
FT                   PTVWVTSMVHRLHDIDPLPIATYRNSTWSRDFALRSLEQIGRNYRIAFIADTGSGLKNA
FT                   VIAGLAVTTLSRSNIPPGCRELTAEDGFPPVDSSKVVLRRSTYRSSEAVRELAEMIRDA
FT                   FQPIPAPAMT"
FT   gene            151683..152588
FT                   /locus_tag="Rleg_6434"
FT   CDS_pept        151683..152588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6434"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: ret:RHE_PC00122 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6434"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61184"
FT                   /db_xref="GOA:C6BAS6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAS6"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACS61184.1"
FT                   /translation="MTIENPARRLASSEHEKGVFLIVAATLAWSASGVYSRLLTTDVWT
FT                   AIAWRSLFGGLFLLIPCLFLEGGISRQQWRFIFHPSSLAMIACQTFSQGCFIGALYMTT
FT                   VANVTMIYATAPFIAAMLGWVILRERVSRRTLIAGGISLLGVAVIVASSIGGGTGWGDL
FT                   LALGMTASFALVIIIPRISPDVPSLPPTVVSAFLTLALFAPFGSVGSLDLHNWIVLAAF
FT                   GATNFSLALVLFLAGAKRMPPAEAALIGTMEIVLTPFWVWLLFSEEPPVATFFGGAIIL
FT                   GAVIWHTAIDVSRSRRPHRA"
FT   gene            153174..154364
FT                   /locus_tag="Rleg_6435"
FT   CDS_pept        153174..154364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6435"
FT                   /product="formaldehyde dehydrogenase,
FT                   glutathione-independent"
FT                   /note="TIGRFAM: formaldehyde dehydrogenase,
FT                   glutathione-independent; PFAM: Alcohol dehydrogenase GroES
FT                   domain protein; Alcohol dehydrogenase zinc-binding domain
FT                   protein; KEGG: ret:RHE_PC00119 glutathione-independent
FT                   formaldehyde dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6435"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61185"
FT                   /db_xref="GOA:C6BAS7"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014184"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAS7"
FT                   /inference="protein motif:TFAM:TIGR02819"
FT                   /protein_id="ACS61185.1"
FT                   /translation="MSKNRGVVYLRPGKVEVRDIDDPKLEAPDGRRIEHGVILKVISTN
FT                   ICGSDQHMVRGRTTAMPGLVLGHEITGEIIEKGIDVEMLEIGDIVSVPFNVACGRCRCC
FT                   KSQDTGVCLTVNPARAGGAYGYVDMGGWIGGQARYVTIPYADFNLLKIPDRDKAMAKIR
FT                   DLTMLSDILPTGFHGAVRAGVGVGSTVYVAGAGPVGLAAAASARILGAAVVMIGDFNKD
FT                   RLAHAAKVGFEPIDLSKSDRLGDMIAQVVGTNEVDSAIDAVGFEARGHSGGEQPAIVLN
FT                   QMMEITRAAGSIGIPGLYVTEDPGAVDNAAKHGNLSLRFGLGWAKAQSFHTGQTPVIKY
FT                   NRQLMQAILHDRLPIADIVNAKVIPLDDAANGYESFDQGAATKYVLDPHGEVAKAA"
FT   gene            complement(154440..155246)
FT                   /locus_tag="Rleg_6436"
FT   CDS_pept        complement(154440..155246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6436"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   SMART: extracellular solute-binding protein family 3; KEGG:
FT                   ret:RHE_PC00118 amino acid ABC transporter
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6436"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61186"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAS8"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ACS61186.1"
FT                   /translation="MLRISIQTILRGTLMAGGIGVLLAAAAPLELAAQDRMPMRIAVEG
FT                   AFPPFNYLDSNNKLQGFDIDIANALCEVGKFECQFIIEKWDDIIPDLVADKYDAIISSM
FT                   SMSLERRQKVAFTEKYYNSPSVFIARKDSSISDVSPAALSDKILGVTSSTAQESYANHL
FT                   YPAMKKTVFRSSPELYKGLADGSVDIILEDKLAIYDWIANTKAGSCCEFKGPDLVDVTY
FT                   FGEGAGIALRLDDKERLTRLNEALKSIQADGTYDMINAKYFPFSIQ"
FT   sig_peptide     complement(155148..155246)
FT                   /locus_tag="Rleg_6436"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.479 at
FT                   residue 33"
FT   gene            155373..157739
FT                   /locus_tag="Rleg_6437"
FT   CDS_pept        155373..157739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6437"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="KEGG: ret:RHE_PC00117 putative kinase/esterase
FT                   protein; TIGRFAM: diguanylate cyclase; PFAM: EAL domain
FT                   protein; GGDEF domain containing protein; SMART: EAL domain
FT                   protein; GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6437"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61187"
FT                   /db_xref="GOA:C6BAS9"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR007892"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAS9"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACS61187.1"
FT                   /translation="MQIVLPSSSNTFQQSWIASGRILFLIAVSGLGAIGLVVLSALWAG
FT                   TESDAAALDRQRQLVNARLREQVDQVAHVIGQFGNGYLARVYPAALSTEGSSGLDAVLT
FT                   AAAGSAIGQTAMSAFGYDQAFVVDEKAQLLMLADAQTEKRYRWMRPLFLPLLQDARFGV
FT                   RRSTALNERTPSSMEARLASAAHSNRALANLMRLEGRPTIVGVVAINEAAGGQRQPMRQ
FT                   FLIVVRFIDGAALDELSRQQGLNGARFARTADADENEVAFQIDATANGEPIGFIVWRPD
FT                   LPGSRVIGRLMPALSIAALVIAILFSVLLVRLRRSLGELKKSELHARQLALHDVLTDLP
FT                   NRALFAMRFDECLAETQNSTERSAVALLDLDRFKAVNDTFGHAAGDELIRMAAERIRSL
FT                   LRPGDTLARLGGDEFALLLRDIKDHDHVLPAICEAIVAELGKPFPLLRGEAVARVGGSI
FT                   GVTVVPDAGRNADDIMRYADVALYEAKMGGRGQWRLYSPSMDGGRNARDILKNELREVL
FT                   AKGMASDGPHADPVSNRPDFGSLEVYYQTVHRAEAGYAASGAEALVRWRHSQRGLLTPA
FT                   SFIPVAEEGGLIDALGFWVLREACRAACKWPEDTFVAVNVSPAQLRRPNFAEEVFAVLE
FT                   ESGLQPSRLELELTESSLIEDNSDVYTVLKSLRSRGVQVSLDDFGTGFSCLSHLLRFDI
FT                   DRIKIDRSFVSQLGTKANGAAIIGAIVALSRNLGISTTAEGVETDYQRDFLAALGCTDL
FT                   QGYFFSKPVPIGELDSFRKAESAAGLLTTARGAVA"
FT   sig_peptide     155373..155507
FT                   /locus_tag="Rleg_6437"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.712) with cleavage site probability 0.606 at
FT                   residue 45"
FT   gene            157820..158404
FT                   /locus_tag="Rleg_6438"
FT   CDS_pept        157820..158404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6438"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG:
FT                   ret:RHE_PC00116 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6438"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61188"
FT                   /db_xref="GOA:C6BAT0"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAT0"
FT                   /inference="protein motif:PFAM:PF00857"
FT                   /protein_id="ACS61188.1"
FT                   /translation="MGEVGEWRHLCVDMQRMFAEDTPWHVAWMARISPQIEELAGRHPS
FT                   RTIFTRFLPPERADDMPGKWRDYYQKWWMMTGEHLPRGFIDLAPSLASLVPPARHFDKR
FT                   TYSPWIDGRLHPILQSERVDTLVITGGETDVCVLATTLGAIDLGYRVIVLNDAVCSGAD
FT                   DTHDASLELLHDRFSVQLELMDTEEFLRCVG"
FT   gene            complement(158595..159650)
FT                   /locus_tag="Rleg_6439"
FT   CDS_pept        complement(158595..159650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6439"
FT                   /product="agmatinase"
FT                   /note="TIGRFAM: agmatinase; PFAM:
FT                   Arginase/agmatinase/formiminoglutamase; KEGG: speB;
FT                   agmatinase ; K01480 agmatinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6439"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61189"
FT                   /db_xref="GOA:C6BAT1"
FT                   /db_xref="InterPro:IPR005925"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAT1"
FT                   /inference="protein motif:TFAM:TIGR01230"
FT                   /protein_id="ACS61189.1"
FT                   /translation="MVWDKTRLEQLRAEFADANGGEIFDEKFRKVAEKIISKSGTRLAP
FT                   YAGVPTFLSAPYMQVAADDPDFGNLQVAITGIPMDLGVTNRPGSRFGPRALRAIERIGP
FT                   YNHVLATAPVFDLRVADIGDISFQSRYRLELSHDDIEKRIGQIVDAGVAPLSVGGDHSI
FT                   SHPILKAIGRHQPVGLIHIDAHCDTSGAFDQTKFHHGGPFRNAVLDGVLDPTRTIQIGI
FT                   RGSAEYLWEFSYASGMTVIHAEDISGMGIAAVIAKAKSIVGDGPTYLSFDVDSLDPSFA
FT                   PGTGTPEVGGLTTREVLELIRGLKGINLVGGDVVEVAPQYDATTNTAHAAAQVLFEVLS
FT                   LMVFSPSIGRR"
FT   gene            159747..160910
FT                   /locus_tag="Rleg_6440"
FT   CDS_pept        159747..160910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6440"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG: aspB2;
FT                   aspartate transaminase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6440"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61190"
FT                   /db_xref="GOA:C6BAT2"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAT2"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ACS61190.1"
FT                   /translation="MIAAKPNSLVARLSAPPIPSVVAWSHEYKGGKGPLIDLSQAVPGY
FT                   PAHPEMLRLLAEAAGQQAMTGYGPIEGEPLLRKTYAAHVAEYYGADLSAGNIHITAGCN
FT                   QAFMCSAIALAGAGDTVALTNPFYFNHDTTLSMLGIGRRLVDCDPAFGFLPDPGSAEAA
FT                   LAAGAKMLAVVTPNNPTGAVYPPSLLHELFVLCRRYGAWLILDETYRDFLGEDNGRPHS
FT                   LLSEPGWEDTLVLLYSFSKSFCIPGHRLGAITAGPKLIAEIAKVMDNMQICAPRSAQIA
FT                   VASAIPALADWRAGNRLEIARRADALRLVLSGLPDWEIGAIGAYFAFVRHPHADRSSSE
FT                   VAEKLAKESGIVCLPGAYFGEGQERYLRLAFANADVASIGLLSERLR"
FT   gene            complement(160887..161426)
FT                   /locus_tag="Rleg_6441"
FT   CDS_pept        complement(160887..161426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6441"
FT                   /product="flavin reductase domain protein FMN-binding"
FT                   /note="PFAM: flavin reductase domain protein FMN-binding;
FT                   KEGG: rec:RHECIAT_PC0000729 putative flavin reductase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6441"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61191"
FT                   /db_xref="GOA:C6BAT3"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAT3"
FT                   /inference="protein motif:PFAM:PF01613"
FT                   /protein_id="ACS61191.1"
FT                   /translation="MSVEALISEADFKLSMRHLAGAVSVITVGDGQHRTGFTATSVSSL
FT                   SAELPSVIVSVNRASSSWPALQRYGCFCVNVLAADQQQVAQSFAGLDGRKGAERYGGAG
FT                   WYRLKTGAAALENALTVLDCKLETAFHYNSHAILVGHVCAMEIRQGIGPLLYWRGGYHE
FT                   LPAEVDQNGLAKALGQ"
FT   gene            complement(161423..162778)
FT                   /locus_tag="Rleg_6442"
FT   CDS_pept        complement(161423..162778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6442"
FT                   /product="monooxygenase protein"
FT                   /note="KEGG: monooxygenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6442"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61192"
FT                   /db_xref="GOA:C6BAT4"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAT4"
FT                   /inference="similar to AA sequence:KEGG:Arad_9119"
FT                   /protein_id="ACS61192.1"
FT                   /translation="MARTDKMKLGTFVYTFGFHPASWLHPASDVNGANDFAHLLDVAKR
FT                   SEAAKFDFMFMADSPAAAVGDPKALARIPTKMNRFEPLSLLSALAVTTNDLGLVATVST
FT                   SYYEPYNVARLFASIDHLSKGRVCWNVVTSDHDETGYNFNREGLDPHALRYERGNEFVD
FT                   VVFGLWDSFEDGALLLDRENGVYYDKDKHHTLNHKGTHFQVRGPLNIARTPQGRPVIAQ
FT                   AGGSEPGMDMAARTAEIVFSLASNIDRNRAFYENVKRRMPAFGRDPDDLKIMPGIVINV
FT                   GETEAEAKAKVDYLIDKMHPDVGRLMLSEFLEADLRDVALDKPFPMDRLPAAPKGSRAL
FT                   FDELVDFVRSGRTVGELIRHYAEKHTGNGMTGTPAQIADFMEEWFETRAADGFILMFPT
FT                   LPSSLDDFVRLVLPELRRRGLFREEYEGKTLRENLGLSMPVNRFAKTKEPAR"
FT   gene            complement(162892..163830)
FT                   /locus_tag="Rleg_6443"
FT   CDS_pept        complement(162892..163830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6443"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6443"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61193"
FT                   /db_xref="GOA:C6BAT5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAT5"
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /protein_id="ACS61193.1"
FT                   /translation="MTDERLKAIPLKSLQAFEAVGRCGGVTAAALELRVSPGAISQQIR
FT                   KIESFLGISLLERSGRTVELTAWGRLYHQEISKGFEQFALAQQLLEKARNETALVLSAL
FT                   SSVVNKWIGRRIFDWQALHPEVPVRIIGRDKEPRIGFDDVDFRVSYGSDVLQHEHYTEL
FT                   FRDWVVPACSPALMQDRAHAARDLFEKPLLHVEWERHFTPYPSWAEFAAKAGVPLDAST
FT                   PGLSFTLSSSAIDAAVNKRGVVLAQMSMISDELEAQTLVIPVDLRIALRESYFLAWDRA
FT                   ALQKPHGHEFREWLIAISRQQALASAPKPIL"
FT   gene            complement(163861..164565)
FT                   /locus_tag="Rleg_6444"
FT   CDS_pept        complement(163861..164565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6444"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: UbiC transcription regulator-associated domain
FT                   protein; regulatory protein GntR HTH; SMART: regulatory
FT                   protein GntR HTH; KEGG: hutC; histidine utilization
FT                   repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6444"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61194"
FT                   /db_xref="GOA:C6BAT6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAT6"
FT                   /inference="protein motif:PFAM:PF07702"
FT                   /protein_id="ACS61194.1"
FT                   /translation="MSIYQRIFTDVETKIISGDWRPGDRIPVEHELAAEYRCSRMTVSK
FT                   ALSALAERGMIVRRRKTGSFVASPQIDRTVMDIQDISTEAELAGHEHRFEILARKIERL
FT                   GEAEAQQLSEPADAEVLRLQCLHIVDGRPNAIERRIIMLDAVPRAREESFASTPPGKWL
FT                   LDEVPWSKAKHVIRAVSADTTTARILQTERGEACLSLIRQTWQNGRTVTYVEFTHPGDR
FT                   FQFAGTFHPAAN"
FT   gene            164796..165623
FT                   /locus_tag="Rleg_6445"
FT   CDS_pept        164796..165623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6445"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   SMART: extracellular solute-binding protein family 3; KEGG:
FT                   amino acid ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6445"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61195"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAT7"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ACS61195.1"
FT                   /translation="MKAHSLLKGLVGAAFLLGAAVSAHAADTLAAVKAAGTLKVGTETA
FT                   FAPFDYIDAGEHTGLNVDLFAEIGKELGVKIEWVALPWDGVFPALEAGKFDVVAGPATI
FT                   TKKRMERYRFTPPIAEATIAILKKAGDTTISKPEDIAGKTIGVGKATAQLDQLKEFSAT
FT                   LPTKVDVREYPAFTESYADLAAGRIAGVANSLPNIAFVASQRKGTFEVVLPPFGKKSYF
FT                   GFIGLKDADHAPLMDAIDAAMLKIKADGRMAELQKKWFGASFDTPDAVKDPAF"
FT   sig_peptide     164796..164873
FT                   /locus_tag="Rleg_6445"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 26"
FT   gene            165722..166363
FT                   /locus_tag="Rleg_6446"
FT   CDS_pept        165722..166363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6446"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: amino acid ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6446"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61196"
FT                   /db_xref="GOA:C6BAT8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAT8"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ACS61196.1"
FT                   /translation="MSIKLFELLLQASIYTVTISVVSILIGFAIAIVISAMLLSQQRLL
FT                   VLPAKIFISFFRGVPLLVQLLLIYNLLPAIDINVPSIVAAIVGLSLCTAAYQAENLRGG
FT                   FASVPMGLVESAEMVGMSPVQIFRRIKAPIALRLTFPALVNEAILILKASSLVSVVGVI
FT                   ELTRMAQDLAGSTFLPLEIFASAGLIYFIINWIVALAGGLIERSLPGVPR"
FT   gene            166360..167028
FT                   /locus_tag="Rleg_6447"
FT   CDS_pept        166360..167028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6447"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: amino acid ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6447"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61197"
FT                   /db_xref="GOA:C6BAT9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAT9"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ACS61197.1"
FT                   /translation="MTFDINVIFNNFPEILSGAWLTIVIWIVTTPAAAALGFLVAVARR
FT                   FGGVVPDKAFGVVIAVLRGTPFLIQIFLVYYGGPFVGLSLDPIPAGVIGLSIYGAAYFS
FT                   EIFRSGFAAVPKGHIEAGLCVGLTQGQIVRRILLPEMTMLVLPPSVNMTIILMKETAVL
FT                   SIITVPELTATLSAIGSQQYAFVEALFVLALFYWALVEITGWLGHLAETKLSRFRFFNI
FT                   "
FT   gene            167025..167816
FT                   /locus_tag="Rleg_6448"
FT   CDS_pept        167025..167816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6448"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: amino acid ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6448"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61198"
FT                   /db_xref="GOA:C6BAU0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAU0"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS61198.1"
FT                   /translation="MSIPAIAVKNLVKTFGGSTVLQGIDLDIVQGQVSCVIGPSGSGKS
FT                   TLLRCMAFLEESTKGTIAVNGEVLGFAENAKGVRERVPAAANRRIRSQIGMVFQQFNLW
FT                   PHMTALGNVSEALKSVHKMSRKDAEERAMAQLVKVGLEGRAGHYPSQLSGGQQQRVAIA
FT                   RALALNPKIMLFDEPTSSLDPELTGEVLNVMRDLAAEGMTMVVVSHEIGFAATVGQQII
FT                   FLDHGKVLFTGPPQDVFKRPRNPRLEQFLDTYIDRGASMLL"
FT   gene            complement(167868..168221)
FT                   /locus_tag="Rleg_6449"
FT   CDS_pept        complement(167868..168221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6449"
FT                   /product="anti-ECFsigma factor, ChrR"
FT                   /note="KEGG: ret:RHE_PE00109 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6449"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61199"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR025979"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAU1"
FT                   /inference="similar to AA sequence:KEGG:RHE_PE00109"
FT                   /protein_id="ACS61199.1"
FT                   /translation="MPETTRERLTSGGWKELEFGPFRDAVTIHWIRPFEGDQPGVALLK
FT                   YEPGASVPRHRHEGLETILVLDGVQSDETGDYISGSYIVNAPGSEHSVWSETGCVVLIQ
FT                   WDRPVKIFEDDTA"
FT   gene            complement(168214..168882)
FT                   /locus_tag="Rleg_6450"
FT   CDS_pept        complement(168214..168882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6450"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG:
FT                   ret:RHE_PE00110 putative isochorismatase hydrolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6450"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61200"
FT                   /db_xref="GOA:C6BAU2"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAU2"
FT                   /inference="protein motif:PFAM:PF00857"
FT                   /protein_id="ACS61200.1"
FT                   /translation="MMGIKAEPFAFPVKHDELALIVIDMQRDFAEPGGFGASLGNDVSR
FT                   ITRIVPDVKRLIQGFRNAGLPVIHTMECHRPDLSDLPPAKRDRGNPALRIGDEGPMGRI
FT                   LISGEPGTAILPELAPVKGEVVIEKPGKGAFYATDLGTVLQQKGIRQLVFAGVTTEVCV
FT                   QTTMREANDRGYECLLAEEATESYFPEFKAAAIAMIRAQGAIVGWTAHIDDILESIAHA
FT                   "
FT   gene            complement(168882..170432)
FT                   /locus_tag="Rleg_6451"
FT   CDS_pept        complement(168882..170432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6451"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rec:RHECIAT_PC0000087 probable sugar ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6451"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61201"
FT                   /db_xref="GOA:C6BAU3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAU3"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS61201.1"
FT                   /translation="MSTVRDTPLPQAGKAVGIETLDMTMRFGSFTALDNVSIAVPAGSF
FT                   HALLGENGAGKSTLVKCIMGFYHATSGSLSVDGREVAVASPKDAATYGLGMVYQHFTLV
FT                   PSLTGAENLVISRTEVPAVINWPRERKDLAAFMERMPFKIPLDRPVSELAAGEKQKLEI
FT                   VKQLYLGRSFLVLDEPTSVLTPAEADEMLGIVRGMTERGELTVLMISHKFHEVTKFADA
FT                   VSILRRGKLVGTGKVGELSTAEMAAMMIGDVKLAELDSRLPVAEAAKSVLTVTQVKAPD
FT                   RSGLKTIEIDALTVRSGEIVGIAGISGNGQKELTEILAGQRPTDSGQVMVNGETYGATR
FT                   EETRKNRVRFIPEEPLQNACAPKMTVSENLAFRTFDLKLDGKDAIWLNKGSMKKRASAL
FT                   ISDFKVKTASSSSPIAALSGGNVQRAVLARELTGDVDLLIVSNPCFGLDFSAVAEIRAR
FT                   IMKARNLGAAVLLLSEDLDELLEMSDRIMVISEGKLVYETPARSADIGVIGAHMAGHH"
FT   gene            complement(170434..171489)
FT                   /locus_tag="Rleg_6452"
FT   CDS_pept        complement(170434..171489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6452"
FT                   /product="ring-opening amidohydrolase"
FT                   /EC_number="3.5.2.15"
FT                   /note="TIGRFAM: ring-opening amidohydrolase; KEGG: cyanuric
FT                   acid amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6452"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61202"
FT                   /db_xref="GOA:C6BAU4"
FT                   /db_xref="InterPro:IPR014086"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6BAU4"
FT                   /inference="protein motif:TFAM:TIGR02714"
FT                   /protein_id="ACS61202.1"
FT                   /translation="MPSLRAHVFRVPADGPDDVAGVEALFASGLQANNVVAVLGKTEGN
FT                   GCVNDFTRGYATRSFETLFSRYGVDGVSIIMSGGTEGALSPHWTVFARETVETPGERAL
FT                   AIGVSRTPALPPEHLGRREQILLVAEGVKSAMRDAGIDDPADVHFVQIKCPLLTSRRIA
FT                   EAEAAGRTVATHDTLKSMGLSRGASALGVAVALGEIDATSIGDADICTRFDLFSRCAST
FT                   SSGGELTDHEIIVLGMSAKWSGPLSIDHAVMLDAIDAHSVRKARERLPENSRLAAVLAK
FT                   AEPDPSGRIDGRRHTMLDDSDIAGTRHARAFVGGVLAGIFGITDLYVSGGAEHQGPPGG
FT                   GPVAIIVEKEQ"
FT   gene            complement(171489..172193)
FT                   /locus_tag="Rleg_6453"
FT   CDS_pept        complement(171489..172193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6453"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG:
FT                   ret:RHE_PE00112 putative isochorismatase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6453"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61203"
FT                   /db_xref="GOA:C6BAU5"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAU5"
FT                   /inference="protein motif:PFAM:PF00857"
FT                   /protein_id="ACS61203.1"
FT                   /translation="MMDAMVETNGHFIDADPYPWPYNGALRPDNTALIIIDMQTDFCGK
FT                   GGYVDHMGYDLSLVQAPIEPIKRVLAAMRAKGYHIIHTREGHRPDLADLPANKRWRSQR
FT                   IGAGIGDAGPCGRILTRGEPGWDIIPELYPIEGETIIDKPGKGSFCATDLELILNQKRI
FT                   ENIILTGITTDVCVSTTMREANDRGYECLLLEDCCGATDYGNHLAAIKMVKMQGGVFGS
FT                   VSNSAALVEALP"
FT   gene            complement(172202..173218)
FT                   /locus_tag="Rleg_6454"
FT   CDS_pept        complement(172202..173218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6454"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6454"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61204"
FT                   /db_xref="GOA:C6BAU6"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR022843"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAU6"
FT                   /inference="protein motif:PFAM:PF00795"
FT                   /protein_id="ACS61204.1"
FT                   /translation="MNGLGGLNKSEHGVGIGLVQLQLPVTVTKADLAKQTQVIVDLVAK
FT                   ARRNQPGMDLVVFPEYALHGLSMDINPEIMCTLDGPEVAAFKQACRDNRIWGCFSIMEL
FT                   NPGAMPYNSGIVIDDQGELKLYYRKMHPWIPVEPWEPGDLGIPVIEGPRGAKLALIICH
FT                   DGMFPEMARECAYKGAEIMIRTAGYTAPIRDAWCFTNQANAFCNLMITANVCMCGSDGT
FT                   FDSMGEGMICNFDGTIIAHGTSGRVNEIITAEVRPDLVREARLGWGVENNIYQFGHRGY
FT                   VAVAGGAQDAPYTYMHDLIAGKYRLPWEDEIKVKDGTSCGFDKPMRRYGEPLKPAAE"
FT   gene            complement(173231..174157)
FT                   /locus_tag="Rleg_6455"
FT   CDS_pept        complement(173231..174157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6455"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   ret:RHE_PE00113 sugar ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6455"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61205"
FT                   /db_xref="GOA:C6BAU7"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAU7"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACS61205.1"
FT                   /translation="MEETGIGIWGVPLAIFAGAIRVSTPFIFVSLGEAITERSGRINLG
FT                   LEGTLVFGAMTAYAVAVMTGSPTLGVLAAMVAGAIFGLIHGWICKFPKVNDIAIGIAMM
FT                   QFGLGMAFFLGKSFIQPVAPKLPSIPLGGWSSTPQVQAALNINVLFFIGAALALFLFWA
FT                   FKNTRIGLILRVVGDSTDAARAMGIHPDRVRLLATAVGGSLAAIGGAYLSLYYPGSWNE
FT                   GISSGQGLMAVALVIFARWNPIGCFLAALLFGGAGALGPALQSVGVTQGYYLFYAAPYV
FT                   LTLIILIATSSPTRSLAGAPGALSLTK"
FT   gene            complement(174157..175284)
FT                   /locus_tag="Rleg_6456"
FT   CDS_pept        complement(174157..175284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6456"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   rec:RHECIAT_PC0000090 probable sugar ABC transporter,
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6456"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61206"
FT                   /db_xref="GOA:C6BAU8"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAU8"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACS61206.1"
FT                   /translation="MTIEANDPAIAITEKPVSLRPIFEWIARRAEPVVIGLAAILIGLA
FT                   LFSLFILAVGKSPATLFQLIYTGGFGSWFSVQNSLSRAAPLLLTALCVALPARLGLVII
FT                   GGEGAVVLGGVAAAAMALPLAGTAPVFLTLILMAIAAMVVGGIWIGLAGFLRHYRGVNE
FT                   TISSLLLSYIAIALMNQFVEGVLRDPASLNKPSTRPLPADYMLGNIPGMDVHWGLVIGI
FT                   LACMISWIVIEATSYGFAARIAGGNVRAAQIQGLPVGKLIAGFTALAGSFAGLAGMIEV
FT                   AAVQGSANASLAAGYGYTGILVAFLARHNPLAIIPVAILLGGIDASGGLIQRRMGLPDA
FT                   TVLVLQGTLFIVILFCETFYGRFKIFNPDLWKRSL"
FT   gene            complement(175305..176432)
FT                   /locus_tag="Rleg_6457"
FT   CDS_pept        complement(175305..176432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6457"
FT                   /product="basic membrane lipoprotein"
FT                   /note="PFAM: basic membrane lipoprotein; KEGG:
FT                   rec:RHECIAT_PC0000091 putative ABC transporter,
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6457"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61207"
FT                   /db_xref="GOA:C6BAU9"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAU9"
FT                   /inference="protein motif:PFAM:PF02608"
FT                   /protein_id="ACS61207.1"
FT                   /translation="MTKLLSMNRRNFLQASAAGALAGAMPGLIASSAAAQTALTVGFIY
FT                   VGPKDDYGYNQAHAEGAAVVKALSGVTLVEEENVPETVDVQKTMESMINLDGATLLFPT
FT                   SFGYFDPHMLAVAAKHPDIQFRHCGGLWQEGKNPANTGSYFGYIFQGQYLNGIAAGHAT
FT                   KSKKIGFVAAKPIPQVLQNINAFLLGARAVDPGITCQVIFTGEWSLAVKEAEATNALVD
FT                   QGVDVITCHVDSPKVVVETAAGRGAFVCGYHANQSPLAPEKYLTGAEWAWGNVYSDFVK
FT                   KAQAGEKLGNFVRGGLKDGFVKMSALGPAVSAEGRKAFEATQAEMMKGGFSVFKGPLKD
FT                   NKGDTVVAADKSYAEDAIELESMNYLVEGVAGSTA"
FT   sig_peptide     complement(176325..176432)
FT                   /locus_tag="Rleg_6457"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.930 at
FT                   residue 36"
FT   gene            176794..177444
FT                   /locus_tag="Rleg_6458"
FT   CDS_pept        176794..177444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6458"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: GntR domain protein; regulatory protein GntR
FT                   HTH; SMART: regulatory protein GntR HTH; KEGG:
FT                   rec:RHECIAT_PC0000092 probable transcriptional regulator
FT                   protein, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6458"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61208"
FT                   /db_xref="GOA:C6BAV0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAV0"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ACS61208.1"
FT                   /translation="MIRTGTTVEQMVRAIADMIVTGEILPGAKLDEVSLAVRFDVSRTP
FT                   VREALRELGAMGLIAREPNRSAVVTNVTEAYLHSMFEAMAELEAICARLSAERMTVDER
FT                   RALELEHRESVRLVHAGAEEEYSAHNTDFHTRLYRGAHNDHVFEMVTQTRARLAPFRRA
FT                   QFRLPGRLAKSYEEHGRIVTAIMRADAAAAGQAAYSHVEIVSDASAVFATPGE"
FT   gene            complement(177527..178324)
FT                   /locus_tag="Rleg_6459"
FT   CDS_pept        complement(177527..178324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6459"
FT                   /product="nitrate ABC transporter, ATPase subunits C and D"
FT                   /note="KEGG: rec:RHECIAT_PC0000679 nitrate ABC transporter,
FT                   ATP-binding protein; TIGRFAM: nitrate ABC transporter,
FT                   ATPase subunits C and D; PFAM: ABC transporter related;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6459"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61209"
FT                   /db_xref="GOA:C6BAV1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005890"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAV1"
FT                   /inference="protein motif:TFAM:TIGR01184"
FT                   /protein_id="ACS61209.1"
FT                   /translation="MNAYLKLDHIDKHFDRGGVRAEVLKDINLTISAGEFVSIIGHSGC
FT                   GKSTLLNLIAGLTPVSAGAVLLENREVNGPGPERAVVFQNHSLLPWLTVYENVNLAVSK
FT                   LFNRTKTKAERHDWVMANLDLVQMAHARDKRPSEISGGMKQRVGIARALSMEPKILLLD
FT                   EPFGALDALTRAHLQDAVMEIHARLGNTMVMITHDVDEAVLLSDRIVMMTNGPAARIGE
FT                   VLDVTMPRPRNRIELASDRTYLKCREAVLKFLYERHRFIEAAE"
FT   gene            complement(178336..179229)
FT                   /locus_tag="Rleg_6460"
FT   CDS_pept        complement(178336..179229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6460"
FT                   /product="nitrate ABC transporter, inner membrane subunit"
FT                   /note="TIGRFAM: nitrate ABC transporter, inner membrane
FT                   subunit; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ret:RHE_PF00453 nitrate ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6460"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61210"
FT                   /db_xref="GOA:C6BAV2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005889"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAV2"
FT                   /inference="protein motif:TFAM:TIGR01183"
FT                   /protein_id="ACS61210.1"
FT                   /translation="MSALANKEIPSTSASAKLAAKVLPFSGKHGSRIDFRRAALTALRN
FT                   VVPPVVVLALILLVWQVLCSSADASLPSPHRVWLDSYDLIAYPFFNYGSQDIGLGWRVL
FT                   ISLQRVLYGFGLAAVTGVIIGAIIGQSVWAMRGLDPIFQVLRTVPPLAWLPLSLAAFQD
FT                   SNPSAIFVIFITSIWPVIINTAVGVRNIPQDYRNVAEVLRLNQFEFFWKIMLPSAAPYI
FT                   FTGLRIGVGLSWLAIVAAEMLTGGVGIGFFIWDAWNSSRLPDIIVALAYIGIVGFALDK
FT                   LVAALGKLITRGAMAN"
FT   gene            complement(179286..180599)
FT                   /locus_tag="Rleg_6461"
FT   CDS_pept        complement(179286..180599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6461"
FT                   /product="nitrate ABC transporter, substrate-binding
FT                   protein"
FT                   /note="KEGG: rec:RHECIAT_PC0000677 nitrate ABC transporter,
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6461"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61211"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAV3"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_PC0000677"
FT                   /protein_id="ACS61211.1"
FT                   /translation="MTKNLQTGISTTGITRRSMLKTTAAAALIGAVKTAFPSGAFAAGA
FT                   GPEVKGVKLGFIALTDSAPLIIAKEKGFFDKHGLPETDVAKQASWGATRDNLVLGGAAN
FT                   GIDGAHILSPLPYLMHTGKVTQNNKPVPMAILARLNLDSQGISVAKEYADTGVQLDSSK
FT                   LKAAFEKKKAEGKEIKAAMTFPGGTHDLWIRYWLAAGGIDPSKDVSTIVVPPPQMVANM
FT                   KVGNMDVFCVGEPWNEQLVNQGIGFTAATTGELWKGHPEKALGLRAEWIEKNPNAAKAL
FT                   LMAVMEAQQWCESMDNKAEMADILGKRQWFNVPTKDVLGRLKGDINYGNGREVKATDLY
FT                   MKFWKDGASYPFKSHDTWFMTENIRWGNLPASTDIKALVNQVNREDIWREAAKDLGVAA
FT                   ADIPASSSRGKETFFDGKVFDPENPSAYLDSLSIKAVS"
FT   sig_peptide     complement(180471..180599)
FT                   /locus_tag="Rleg_6461"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 43"
FT   gene            complement(180969..181880)
FT                   /locus_tag="Rleg_6462"
FT   CDS_pept        complement(180969..181880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6462"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   ret:RHE_PC00085 sugar ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6462"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61212"
FT                   /db_xref="GOA:C6BAV4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAV4"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACS61212.1"
FT                   /translation="MNAIEFILAGMLAAATPFLLAALGELVAERAGVLNLGVEGLMAFG
FT                   AVLAFIIVYQGGGHLLGFVVAGLGSAVLSLLFAFVTLGFRANQVAAGLAIGILGQGLSA
FT                   LFGKTYESLTVRGLPKLGLPGLSELPVVGGLFVQDIVVWISLAATLALWAIFAYTKLGL
FT                   IVRAVGENPKAAHAIGYSVISVRVLAIAFGGAMAGFAGAYASVVYTPLWADGMIAGRGW
FT                   IAIALVVFGTWLTGRIFLGACLFGAVSLMGLAAQATGLDVPSQLLSSLPYLVTIIVLGI
FT                   ISADRRLLKLNGVASLGEPFER"
FT   sig_peptide     complement(181815..181880)
FT                   /locus_tag="Rleg_6462"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.859 at
FT                   residue 22"
FT   gene            complement(181877..182977)
FT                   /locus_tag="Rleg_6463"
FT   CDS_pept        complement(181877..182977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6463"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   ret:RHE_PC00086 sugar ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6463"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61213"
FT                   /db_xref="GOA:C6BAV5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAV5"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACS61213.1"
FT                   /translation="MSAWSLAFVPTLVRRERASLAATLLAPVIALVIAVALNLGLYILM
FT                   GRDPVAVIYAMLFEPFLSWASFSEVLLKAGPLLLIAQGLAIGFRAKVFNIGAEGQFILG
FT                   AIFASAIPVWFPQATGQWIWPAMLLLGAIGGALWASLTAFWRVRLNANEILVSLMLSLV
FT                   AAQLLNYLLLGPWKDPNGFNFPQSVMFQYDAMVPTLIAGTRVNVSFLITLALSVAAWVF
FT                   MQRSFIGYKLQVGGLAPRAAGYAGFKEGWAIWLSLLIGGFAAGLAGAAEVAGPLGQLQR
FT                   SVASGYGYAAIIVAYLGGLHPIGIVISALVMAVIYIGGDNAMVSANLPIAAVRVFQGSL
FT                   LLTYLIAVAFVRYRLEWRRAAHRSPS"
FT   sig_peptide     complement(182867..182977)
FT                   /locus_tag="Rleg_6463"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.673) with cleavage site probability 0.310 at
FT                   residue 37"
FT   gene            complement(182977..184497)
FT                   /locus_tag="Rleg_6464"
FT   CDS_pept        complement(182977..184497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6464"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ret:RHE_PC00087 sugar ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6464"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61214"
FT                   /db_xref="GOA:C6BAV6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAV6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS61214.1"
FT                   /translation="MTTPLLSLRGISKSYGQIHANQAIDLDVAPQSIHAILGENGAGKS
FT                   TLMKLIYGVEQPDDGEVIWEGNSLRLASPAEARRNGIGMVFQHFSLFETLTVLENIRLV
FT                   VPGRKAELKERIRTLGREFGLEVDPLAHVHALSVGERQRVEIIRSLMTNPKLLILDEPT
FT                   SVLPPQLVEKLFDTLRRLRDGGVSILLISHKLEEIRAICDRATILRGGRVTGDVDPREH
FT                   DAHDLARMMIGREMPAPISALPLSGGEKRLEIIGLDYQPDDPFAVPLSGISLEVRAGEI
FT                   LGIAGISGNGQGELAALISGETVLGRDQRDRIYMMEMDVGRLDAAARRTLGFAFVPEDR
FT                   LGRGAVPEMSLVLNSLLTAHPLKLLRHGLVDKARALAFTHDCIRQNDVRTPGPDAEAGT
FT                   LSGGNLQKFIVGREIMLSPKLLFLAQPTWGVDIGAASAIRSRLVALRNQGMAILVISEE
FT                   LEELFELCDSIQVLHHGRLSPPLATRDTKPEEIGRHMIGAQASPEKVQ"
FT   gene            complement(184501..185598)
FT                   /locus_tag="Rleg_6465"
FT   CDS_pept        complement(184501..185598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6465"
FT                   /product="basic membrane lipoprotein"
FT                   /note="PFAM: basic membrane lipoprotein; KEGG:
FT                   ret:RHE_PC00088 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6465"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61215"
FT                   /db_xref="GOA:C6BAV7"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAV7"
FT                   /inference="protein motif:PFAM:PF02608"
FT                   /protein_id="ACS61215.1"
FT                   /translation="MTKLTRRNLMTAAAATGLAGVLGSRLALAADEPLGITLVVPSPIG
FT                   DVGWGHALAAGLEPIRAAYGDKVKVTVLENIAEGPDADRIMNKTVADGNKFLIAGSFGY
FT                   QNGALQIARRDPSVTVLHASGFQVAPNFSPFAAKYFQGTYLLGMAAAALSKTGKLGSVS
FT                   AFAIPELITSINAFTLGAQAVKPDIEVSVVWVNSWFDPAKEQEAAKALIAQKCDVIFSN
FT                   AQDTPSVISACEEAGVYAFNLNSSMKKYAPKTYLGCISTDWSPFFKASVDAHLAGTFKG
FT                   ANAFLGVADKVVEVVDWNADVPADVMTKIKEIEAKVADGSFSPFTGPIAKADGSEGVAS
FT                   GATMADPEIIAMNWHVKGVSTPLPK"
FT   sig_peptide     complement(185509..185598)
FT                   /locus_tag="Rleg_6465"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 30"
FT   gene            complement(185625..187004)
FT                   /locus_tag="Rleg_6466"
FT   CDS_pept        complement(185625..187004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6466"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase; Amidohydrolase 3; KEGG:
FT                   ret:RHE_PC00089 hydrolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6466"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61216"
FT                   /db_xref="GOA:C6BAV8"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAV8"
FT                   /inference="protein motif:PFAM:PF01979"
FT                   /protein_id="ACS61216.1"
FT                   /translation="MAGYLLKNCAAVIVDEGKGPVAHRNVDLLTNGPAIMAIGENLGAD
FT                   ALPAGTTVQDAAGWFVYPGLVNTHHHFFQCFVRNRADLDWTKLSVIEWLDRIYPIFSQL
FT                   HEECFYHASVTAMAEMVKHGCTTALDHQYNFPRHAGKRLIDRQFEAAELLGMRFHAGRG
FT                   GNTLPKSEGSTIPNEMLETTDEFIADCARLIETYHDTSPFSMRQVVVAPCQPVNCYRET
FT                   FVESVALARDRGVMMHTHVGEGESPVIQARHGMRTVDYLEELGFAGPDTFYAHCWELTH
FT                   DELRKMAASGTGVAHCPEPVYLVGAEVTDIPAMAAFGLRVGLGCDGAASNDNSNLMHCL
FT                   HSAYMLQCLVSSSRAHPVPPPVDFLGYGTAGGASLLGRRDIGRLAPGMAADLFAIDTRR
FT                   MDYVGTRHDPLSLIARVGIGMATDMTMINGRVVWQKGEFPGLDEAKLAADAEAALSTVE
FT                   F"
FT   gene            complement(187006..187665)
FT                   /locus_tag="Rleg_6467"
FT   CDS_pept        complement(187006..187665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6467"
FT                   /product="Glutathione S-transferase domain protein"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   ret:RHE_PC00090 glutathione S-transferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6467"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61217"
FT                   /db_xref="GOA:C6BAV9"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAV9"
FT                   /inference="protein motif:PFAM:PF02798"
FT                   /protein_id="ACS61217.1"
FT                   /translation="MKLYDYILSPSCYKVRLMAALTGVKLDLRPVDFHPGAEHRGPELL
FT                   ALNPAGSIPILEDGDLILTESSAILVYLAAKAAPEWLGSGKAEEAARVQQWLSFSGRLT
FT                   ASLGGARLHEMLLRPGDIGALQAQGIAALRELEAGLVEQGLRGMRFLAADRPTIADIAC
FT                   FPYVALAPDGGVTLDAYPAIRLWSRALRALDKFIEMPGIHRLHELKPEPQIEPGEA"
FT   gene            complement(187662..188507)
FT                   /locus_tag="Rleg_6468"
FT   CDS_pept        complement(187662..188507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6468"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_PC00091 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6468"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61218"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAW0"
FT                   /inference="similar to AA sequence:KEGG:RHE_PC00091"
FT                   /protein_id="ACS61218.1"
FT                   /translation="MTMQAMIDEWYPVGLFSQLDSAGRKTALMGEPIKVARDADGNAKV
FT                   TRGDGRALPVRVRYGHVWSSLGEPKKELFPIPEADQPGRRFVDVGVVRVRCSPLRAVEN
FT                   FLDIAHFPFVHTDILGAEPHTEVQNYKVEIREEEDEVWATQVKFYQPQAAKSASGGITT
FT                   EYMYRVPAPTCSVLYKTCPPRPSEWDVITLFVQPLAEDLCDVWPWMALFDDETAMTDLI
FT                   HFQQTIFLQDRSILENQIPRLLPLDPGMEIPTRADLTSIAYRRWLKRHNYTYGAQLVAQ
FT                   "
FT   gene            complement(188504..189157)
FT                   /locus_tag="Rleg_6469"
FT   CDS_pept        complement(188504..189157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6469"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   ret:RHE_PC00092 oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6469"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61219"
FT                   /db_xref="GOA:C6BAW1"
FT                   /db_xref="InterPro:IPR015881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAW1"
FT                   /inference="protein motif:PFAM:PF00355"
FT                   /protein_id="ACS61219.1"
FT                   /translation="MPSDTTGFWTPVALSRDLPAGTVMPAWTAAGSIALWRSASGRISA
FT                   SADRCPHRGMRLSHGFVRGEALSCIYHGWSYGQAGNCLRIPAHPGLTPPESIRVATHDV
FT                   EEAGSVIWVAVGTPASKPPGLEGLIPLRSLTAFAGIAAIEAAAGAKTSPDGLVEFDAFT
FT                   GTICLLLSAQEDGKTLIHVLLKGDAGPAAGIGASRAAESLRRRAEGLQKKEIAQ"
FT   gene            complement(189313..189579)
FT                   /locus_tag="Rleg_6470"
FT   CDS_pept        complement(189313..189579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6470"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_PC00093 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6470"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61220"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAW2"
FT                   /inference="similar to AA sequence:KEGG:RHE_PC00093"
FT                   /protein_id="ACS61220.1"
FT                   /translation="MGQDTSDLLERMTIVGDLEVASFVPWIRRHAAKLGLSHTISHTSS
FT                   MRIELEVAGPEELIDMMEMGCSLGPIDVWVERIDRTAISGERT"
FT   gene            complement(189770..190663)
FT                   /locus_tag="Rleg_6471"
FT   CDS_pept        complement(189770..190663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6471"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: bbt:BBta_2294 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6471"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61221"
FT                   /db_xref="GOA:C6BAW3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAW3"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACS61221.1"
FT                   /translation="MEAVNLNRLAYFAAVVDTGSFTKAAERLAITKTVVSQQVARLEAE
FT                   LKTSLLLRTTRRVEPTEAGKLLYARCVLIFREAEDAVDEITRANAEPTGMLRIAAPNDY
FT                   GASTIAPIAASFIRKYPACRVELLLADTKMDLLANQIDLSIRVGWLDDSSHQARRIGSF
FT                   RQFLVASPSFSATLSLNSPEDAAGQPFIANLALKEPVTWRFIQGDFDRRTVRMQQSLMS
FT                   NSTPAVLAATLAGAGISVLPDFLAGEHIDAGRLIRLLPDWSLPAGGIYVVYPAARFRTP
FT                   KVTAFVAMLTGGRSPD"
FT   gene            190779..191411
FT                   /locus_tag="Rleg_6472"
FT   CDS_pept        190779..191411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6472"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mlo:mll3417 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6472"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61222"
FT                   /db_xref="GOA:C6BAW4"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAW4"
FT                   /inference="similar to AA sequence:KEGG:mll3417"
FT                   /protein_id="ACS61222.1"
FT                   /translation="MHLIYLYDPLCGWCYGAAPALDKMAKLDNLTVELAPTGVFAGEGA
FT                   RPLDERFAAYAWHNDQRINRLTGQVFSQLYRDQVLGGADDMFDSAPATLGIIAVGVTQL
FT                   DREGDALKALQSARYVDGRNTSEIAVVADVLDQAGFSDSAARVRAPDEALLEIYRNRIG
FT                   KSRQLMAAFRMDGVPALLVSDGDKRRVLRSVALFGGFDRLAAELQAA"
FT   gene            191531..192412
FT                   /locus_tag="Rleg_6473"
FT   CDS_pept        191531..192412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6473"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   bbt:BBta_2292 metallo-beta-lactamase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6473"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61223"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAW5"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACS61223.1"
FT                   /translation="MKTTLAAGAVAVFAPAGLGNAAGSKLAWKHFPAGQNGFFRAPVLL
FT                   TGPSEALLIDGGFTYPDGRALAEAIKATGKTLTAIYVSQSDPDYYFSLKPVLEAFPGTK
FT                   VLAASDTIAAIKGNIEKKLAVWGPQLKENGPQTLADIVMPEAFDAPSVTVDGETVEIVA
FT                   AEAGLSNRRYLFVPSLNAVFGGVMIFSGVHVWTADTQAPEQRAAWVATLDKISARKPTI
FT                   VVPGHMMPEAATDLSAVEHTKSYLVAFEEELAKAADSAALKAAMEARFPGLGMGVALDI
FT                   GSKVAKGEMKWG"
FT   sig_peptide     191531..191596
FT                   /locus_tag="Rleg_6473"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.947 at
FT                   residue 22"
FT   gene            192943..193752
FT                   /locus_tag="Rleg_6474"
FT   CDS_pept        192943..193752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6474"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: fhuC; ABC transporter nucleotide binding/ATPase
FT                   protein (ferrichrome) ; K02013 iron complex transport
FT                   system ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6474"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61224"
FT                   /db_xref="GOA:C6BAW6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAW6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS61224.1"
FT                   /translation="MAILPIQDPPRTAETFVAENIGLLIERNEILFDVSLKFPAGEVVA
FT                   LVGHNGSGKSSLLKMLARQLVPSTGSISYGNQDLRMYSERAFARSVAYLPQDVTTGSEM
FT                   TVRELVGCGRYPWHGALGRFTKNDEEKVEEALRATHIETFAERIMGTLSGGERQRAWIA
FT                   MLIAQDARCLLLDEPTAALDVAHQVEVLSLVRRLAHEGGRSVIIVLHDINMAARFCDRI
FT                   HALKRGRVVASGTPGAILAPNTLQEIYGIDMDVISAPNLPYPLAYVC"
FT   gene            193766..194644
FT                   /locus_tag="Rleg_6475"
FT   CDS_pept        193766..194644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6475"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG: fhuD; ABC
FT                   transporter substrate binding protein (ferrichrome) ;
FT                   K02016 iron complex transport system substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6475"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61225"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAW7"
FT                   /inference="protein motif:PFAM:PF01497"
FT                   /protein_id="ACS61225.1"
FT                   /translation="MGVSRRSFLQFAGASLIPAPLFAQSMGPRIVSLDYGLASTLLSLG
FT                   LPPIGISDLADWDRWVVEPPMPKSVVDIGSAFEVNFEILVTLKPDIILTTPYLDELLPK
FT                   LQSVAKVVRLEIFTPGIGPILTAAIAATRKLAVELGRENEAEQFLARADVFFAQCRSRL
FT                   EGKNLPPVALVNFMDARHARIYSSPGLFHNVLERIGVRNAWTRESNYWGFETIGIEDLS
FT                   KITDPDARLIAFEPIPLDVLPKLAQSPLWNRLSFARPGHLSILPPALMFGMVNEAMRFA
FT                   GLLTDLLEKDA"
FT   sig_peptide     193766..193837
FT                   /locus_tag="Rleg_6475"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.950 at
FT                   residue 24"
FT   gene            194644..196614
FT                   /locus_tag="Rleg_6476"
FT   CDS_pept        194644..196614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6476"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG: fhuB;
FT                   ABC transporter ; K02015 iron complex transport system
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6476"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61226"
FT                   /db_xref="GOA:C6BAW8"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAW8"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ACS61226.1"
FT                   /translation="MVSRRDNIGPAIVFLLLMCGGGVASWFLAAPALSEMARGDYDVTR
FT                   MVFTYSTLPRLATALIAGAALALSGALFQQVLRNPLADPATLGVSAGANLALVVTSLFL
FT                   PDLLGAGRDLVALIGSATAAAIVVSLGARRGFSPYSLVLSGLVLSLWCGGLAAILTYLN
FT                   QRYLSSLFIWGAGSLAQQSWVIPLSLLWKLAVIAIGCAFVMRPLSLLDLGESSSTALGV
FT                   RLVRLRFVVIALAVTLAAFVTSAVGVIGFIGLVAPTIARLSGARRPTQLILWSPLIGAG
FT                   LLFFADSILQLVAGGLGDFLPTGAVTAIFGSPLLLALLPRLKIRHRLQQSPAFRRPRRW
FT                   DGTRPVIIAAAGLLVLLMVSAFLGRDVNGGWAFTSGEFSVDVLAIRIPKILAALTSGAM
FT                   LAVAGSILQRLTGNEMASPEVLGISAGATFGVAIALFAVAPGFSGQFAFAVAGAISVLF
FT                   VIFVSSRRSAFAPERVLLAGIALSAMVDAVVGVLSSTGDPRAVLLMRWMSGSTYLIDGS
FT                   TAAMEVALGAVLIAVSLAARRWLDILPLGPSPSAAVGIPLAKSRFALFGLAGLLTAAAT
FT                   LTVGPLSFIGLMGPHLAREAGLARALPQMVGAALIGGGLMVAADFVGRTIVSPYQIPAG
FT                   LVSALIGAPFLMLMMRKRGAG"
FT   sig_peptide     194644..194748
FT                   /locus_tag="Rleg_6476"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.966) with cleavage site probability 0.549 at
FT                   residue 35"
FT   gene            complement(196817..198954)
FT                   /pseudo
FT                   /locus_tag="Rleg_6477"
FT   gene            complement(199230..200111)
FT                   /locus_tag="Rleg_6478"
FT   CDS_pept        complement(199230..200111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6478"
FT                   /product="esterase"
FT                   /note="KEGG: esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6478"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61227"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAW9"
FT                   /inference="similar to AA sequence:KEGG:Arad_8218"
FT                   /protein_id="ACS61227.1"
FT                   /translation="MTNPISVYSMLGTCFFDLAPAAGGEPYRLFLSIPAEKPPAGGWPL
FT                   LVMTDGNATFPFAVASLVTQAPYPTGTNVGWGVIAAIGYPSDEPYDPLRRSWDLGPPPV
FT                   KSYPPFVEGGPPVVIGGTGKLVDFIENELIPRIAEMVILDPMRRSLFGHSFGGLFTLYA
FT                   LFERPGLFANWIAASPTIYWENSEILKNEAQRQDAPGNAPFLHLSAGEYEGDELAPFQY
FT                   RNEDATARLEKRKTERTVLLAREMAERLNGTTDGLRTEFELYAGETHMSVLAAAVNRAV
FT                   GIAFAVQSLTDM"
FT   gene            200957..201196
FT                   /locus_tag="Rleg_6479"
FT   CDS_pept        200957..201196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6479"
FT                   /product="putative addiction module antidote protein,
FT                   CopG/Arc/MetJ family"
FT                   /note="TIGRFAM: addiction module antidote protein, CC2985
FT                   family; PFAM: CopG domain protein DNA-binding domain
FT                   protein; protein of unknown function UPF0156; KEGG:
FT                   pmy:Pmen_2127 CopG/Arc/MetJ family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6479"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61228"
FT                   /db_xref="GOA:C6BAX0"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR022789"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAX0"
FT                   /inference="protein motif:TFAM:TIGR02606"
FT                   /protein_id="ACS61228.1"
FT                   /translation="MSTTNISLPDNLKPFVDQQVARRGYGTSSEYVRELIRHDKDRQHL
FT                   RSLLLEGASFETTEPVDAAYFNSLRARASRQSSK"
FT   gene            201193..201438
FT                   /locus_tag="Rleg_6480"
FT   CDS_pept        201193..201438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6480"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sme:SMa0572 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6480"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61229"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAX1"
FT                   /inference="similar to AA sequence:KEGG:SMa0572"
FT                   /protein_id="ACS61229.1"
FT                   /translation="MIAKSIVPRESARGDIENAVDYYAREAGAQVAISFVDALQSTFGL
FT                   IAKHPSSGSSRYAYELGLPHLRSMSLKAFPYTAWIG"
FT   gene            201648..201953
FT                   /locus_tag="Rleg_6481"
FT   CDS_pept        201648..201953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6481"
FT                   /product="PhnA protein"
FT                   /note="PFAM: PhnA protein; KEGG: mno:Mnod_7168 PhnA
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6481"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61230"
FT                   /db_xref="InterPro:IPR004624"
FT                   /db_xref="InterPro:IPR013988"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAX2"
FT                   /inference="protein motif:PFAM:PF03831"
FT                   /protein_id="ACS61230.1"
FT                   /translation="MAAENDEYIYDEVTGEWRPASEMAASASGGEAVVRDASGNVLADG
FT                   DSVTVIKDLKVKGAGQTLKQGTVIRSIRLTDNPEEIDCRHDGIKGLVLRTEFVRKP"
FT   gene            complement(201974..202387)
FT                   /locus_tag="Rleg_6482"
FT   CDS_pept        complement(201974..202387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6482"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xau:Xaut_4992 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6482"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61231"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAX3"
FT                   /inference="similar to AA sequence:KEGG:Xaut_4992"
FT                   /protein_id="ACS61231.1"
FT                   /translation="MNYELIQTASVIRYPYLWAREAGRGETEGRKERPVAVGVRMPRPD
FT                   GDLVLFFPITTKQPEASRFAVEVPAIEKRRAGLDADRRLWIIFDEFNTDIVGNSFYLEP
FT                   EPPTGRFSKAFFLPLLREFIRRRKSATEVSRFR"
FT   gene            complement(202387..202653)
FT                   /locus_tag="Rleg_6483"
FT   CDS_pept        complement(202387..202653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6483"
FT                   /product="prevent-host-death family protein"
FT                   /note="TIGRFAM: prevent-host-death family protein; PFAM:
FT                   protein of unknown function DUF172; KEGG:
FT                   rec:RHECIAT_PC0000250 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6483"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61232"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAX4"
FT                   /inference="protein motif:TFAM:TIGR01552"
FT                   /protein_id="ACS61232.1"
FT                   /translation="MSKSSGSYSTSDLSRKSGDIIAEALRHPVTITQRNKPRLVLLNIE
FT                   DYQRLMKQSDRRTAGTIETMPDELFAEFENAVEAYAGEDEAGN"
FT   gene            complement(202851..203329)
FT                   /pseudo
FT                   /locus_tag="Rleg_6484"
FT   gene            complement(203478..203552)
FT                   /pseudo
FT                   /locus_tag="Rleg_6485"
FT   gene            204027..205571
FT                   /locus_tag="Rleg_6486"
FT   CDS_pept        204027..205571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6486"
FT                   /product="filamentation induced by cAMP protein Fic"
FT                   /note="PFAM: filamentation induced by cAMP protein Fic;
FT                   KEGG: pde:Pden_1534 filamentation induced by cAMP protein
FT                   Fic"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6486"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61233"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAX5"
FT                   /inference="protein motif:PFAM:PF02661"
FT                   /protein_id="ACS61233.1"
FT                   /translation="MREWPTQSVRDFHGRPLPERGEPAGYAAIMARYDLILPPPIRMTA
FT                   IAERHHPTSTEAWLMLTPRYRPQPELGPHLVFAFRYEGVDLQVLSALFQIIETDEIEAI
FT                   IRATPTGAFARRLWFLYEWLTDRQLDIPDPGKVRMVTILDPDQQYALAEGDPSPRHKVS
FT                   NNLPGTPAFCPLVRRTPDLAAFSQKALGERAREAMGRVRPDLLARAAAFILLNDSKSSF
FT                   AIEGERPSGQRAARWGQAIAQAGVRPLSLDELDRLQRIVIGDARFVRLGLRDEGGFIGV
FT                   HDRDTNMPIPDHISARHEDLESLVGGLIAFSDRAARGAMDPVVAAACLAFGFVYIHPYV
FT                   DGNGRLHRWLIHHALAAASYSPPGLVFPVSAVILRNIDRYRAVLESWSAPLLPFIEWRP
FT                   TVSANVEVLNDTAVFYRYFDATAHATFLYACVEQTVEHDLPQEVRFLQAFDTFSEGVQQ
FT                   IIDMPTAQAELLHKFLGQNDGRLSQRARTKEFAALDDLEVERIEALYADAFERDRA"
FT   gene            205685..206110
FT                   /locus_tag="Rleg_6487"
FT   CDS_pept        205685..206110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6487"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6487"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61234"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAX6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS61234.1"
FT                   /translation="MSENNVNALSFEFDRSNMFEPLLQADPSFREKWETFQEEYRSDDQ
FT                   LPFYLALSELARHLIQDLETGNTHRFDAVFDVVERWHIKGDPYVKQAATVGLLEDLQNS
FT                   HLHRKTRSDDFIPWLRPETLGWWTKVHEFWATGKPII"
FT   gene            206184..206495
FT                   /locus_tag="Rleg_6488"
FT   CDS_pept        206184..206495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6488"
FT                   /product="transposase"
FT                   /note="KEGG: transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6488"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61235"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAX7"
FT                   /inference="similar to AA sequence:KEGG:Avi_7669"
FT                   /protein_id="ACS61235.1"
FT                   /translation="MSRQQFDLTDFEWSIIQSLLPNKPRGVPRVDDRRVINSILWRFRT
FT                   GSPWADVPERYGPYTTCYNRFVRWRKAGVWDHVLHEVAKAFDGDIVMSLCPSRSLRLK"
FT   gene            206488..206768
FT                   /pseudo
FT                   /locus_tag="Rleg_6489"
FT   gene            complement(207050..207364)
FT                   /locus_tag="Rleg_6490"
FT   CDS_pept        complement(207050..207364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6490"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_PB0000162 transport secretion
FT                   system IV protein, VirB5"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6490"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61236"
FT                   /db_xref="InterPro:IPR014158"
FT                   /db_xref="InterPro:IPR023220"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAX8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS61236.1"
FT                   /translation="MERSTTRFALVLAATLLPVGTAFPQGIPVIDQTAIAKQIESITQL
FT                   KSQLDTLNQQLQQARQPSAERVLDDDVRACRHGYPRRRHYPPPPGLVPGFFFPEGNSND
FT                   "
FT   sig_peptide     complement(207296..207364)
FT                   /locus_tag="Rleg_6490"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.926) with cleavage site probability 0.584 at
FT                   residue 23"
FT   gene            complement(207364..207666)
FT                   /pseudo
FT                   /locus_tag="Rleg_6491"
FT   gene            complement(207686..208348)
FT                   /locus_tag="Rleg_6492"
FT   CDS_pept        complement(207686..208348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6492"
FT                   /product="transport secretion system IV protein, VirB1"
FT                   /note="KEGG: rec:RHECIAT_PC0000911 transport secretion
FT                   system IV protein, VirB1"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6492"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61237"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAX9"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_PC0000911"
FT                   /protein_id="ACS61237.1"
FT                   /translation="MAVAFVDLAQTCAPIVEVRTLAAVVSLESRFKPFAIRINSGSPLE
FT                   RQPASKAEAIELATSLIADHQNIQVSLGGIGMEELRKLKLSISDAFDPCLNLKATATLL
FT                   DSYYRLSLRAGADASHAENVMLQSYYGRDDPSVGKMVKYDRQVRQEMVPLSSNLASVAI
FT                   AEPREEVPLEESADGEAAPAPGKSLSQPDEAASWDVFSARRQSSVLVFQNDRSEQSK"
FT   gene            complement(208352..208867)
FT                   /locus_tag="Rleg_6493"
FT   CDS_pept        complement(208352..208867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6493"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_PD00142 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6493"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61238"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAY0"
FT                   /inference="similar to AA sequence:KEGG:RHE_PD00142"
FT                   /protein_id="ACS61238.1"
FT                   /translation="MKNLLFNSVVAACCILPPYLTSPGNAQATDWGCEVVLCLSNPGGP
FT                   TQFAEWRELAEGHSFPTCSGVGCRSSRPGYEPYYCETGYWLESDYGPRGREAICVSTAP
FT                   AAGERRILPQSWRRQQFQQGSVLSPRWQREDGRRRCMGYSTARPNVRSQPHYVDVTIDG
FT                   TATQRVWY"
FT   sig_peptide     complement(208781..208867)
FT                   /locus_tag="Rleg_6493"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.745 at
FT                   residue 29"
FT   gene            208959..209315
FT                   /locus_tag="Rleg_6494"
FT   CDS_pept        208959..209315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6494"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_PC0000913 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6494"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61239"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAY1"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_PC0000913"
FT                   /protein_id="ACS61239.1"
FT                   /translation="MTRALKTQWHNLAFSGLILHEILDHPLDDDETPQARLKQVGMMTI
FT                   LYSMNQAHQKLTLSSIMEITALTRSGVKETVDLLVKRGMLDETIVKNSMGRGTARQFEI
FT                   SQALLEKLSSFGAG"
FT   gene            209403..209726
FT                   /pseudo
FT                   /locus_tag="Rleg_6495"
FT   gene            209872..210858
FT                   /locus_tag="Rleg_6496"
FT   CDS_pept        209872..210858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6496"
FT                   /product="UbiA prenyltransferase"
FT                   /note="PFAM: UbiA prenyltransferase; KEGG: noc:Noc_1948
FT                   UbiA prenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6496"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61240"
FT                   /db_xref="GOA:C6BAY2"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAY2"
FT                   /inference="protein motif:PFAM:PF01040"
FT                   /protein_id="ACS61240.1"
FT                   /translation="MNTSLGDRRVTASGRAGLRDYIAIARLDHSTKHVFIVPGIILAYL
FT                   LRGVRTDDLTSSILLGFVTALCIASANYCINEWFDREFDRHHPTKSQRSAVQCAMNGRL
FT                   VQLEWTVLLIVGLGCAILSSKLLFFVACLFAIQGILYNLDPIRSKDKTYLDVISESINN
FT                   PIRLVIGWSMIDPTSLPPGSIILAYWFGGAFLMAAKRLSEYDEIVASHGKELLSRYRAS
FT                   FAKYTKVSLTASCIAYSLFSIAFLSVFLVKYRIEYMLVLPFVVALFTAYFVMATKPGST
FT                   AQKPEKLFREPGLIAIVAALAAAFIFATFVDIPLLVTLTEQHYITIQ"
FT   gene            210855..211559
FT                   /locus_tag="Rleg_6497"
FT   CDS_pept        210855..211559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6497"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 1; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: pna:Pnap_2974 haloacid dehalogenase domain
FT                   protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6497"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61241"
FT                   /db_xref="GOA:C6BAY3"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAY3"
FT                   /inference="protein motif:TFAM:TIGR01549"
FT                   /protein_id="ACS61241.1"
FT                   /translation="MIARNVDWGSIRFVVFDVDGTLYNQRMLRLRMAGELIADAVARGS
FT                   LTNLRVLRAYRSLREAIGEGEIDDFQASLMTRTVARTGQPAERIEAIVSEWIERRPLAY
FT                   IASCRYDGLVELFAGLRRQNKSIGIYSDYPADEKLQRMTLSADYILAASDPGVGIQKPD
FT                   PRGLQMLMQRAGVGPAQTVLIGDRPERDGLAARRAGVLPLIRSDGPREGWLTFSTYSDP
FT                   VFAALRAKEASG"
FT   gene            211556..211921
FT                   /locus_tag="Rleg_6498"
FT   CDS_pept        211556..211921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6498"
FT                   /product="GtrA family protein"
FT                   /note="PFAM: GtrA family protein; KEGG: bat:BAS5286 GtrA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6498"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61242"
FT                   /db_xref="GOA:C6BAY4"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAY4"
FT                   /inference="protein motif:PFAM:PF04138"
FT                   /protein_id="ACS61242.1"
FT                   /translation="MILSKAIRYVFTGGLAAFVDLTVFRGLLAFGVPLGLSATSSWLIA
FT                   AAVNYSATSRYVFNQATSRKRASLFLIGALLGLSINVFVTLILVQQVGLSPLWAKLFGI
FT                   GAAFVFNFLINLLWVFR"
FT   gene            complement(212142..212471)
FT                   /locus_tag="Rleg_6499"
FT   CDS_pept        complement(212142..212471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6499"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6499"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61243"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAY5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS61243.1"
FT                   /translation="MDAYLVHVLSPGDLDTIATTREAGTRIAYSEQQLSGWILAVQGVV
FT                   AYLKGQPRSGGKIGILGISLGTQIASAASLGRSIIEAEVVEELRRNHLTPSSLNPPQIN
FT                   ATIES"
FT   gene            complement(212987..214384)
FT                   /locus_tag="Rleg_6500"
FT   CDS_pept        complement(212987..214384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6500"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /note="TIGRFAM: dihydrolipoamide dehydrogenase; PFAM:
FT                   pyridine nucleotide-disulphide oxidoreductase dimerisation
FT                   region; FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; glucose-inhibited division protein A; KEGG:
FT                   ret:RHE_PC00073 dihydrolipoamide dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6500"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61244"
FT                   /db_xref="GOA:C6BAY6"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAY6"
FT                   /inference="protein motif:TFAM:TIGR01350"
FT                   /protein_id="ACS61244.1"
FT                   /translation="MKEIVCKLLVIGAGPGGYVCAIRAGQLGVDTVIVEAGKPGGTCLT
FT                   VGCIPSKALIHAAEEFDVAQKMLAGKNPMGIRVEGASIDLMRTIAWKDGIVGRLTTGVS
FT                   GLLQKARVKIVHGRAHFRDGKTVEVETETGQQIIRAETVVIATGSDPVELANLPFGGRV
FT                   MSSTEALSLTELPKKLVVVGGGYIGLELGTAFSKMGSDVTIVEATPQVLPQYDAELVRP
FT                   VMRKLTEGGIRVLTGAKAIGLADNGEALIVETADGRRETLPADRILVTVGRRPRTAGSG
FT                   LEELDLDRAGPYLRIDDRCRTSMRGIYAIGDITGEPMLAHRAMAQGEMVAEIMAGKKRA
FT                   WDKRCIPAICFTDPEIVSAGLSPAEAKAQGYEIRTGQFPFSANGRAMTMLSEEGFVRVV
FT                   ARADTNLVLGLQAVGAGVSELSAVFALAIEMGARLEDIAGTIHAHPTRSEAVMEAALKA
FT                   LGSALHI"
FT   gene            complement(214390..215628)
FT                   /locus_tag="Rleg_6501"
FT   CDS_pept        complement(214390..215628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6501"
FT                   /product="catalytic domain of components of various
FT                   dehydrogenase complexes"
FT                   /note="PFAM: catalytic domain of components of various
FT                   dehydrogenase complexes; biotin/lipoyl attachment
FT                   domain-containing protein; E3 binding domain protein; KEGG:
FT                   ret:RHE_PC00072 branched-chain alpha-keto acid
FT                   dehydrogenase subunit E2"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6501"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61245"
FT                   /db_xref="GOA:C6BAY7"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAY7"
FT                   /inference="protein motif:PFAM:PF00198"
FT                   /protein_id="ACS61245.1"
FT                   /translation="MSEFIIKMPDVGEGVAEAEIVEWHVKTGDPVREDMVIAAVMTDKA
FT                   TVEIPSPVSGTVTWLAGEVGDRIAVKAPLVRVETAGDVGEPQSIGTSQTPIAETPKAEI
FT                   AKPAPPAPMAPVPAATPAEKPLAAPSVRLFARESGVDLRQVQATGPAGRILREDIEQFL
FT                   SHGPAPATAKNGFARKTATEEIKLTGLRRRIAEKMVLSASRIPHITYVEEVDMTALEEL
FT                   RATMNGDRRPDHPKLTVLPFLMRALVKAISEQPDVNATFDDDAGIITRYGAVHIGIATQ
FT                   TPAGLTVPVVRHAEARGIWDCAAEMNRLAEAARSGTATRDELSGSTITISSLGALGGIV
FT                   STPIINHPEVAIIGVNKIATRPVWDGTQFVPRKMMNLSSSFDHRIIDGWDAANFVQRIR
FT                   TLIETPALIFIES"
FT   gene            complement(215632..216630)
FT                   /locus_tag="Rleg_6502"
FT   CDS_pept        complement(215632..216630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6502"
FT                   /product="Transketolase central region"
FT                   /note="PFAM: Transketolase central region; Transketolase
FT                   domain protein; KEGG: ret:RHE_PC00071 2-oxoisovalerate
FT                   dehydrogenase beta subunit protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6502"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61246"
FT                   /db_xref="GOA:C6BAY8"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAY8"
FT                   /inference="protein motif:PFAM:PF02779"
FT                   /protein_id="ACS61246.1"
FT                   /translation="MIEAVRSAMDVSMARDDNVVVFGEDVGYFGGVFRSTQGLQAKYGR
FT                   TRCFDTPISESGIVGTAIGMAAYGLKPCVEIQFADYMYPAYDQLTQEAARIRYRSNGDF
FT                   TCPIVVRMPTGGGIFGGQTHSQSPEALFTHVCGLKVIVPSNPYDAKGLLIAAIEDPDPV
FT                   MFLEPKRLYNGPFDGHHERPVTPWSKHDLGEVPDGHYTIPIGKAEVRRAGSAVTVVAYG
FT                   TMVHVALAAAEDAGIDAEVIDLRSLLPLDLDTIVKSVSKTGRCVVVHEATLTSGFGAEV
FT                   AALVQEHCFYHLEAPVVRVAGWDTPYPHAQEWDYFPGPGRVGRALAEVMEA"
FT   gene            complement(216647..217879)
FT                   /locus_tag="Rleg_6503"
FT   CDS_pept        complement(216647..217879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6503"
FT                   /product="3-methyl-2-oxobutanoate dehydrogenase
FT                   (2-methylpropanoyl-transferring)"
FT                   /EC_number="1.2.4.4"
FT                   /note="PFAM: dehydrogenase E1 component; KEGG:
FT                   ret:RHE_PC00070 2-oxoisovalerate dehydrogenase alpha
FT                   subunit protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6503"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61247"
FT                   /db_xref="GOA:C6BAY9"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR022593"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR034616"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAY9"
FT                   /inference="protein motif:PRIAM:1.2.4.4"
FT                   /protein_id="ACS61247.1"
FT                   /translation="MVDSARLSLHVPEPAVRPGGQPDFSNVKIAKAGSVPRPEVDVASE
FT                   DIRDLAYSIIRVLNREGEAVGPWAGSLSNEALLTGLRNMMKLRAFDARMLMAQRQGKTS
FT                   FYMQHLGEEAVSCAFRKALETGDMNFPTYRQAGLLIADDYPMVEMMNQIYSNESDPLRG
FT                   RQLPIMYSSKEHGFFTISGNLATQYVQAVGWAMASAIKNDSRIAAAWIGDGSTAESDFH
FT                   SALVFASTYKAPVILNIVNNQWAISTFQGIARGGSGTFAARGLGFGIPALRVDGNDYLA
FT                   VHAVAYWAAERARRNLGPTLIEYVTYRVGAHSTSDDPSAYRPKTESEAWPLGDPVLRLK
FT                   KHLIVKGAWSEERHVQAEAEIMDEVIEAQRQAEAHGTLHAGGRPSVRDIFEGVYAEMPP
FT                   HIRRQRQKAGY"
FT   gene            complement(217944..219071)
FT                   /locus_tag="Rleg_6504"
FT   CDS_pept        complement(217944..219071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6504"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: ret:RHE_PC00069
FT                   acyl-CoA dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6504"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61248"
FT                   /db_xref="GOA:C6BAZ0"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAZ0"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ACS61248.1"
FT                   /translation="MILSDLQQQISDLARDFARDRLAPGAAKRDREHLFPREELKEMGE
FT                   LGLLGMLVPEAYGGSDTGVVAYAAALEEIAAGDGTCSTIMSVHSSVGCVPILKFGAEEQ
FT                   RQRFLPKLASGEWIGGFALTEPQAGSDASNLKTRARRDGDHYVIDGSKQFITSGKNGDV
FT                   IIVFAVTDLDVGKKGITAFIVQTDTPGYEVIRVEEKLGLHSSDTCQIAFNSMRIPAELR
FT                   LGAEGEGYRIALANLEGGRIGIAAQAVGMARAAFEAARDYARERTAFGKPIFEHQAVAF
FT                   RLADMAVRIEAARQLVFHAASLREAGLPCLSEASMAKLFASEMAERVCSDAIQIHGGYG
FT                   YMADYPVERIYRDVRICQIYEGTSDVQRMVIARNL"
FT   gene            complement(219088..220275)
FT                   /locus_tag="Rleg_6505"
FT   CDS_pept        complement(219088..220275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6505"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /note="KEGG: ret:RHE_PC00068 thiolase protein; TIGRFAM:
FT                   acetyl-CoA acetyltransferase; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6505"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61249"
FT                   /db_xref="GOA:C6BAZ1"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAZ1"
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /protein_id="ACS61249.1"
FT                   /translation="MTLQDPIVIVGAARTPIGSFQGELKEATAPELGATAIRAALQRSR
FT                   VEAEAIEEVVFGCVLPAGQGQAPARQAAIHAGLPFATAASTVNKMCGSGMKAVMIAHDL
FT                   IAAGSASVAVAGGMESMTNAPYLLDKARGGYRLGHGRVVDHMFLDGLEDAYDKGRLMGS
FT                   FAEDCAEAYQFTREAQDSYAIASLTRAQKAIAEGCFESEIAPVTVKSGKAEQVASRDEQ
FT                   PDKAKLDKIPTLKPAFREGGTVTAANSSSISDGAAALVLMRRSEAERRGLKPLATILGH
FT                   ATHSQAPNLFATAPIGALQKLSDRTGLPLSAVDLFEINEAFAVVAMAAMRDLNLPHEKV
FT                   NVHGGACALGHPIGASGARILVTLLAALERYDLKRGMAALCIGGGEATAVAIERQ"
FT   gene            complement(220299..221066)
FT                   /locus_tag="Rleg_6506"
FT   CDS_pept        complement(220299..221066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6506"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: ret:RHE_PC00067 3-hydroxyacyl-CoA
FT                   dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6506"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61250"
FT                   /db_xref="GOA:C6BAZ2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAZ2"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACS61250.1"
FT                   /translation="MLIRGASFIVTGGGSGLGAATVRALVEAGGRVTIADLNAEAGQEI
FT                   AREFGSDACFVKADVTDGEEGAAVVAAAVEAFGSLRGLVNCAGVAPAEKVIGRDGPHRL
FT                   ESFARTVGINLIGTFNMIRLAAAAIQTTEPDAEGERGVIVNTASVAAFDGQIGQAAYAA
FT                   SKGGVAAMTLPIARELARHGIRVVAIAPGIFETPMMADMPAEVQAALGKSVPFPPRLGR
FT                   PAEFAGLVRHILENNMLNGEVIRLDGALRMGAR"
FT   sig_peptide     complement(220992..221066)
FT                   /locus_tag="Rleg_6506"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.869) with cleavage site probability 0.434 at
FT                   residue 25"
FT   gene            221200..222234
FT                   /locus_tag="Rleg_6507"
FT   CDS_pept        221200..222234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6507"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; SMART: helix-turn-helix- domain containing
FT                   protein AraC type; KEGG: ret:RHE_PC00066 AraC family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6507"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61251"
FT                   /db_xref="GOA:C6BAZ3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAZ3"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ACS61251.1"
FT                   /translation="MAEIERRMIAPGFVEEALDSLRRLGKPTAPVLARVGLASPVDQPV
FT                   SAETYGALWLAIAVELDDEFFGMGGRPMRSGSFTLLCHSVLHAPTLGHALRRALRFLDV
FT                   VLDDPRGRLVIRDGLAEIELSDAGGPRSAFAYRTYWIILHGLICWLVGRRIPIRLVDFR
FT                   CAEPKQGADYRLFFGAPVRFSQAISRLGFDSALLDLPVGRSEQALKQFLRGAPANILVR
FT                   YRYDAGIAAGVRRRLNQATPAMWRSFAELAADMRMPPSTLRHRLRDEGQSYAAIKDDIR
FT                   RDLAVELLLNTTMTIGEIAVQLGYSEPSAFFRAFRKWVGKSPEAFRRDGAEIEGMSVES
FT                   VDPP"
FT   gene            complement(222208..222628)
FT                   /pseudo
FT                   /locus_tag="Rleg_6508"
FT                   /note="SNP /replace=A; SNP /replace=G; SNP /replace=C; SNP
FT                   /replace=T; SNP /replace=C"
FT   gene            complement(222618..222878)
FT                   /locus_tag="Rleg_6509"
FT   CDS_pept        complement(222618..222878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6509"
FT                   /product="prevent-host-death family protein"
FT                   /note="TIGRFAM: prevent-host-death family protein; KEGG:
FT                   xau:Xaut_5007 prevent-host-death family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6509"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61252"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAZ4"
FT                   /inference="protein motif:TFAM:TIGR01552"
FT                   /protein_id="ACS61252.1"
FT                   /translation="MRQFTTGDLNKQIGDVTDVASREPVILTRHRKPRFVLMSYEHYQR
FT                   MRSGGDPRRAHHISEMPDEHAELFDEAIERLARGESYDDEP"
FT   gene            223037..224182
FT                   /locus_tag="Rleg_6510"
FT   CDS_pept        223037..224182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6510"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: ret:RHE_PC00064
FT                   isovaleryl-CoA dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6510"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61253"
FT                   /db_xref="GOA:C6BAZ5"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR034183"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAZ5"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ACS61253.1"
FT                   /translation="MFDFSLGETADAIRETTARFAADHIAPLAVEIDESNTFPRQLWPE
FT                   MGALGLHGITVEEEFGGAGLGYLDHVVAMEEVSRASASVGLSYGAHSNLCVNQIRRWAS
FT                   PEQKRRYLPKLISGEHVGSLAMSEVGAGSDVVSMRLRAEKKGDRYVLNGTKFWITNAPH
FT                   ADVLVVYAKTDPAAGPKGISALIIEKGLPGFGVSKKLSKLGMRGSDTAELVFEDCAVPA
FT                   EALMGREGEGVKILMSGLDYERAVLAGGPLGIMQACLDVVLPYVRDRKQFGKAIGDFQL
FT                   MQGKIADMYVALNSARAYVYSVARACDAGRATRTDAAAAILFASENAVKVSLEAIQALG
FT                   GAGYTKEWPVERFLRDAKLYDIGAGTNEIRRYLIGRELIAS"
FT   gene            224179..225789
FT                   /locus_tag="Rleg_6511"
FT   CDS_pept        224179..225789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6511"
FT                   /product="Methylcrotonoyl-CoA carboxylase"
FT                   /EC_number="6.4.1.4"
FT                   /note="PFAM: carboxyl transferase; KEGG: ret:RHE_PC00063
FT                   methylcrotonoyl-CoA carboxylase non-biotinylated subunit
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6511"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61254"
FT                   /db_xref="GOA:C6BAZ6"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAZ6"
FT                   /inference="protein motif:PRIAM:6.4.1.4"
FT                   /protein_id="ACS61254.1"
FT                   /translation="MTVISTAIDRDSDSFKANASKNKALIDELLNRSAKAREGGSQTAR
FT                   ERHTGKGKLLPRDRIQLLIDAGSPFLEIGTLAANGMYDDEAPGAGIISGIGRVSGREVM
FT                   IVANDATVKGGAYFPMTVKKHLRAQEIAMQNRLPCIYLVDSGGANLPHQAEVFPDRDHF
FT                   GAIFYNQAQMSAEGIPQIACVMGSCTAGGAYVPAMSDETVIVRNQGTIFLAGPPLVKAA
FT                   TGEIISAEELGGAETHGRRSGVVDHVAENDEHALLLVRDIAATLNSVKAIDIDLQQPRP
FT                   PKLDPEDLCGLIPGDVRSPYDVREVIGRIVDGSELHEFKPLYGTTLVCGFARIWGMPVA
FT                   VIANNGVLFSESALKGAHFIELACQRRVPLLFLQNISGFMVGGRYEAGGIAKDGAKLVT
FT                   AVATASVPKVTVIIGGSFGAGNYGMCGRAYRPRFLFTWPNSRISVMGGEQAASVLATIR
FT                   RDSTEARGENWPIEEEEAFKAPIRAGYEAEGNPYYATARLWDDGIIDPRQTRDVLGLAF
FT                   SACLNAPIPKGPRFGLFRM"
FT   gene            225797..227662
FT                   /locus_tag="Rleg_6512"
FT   CDS_pept        225797..227662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6512"
FT                   /product="Carbamoyl-phosphate synthase L chain ATP-binding"
FT                   /note="PFAM: Carbamoyl-phosphate synthase L chain
FT                   ATP-binding; biotin carboxylase domain protein;
FT                   ATP-dependent carboxylate-amine ligase domain protein
FT                   ATP-grasp; biotin/lipoyl attachment domain-containing
FT                   protein; Carbamoyl-phosphate synthetase large chain domain
FT                   protein; KEGG: ret:RHE_PC00062 methylcrotonoyl-CoA
FT                   carboxylase biotinylated subunit protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6512"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61255"
FT                   /db_xref="GOA:C6BAZ7"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAZ7"
FT                   /inference="protein motif:PFAM:PF02786"
FT                   /protein_id="ACS61255.1"
FT                   /translation="MMESLLIANRGEIARRIIRTAKMLGIRTIAVYSEADAGLPFVSEA
FT                   DEAIAIGPSPARESYLSQERILDAARKTGAAAIHPGYGFLSENAGFAEAVEKAGIIWVG
FT                   APPAAIRAMGLKDAAKELMQAAGVPVTPGYIGADQSEERLTAEADIIGYPVLIKAVAGG
FT                   GGKGMRRVDRPQDFAELLASCRREAAAAFGDDRVLIERYIANPRHIEVQVFADKLGNCV
FT                   HLFERDCSLQRRHQKVIEEAPAPGLDAATRAVICDAAVKAARAVNYVGAGTIEFIADAS
FT                   EGLREDRIWFMEMNTRLQVEHPVTEAITGEDLVLWQLKVASGEPLPKMQDEIAMNGWAF
FT                   EARLYAENPAAGYLPSIGRLEHLRLPETVRVDSGVEQGDDITAFYDPMIAKVIAHGPNR
FT                   EAALSKLAAACAGIEVWPVRSNAGLLARIAIDPDFRAARIDTGFLDRHDERLVATEPSE
FT                   TAIDSAATALLKNTDGNPWTALTGFRIAGAEDKRVRIRIGDHLHWGQSRPEFEANTITI
FT                   GETTVLFEAGNAWPISLPVASEVEASQSAGDGAILSPMPGLVISVDVADGDRVAKGDRL
FT                   LTVEAMKMEHSLRAPFDGIVEKLQVSSGIRVSENQLVVSIVKEQD"
FT   gene            227662..228114
FT                   /locus_tag="Rleg_6513"
FT   CDS_pept        227662..228114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6513"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   ret:RHE_PC00061 putative amine oxidase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6513"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61256"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAZ8"
FT                   /inference="protein motif:PFAM:PF01575"
FT                   /protein_id="ACS61256.1"
FT                   /translation="MAGRYFDEWTVGDRIAHDIRRTVTETDNLLFTTLSHNPQPLHLDA
FT                   DYAAGTEFGRIVVNGTFTFALTVGLSVGDTTLGTLVANLGYDKVTMPKPVFIGDTLRVE
FT                   TEVMELRRSNSRPDAGIVTFRHITLNQRGEIVCQCLRTAMLKVKPS"
FT   gene            228111..228947
FT                   /locus_tag="Rleg_6514"
FT   CDS_pept        228111..228947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6514"
FT                   /product="HpcH/HpaI aldolase"
FT                   /note="PFAM: HpcH/HpaI aldolase; KEGG: ret:RHE_PC00060
FT                   citrate lyase, beta subunit protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6514"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61257"
FT                   /db_xref="GOA:C6BAZ9"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C6BAZ9"
FT                   /inference="protein motif:PFAM:PF03328"
FT                   /protein_id="ACS61257.1"
FT                   /translation="MKLRSLLFAPGDRPERFEKALASGADAVILDLEDSVAPLNKPKAR
FT                   ESVHEFVLHHAGETALLIRINPLASPEFEGDLAALSGLRPFAIVLPKAEGAASVLKLAG
FT                   SLASAMPILPIATETPSAIFEIGSYRNVATSLCGLTWGAEDLPAAMGATTARRTDGRYT
FT                   PPYELARSLTLFAAHAAGVPAIDTVYPDFHDLNGLRAYVGRARRDGFSGMMAIHPSQIE
FT                   TINHTFTPDPSEIAWAEKVAAAFAASPDAGVIQLDGRMLDLPHLKLATRILDVAGR"
FT   gene            complement(228965..230398)
FT                   /locus_tag="Rleg_6515"
FT   CDS_pept        complement(228965..230398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6515"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: ret:RHE_PC00059 nodulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6515"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61258"
FT                   /db_xref="GOA:C6BB00"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB00"
FT                   /inference="protein motif:TFAM:TIGR01845"
FT                   /protein_id="ACS61258.1"
FT                   /translation="MNLSSLRYAASAVTLLLAGCVSGPNHVPPEMPLPAKFKEGSTKSN
FT                   GDVVAAQWWTAYRDKRLDGLVAHGRSENLDVLQALERINSASANVTVAAAGGLPSLDVG
FT                   ASHTVSGEKGSERTTIGTTNETGGEASLSWLLDIFGQYRRSKESAIASLGAAYATADNA
FT                   KLTFLKDLVESYIDARYYQQRIALSQANLKSRQQTYELTQLQLKAGAASRLDVVQAEGL
FT                   VQSTKSDIPGLEQSFTESGHHIATLLGMPAASLMGELQKSAGQPVFRGDIRAGIPADLI
FT                   RNRPDIRKAERELAAAVADIGAAEAQLYPSISLSGSISPSWVKSSGASGGTLTSWTFGP
FT                   TLNLPIFDGGKLRANVDIEKSDARTQYLAWKAAVLNGVEEVENALSAVRRDTQTLEPLR
FT                   RQVQTAQESLALSTTSYKDGASSLLDVLEAQRSVSDAQESLADTVQQVAKDYVDLYVAI
FT                   GAGYLNRENAASKHTAKAG"
FT   gene            complement(230517..231806)
FT                   /locus_tag="Rleg_6516"
FT   CDS_pept        complement(230517..231806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6516"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein;
FT                   histidine kinase HAMP region domain protein; KEGG:
FT                   ret:RHE_PC00058 two-component sensor histidine kinase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6516"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61259"
FT                   /db_xref="GOA:C6BB01"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB01"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACS61259.1"
FT                   /translation="MPRLFWKFFTTIWLTMAATVGVIILLVNFLQGVPFARELEEERRV
FT                   IALNLTANMLARDGEDAAAHFVRASEETLPSGLTISKTAKADACEVQKTVDTRFVLKDE
FT                   VCYQISLPAKATFTFENFGPFLPWLTILISSTISAGALARYLIRPVVHLRDGLSALAHG
FT                   RFDFRIGDKMAGRKDEVTALAHDFDSSAARLQELQDAQQRLFHDVSHELRSPLSRLQAA
FT                   VGVLRQSPAKLGAMLDRMDREVERLDALVGEVLTLARLTAGSSRPLKTHALDVIELLNE
FT                   ILGDAAFEAQAREVSITTSVEGVFRAEVEGELIYRALENVVRNAVKYTAEHSRISVSCE
FT                   TTDERLKICVTDQGPGVSRDELERIFQPFSRGNEAVPRGGYGLGLAITRQAIERHGGRV
FT                   HASLPDAGGLAITLELPRKPTLYGSADDQA"
FT   sig_peptide     complement(231708..231806)
FT                   /locus_tag="Rleg_6516"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.909) with cleavage site probability 0.672 at
FT                   residue 33"
FT   gene            complement(231809..232495)
FT                   /locus_tag="Rleg_6517"
FT   CDS_pept        complement(231809..232495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6517"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: ret:RHE_PC00057 two-component response
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6517"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61260"
FT                   /db_xref="GOA:C6BB02"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB02"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACS61260.1"
FT                   /translation="MNKVLLIDDDAELTTLLQEYLVEEGYEVVTDTDGRAAIAAAAGNT
FT                   VDIIVLDIMMPRMNGIEVLQRIRKLSQVPVLMLTARGDDVDRISGLNLGADDYVPKPCS
FT                   PGELAARLRAILRRAGQPAAGASIDIIRAGKLVIHPGSRIAEWRGESLDLTGTEFSLLE
FT                   VLARSAGQLVSKQDISKRAFGKPLTPFDRRIDVHISSVRQKLGLREDGQSWIQSVRGQG
FT                   YQLLVD"
FT   gene            complement(233434..234177)
FT                   /locus_tag="Rleg_6518"
FT   CDS_pept        complement(233434..234177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6518"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6518"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61261"
FT                   /db_xref="GOA:C6BB03"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB03"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS61261.1"
FT                   /translation="MMDLFRREGDDQAQLKKMTLNSRYRNIAAMLSIAVVALSIFLISI
FT                   GALIEFFQPAFLSNVILDDVPLHYIAWFMITFGITIAVINVILAARREIEQETAESMLP
FT                   SDAAEIKRQALRDLRTHRNGYARSSKVNQYLWNFLTLAIIVLSGLSSLFSAYGPVVPNW
FT                   LPMTASALVALFGVIMVQFRVRDVWQLREQGRIEAEMLVADAHLIETTDNLATLKQVAA
FT                   LRRRAHALEMKQLNQLFVETTEANR"
FT   gene            complement(234332..234424)
FT                   /pseudo
FT                   /locus_tag="Rleg_6519"
FT                   /note="SNP /replace=C; SNP /replace=C; SNP /replace=T; SNP
FT                   /replace=G; SNP /replace=T; SNP /replace=A; SNP /replace=A;
FT                   SNP /replace=G; SNP /replace=G; SNP /replace=T; SNP
FT                   /replace=T; SNP /replace=C; SNP /replace=T; SNP /replace=A;
FT                   SNP /replace=C; SNP /replace=C; SNP /replace=G; SNP
FT                   /replace=A; SNP /replace=A; SNP /replace=T; SNP /replace=A"
FT   gene            complement(234515..235657)
FT                   /locus_tag="Rleg_6520"
FT   CDS_pept        complement(234515..235657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6520"
FT                   /product="peptidase M24"
FT                   /note="PFAM: peptidase M24; creatinase; KEGG: map1;
FT                   methionine aminopeptidase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6520"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61262"
FT                   /db_xref="GOA:C6BB04"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB04"
FT                   /inference="protein motif:PFAM:PF00557"
FT                   /protein_id="ACS61262.1"
FT                   /translation="MSWQHPVPRITEDERQNRLAGLRKLIEAEGLAAVLLGPTESLHYF
FT                   TGLVWHPSERFLGALVMPATISYIVPGFERSRVETLPHLPGEILVWEEEESSAALIARL
FT                   VAQRGRLALDDGLPLFFYHALAAEMGAARLADGGRLIRDLRCIKSAAELALIQYAMDLT
FT                   LDVHKQVHGLLKPGIKSSEVVEFIDRQHRQAGADAGSTFCIVSFGAATSLPHGADGDQV
FT                   LGRDDVVLVDTGCRIDGYHSDITRTYILEDGNSAFERAWWIEREAQQAVFDAARIGAAC
FT                   SSLDDAARKVLAKHSLGPDYRLPGLPHRAGHGLGLEIHEEPYIVRGNDAPLAAGMCFSN
FT                   EPMIVFPGKFGIRLEDHIYMTAEGPRWLTNPAAGPTKPFS"
FT   gene            235780..237078
FT                   /locus_tag="Rleg_6521"
FT   CDS_pept        235780..237078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6521"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   mmw:Mmwyl1_2460 alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6521"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61263"
FT                   /db_xref="GOA:C6BB05"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB05"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACS61263.1"
FT                   /translation="MAVEYTTPGMLMRDHMVDVPLDWSKPEGETIRIFAREVCDPARRR
FT                   ETLPLLAFLQGGPGGKSPRPSNGGPPWLAEALKTHRVILIDQRGTGRSSRIESATMEHF
FT                   ADGRAAADYLSLFRADSIVADCEHLRKTVFGGGRWQTLGQSYGGFLTLTYLSKAPEGLS
FT                   ACYVTGGLAGLGATAEDVYRRTYPRVTEKNAAYYRRYPGDAERIGRIADYIETNEVRLP
FT                   DGDRLSVRRFQTIGIDFGMAPGYENIHWLVDEAFSGPNEERLSERFLASVMSLTSYDDN
FT                   PLFAVLQESIYGQAGTPTAWAAERIRAEHPAFAGDRRPLLLTGEMMYPWMFEEIRSLRA
FT                   FRAGVEALATIEHYAPLYAPARLAANEVPVAAVIYHDDMYVDAGLSLETARHVANVQAW
FT                   VTNEFEHDGVRQSAAVLRRLMTLVREQGGPLAS"
FT   gene            complement(237108..237812)
FT                   /locus_tag="Rleg_6522"
FT   CDS_pept        complement(237108..237812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6522"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: GntR domain protein; regulatory protein GntR
FT                   HTH; SMART: regulatory protein GntR HTH; KEGG:
FT                   ret:RHE_PC00043 AsnC/GntR family transcriptional regulator
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6522"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61264"
FT                   /db_xref="GOA:C6BB06"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB06"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ACS61264.1"
FT                   /translation="MRNDAENVRVRGSGTQSVYVTLRQEILSMALEPGSPLDEVRLSER
FT                   FRMSRTPIREALLRLAADGLVTTLPNRNTIVATIDFASLPTYFEALTLMYRVTTRGAAQ
FT                   RRNGEIMKTIRRNQKDFADAVAARDAYAMIEANREFHVAIAELAGNSYYTAFFARLLDE
FT                   GRRILRLYYSTFDDRLPRQYVDEHEEIIAAIEAGDVERADQLAIAHAGQIVRQIQEYIA
FT                   RDLDRPVAISMS"
FT   gene            237962..238873
FT                   /locus_tag="Rleg_6523"
FT   CDS_pept        237962..238873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6523"
FT                   /product="dihydrodipicolinate synthetase"
FT                   /note="PFAM: dihydrodipicolinate synthetase; KEGG:
FT                   ret:RHE_PC00042 dihydrodipicolinate synthetase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6523"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61265"
FT                   /db_xref="GOA:C6BB07"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB07"
FT                   /inference="protein motif:PFAM:PF00701"
FT                   /protein_id="ACS61265.1"
FT                   /translation="MTTGWKGVFPAVTTQFNDDLSVDLPSTQRVQDALVNDGVNGLIVM
FT                   GTCGENNSLDPEEKRTILKAAVEVVNGRVPVVTGVSEFDTRRAVAYARDAEKLGADGLM
FT                   LLPAMVYVPKPEELIAHFRTVAEATSLPIMLYNNPPAYRVNIGADVLKVLADVPNIKAV
FT                   KESAPDPRRFTDLINEFGDRFDIFAGLDDVALEGLMLGAKGWVSGLTSAFPQESVQLVA
FT                   AAERGDWEEARKIYRWFMPLLHLDAEHDLVQSIKLAEQIMGRGSERVRMPRLPLSGARR
FT                   AEVTAMVEKAAATRPSKIRQAA"
FT   gene            complement(238924..240024)
FT                   /locus_tag="Rleg_6524"
FT   CDS_pept        complement(238924..240024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6524"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; TOBE domain protein;
FT                   Transport-associated OB domain protein; SMART: AAA ATPase;
FT                   KEGG: smd:Smed_2142 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6524"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61266"
FT                   /db_xref="GOA:C6BB08"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB08"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS61266.1"
FT                   /translation="MARLELKSIVKSYGIYEAVRGISLDIEDNEFVVFVGPSGCGKSTT
FT                   LRMIAGLEHITGGEIVIGDQVVNRLGPGKRDIAMVFQNYALYPHMTVRENISFCLEQQK
FT                   LAKSEIDARIIRAAETLHISELLGRRPGQLSGGQRQRVAMGRAIVRNPKVFLFDEPLSN
FT                   LDAKLRVQMRTEIKRLHQLLPTTTVYVTHDQVEAMTMADRVVVMNGGIIEQAGPPQALY
FT                   HRPVSQFVAGFIGSPSMNFLSATLLSGDKGLVVKLTDGSELPVPKARAGDYASHAGKSV
FT                   VFGIRPESITDRQARPGYADIEAKIDLVEPLGPETMVYFGIGEASLCACIDPESGPRPM
FT                   STMPLSFNMNQMHLFDPATGRSLALA"
FT   gene            complement(240034..241977)
FT                   /locus_tag="Rleg_6525"
FT   CDS_pept        complement(240034..241977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6525"
FT                   /product="protein of unknown function DUF1680"
FT                   /note="PFAM: protein of unknown function DUF1680; KEGG:
FT                   smd:Smed_2143 protein of unknown function DUF1680"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6525"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61267"
FT                   /db_xref="GOA:C6BB09"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012878"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB09"
FT                   /inference="protein motif:PFAM:PF07944"
FT                   /protein_id="ACS61267.1"
FT                   /translation="MTSSPRFQPARAAGRQRYRPADHSSVVFRGGFWQSWTETVRNVTI
FT                   PTQHKRLEEEGFLEVLDFDKPAGPLVRPIQPSGLSMQHFFDSDFGKWIEAASYTLKAHP
FT                   NAALETKIDAIVEKLEKGQMADGYLNSWFIRREPDRRWTNLRDLHEMYSMGHLLEGAVA
FT                   YYEATGKRRFLDVMIRAVDHIIETFGAEPGKLRGYDAHEEIELALVKLYRVTGDPRHLK
FT                   LATYFVDERGRMPSYYDEEARKRGESPEDYVYKTYAYSQAHLPVRDQHQVVGHAVRAMY
FT                   LFSAMADLSRENDDPTLKEACDRLFDNLVSRQLYVTGGLGPSASNEGFTREFDLPNETA
FT                   YAETCAAVALGFWSHRMAQVDLDSKFTDRLETVLYNGALSGISRDGERYFYENVLESHG
FT                   QHRRWKWHYCPCCPTNIARFITSLGQYFYSTDDHQLAVHLYGTNSAELTVGDSFVRLIQ
FT                   KTQYPWDGDISLRFAVERPSRFQLRLRIPGWCRQAQISVNGVAVDLDQCVTKGYAAISR
FT                   EWRNGDEVRIGFSMPVERIYAHPAVSEDGGRVALRRGPVVYCIEETDLGGEPQRLRLPA
FT                   SEEISARYDASLLGGATVLEGTALEADISDWQNALYRTARPALKERPFTAIPYHLWANR
FT                   EPGAMAIWLHEV"
FT   gene            complement(242005..242874)
FT                   /locus_tag="Rleg_6526"
FT   CDS_pept        complement(242005..242874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6526"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: smd:Smed_2144
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6526"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61268"
FT                   /db_xref="GOA:C6BB10"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB10"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS61268.1"
FT                   /translation="MERLNHNLAGKPASERLGYLAFVLTACVFAVFFVMPIIWSFANSF
FT                   KPAAAALADPAALFSKAFSLENYRRLEHVGAGWYVYAGNSVLIAAGTVILTVLVAVPAG
FT                   YGFSKFRFPGQSLLFVLIMATMMIPFQSILTPLFLILKFLHLQNSLLGLVLIYVTFQLP
FT                   FSVFMMRNAFDAVPKALIEAARIDGASQATILRRIMLPIALPGVATVAMFAFLNSWNEF
FT                   LAALIFLSDQNKFTLPIMLVNVSSGIYGIIDWGALQAGIAVTMVPCILLFLLLQRYYVR
FT                   GLTAGAVK"
FT   gene            complement(242874..243797)
FT                   /locus_tag="Rleg_6527"
FT   CDS_pept        complement(242874..243797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6527"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: smd:Smed_2145
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6527"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61269"
FT                   /db_xref="GOA:C6BB11"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB11"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS61269.1"
FT                   /translation="MVSSTLRSRRRAIATGEAEPKGWLGLAFILPGLLFIVVLFLVPLV
FT                   MTVWMSFYNWPLLGRTKFIGLSNYAELIGDTQLWHSLGFTLLYTVLVTVAIFLVAFPLA
FT                   LLVDRPLRIAGFFRTIYFMPVVIGFGAASTLWMWLLNPDSGVFAQLLRGAGIIDSAPRP
FT                   LESFWPALGVVILMVVWKTAGFTMIILLTGLQSISNDVIEAARIDGASVWSRFRRITLP
FT                   LMRNSVVLALVLNVTSSMLAFDQFFIITQGGPENSTISAVFSIYLASFSSYRLGYGSAI
FT                   SFALLVVLVAISAIQFVLLRQRPEEG"
FT   gene            complement(243880..245127)
FT                   /locus_tag="Rleg_6528"
FT   CDS_pept        complement(243880..245127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6528"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: smd:Smed_2146 extracellular solute-binding protein
FT                   family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6528"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61270"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB12"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACS61270.1"
FT                   /translation="MLRLKTTITALALLASSSLAGAEEITLWVRTSSGAVLQGLADKYN
FT                   AAHSDKVNVTQITAEQMVPKLGAAIAGSAAPDGAVLDLIYLPTFAAADGLEDISDFVKG
FT                   LPYSSAMSPSHIRLATYDGKIYGVPALPDASIIAYNTDLFTKAGLDPNKAPASMEEVAA
FT                   DAKKIAALGNETYGFYFVANSGSWLIYDFLPHLWAANADVLSDDGRSATVDTPALRETI
FT                   AAYRDMWKAGAIHPTSRSGNGNNAVEAFASGKVGILMTGSYIVNLLTSKYPDVKFAVAP
FT                   IPGPKGGESSFAGGDTLSLIKGISDEKKKVALDFVNFYMQPEQQVYITQESGMPSRTDL
FT                   AAEAYAKFDPRNLVAYNILAKARTPYTFSSDELFVSRTGPFLNLIQGTIFGDDVDGTIA
FT                   KTQADFTRILERTNPN"
FT   sig_peptide     complement(245059..245127)
FT                   /locus_tag="Rleg_6528"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.911 at
FT                   residue 23"
FT   gene            245307..246323
FT                   /locus_tag="Rleg_6529"
FT   CDS_pept        245307..246323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6529"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; regulatory protein LacI; SMART:
FT                   regulatory protein LacI; KEGG: smd:Smed_2147 periplasmic
FT                   binding protein/LacI transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6529"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61271"
FT                   /db_xref="GOA:C6BB13"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB13"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ACS61271.1"
FT                   /translation="MKNSGDRRRTIYDVAKAAGVSISTASNALNDTGRTKRETRERVRR
FT                   VAEEIGFRPNALARGLLSKRSHAIGMLTNDTYGRLTLPMAAGVSEVLVDHGVSVFLCAT
FT                   NNDPRLAQLHLEALLDRQVDGIIFTATRLDLKPPVQLSRLPIPVVYVFAEGPADSVTFF
FT                   PDDEQGARLAVDHLKELGRSRILHITGPRDYLAARIRAQSYLDACGDGAEAMFGEWSEE
FT                   WGHEAVQTVFARPGPKPDAIFCGSDEIARGVIDALRDLNVEIPTDVAVVGFDNWEVVAR
FT                   QTRPPLSTIDMELKELGHRAGLAILSLSKGEPVPAGITRLPCRLVVRQSCGSPPQSD"
FT   gene            complement(246366..247424)
FT                   /locus_tag="Rleg_6530"
FT   CDS_pept        complement(246366..247424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6530"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; SMART: regulatory
FT                   protein LacI; KEGG: ret:RHE_PC00041 LacI family
FT                   transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6530"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61272"
FT                   /db_xref="GOA:C6BB14"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB14"
FT                   /inference="protein motif:PFAM:PF00356"
FT                   /protein_id="ACS61272.1"
FT                   /translation="MSIEEKQKPQRNDRVTIRTVATHAGVSVAAVSKVMRNAYGVSDAL
FT                   RARVTDSIETLAYRPSRAARGLRGRSFTIGVLLIDIRNPFLPEVIAGVNGVLAPSHYQA
FT                   MIGVSDARVQLETSLIESMIDYKMDGLILVAPRLPSDILAKFAVQIPIVAVGYHDASAT
FT                   AFDTVNADDQRGAEIAVEALLACGYRDIEMLSLGERQGHAVSVVRQREIGFRRAMQRGG
FT                   LGSSPAIGKIPIASPKREEAMRKFLSRKDRPRAVFCWSDLDAITLLSLAMEMGVRVPED
FT                   LAVIGYDNSPTAALGLVNLASIDQSGRELGQVATRALISRIEGRTASEHIFQIPSLVSR
FT                   NSLARSGNSTDR"
FT   gene            247565..249886
FT                   /locus_tag="Rleg_6531"
FT   CDS_pept        247565..249886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6531"
FT                   /product="alpha-L-rhamnosidase"
FT                   /note="PFAM: alpha-L-rhamnosidase; alpha-L-rhamnosidase
FT                   domain protein; KEGG: ret:RHE_PC00040 putative
FT                   alpha-L-rhamnosidase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6531"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61273"
FT                   /db_xref="GOA:C6BB15"
FT                   /db_xref="InterPro:IPR008902"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR013737"
FT                   /db_xref="InterPro:IPR035396"
FT                   /db_xref="InterPro:IPR035398"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB15"
FT                   /inference="protein motif:PFAM:PF05592"
FT                   /protein_id="ACS61273.1"
FT                   /translation="MNFQPAAISGNLVSRTWSGDMIAPLSDGGQGTAASFVSQTFEHDG
FT                   PGLPVDLFISALGLYRCFINGVRVSGDLLTPGWTNYDDRLAYQRYDVSNLLKPGLNRIE
FT                   IWLADGWYRSPLMWGAQAIPNCWGERIGAIADLIGADGALLSTDTTWRSGVLPILKSGI
FT                   YFGEIYDARQESYLESHGTERLPFDRALLVAHETAAVRELRPLAAVENWIDDEGRTIYD
FT                   FGQNAGGYIRYTVRGTAGAEVRVEHSEVLGPDRHFDNRNYRTAAAHTVYTLRGDGDETY
FT                   APHFTFHGFRYARVTITGDAKILAIASIPISSVAEPAGGFTSGNPLVNRLVENTIWSQR
FT                   ANFVEVPTDCPQRDERLGWTGDAQVFAATACWLSDSQSFLRKYLRDVMADQREDGAVSH
FT                   FSPDPTRLHPTNFPGYAGSTGWGDAIVVIPWVLYTHYGDRAVLAECLDSMVRWVDFVWS
FT                   ISDGPLVRPPSHWGARGFTFGDWLQPVGDNRKPRPTIADDCAATLYHFISTDLLARIAA
FT                   TLGEHALEEKMKQRANEIRLTFSNEFITPAGRLAHNDQTSYALAFLHDLIPAEHRQAAQ
FT                   QHFRQVIIDADYKIGTGFIGTPALLPALTKLGMDDLAEKVFLQEDVPGWLYQVSKGATT
FT                   IWERWDSMAPDGTIYEPDMNSYNHYAYGAVCQWLFESVAGISPSPSAPGFAEVIVDPAP
FT                   IPSLSPVSAHHDISQGRIEAGWQCDGNKVTYVLTLPEGCIGRFRPGKRHQNPSLNGEPV
FT                   VEEAVIHPGTHRLAFSLPTS"
FT   gene            249924..251207
FT                   /locus_tag="Rleg_6532"
FT   CDS_pept        249924..251207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6532"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: ret:RHE_PC00039 sugar ABC transporter,
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6532"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61274"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB16"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACS61274.1"
FT                   /translation="MTHRIKVILAGASALLALVAAGPSHAETTLSFLIDNNPDTVAAAE
FT                   ALVAAYQTKVPDVTIEIEPRAGGGEGDNIIKTRLATGEMSDVFLYNSGSLLQALKPAQT
FT                   LVDLSGLASQAKVDEGFKSVVRADGKLYGVPFGTAMAGGILYNRKIYQDLGLSVPKTWA
FT                   DFMANNAKVKASGKVAVAQTYRDTWTSQLFVLADYYNLHAAVPNFAADYTANKAKYAET
FT                   PAAMKGFERLKDVHDAGLMNEDFGAASYDDGLRMVATGEAAHYPMLSFAIGALKQNYPD
FT                   NLADVGFFAQPSDDAATNGLTVWMPPALYIPLTSQHAEEAQKFVDFAGSVEGCKIMVET
FT                   NTVQGPPLIDGCGLPADVPPAVKDMLPYFEAKDKTTPALEFVSPVKGPALEQITVEVGS
FT                   GIRQPADAAKLYDDDVRKQAKQLGLPNW"
FT   sig_peptide     249924..250004
FT                   /locus_tag="Rleg_6532"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 27"
FT   gene            251274..252152
FT                   /locus_tag="Rleg_6533"
FT   CDS_pept        251274..252152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6533"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ret:RHE_PC00038 sugar ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6533"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61275"
FT                   /db_xref="GOA:C6BB17"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB17"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS61275.1"
FT                   /translation="MTETRPRSRKSPYPLWFFIPAAIIYGVLFLVPTVSSLWFSLTRWD
FT                   LSTAEFIGLENFQQFFSEPFLVKGLVNTLIYAVTTSGLKTVCGLLLAVLLTSNIFARGF
FT                   LRTLVFFPVLVSTIGIGITFTVMMHPTRGIINVTLETLGIPGPGWLTNPALALFSVALV
FT                   DVWKGVGLATLIFIAGLAAISPDYYEAARIDGATRLQQFFRITLPLVRPATVIVVTLSL
FT                   IGGLRSFDLIWAMTRGGPGFSSDVVASVIYKQYQAGFYGLSTAGNVILFALIAVIILPF
FT                   TLWFNRREVEE"
FT   gene            252149..252976
FT                   /locus_tag="Rleg_6534"
FT   CDS_pept        252149..252976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6534"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ret:RHE_PC00037 sugar ABC
FT                   transporter, substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6534"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61276"
FT                   /db_xref="GOA:C6BB18"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB18"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS61276.1"
FT                   /translation="MRSVRPYVTGAIALAAAAVIFVMPFVFVALQAVKSKSEASRLNFE
FT                   LPAQWLFWDNLVAVFKARDYQLMLAYFNSTLITVASVTILILLSAMVGYVMQRRRTVWN
FT                   RVASVALFMGLMMPPAVVPTIGLLQEIGLFKTMTGMILIQVAYNLSFSTLLYRSFISTI
FT                   PRDLDEAALIDGAKPRQIFFRVILPLLKPVTVTNIVVQSIAIFNDFTNPLYYLPGKENV
FT                   TVQLTLYNFQSMYTSQYNLLFMNILLVTIPPLIVFIFFNRQIVAGMTAGAVKG"
FT   sig_peptide     252149..252235
FT                   /locus_tag="Rleg_6534"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.507 at
FT                   residue 29"
FT   gene            252981..253958
FT                   /locus_tag="Rleg_6535"
FT   CDS_pept        252981..253958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6535"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; Transport-associated
FT                   OB domain protein; SMART: AAA ATPase; KEGG: ret:RHE_PC00036
FT                   sugar ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6535"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61277"
FT                   /db_xref="GOA:C6BB19"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB19"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS61277.1"
FT                   /translation="MAELTLKQVRKSFGALEVIKGIDLEVASGEFVVFVGPSGCGKSTL
FT                   LRIIAGLEETTSGALTIGGKDVTYAEPSERGIAMVFQSYALYPHMTVAENIGFGLSLAR
FT                   RPKAEIAAKVAATAETLQLAQLLERKPKALSGGQRQRVAIGRAIIRDPKVFLFDEPLSN
FT                   LDASLRAQMRLEIADLHARLKSTMIYVTHDQVEAMTMADKIVVLNGGAVEQIGSPMELY
FT                   RNPATPFVAGFIGSPKMNLYGGEIARRMNCATYGIRPEHIRLSERAGQWQGRIRHLERL
FT                   GADAILYLDVPELGEMVVRAEGETPFASGMTVWANPVEGAEHRF"
FT   gene            254093..254341
FT                   /locus_tag="Rleg_6536"
FT   CDS_pept        254093..254341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6536"
FT                   /product="putative plasmid stability protein"
FT                   /note="KEGG: sme:SM_b21509 putative plasmid stability
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6536"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61278"
FT                   /db_xref="GOA:C6BB20"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB20"
FT                   /inference="similar to AA sequence:KEGG:SM_b21509"
FT                   /protein_id="ACS61278.1"
FT                   /translation="MASMTIRNLDDGLKQRLRMRAATHGRSMEDEARDILRMALATSEP
FT                   PARNLADAIRARLLSVGGVELDIPPREPIRDPPDISA"
FT   gene            254316..255116
FT                   /locus_tag="Rleg_6537"
FT   CDS_pept        254316..255116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6537"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6537"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61279"
FT                   /db_xref="GOA:C6BB21"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB21"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS61279.1"
FT                   /translation="MIPRTSPRDHSRYQRHRRAADARPECGGDRLVRRTTSYIDLHDSS
FT                   HRLRSSTDCVSFPRDVVDAILRRRSCWYLARILAVVFCHLIATLQISMPLSSPTAARRV
FT                   DRSVNSMLRLLPSQFHAALHSRHAMSRILREWTSRSSIRGKTDKGAERQRILQDLLLLR
FT                   KSPHFCLLDNMPAVSSTRGSAGQSETRIVIFRTEDHSGRRTLERPPCWPISCRLTSTGC
FT                   VCSTAPRWPSLCSASHVCCVPRRRGTALRSLAYLCATAAAHPIT"
FT   gene            255142..255645
FT                   /locus_tag="Rleg_6538"
FT   CDS_pept        255142..255645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6538"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pfl:PFL_5484 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6538"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61280"
FT                   /db_xref="GOA:C6BB22"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB22"
FT                   /inference="similar to AA sequence:KEGG:PFL_5484"
FT                   /protein_id="ACS61280.1"
FT                   /translation="MPAQSFVNRMPLGLKAGRATFEFIGGSLLVATIYYPGDQSHSYIR
FT                   RDETARKGLTVRGGFAEGFGLRAEALKKMLRREWKRLGLIQLPGTSLAEPGIDAHFAGT
FT                   LPMGAAGPFGTSSDGDMNLHPGLYVVDGSILPDLSSKYVTMTIMANADRIAHRLAETEA
FT                   NSAL"
FT   gene            complement(255661..256524)
FT                   /locus_tag="Rleg_6539"
FT   CDS_pept        complement(255661..256524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6539"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_PC00033 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6539"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61281"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB23"
FT                   /inference="similar to AA sequence:KEGG:RHE_PC00033"
FT                   /protein_id="ACS61281.1"
FT                   /translation="MYASAALLDLVDACASQGKTRMPLVSIAMYATSQPVAEATAELWS
FT                   FLRHYLLEAGLKDLPEKLDQAVRYDEAWLRPDLLLSQACGYPFATSLRGRVRLVATPIY
FT                   HHPGCDGPLMRSFIIVAKDSALHSLEDLRGTTAAINGPDSNSGSNFFRAAVAPLARDGH
FT                   FFGRIIETGSHGGSIAAVVEGRADSAAIDCVTYANIRRFDPGHIQAVRIIAETTKGPGL
FT                   PFITSGDASDDRVLLLRNALGAAIKEPSLSAMRATLGLVDFSVLSEGDYQPLLSLAGDA
FT                   LPQLRA"
FT   gene            complement(256499..257953)
FT                   /locus_tag="Rleg_6540"
FT   CDS_pept        complement(256499..257953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6540"
FT                   /product="succinic semialdehyde dehydrogenase"
FT                   /note="TIGRFAM: succinic semialdehyde dehydrogenase; PFAM:
FT                   Aldehyde Dehydrogenase; KEGG: ret:RHE_PC00032
FT                   succinate-semialdehyde dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6540"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61282"
FT                   /db_xref="GOA:C6BB24"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB24"
FT                   /inference="protein motif:TFAM:TIGR01780"
FT                   /protein_id="ACS61282.1"
FT                   /translation="MKLNDPSLFRQACPIADRWIEAEGRKAATVRNPATGEPLGVVPDL
FT                   GAAETEDAIRAAVIAQKLWAKKTAGERAAVLKAWHRLMIENRDDLAMILTLEQGKPLAE
FT                   AKGEITYGASFIEWFAEEARRINGEVVPGHQPDKRILVLRQPAGVVAAITPWNFPNAMI
FT                   TRKIGPALAAGCAVVLKPALQTPFSAIAIAVLGERAGLPPGLLNIVTGDAAAIGGVLTA
FT                   SRDVRVLTFTGSTRTGELLYRQCAPTIKKLGLELGGNAPFIVFDDADLDAAVEGALIAK
FT                   FRNNGQTCVCANRLYVQDGVYEAFAAKLAAAVSGLKVGNGLERDVVLGPLIDDNAVAKV
FT                   ESHISDAVTKGAGIVLGGKRHALGGHFFEPTILRDVAAGMQVAREETFGPLAPLFRFRD
FT                   EEDVIEQANDTEFGLASYFYARDLSRVFRVAEALEYGMVGVNTGLVSTAEAPFGGVKMS
FT                   GLGREGSRHGLDEYTELKYVCLGGIA"
FT   gene            complement(257964..259043)
FT                   /locus_tag="Rleg_6541"
FT   CDS_pept        complement(257964..259043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6541"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; Transport-associated
FT                   OB domain protein; SMART: AAA ATPase; KEGG: ret:RHE_PC00031
FT                   polyamine ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6541"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61283"
FT                   /db_xref="GOA:C6BB25"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB25"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS61283.1"
FT                   /translation="MKEPFLQIRGIRKEYGPVVAVHDVNLDVRRGEFLTFLGPSGSGKS
FT                   TTLYILAGFETPTKGDITLEGKTLLDTPSHKRNIGMVFQRYTLFPHLTVGENIAFPLKV
FT                   RRKSKAEVDSKVKEMLRLVRLEGFEDRKPAQMSGGQQQRVALARALAYDPPVLLMDEPL
FT                   SALDKKLREEIQHEIRRIHQQTEVTILYVTHDQEEALRLSDRIAVFSKGVIDQIGTGPE
FT                   LYANPRTRFVAEFIGDSDFISCDLLSSSDGQATISLGGGSVFNDIPVHGKGSSGTRAAL
FT                   MLRPERIRLSRNQVAGAGLAATVSDITFLGNNIHVSTETATGEALAVRLPFGHEAIVGL
FT                   SRGDIVHLNFDPGAAHVFC"
FT   gene            complement(259040..259840)
FT                   /locus_tag="Rleg_6542"
FT   CDS_pept        complement(259040..259840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6542"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ret:RHE_PC00030 polyamine
FT                   ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6542"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61284"
FT                   /db_xref="GOA:C6BB26"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB26"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS61284.1"
FT                   /translation="MLLNFDRLGWWKYILLAITLLTAAFLLMPIVFIAALSFGSSQWLI
FT                   FPPPGWTLQWYSELFADPRWLESAWTSFKIAVIVTVLSVLLGLVTSFGLVRGSFLFRDA
FT                   LKALFLTPMILPVVVLAVALYAFFLRIGLGGTLVGFVISHLVLALPFSILSISSALEGF
FT                   DKSIEDAAVLCGASPLEAKIRVTLPAISHGLFSAAVFSFLTSWDEVVVAIFMSSPTLQT
FT                   LPVKVWATLRQDLTPVVAAASTLLILLTILLMALVAVVRKVLKQ"
FT   sig_peptide     complement(259721..259840)
FT                   /locus_tag="Rleg_6542"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.955 at
FT                   residue 40"
FT   gene            complement(259842..260714)
FT                   /locus_tag="Rleg_6543"
FT   CDS_pept        complement(259842..260714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6543"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ret:RHE_PC00029 polyamine
FT                   ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6543"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61285"
FT                   /db_xref="GOA:C6BB27"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB27"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS61285.1"
FT                   /translation="MSTYSDASAAIAPLPKVRRATGFGGVLPALAFVTIFFIAPVAVLL
FT                   LRSVLEPVPGFGNYAQLIGSATYLKIFANTFIVSGLVTVISLLIGFPVAWALAIMPGRL
FT                   TSVIFAILLLSMWTNLLARTYAWMVLLQRTGLINKMLIGIGLIDKPLALVNNLTGVTIG
FT                   MTYIMLPFIILPLYGVIRKIDPSTLQAAALCGANRWQCLTRVLLPLAMPGMAAGALMVF
FT                   VMSLGYFVTPSLLGGTSNMMLAELIAQFVQSLVNWGMGGAAALVLLVVTLLLYAVQLRF
FT                   VGNQNPGGR"
FT   gene            complement(260827..261837)
FT                   /locus_tag="Rleg_6544"
FT   CDS_pept        complement(260827..261837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6544"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: ret:RHE_PC00028 polyamine ABC transporter
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6544"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61286"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB28"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACS61286.1"
FT                   /translation="MKTTFAVAAVAAFVAVSVPAHADNMVFSSWGGTTQDAQKAAWASP
FT                   FTEKTGITVVQDGPTDYGKLKAMVEAGQVTWDVVDVEGDYAAQAGKNGQLEKLDFSVID
FT                   KSKLDPRFVTDYSVGSFYYSFVIGCNADAVTACPKTWADLFDTAKFPGKRTFYKWSAPG
FT                   VIEAALLADGVAADKLYPLDLDRAFKKLDTIKSDIVWWSGGAQSQQLLASAEAPFGSVW
FT                   NGRMTALAASGIKTETSWEQNITAADSLVVPKGSPNVEAAMKFIAMATSAEPQAALAKA
FT                   TGYAPINVDSAKLMDPETAKTLPDQQTASQVNADMNYWADNRDAIGEKWYAWQAK"
FT   sig_peptide     complement(261769..261837)
FT                   /locus_tag="Rleg_6544"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            complement(261886..262209)
FT                   /locus_tag="Rleg_6545"
FT   CDS_pept        complement(261886..262209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6545"
FT                   /product="NIPSNAP family containing protein"
FT                   /note="PFAM: NIPSNAP family containing protein; KEGG:
FT                   ret:RHE_PC00027 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6545"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61287"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR012577"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB29"
FT                   /inference="protein motif:PFAM:PF07978"
FT                   /protein_id="ACS61287.1"
FT                   /translation="MFYEIRTYRLKNGTIPQYLKVVEEEGIEIQKSHLGTLVGYFFSEI
FT                   GTINEIVHIWAFASLDDREARRQRLLADPRWQAFLPKIRDLIEVAENKIMKPANFSPRS
FT                   EAH"
FT   gene            complement(262215..263678)
FT                   /locus_tag="Rleg_6546"
FT   CDS_pept        complement(262215..263678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6546"
FT                   /product="Betaine-aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.8"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: ret:RHE_PC00026
FT                   aldehyde dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6546"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61288"
FT                   /db_xref="GOA:C6BB30"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB30"
FT                   /inference="protein motif:PRIAM:1.2.1.8"
FT                   /protein_id="ACS61288.1"
FT                   /translation="MRRFQHYIDGEFSDGEASYPSIDPASGAVWADMPEAREADVDRAV
FT                   NAADRALYDGPWPKLTATQRGKLLYKLADLVAANAQILAELETRDTGKIIRETSAQIAY
FT                   VAEYYRYYAGIADKIEGAYLPIDKPDMDVWLRREPIGVVAMVVPWNSQLFLSAVKIGPA
FT                   LAAGCTMVVKASEDGPAPLLEFARLVHEAGFPAGVVNIITGFGASCGAALGRHPKVAHV
FT                   AFTGGPETARHVVRNSAENLASTSLELGGKSPFIVFADADLESAANAQVAGIFAATGQS
FT                   CVAGSRLIVERSVKDKFVALLREKAEAIRIGAPLDMATEVGPLATKRQQDNIGALVAKS
FT                   IESGARLVTGGRKIDGDGYYFPPTILDCDDVASPSLIEEFFGPVLSVVSFETETEALRL
FT                   ANDTRYGLASGVFTQNLTRAHRLMKGLRAGIVWVNTYRVVSPIAPFGGFGLSGHGREGG
FT                   MAAALDYTRTKTIWLRTSDDPIPDPFVMR"
FT   gene            complement(263683..264723)
FT                   /locus_tag="Rleg_6547"
FT   CDS_pept        complement(263683..264723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6547"
FT                   /product="Luciferase-like monooxygenase"
FT                   /note="PFAM: Luciferase-like monooxygenase; KEGG:
FT                   ret:RHE_PC00025 monooxygenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6547"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61289"
FT                   /db_xref="GOA:C6BB31"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB31"
FT                   /inference="protein motif:PFAM:PF00296"
FT                   /protein_id="ACS61289.1"
FT                   /translation="MKFSLFVHMERLDANQSHKSLYEEFVALCEIADKGGMHAIWTGEH
FT                   HGMDFTIAPNPFVTIADLARRTSRARLGTGTVIAPFWHPIKLAGEAAMADIICDGRLDI
FT                   GIARGAYSFEYERLLPGLDAWGAGQRMRELIPAVKGIWAGDYAHDGEFFKFPSTTSAPK
FT                   PLQQPNPPIWVAARDPNSHEFAVANGCNVQVTPLWQGDDEVQSLMERFNDACAKHPEIE
FT                   RPKIMLLRHTYVGSSADDVAQAAHELSVYYNYFFAWFKNEKPVTQGLIERIPDDQIRAN
FT                   AMLSDQVMRTNNVVGDAETVIDRLKAYEALGYDEYSFWIDTGMSFERKKASLERFITEV
FT                   MPAFQE"
FT   gene            complement(264720..265655)
FT                   /locus_tag="Rleg_6548"
FT   CDS_pept        complement(264720..265655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6548"
FT                   /product="flavin reductase domain protein FMN-binding"
FT                   /note="PFAM: flavin reductase domain protein FMN-binding;
FT                   KEGG: ret:RHE_PC00024 flavoprotein oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6548"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61290"
FT                   /db_xref="GOA:C6BB32"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB32"
FT                   /inference="protein motif:PFAM:PF01613"
FT                   /protein_id="ACS61290.1"
FT                   /translation="MTIQTVDPRALRDAFGAFPTGVTVVTACDGDGNPIGFTANSFTSV
FT                   SLNPPLLLVCLAKSSRNFATMTGAQHFAINVLSETQKDVSNTFARPVEDRFAAVEWAKG
FT                   SAGCPIFSSVAAWFECAMEEVIEAGDHVILMGRIEAFDNSGRNGLGYARGGYFTPTLAS
FT                   KAVSAASEGNMELAAVVERRGKVLLLGEDLLSLPGVDAHDGSPTETLQKYLETLTGLKV
FT                   SIGFLYSVYEGKSDGKQHIVYHAVAGEGEPAGGRFLKPDALVAAKFKTSSTADIVNRFA
FT                   MESSIGNFGVYFGDETGGTVHPIPAKDAKA"
FT   gene            complement(265652..266497)
FT                   /locus_tag="Rleg_6549"
FT   CDS_pept        complement(265652..266497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6549"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   ret:RHE_PC00023 hydrolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6549"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61291"
FT                   /db_xref="GOA:C6BB33"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB33"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACS61291.1"
FT                   /translation="MLTAGSTTRTAAATNAAGALPRKRTASGTAYHEAGSGEPLVLIHG
FT                   VGMRLEAWAPQIAFLSAGHRVIAVDMPGHGESAKLPAGSRLEEFVDWFGRFLDEMAIDT
FT                   ANVAGHSMGALVSGGAAVTFGERISRVAYLNGVYRRDPEAKAAVLARAAAIPVSGVDKE
FT                   GPLARWFGDDADSVTARELTRKWLNLVDPQGYAVAYAAFAGGDETYANGWKDVAGPALF
FT                   LTGSDDPNSTPLMATQMAELAPQGYARIVEGHRHMVNLTAPDIVNSLLAEWLSFGEDER
FT                   "
FT   gene            complement(266512..267114)
FT                   /locus_tag="Rleg_6550"
FT   CDS_pept        complement(266512..267114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6550"
FT                   /product="protein of unknown function DUF1185"
FT                   /note="PFAM: protein of unknown function DUF1185; KEGG:
FT                   ret:RHE_PC00022 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6550"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61292"
FT                   /db_xref="InterPro:IPR009569"
FT                   /db_xref="InterPro:IPR035936"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB34"
FT                   /inference="protein motif:PFAM:PF06684"
FT                   /protein_id="ACS61292.1"
FT                   /translation="MAIQIRKTGLQIETTLIEGGKAAAVPLKLFTAFAVVKNPWAGRGF
FT                   VDDLKPEIHAGAPVLGELLTKMIIDAVGSGEAVEGYGKSAVVGLDGEIEHGSALIHTLR
FT                   FGNFYRQAVGAKSYLAFCNTRGPANAPIMIPLMDKNDEGRRSHYLTIQTSIPDAPAADE
FT                   IVVALGASIGGRPHHRIGDRYQDLKDLGQDVANPAGV"
FT   gene            complement(267525..268217)
FT                   /locus_tag="Rleg_6551"
FT   CDS_pept        complement(267525..268217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6551"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: GntR domain protein; regulatory protein GntR
FT                   HTH; SMART: regulatory protein GntR HTH; KEGG:
FT                   ret:RHE_PC00021 GntR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6551"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61293"
FT                   /db_xref="GOA:C6BB35"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB35"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ACS61293.1"
FT                   /translation="MSGALKDAIRVERPAKTLRELALDKVREAIVNGYFRPGDRLVERD
FT                   LCAQLGVSRTVVREVLRHLESEGLVANLPNKGPIVAQLDIGEAKQIYEIRGALEGMAAR
FT                   LCAERRSPEIVAALEESLAGIRNSYRDNDMAAVLTNTSSFYHTLFTMVDRNVAWGVVNL
FT                   LTVRINHLRSMTIKTERRGIEGPLQMSKIVDAIRRGDGEGAYRAAMDHVAAASAIAEAV
FT                   LSGKKPAD"
FT   gene            complement(268420..269781)
FT                   /locus_tag="Rleg_6552"
FT   CDS_pept        complement(268420..269781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6552"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_PC00020 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6552"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61294"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038732"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB36"
FT                   /inference="similar to AA sequence:KEGG:RHE_PC00020"
FT                   /protein_id="ACS61294.1"
FT                   /translation="MYLAYDVIVVGSGFSAIAVTCNLIEQLPASAKVAVVGDDPGFGRG
FT                   TAYRTELYLHRLNVPAGRMSLLPHQPDDFVDWLKSHGRPLQAGDFASRSDYGLYVRDTL
FT                   ARLLRKRDGRCRVDFIKAKAAGCIERYSSTLAFHLGNGDEIAGKTVVLCLGVGNATLPV
FT                   APDGIPPSLRSRIIENPWRLSWLRRVAPSDAVCILGSGLTMIDQVLALRAHGHRGRIDV
FT                   LSRRGLAPLGHARKPPAPLPIDVEKLPDTISGILKTLRGKSRTVADWRAVMDGLRPATQ
FT                   ALWQRLSSKERARFLRHALPWWNIHRHRVAPDVFDRFETLVLDGTVRFHAGFLKSLGAE
FT                   EGRLVAGYRVRAAREIAEIRADWLVNCTGMERAGISHSPLLKEMSRFELIAPDPLGLGL
FT                   QVDSASEVIAPSRISPARLFAVGALTAGQFWEITAVPDIRVQAKAVVEEIVSRG"
FT   gene            270046..270327
FT                   /locus_tag="Rleg_6553"
FT   CDS_pept        270046..270327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6553"
FT                   /product="prevent-host-death family protein"
FT                   /note="TIGRFAM: prevent-host-death family protein; PFAM:
FT                   protein of unknown function DUF172; KEGG: ret:RHE_PC00002
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6553"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61295"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB37"
FT                   /inference="protein motif:TFAM:TIGR01552"
FT                   /protein_id="ACS61295.1"
FT                   /translation="MKLSEQVKPISYLKAHAPEVIRKLKDNPQPVVITLHGEAKAILQD
FT                   IGQYEETQETLALLKVLALTNRQVEEGKLRPAAESFARIRNRLADSQP"
FT   gene            complement(270725..271570)
FT                   /locus_tag="Rleg_6554"
FT   CDS_pept        complement(270725..271570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6554"
FT                   /product="Domain of unknown function DUF1814"
FT                   /note="PFAM: Domain of unknown function DUF1814; KEGG:
FT                   bja:bll1927 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6554"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61296"
FT                   /db_xref="InterPro:IPR014942"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB38"
FT                   /inference="protein motif:PFAM:PF08843"
FT                   /protein_id="ACS61296.1"
FT                   /translation="MARELKKNVGASVRARLLDRSRAERTDFQILLTRYALERLLYRLS
FT                   LSEHRDRFILKGAMLFVTWIADPFRPTRDLDLLGYGENSPKAIAETFHAICTQPVDADG
FT                   VVFDVDALAAAPIREEVEYGGVRVRTTATIGGARIPIQVDIGFGDAVTPGPVDIEYPSL
FT                   LDAPVPRLRAYPVGTVVAEKFEALVSLGMANSRLKDFYDLWLIAETFELERSTLAEAVR
FT                   QTFARRGTGIPTEGPTGLSEAYAEVWIGNGGRSLVANGWRPHHPPWARWSLISDASYCR
FT                   "
FT   gene            complement(271560..272180)
FT                   /locus_tag="Rleg_6555"
FT   CDS_pept        complement(271560..272180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6555"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:bll1928 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6555"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61297"
FT                   /db_xref="InterPro:IPR025159"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB39"
FT                   /inference="similar to AA sequence:KEGG:bll1928"
FT                   /protein_id="ACS61297.1"
FT                   /translation="MTFTTAQRLRALDLLKARGMLRLKDFVAEGIGPETLARLVREEAV
FT                   VRPARGLYQLPDTQAEAAHALAEAAVLVPKGVVCLTSALQYHELTLQMPSAVWMAIDRT
FT                   AWRPKIDYPPIKFVRFKGSALTEGVERHRIEGVEVPITNPARSIVDCFRYRAKVGLDVA
FT                   MEGLREGLRRRKTTSDDLWTYAKEARIWSIMRPYVEATVADGA"
FT   gene            272273..272538
FT                   /pseudo
FT                   /locus_tag="Rleg_6556"
FT   gene            complement(272541..275828)
FT                   /locus_tag="Rleg_6557"
FT   CDS_pept        complement(272541..275828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6557"
FT                   /product="Ti-type conjugative transfer relaxase TraA"
FT                   /note="TIGRFAM: Ti-type conjugative transfer relaxase TraA;
FT                   PFAM: MobA/MobL protein; KEGG: traA; Ti-type conjugative
FT                   transfer relaxase TraA"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6557"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61298"
FT                   /db_xref="GOA:C6BB40"
FT                   /db_xref="InterPro:IPR005053"
FT                   /db_xref="InterPro:IPR014136"
FT                   /db_xref="InterPro:IPR027351"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB40"
FT                   /inference="protein motif:TFAM:TIGR02768"
FT                   /protein_id="ACS61298.1"
FT                   /translation="MAIYHLSMKPIARSGGRSAVASAAYRAAERLTNERDGLTHDFSNR
FT                   TGVEHAEIVLPAGSSAYWAMKRSALWNAAERAEKRSDARIAREFEIALPHELTPDQRLV
FT                   LTRAFAEDLANRYGAAVDFAIHRPGEGSDIRNSHAHLMMTTREVRETGLGDKTLLEREN
FT                   RWLLANHLPPSQLQLKDLRQAWEHLANEHLERAGHDIRIDHRSHLEAGITIEPSEHVGV
FT                   HATQIDRQGGAVSRVRISPQSADRNAEIVRRRPEEILKLITNEKSVFSRYDIARALHRT
FT                   INDDPQTFQNAFASVMASKALVELRPDSSSVRGRDGEARYSTVEMVAIEGAMATATVAM
FT                   KARQNHGVAKRYVDAAIADQDRSIQAGNPSPGQGLSAEQRQAIEHVTGASQIAVVIGFA
FT                   GAGKSTMLAAARHAWEAQGYRVHGAALAGKAAEGLEQSSGISSRTLASWEYSWQADRGR
FT                   LNARDVFVIDEGGMVGSRQLARFVDEVKRAGAKLVLVGDHEQLQAIGAGAPFRAIAEAV
FT                   GHAQLSEVRRQKADWQKQASIDFASHRTAAGLSAYEARGSVHLKTDRAETLKVIIADYV
FT                   ADRSANPNDTRIAMAHRRDDVRAINAGIRARLQERGELSRSTGTSDDRGEELTYQTNNG
FT                   KRSFARGDRIVFLENDRDLAVKNGMLGEVIAVAPDAIQVRLDGKAQTQDGQRQVTVPVN
FT                   RYQSFDHGYATTIHKTQGATVDRSFVLASTTMDRHLTYVAMTRHREEVQLYASLDAFKT
FT                   VRSLTETLSRSGVKETTLDYTHDFANRRGMNDRRGQGESEVASQGISKGIQPIPDTAVP
FT                   KPMQEPRPLAARTIADGGSSHQDPNVDERDDERRVLVAAVKTYAMSVEAVGRAKAMPAF
FT                   ERDWAAAKQLAPQVFKDAPAAMDVLRGRILDENADPVALANQISTSPETIGALAGKTGL
FT                   FGDNAERKHALSRIDALASHVRQSANTWQRRLAAECGSERWKREKQDVVEVLGPSRRSE
FT                   ALLRNLDDLPYSDKAKFVERLAATSEGRQALAEAKDIVSAIETRFGRADPSDLADQLKR
FT                   VGPDRAGDVERIREVARLADRSHRAELTQQMELKRSLSRTKSLGLGM"
FT   gene            276115..276426
FT                   /locus_tag="Rleg_6558"
FT   CDS_pept        276115..276426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6558"
FT                   /product="mobilization protein C"
FT                   /note="KEGG: mobilization protein C"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6558"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61299"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB41"
FT                   /inference="similar to AA sequence:KEGG:Arad_15021"
FT                   /protein_id="ACS61299.1"
FT                   /translation="MARKTIGERLAQLEAQRKTLQIRLGKQERAIDTRRKVLIGALVLH
FT                   RLEHDRDVHFAGGIAEWLRRELPKFLTRDGDRDLFDDLLKPQANEPTIGDIGNGSATS"
FT   gene            276423..278108
FT                   /locus_tag="Rleg_6559"
FT   CDS_pept        276423..278108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6559"
FT                   /product="TRAG family protein"
FT                   /note="PFAM: TRAG family protein; KEGG: traG; Ti-type
FT                   conjugative transfer system protein TraG ; K03205 type IV
FT                   secretion system protein VirD4"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6559"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61300"
FT                   /db_xref="GOA:C6BB42"
FT                   /db_xref="InterPro:IPR003688"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB42"
FT                   /inference="protein motif:PFAM:PF02534"
FT                   /protein_id="ACS61300.1"
FT                   /translation="MIHASQIKSAFANMMRMAVRDPLWAIVAFITFPLRYARSFLKGAV
FT                   GYVIVIVTVYFGIDYLRRVMLGGHRGDVIWHIGDWVFMLFAVVLLIRFLSEPLITHFST
FT                   ASDADTHGTARFGGTREIAPLTKAEGGLLIGRANNSGRLLRYGGPAHLLTMAPTRSGKG
FT                   VGTIIPNLLTADRSIICIDPKGENAQIAGDARQKFGPVHILDPFGITGKPSAAFNPMNG
FT                   FNPAGIDVAEDVSTLADALVFDEPGLSGDAHWNEEAKALIAGLLLHVLASQPDDRRTLT
FT                   MLRHFLTLAPEAFRAVLDEMQASDAVNGLIARAANRHLGKSDREASGVLSAAQRHTHFL
FT                   DSPRMTAVLSRSDFRFSDLKANKATVFLVLPPDRLAAYSRWLRLLVAQSLTEMARTAPS
FT                   PQPSAPPVLYLLDEFAALGHLAPIERAMGLMAGYGVQLWPIVQDIHQLRATYGQRAGTF
FT                   LSNAGVLQVFGVNDHDSARLVSDLLGQETVVFNTAARALDSERTGLSFAEQHVGRPLLT
FT                   PDEVRNMHAETELLFIAGQRPIAAVKLRYYADPEFAGLFTASQI"
FT   gene            278200..278445
FT                   /locus_tag="Rleg_6560"
FT   CDS_pept        278200..278445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6560"
FT                   /product="WGR domain protein"
FT                   /note="PFAM: WGR domain protein; SMART: WGR domain protein;
FT                   KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6560"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61301"
FT                   /db_xref="InterPro:IPR008893"
FT                   /db_xref="InterPro:IPR036930"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB43"
FT                   /inference="protein motif:PFAM:PF05406"
FT                   /protein_id="ACS61301.1"
FT                   /translation="MTAQPYRLYIERIDPSKNMARFYALSIEPNLFGETSLVRSWGRIG
FT                   SRGQQKIHVFDSEAKAVDLLLSLLRRKRSRGYRVLQ"
FT   gene            complement(278509..279429)
FT                   /locus_tag="Rleg_6561"
FT   CDS_pept        complement(278509..279429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6561"
FT                   /product="domain of unknown function DUF1738"
FT                   /note="PFAM: domain of unknown function DUF1738; KEGG:
FT                   rec:RHECIAT_PB0000154 probable DNA conjugal transfer
FT                   antirestriction protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6561"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61302"
FT                   /db_xref="InterPro:IPR013610"
FT                   /db_xref="InterPro:IPR017113"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB44"
FT                   /inference="protein motif:PFAM:PF08401"
FT                   /protein_id="ACS61302.1"
FT                   /translation="MSRQQSNQRSDIYSRITNTIIADLERGVRPWTKPWTTGHATSEVS
FT                   RPLRHNGQPYTGINVLLLWSEAIARGFASSRWMTFRQAIELGGAVRKGETGTTVVFASS
FT                   FIRTETTETGTEIEQDVPFLKTYTVFNTDQIAGLNGRLDEMAPHQDPMSRIGNAGRFFA
FT                   NTGALIRHGGSAAYYAPQRDYIQMPCLDAFRDDASYVAILSHEMTHWTAAPRRLDRDLS
FT                   RYAKDRSERAREELIAELGSAFLCADLGIVPELEPRPDHARYLDGWLKVLANDKRAIFS
FT                   AAAHAQRAVDYLHSLQPELDEEAAA"
FT   gene            complement(279696..280586)
FT                   /locus_tag="Rleg_6562"
FT   CDS_pept        complement(279696..280586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6562"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: ppu:PP_4467 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6562"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61303"
FT                   /db_xref="GOA:C6BB45"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB45"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACS61303.1"
FT                   /translation="MELRQLSYFVAVAEELHFGRAAAKVRIAQPALSNHVQALERELGC
FT                   ALFIRSTRRVELTRAGEIFHERCVGILSEVDLSAEITRAVAGKTIRQIRIGTVYPATTG
FT                   VLPAFLAKIARKYPDIRIHISSGNTGDIIRGLENGQINLGFIRPVENIGSLRFASIAHE
FT                   RYLLAVARTNRLAEQAEIAIDDLRSEKIIAFNRKNLSYTERYFNEKFEEYDLTRNIAYS
FT                   CDDTYSLVSLVSAGLGIGFAPEWTEGLPNRAFELKAVRGIDFRIGLGVAWNKEDPTASR
FT                   DDIVDIARSLARPAR"
FT   gene            280692..280910
FT                   /locus_tag="Rleg_6563"
FT   CDS_pept        280692..280910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6563"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: rpa:RPA2243 XRE
FT                   family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6563"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61304"
FT                   /db_xref="GOA:C6BB46"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB46"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACS61304.1"
FT                   /translation="MEIRETFARNLRTLRQARKMSQEELAHRSSVDRTYISSLERCVYS
FT                   PSIEVLDRLAAVLGVEPADLLRKLGKE"
FT   gene            complement(281415..281915)
FT                   /locus_tag="Rleg_6564"
FT   CDS_pept        complement(281415..281915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6564"
FT                   /product="Ankyrin"
FT                   /note="PFAM: Ankyrin; SMART: Ankyrin; KEGG: similar to
FT                   ankyrin 2,3/unc44"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6564"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61305"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB47"
FT                   /inference="protein motif:PFAM:PF00023"
FT                   /protein_id="ACS61305.1"
FT                   /translation="MNDQSKIEHFIERIVASASQAQLEIESKELDLNKVGIHGRTPLMV
FT                   SAAEGLLAAVETLVRNGASVHAIGHGELTALHEASANGEAAVANFLLSLGADVNAETAD
FT                   GVTPLMCAAAWGNTEVAKLLLENHADLTKTDRTGATAADIAREKGEDDAADLINSYLPR
FT                   GSA"
FT   gene            complement(281912..282202)
FT                   /locus_tag="Rleg_6565"
FT   CDS_pept        complement(281912..282202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6565"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6565"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61306"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB48"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS61306.1"
FT                   /translation="MEARLGVDVKPAADGLIHPLAKNGKAQGLSLNLDPKDLFIQKYGG
FT                   AFPVNSLPEGLQALQSGKTGHFVVAPATPMTFETYQGLLNRIELGNFNVLP"
FT   gene            282333..282401
FT                   /pseudo
FT                   /locus_tag="Rleg_6566"
FT   gene            complement(282424..283965)
FT                   /locus_tag="Rleg_6567"
FT   CDS_pept        complement(282424..283965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6567"
FT                   /product="Peptidase M15A"
FT                   /note="PFAM: Peptidase M15A; protein of unknown function
FT                   DUF882; KEGG: ccs:CCNA_00583 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6567"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61307"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR013230"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB49"
FT                   /inference="protein motif:PFAM:PF08291"
FT                   /protein_id="ACS61307.1"
FT                   /translation="MATDASIVATQLWNEFLTAESEADREAIRPAAIEAVEGALDEEIT
FT                   EFRQGTFKILALSTKLSQAIENIGSASAKERLVAIQERLSEIASAVHDKEGMRTTWQTN
FT                   EEFEEVFDDEKDVPPATDFDVIPVGAPVNGDLSTVVLSTSRQFGDLADEYITLFRKARY
FT                   RDAAAEKAAKDFAKTAFGNKSRYQEVGQQLRIPWWFIAGVHLLEASFNFSTHLHNGDRL
FT                   TARTFRVPAGRPKNGTPPFTWEQSAIDALKFEDLDNLQDWSLARALYRWEAFNGFGYRS
FT                   RRIATPYLWSFSNNYSKGKYIGDGVFSPTAVSKQCGAAAFLKALVGLGHVSLEIGITTE
FT                   GDGEATESDPASAEEVVDQDKPNIDGVISGNVDFKTFFDTNLPDVKHFQWHEFLVKGSR
FT                   NATSGLNTDPPMALWSNILQVARILDRFREEIGHSVVLTSVYRSPAYNATLPGAAKSSQ
FT                   HMQFKAVDFKVVGAGTPRDWAKIIRSYRSQKMFEGGVGVYDTFVHVDTRGHNVDW"
FT   gene            complement(283987..284895)
FT                   /locus_tag="Rleg_6568"
FT   CDS_pept        complement(283987..284895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6568"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6568"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61308"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB50"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS61308.1"
FT                   /translation="MQDFMRMQWYLRPHFVRVRLFCALLSLIALAACATRIQPEDLKSL
FT                   NTSFAEAQKAGDLLYDETAKVIASRAKQGKDSCGTDAAGVPTCFNPQAIGGGRNEDPSV
FT                   AVRRLALQLLTEYSLALVELSEGKSADELKSSINDIAAAASGIVAIAGVTTGVLPAVFG
FT                   GPIVSSLSDLAGDLERARSAEAIRRSLLQQRETIAQLIDALIADTPQMYKIYYLSQQLA
FT                   VLKASGAEITAMRQNTTAYHDSLAAYVALLRQAKVTHTRLATVARTPSNTPADFRMMVE
FT                   EAANIQAKADTFWDAVRKLRN"
FT   sig_peptide     complement(284791..284895)
FT                   /locus_tag="Rleg_6568"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.916) with cleavage site probability 0.718 at
FT                   residue 35"
FT   gene            complement(284968..286371)
FT                   /locus_tag="Rleg_6569"
FT   CDS_pept        complement(284968..286371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6569"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6569"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61309"
FT                   /db_xref="GOA:C6BB51"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB51"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS61309.1"
FT                   /translation="MSDIDANANETANAELRSTANSQPEPRPIPHGMEYVALIAGLLIA
FT                   GFGFYYITLSPSYWQLAALAVCIGFGIILVAFGTHVHGSYRGWTVVGAGAMAVVLYLVL
FT                   AFVPLKTVRPYVLITLDSSSEMQSVAASASRSILVGRPTGSESFRMVAFPGDLNTKFIN
FT                   ILFVNKPGKSPQEFYIRCVDTEPMRKALEHGEEMTFQLQQLDDTQEYVLIDGRTGQQVG
FT                   THTPLCHDDKAPQGVASVSDRLLRAVLSPASAAGLNSDIDSYLSGLPSETSETRDWARK
FT                   SLSQLSSQDDWDHVASTWSISEADYRQDLGRLVAWVTAVSNDRANAVRIVESLSPEQMK
FT                   YIVELTGSNDSTMRNWSTEFLSWALQATGWPSGSPDRAGDWAVAFVDALSKNSLPPQPL
FT                   ANGFRIDRRVNNAIVAIGFAGCNPENSLRNLLREQVTAISKSADYVFPDGINVQKKAQD
FT                   TLNDLMLCK"
FT   gene            complement(286806..287771)
FT                   /locus_tag="Rleg_6570"
FT   CDS_pept        complement(286806..287771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6570"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61310"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB52"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS61310.1"
FT                   /translation="MNAADLVNDDPSQVLDENSDLFLMQKIFNATSSSRRVFSEVHFHD
FT                   PEDPNLTIGMGHWIGGNIADLFHRLNEDAQVWKTLTEIWSAALSEDAWRQFHNETGISE
FT                   RGASGLSAGLESTLCVSHPIKTCVENNLLRWASRVREGFNDEKHWFTAGWKQISRSESV
FT                   AATQLAFWADGVLVQGVDGAHARGIHTRGGVASVISACSSGLGSTMFGIGVTETKASNG
FT                   GISRRWSLTEVPDSARPIGRSNLSDQRLLEDWRALVAWQYYAISKGKIRDRMKAIWKAY
FT                   YEGSWGGLNEGSLAAATDIPRHLGRAMNDAPFDFSVIFRS"
FT   gene            complement(288555..290456)
FT                   /locus_tag="Rleg_6571"
FT   CDS_pept        complement(288555..290456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6571"
FT                   /product="peptidase C14 caspase catalytic subunit p20"
FT                   /note="PFAM: peptidase C14 caspase catalytic subunit p20;
FT                   KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6571"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61311"
FT                   /db_xref="InterPro:IPR029030"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB53"
FT                   /inference="protein motif:PFAM:PF00656"
FT                   /protein_id="ACS61311.1"
FT                   /translation="MRPVAAFVLCFVLFSLPASAEQRPGLHALLVGVGTYQNSNGGSFR
FT                   NLRGPANDVPALESVLRDRYGLMPANTETLIDQAAKRQAVVDGLQKLLSDAAIGDVVLF
FT                   YFSGHGSRQFDKSMDETSQLDDTILPYDARDKDGKIPDIIDDELSSFVAKALDRGLKPV
FT                   VILDSCHSGTGTRLWAQARTVPALNEPAAGWSSNKSQASQHNIFTGDSILLAAAQDDEE
FT                   ALESDRDGVVRGEFSRALVRVLETAEEDVTYLDVLTRVRVTLNSQGVPHNPQGEGGLSQ
FT                   KFLGAGPLGKLPVRAEPEGAQRVKLFAGAVSGVTQGSQFALFTTAAEAGRGFPVLTDGV
FT                   VTAVHPASAEIDLKKDVILPARLFAMEQAHSFGDLRLRVALSGGDEVKRGQVKDVIEKL
FT                   SFVEIVPDRDATQWLDVSDKGVRLKRLDGSAVGPVRPLSAFTEGQGALLLGRLARYQAL
FT                   LSLSNPENPNAPVRARVLLATKGSDKVSNPKMQDGEAVIKPRQSFVLGLYNGSVSPKHA
FT                   YVLNLDADYCVRLLMPPPSGSDEPLLGSVRTKLLRAPDRAGREYFLIISTDRPIAPEAL
FT                   EQDCLTDETLRQGLATKLGDPLAQLLANAASTQRGPTPELSVKGWSTSFVSLVVRED"
FT   sig_peptide     complement(290394..290456)
FT                   /locus_tag="Rleg_6571"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 21"
FT   gene            complement(290453..293941)
FT                   /locus_tag="Rleg_6572"
FT   CDS_pept        complement(290453..293941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6572"
FT                   /product="peptidase C14 caspase catalytic subunit p20"
FT                   /note="PFAM: peptidase C14 caspase catalytic subunit p20;
FT                   SMART: WD-40 repeat protein; KEGG: mgm:Mmc1_3477 peptidase
FT                   C14, caspase catalytic subunit P20"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6572"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61312"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR029030"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB54"
FT                   /inference="protein motif:PFAM:PF00656"
FT                   /protein_id="ACS61312.1"
FT                   /translation="MKQQTGLCVFLLIVLLLGLFLRPGLAADDRPLAYLPISHLKQIVG
FT                   AGRIAGTGLIVTAGTDGRVKTWEAATGLLISEYVTPGAMAVAGLAVDPSNSENVAIAVI
FT                   NDNSAYATLVGGDADIQILDLSNNRIVRSFRGQAGRLVFSPHGRWLTSAAYSLLSIWDA
FT                   ETGTLEATIEIQDGSMQAAFADDDTLVFRRNGAVVLLNLLTGQTRSFASSAKGVLAVSQ
FT                   DRKLLAEVGDREVVVRQLPDGTVVGSQPLMNSPEFIYFAEDGAVVAGGHFSSTFVGQNM
FT                   IYRLNPGDWTLKTYTAGHSPLTLMADGGDSALLGQANGRIQRVDFKAPVRLDDLGQEAD
FT                   AITALGFSATGRYLAAGLEGGGALIWEPTSNFYRVLDPLNVVTTPPELGFSDVEQQKHV
FT                   SATYRTGEGQTKSPEINKDGIVGLAFVGTEALMLVHKSGKAEIVNVTTGTVLRSFSVDS
FT                   PNAVVSSGSVAVIHSYHNITVVMAETFETRQIALGNVSAISVAIKPQGDHVVVRGFEGT
FT                   ADVDLMTGIITPLSTKTEGVPVFRAGGDMATLSWSSPISVTPPEGAGGNNDLVAWRRDL
FT                   SLGVLAQRTGAVRIWSGEQSTPLEFYAGGAISSIAVSPDGVTVAIGSNNGRIAFHRISD
FT                   GHAKGELLGADRRGWLVKSSDGYFDGSYAAWANIRGTRASTRLSAEEPSVLFDTWFRPQ
FT                   LLSLIIADGAVDAAAPRSPALSARPPSVQIISPVSNYLRDAAPPMSTTSSLVSDERVDA
FT                   SGKQITWEVIAPNRQNSQVIGQKIGEDANVDLVSEVADLGDGVQECRVFRNRRLVASSR
FT                   PILNAGKAQFSSKIPLSDGDNVLSVYCFSNSGLRSQEAELHIYGSDSLRRDRTAFVVVV
FT                   GIDSYQEGYKLRYAKADARLAAAKLEATLKSTGNYTRIVPVSLLDEQATASTILSGLQI
FT                   LAGSREPVASGPLSGLLASTPSDAVFFFFAGHGGGFAGDYRLIASDGLVGSDKTEGTVS
FT                   ASALRDVLTPLKADRTVLIIDACESGQTLDKLDKRAGPLAGRSLAQLAYDKAMFLISAS
FT                   QSRQSARELQRLGHGLFSYVLFEPGLGPQADDNKDGYVTIGEWLSFAQIQSPKEQDQER
FT                   EMASMPVPAITYEEDAKRSTFFDEVENVAQTPRLFIPDPVLAREFVIVKTQGTQP"
FT   sig_peptide     complement(293861..293941)
FT                   /locus_tag="Rleg_6572"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.899 at
FT                   residue 27"
FT   gene            complement(293938..294492)
FT                   /locus_tag="Rleg_6573"
FT   CDS_pept        complement(293938..294492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_6573"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_6573"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61313"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB55"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS61313.1"
FT                   /translation="MAYGRFGAEVRSAGRRLVVLEGRSGRVYLFDLQSPENDPLQLVET
FT                   GAQSVAMTDTQVFVGGDGAIRVFDVAKPLSPVEVIFTPPAMRTFSGQIAVEDDLLVWTN
FT                   GGLSLGDAGPTGPGRIEVFRRAGGAWRWQARLASDQTDGEDASGQSCCVEIDQGQIVVS
FT                   TADGARRFAFQGGRWIEERLP"
XX
SQ   Sequence 294782 BP; 58531 A; 89173 C; 88789 G; 58289 T; 0 other;
     ctctgagatg tgctcgcata agagcaatta agcgccgata cttgcggttt ggcaatatat        60
     cgcgcttgcg attgaatcaa ttttaagctg ttattgcgcg agtggcggcg gggagaaagc       120
     tatgagggct acaggtcgat acggactggc aattgctttg ttagcatggg ttatcgggat       180
     tgcgtcaccc ccggcggtcg cggctccgaa catcgtctcc gggttggagg ttggcttagg       240
     ggattgtgtc accgccgacg ttcccggcgg gaggggcctc cttgatgctg tcgccagctc       300
     ggccatttca gccggcatca atctcctcgg caacgctctt gctgaagcgg gcaaagacga       360
     gacgcggaag gcgatgggat cacgcaatct cggcggcgga atgacgcctt tcccgcagtg       420
     cattcaaatc gttctaggca gatttcgcac cgacgcggct agcaccggtt caaattggct       480
     ggaatcgatc aataaaggcg gggatgccaa gctcgctgca aacggcatct ggctggctga       540
     taagcccgac ttctttctcg aagccatgat tgtcccaagc gaagatcgtg cagctgtcgc       600
     gatacgtcct cttctggccg cgatgaacga gccgcaggaa agcagttttt tcggaaccaa       660
     gacgcgcagc gtcgtcgcac ttttcgcttt ttccaagccc ggcgaaagcc caagcttgga       720
     gaccaatcct tcggcggcga tcgagatcgg tgcaatggag cccggcgaca tcattcgcta       780
     tcctgtcggc acccccggca aaccgtcgac accttatgaa tccgcttggt ttactctttc       840
     ggatgcggat gcgcgaggcc cgatgacgct caccgcggtg atatcggaga ccaaagcagg       900
     caaccccctc ttgtcctttc tggggaccgt tctcaatgac gaggcggtga agagtgcagc       960
     gtccgataac gccaaggtca tgctgctccc ggcagcccga caacaggcga acacggcggc      1020
     tgccatagaa agccagaatg cagctgccga tcagatcgac acaagctttg ccgatgcggt      1080
     gacaaaactg gaattatgtc atggagccgg cgccgatctc aacaaggccg cagaggcacg      1140
     tgctgccctt cgcgcatatc ttgcggcaag cgctgccatg ccggcccatc cggccaagat      1200
     cgatggcgcg gcgatcgata ttctcgatct cacctctccc gagacgattg cgcagagctg      1260
     cagccaacta tttgagcgtc tgacgggcaa ggtgctgtaa gtgcgtggac ctgtgacaca      1320
     cgaggatggc ggcctgccct gaagtgcgcc taagcaacgc cggcgaccgt caggccatac      1380
     gcccaggggt cgtcattccg ccccggattg cctaccggta atagcgcaat ctctggtagt      1440
     gattgcgaag caaaagaatt tctgccgcct tgagttggtt attgtgggga gcgagatgat      1500
     tgacgaaaag gattgggtcg ccaaatgggc ctaggacgcc gaaagcctga tcaacctgat      1560
     gcctgcctac cagatgaacc ccgacccaga tcgggccgat cgtccgcaac accgcctacg      1620
     gaaagaagca actggtccat gcgcgctggg gactgccctc gccgcgcttc gcacttgaga      1680
     aggcggccaa agccaaggcc gagaaacttg cggcgaaagg caagccattc gatctcgaag      1740
     agctgatccg tatggaggcc gaccgcggca cgaccaacgt gcgcaagctt aattttccac      1800
     actggaaacg atggttcggc gtcgaaagcc gaagcctcgt cccggtcacc agtttcgcgg      1860
     aaccggatcc ggccagccag gagcaaggcg gcaacgtgcc gaacgcctgg ttcgctcgcg      1920
     acgaaggtaa gccgctgatg ttcttttgcc ggcatccacg tgccgcagtg gcagagtgtc      1980
     cgaaaggtca gggacggtct gaccaccgac gatctctatg ggtttctgac tacggatccc      2040
     aacgacctga tgaaacccat ccatgaaaag gccatgccgg ttctgttgct gacgaaggaa      2100
     gagaccgaaa tctggatgcg ggcgccctgg caagaggcca aggaactggc ccgtccgtta      2160
     ccgaatgacg cgctgatcat ttcatcacgc gaaccgtacg gatcgacggt tgtctcgaaa      2220
     tccggagagc tggtggaaca gggcagtcta ctttgacgcc tgaattcggg acttgaatcg      2280
     gaaaacgaaa aagcctgccg cgggaggagg tgcggcaggc ttctcgaaat attgaacaac      2340
     ggctgggagg aggagcgccg ctgttccgtc aggcgccccc cgggaggagg aatgggtcgc      2400
     ctgagacacg aagctctgcg ggaggaggtg cattgcttcg ttgaggtgaa gatatcagag      2460
     gctgcctcga cggccagcgc tcagatcgca gtgcagccat gcacttgctg caatgcaata      2520
     tagatcctgt gctcattttt ccgccattat ggtcgagacg cggctttcgc tgtactgggc      2580
     acgaaaccga gaacgaattc gatcacctta gcggaggaca tttcgcacgg ctttagtatc      2640
     ggcccaggtc cagccaatcg ataaaggttg aagctgacga tatcggttcc gctaagctcc      2700
     tcgccataga gccagatccg tttgccatcc tccgaccgct taacggtcac gccccatggt      2760
     cgattaccaa aatgtccgtc gatatcaccg tccggcaatt tcgcaagcgc gtcttcgaac      2820
     gtcgcctgga ttgatggaag tgttttgccg ccggcggtca tggtgccagg cattcgtcgc      2880
     agatcccgca gccatcgtca tccatgctca aggccggacg taatcttcga cagcacggac      2940
     atgtcgttgc atccgacgca cacgtgtcat cgcggtccgg cggaagaatt tcaatataga      3000
     attccgacag catatcggcc gcgcttcgat ccatggcgat gctccagttc ggggtaaact      3060
     agagatagtg agcctcgatg gttgcacaag ccggcaagag atcgcagtcg gagacgatcc      3120
     aattgcgtcc acgttgcgcg ctgctatgtt gagagagaat ggcaggaatc acggcgagac      3180
     cgggtggcag cgacggaaca cgtcacgcga agccgccatc gataagcgag acgacgatgg      3240
     ctgatttttc ccacaagacg gatatcgaga tcgatcagtg gatcaggaac tttgagaaac      3300
     gctgccagac cgaagcccca ttgtatctcg aattgctcga agaacggggc catcgcgctg      3360
     gaaggcgggc aggccttgat cttgagaagt cacttgcagc cctgaagcgg gcggccatct      3420
     ccggaacctg cataagctac ggagatttgg caaaagcgag cggtgtcgag tggagcaagg      3480
     cgcgacatca gctgaacgga aagaatggac acctcgaccg gcttctagaa atctgccacg      3540
     cccgcaaact gccattgctg acggccatct gcgtgaatca aggcagctta caagagggcg      3600
     agctggagga gaatgcgttg aaaggctttt ccgaaggtgc gcggcgtatt ggtaggtcct      3660
     tcagcgacga cctagatttc catctcgcct gcagagagga gtgctggaac tggggccgaa      3720
     tgcagttggg gtagcgaagt tccatctctt cgtcaggagc aggggaccga tcaaagaatc      3780
     ttcagaacag gaacgctgac gcatgcaatt gtctcggctc gagctttaca agcgcgtaag      3840
     tgccaggcct ttaagcaagc ttgccgcgga attgggtacg accgggaccg ccttagctgc      3900
     ggtgtgcaag aagtatcagg tcccctatcc tggttccgga tactggacgc gaaaatcctt      3960
     aggtctccca gttgagctac ccgcattgcc ggaagcgcct gatgaagtga tcgagatcac      4020
     gccggcgatc tcgaagcccc ggcgaccgag aacacccaag gatcaaccct cgaaggacag      4080
     ggccccaaaa aaagcccgcc ggatggaaca tcatccactt ctttttggcg tcgaggggca      4140
     tttgcgtaag tcgagggagg taaaagacgg tgagttcctg cgtccttaca agcggctcct      4200
     ccccgacttg atttcgtcgg aagtcgcact gccaaggaca cttcgtatcg cgaacgccct      4260
     ttacctcgcg ctggatgagc ggggttatcg cattcacatc gccccgcaaa gcgatgacat      4320
     tggtcggatt ctcgtgtccg aacaggaagt tgagctcaag gaccggaagt atggacgcta      4380
     ttattcaagc gggatctggg gacctgaccg agcgaccatc ttttacatcg acagcgtgcc      4440
     tataggcctg gccatcacgg aaatgactga aagggtgacg atgcgataca tcaacggcga      4500
     ttattatcgg gaggacagca agctcgtccg gtcaatgaaa ccgtggcaga tgacgcattc      4560
     ctggacgacg gagcaggaca tgccctccgg ccgcctgagg ataatcgcct actctgcaaa      4620
     gaagggtgtc gagtggtcgg ccagatggca ggatgcgcaa gagcagcccc ttgaaaaggc      4680
     catgtcaacg atcgtcgaga cattgctggc ttcgcacgat gacattttgc agctgatgat      4740
     cgccgaagat gcagccgaag ccaggagaaa gaaagagcgg gcggaggaat gggagcgcta      4800
     cgagcgacga gaggacgctc gaaaggtcgc gcaggctctc tcagacagcc ggcagcagct      4860
     tgccgaaacc atcgagaaat gggcaaaggc gatggcagta gaacgcttct tcgctgacgc      4920
     cgaggagcgt ttgaataaac tcgacaacga gcgtcgccaa cgcctcgaag agcggctgga      4980
     gcttgcgagg gccatgatgg gcagcatcga tcccctggac ttcattgaaa attggaaggc      5040
     acctgatgag agataccgat caaagtatcg ggaagattag agcgcaggca aagagacgct      5100
     cgcccactgc tagctacagg gtttaccact cttccgccga ggccaagcct agtctcgaac      5160
     aaaacgatgg aaggcattgg agctttcagc aacgcgcgca aaagcgaaag gtcaggatag      5220
     gctgcccccg ccggaccgct ctgcggacat taacaaagct tggccatacg gcgccagcga      5280
     tggaccggct tttgttggtt gatgcggtcc agctcccgtt gtagcttcgc tgcgaaatcg      5340
     cggcacgctt agataggatt ggaatttcca tggcaaccgg taccgtcaaa ttctttaatg      5400
     acgacaaagg cttcggcttc attacacccg agaatggcgg acaggacgtc ttcgtccatg      5460
     tgtctgcact gcaacgtggc ggttcactgc gtgaaggcga taaggtgagc ttcgaagttg      5520
     gacaggatcg caaaaccgga aagtccaaag cagagaatgt atcggtcctg taactccagg      5580
     acgttgtaac tatccagcct gccaacatcg tgtggagcat ggccatagga agaggctgac      5640
     agatgaccgg cacatccgac accttggctc tcctcatcga tggcgataac gcttcgccga      5700
     agatcgtcag cgggctcctt gcggagatcg ccacctatgg caccgccagt gtgaggcgca      5760
     tctatggcga ttggaccaag ccaaatctca acggctggaa agagtgcctg ctggagcatt      5820
     caattcagcc cgtccagcaa tttgcctaca cgacgggaaa gaatgccacg gacggcgcaa      5880
     tgataatcga cgcgatggac ctactctata ccggccgttt ttccgcattc tgcatcgttt      5940
     ccagcgatag cgatttcgcc aggctggcgt cgcgcatccg cgaacagggc gtcacagtct      6000
     acggcttcgg tgaacggaag acaccgcgtc cgttcataac cgcatgcgac aagttcgtct      6060
     atttcgatgt cctcaacgcc aattcagtcg agtccgattt acggcaagac gcgcgcccgg      6120
     ctgccgcggc gaaggccaag gcaataccgg ccaaggtgcc ggcaaaacct aggctcgacg      6180
     ctgccgcctt aaagatgttg gaaaacgccg tgatagcatc agccgacgaa gacggccgcg      6240
     caaacctggc ccgtgtcggc gctcatcttg caaaacaatc atcagatttt gacgcccgca      6300
     actacggttt tgcccgtctc accgacttgg tcgaggcgtc tggcatcgtg gacgtggagc      6360
     gaagcggcga cagcccaaag atcgtcacgg tgcgcatgaa ggggaaggca aggccaaggt      6420
     ctaacggcta ggcccgatcg cgcatgagac gagggccgtt atatcgagaa tgtcccgctc      6480
     caatcacgtg ctgcctcgat gaactcgttc gcatgaaaaa gacgcttgat gatgccacaa      6540
     cggggacttt ccagggaaga actcttcgcc cttgtatggg agaagccgac cagcgagatc      6600
     gccaaggaac ttggcctgtc ggacgtggcc ataggcaagc tctgcacaaa gttgcaggtc      6660
     ccgaagccgc ctcgcggata ttgggcccgc atgcaggccg ggcaacgacc acgccgaccc      6720
     gccttggctg ccttccgcga ggaactggaa gcgaagcgcc gcgacgagct gcgtgagaaa      6780
     acagcggaat cgctttcgaa actgcaacgc cggttccttg aactggcgct ggcggagctg      6840
     aacagcaaag gcgccggact cgctccacca ctaggcgcga ggccgttagt caatcttgat      6900
     cgcgatgtcg ccgctcaggt cctcctgctt atccaaggcc ggggacaggt ttgggtggaa      6960
     gagggtcgca ttgccacgcg atggggaccg tccgtccgaa acagcgtcgg caggctggtt      7020
     gaacgactgc tgccgcttgc gcgggaacag ctcctggtgt tcgagaccga aagtaaacgg      7080
     acatcttttc gggcggacgg gccggtgatt ttcatccgtc tgaccaagcg tttgcaggca      7140
     cgggtcgtcg gactggcgaa catcgtccgg gatcaggatc ttcagcatgt cgtcatgcct      7200
     cttgtggcgg ccgaccatgc ctggtccaca catcatctct attcgccgga atcgcacctg      7260
     ttcctcgaca gctggctctg tgtctcggcc cgcgagatct gggtggaatg gaaccgcaag      7320
     tcttggcgcg aggaagatcc gcccgagcgg catgccacca atcggatagg gctgagcgac      7380
     gtaatgccag tcgacttctt gcctggctcg gacaaggcgc tttctccggt aatctcggga      7440
     gtggcaatca agccgtacgc cgatcgcctt cgcgccgtgc aggaggcaga gcgggtccat      7500
     gagatgatga gcaccgccgc gtacgcgatg cagaaggagg tcccaggaga gtttctttcc      7560
     gtggtggacc gattgtggtt tggagaggaa cgccccttcc aggcagcgcg cgatgctttt      7620
     cggcatgtag aaacagagct ggaacgatgg gagaccgagc ttgaagcgga acgatcggcg      7680
     cttgcccgat caatcctcgg aattgtgcct ggagacatcg cgacctccga aagccggggc      7740
     aagctcctgc ggctttcggt cacgagcgtg actctttact cgagcggcgg ctgcgtcagt      7800
     ttcatggtgt ccggaattcg ctttcgaaag gacggaacgc tcggcaagtt gcaggaaacg      7860
     ttgagtttgt cttttgccga cgaaaggcaa acttgatagc gagagcgcga ctgtttgacg      7920
     gatgaaggcg gatgctggca agcctctgaa atcctgcccg acggccccgg tgcatcgtgc      7980
     gccacttgag tgagcgcctt gatgagatat gaaccttcga cgtgccaatt ctccagggcg      8040
     tactggcgtc tcatcatatt gatctcgttt tgcttctatc gtgcccgagc gcgtggtgta      8100
     gctgtgcgtc atagccatcg ctcttttgcg gtagagtcgg tgcttatgac caacctgaag      8160
     gatattaccg atggctatga agcccaggcg cgctgttaca cgatcgggtc cgcaaccggc      8220
     aaaagagcca ccatcctatc aaagtctcga agaaaacaga aaattcgtat ttgccagtgt      8280
     attcaggaga gatccaacgg ggaaaaaaaa tggtagactt ggcagacgaa ctacgagggg      8340
     tgcttaaaga tcttaagggc gctaaaaccg cgaccccggt aaccataaga acattcctct      8400
     cctggtttgg aatgcaacgc cggactgcat ccaatgttga atacattaac tctcagctca      8460
     aggcagctgg tgttcgtact gttccaaact atctggatat ctgggtagac acgcccatta      8520
     cttttgagct gaccgctaag cgcagaggcg atgggcctga cagcacagcg ccagcaccag      8580
     ctgtcgagaa ttccacggac ataacattca ccgatagcaa atcggctgac gatccatcat      8640
     tccgaatcgg taaaattgaa tctgccaacc gcgccccgat tagtgtccgg ccaaccgcga      8700
     gtttacagga ggccatcacc ttgatgctcg ctcgaaattt ctcgcaatta ccagtgatga      8760
     caacagaccg agaggtcaaa ggggtgatta gctgggaatc tatcggagcg cgcaacatca      8820
     ctaagacgga tggtacccaa gctcagcatt ttatggacga cgcgcaagaa atttcagcat      8880
     cagcatcgct gtttgcaggc ataaaaatta tattagatca taattatgtt ttgatacgcg      8940
     cgtcggacaa acgcatcgca ggaattgtca catcaacaga tatcactcac caattcgagg      9000
     aaactagcac accattcttg ctactcgcag aaatagaaaa ccacctgaga gctttgattt      9060
     caaaaaaact cacggtgatc gatatcaaga aagcatgtag cgatgaattt ctccccaaag      9120
     acttcaagaa cgtcgcagac ctcaccttcg gtaattacat ccgtatcctt gagaatgacg      9180
     agaactgggc gaaactcgga cttcagctcg atcgcgcaac tttttgtaga gaactgattg      9240
     aggttaattc aataaggaac gacgttatgc atttcgatcc ggatcccttg acgtccgaaa      9300
     acatttctac acttaggaat gttgcgaaga tgcttgatct tataaggagc ttcgggggct      9360
     tttgacggaa acatcaattt ggtcaatgcc aaccaaattg tctccccact tgacaggtct      9420
     gcacaaccca catcagttgc ctaagccccc ggtcttccca atagacagac taggtgcctg      9480
     agcaatggcg cgaccggcgc tatgagcgag ccgacttcgt tcggcgtaaa ggcggcttgc      9540
     acgtcgtcat ctacacggat tcgatcttat caaagagcct cctacttgcg gggatatctc      9600
     attgacgtga cagggattga tgatgaaacc gaaatggaga cgccacccat ccaatgcccc      9660
     ggttagcctc atttccaagg ccactatttc tgtgccgaca ggttggtcag ttggccccgc      9720
     gcacgcctgc gaataccaac ctgcgggagt attcgtaatg gagtgttagg aaccgttttg      9780
     ctacaacgcg agcctgtgag ctaacacgaa ttggaaagat actttgtatg cgcggtaagc      9840
     ataaaaggtt tgtcgctgca aaggaaataa agcgaccctt gccgaagctg acaatcccga      9900
     ccgatgtgca aactttcgag gattactttg cacggctaca aatcctgcaa aaccgcgccg      9960
     atacccatat ctacttcgac acgtcgtttc ttgtctggtt aacgggcgta tccagtgacg     10020
     gccgcgcaga gctactctca tggctgcacg caatagggca aagccgcatt cacattcctg     10080
     tttgggcggc tcatgagtat ttccgccacc atgtcacagg attgatctcc aatcagctgc     10140
     aagtggtagc gggtaatctt cgcaccgctg ctaatgattc ctatgccgct ttgcggccgt     10200
     acctggatac cccggtaaga ggagagcatc ggtcgctggc ggaaattcat acaaatgtcc     10260
     gaaaaacact gatagacgtc aaacgactgg ccggatttgc atccaaatgg agcactgagc     10320
     actatcagtc tcatgtgaac gacgtcttta agatgataaa cgattacggc gtacaaagcg     10380
     gctctgtatt cgacaatctg catgacatcg agattctgga aaaaagccgc tataccggga     10440
     gaattccccc tggcttcaag gatcaaaaaa agaaagagcg cgacggtgtc ggctcaaaca     10500
     gctttggtga cctcgagttt tggagagaga tcctgcggca ttcgaaagat gtccgcgcaa     10560
     aatccgtgat catcctcagc aacgaccgca aaaatgattg gttgatgggt gcccagcccg     10620
     cgcctacgat tgaccgcgag gatgaagtca ttgcagcgaa gagaagttgg aatcccatcc     10680
     ctcgcgctca tcctatgctt ttattcgaag cgcacgcgtc cgccggcgtg gaagagcttg     10740
     ttctgaccga taccgtatat cttgccacat acttcaagaa ggcaggaatt ccttgccagt     10800
     ctttcttcaa tgctgcggtc gacgttgaac tgcccgagcc ctcggagttt gacaaagacg     10860
     ttcgcaaggg tcttaaagca accgccgcga tggtcggaag cgagccccgc ggaaagaacg     10920
     atgacatccc tgcaggaacg ctattcaaag acggccccaa tgtcctggtt gctccgctta     10980
     agttgaacct tgccttcacc accagcggaa agctggagca tccccctgga aaggcattgg     11040
     ttaaggcagt tctggacgac aatactgaat caagaggcat aatcaatttc ctgcaactgg     11100
     agctgttcaa ggctgcagac accggcacct tggtttggct ggcgcgagcc ttggtttcaa     11160
     gaagccaagc tggcgattct cttgccgtcg ctcactgctc cgatctcctc gggatgatag     11220
     acgagctacc gagcgggacc gcgacatgcc tttacctcgg ctttctagcc ggcgcgtatt     11280
     tcgatggcga tgatctacgc gcgccaccgt ccgctcccat ctttcaagcc cttttgggtc     11340
     ttcaagaccg accgttcgct gcgcagccaa ttgccgtcat tacaggaaaa tttcgcaaac     11400
     tccacaaaaa gcccttgtac tcaccagacc ctgcaatgcc tgcgctccct gtaacggtgc     11460
     aactgaaaga cgtgtctggc ggcagatcgt ctatctttgg actacagatc ggtggccttg     11520
     gagtactgga cgcagcgcag tcggaggaag aactcacttt gtcccattta ctggacggac     11580
     agggcagcgc caccgtgaga agcatcgccg agagagcgag ccagctgtta ggatttcctg     11640
     tggcgcagtt actaaacacc gcagagcttg accgccaggt cgagttcagc ccgacaatag     11700
     gcctgatagc gccgtcggaa accgtactct tgatcgatga gtgagattat gaccgaaact     11760
     ccagaaatcg gaaccgagat ccccaaaaag gctgatcctt atttcggtgg cttcatcctc     11820
     gaaacactca ccatcggaat gtacggggat tcaaagagcg caattcgaga atatttgcaa     11880
     aacagcttcg attccctgct gctggcgatc gagaaaaaaa ttacgcaggt aagcgaggct     11940
     cgcatcgaca tcaccatgtc tgactcgatg ctcgttatac gcgacaatgg gatggggatt     12000
     ggttccgcta gggcggtgtc agtgctgacc tcggttggcg catcgctgaa ggattttcgg     12060
     tcccaagccg ggttccgtgg catcggaagg cttgcaggca tcgtcttctg caccaacctc     12120
     aaattcgtca cgaaggctca aggcgaaact gtccagacaa cggtgacgtt caatgcgaag     12180
     caactcaggc aacaaatgtc gccgtcgcac ggggcaaagt acacccttac ggagctgttg     12240
     gaaaagaaca tcaccgccag ccagagcgac ggccacaagc cagacgaaca ctatttcgaa     12300
     gtcaggctcg aggggctggt caacccaccg aaggagtgct tggattcttc gctgatgtcg     12360
     gactttgtcg gtcaggttgc accggtgggt taccgcgacg attttagctt tgctgcgcaa     12420
     attctaaagg ctggcgagga gcgccgcttc ccctcagctt cgcaaaagga tgcgaccaag     12480
     aaatctctgc tcgatcaagt ccgagtattg atcaagcgcg gcgacgagga gaccgacgtt     12540
     cgcaaacctt accgaaacca agcagccgtc gggaaagacg atgttccgat ttatgacatc     12600
     aagatttttg atccgcctag ccgtcggtgg tgggcctgga ttgctttgaa gaaagagcca     12660
     ggcgtgtaca aagacgaccg cgtccgggcg atgcgcgtgc gcatgcgaaa catccagatt     12720
     gacggcaccg aactcatggg aaagcaattc tcttccgttg aaggggctgc atcctttggc     12780
     agattcaatg actggtacgc gggagaaatt ttcgtggacc cgacttttgt catcccgaac     12840
     gctcgtcgtg acggctttga ggaggacgac aattggataa aaatgcaggg cgagttggcc     12900
     gacctctgcg ccgatttggg tcggcaggcc tatgacattt ccaggcgagc acagctatcc     12960
     atccgaacct tggcgcgaaa caccaaagag attgaagaga aaggaaagtc gattgcggct     13020
     gccgggaccg acacggacaa ggttattgag ctttcgaacg ccgtgaataa gctgcagcgc     13080
     aaagttggtc gggctctacg gcatgctgat ctggaaacca gttcacagct gcgctcgctc     13140
     gagaacaaac ttctcgatgt caaaacccgt gccgtgcgaa atctcggggt ctctcagcaa     13200
     gtggacctct ccgaagtgcg ggagcaagcg cagctcgata ttatttccga gctaatggca     13260
     gcttttcgag aaaagctcga tccgccaacc tattcaatgg ttgccaaaat cgcgtccgag     13320
     ctgctgggct cggacgattt ttagaaagga ccacccgatc gagcttaaag ttgctgtagg     13380
     attttgtcga caagcgattt ggccacgacg gtgttggtcg agcatcggta cacaaggtca     13440
     cagaaacgtt taaagatcgc gcgctcctgt tcatcgagct ggtggaactc aaccggcgta     13500
     cccgcctctg ccgctacagt gcttaatctc gtacgcagct cactgagttc ggcagacttt     13560
     tccacaacgt cctcgtcatc gaggacaccg ctgctcagcg ttttttccgc acgcgcgata     13620
     ccgtcgttgg cgcgcgtctc gaaccgtgca cgctcctcat cgctaatcgt accctgggca     13680
     ataacgtcgg ttagctgatg gacggactgg agttgcagct ccacgtctcg cagccatttt     13740
     cgtttgatcg agctcgtgcg gcaaagcctt gaaatctcgc gagcaatcgg cgcaagctga     13800
     ttggtcaggt tatgatagtg ggcattctgc tcgaaatggt cgcgccgccc gttcggaact     13860
     attttccgat cgacgacgtg gatttcaccg acagcccaag cattgaaccg aacttcagaa     13920
     aatagctctt cgaggaggtt atgttcgcca atttggacgt ttccggcacg cagcctcaac     13980
     ccctttaccc cgacgccatt tggcaacgcg ccttgatagt catggtggag aacccacacg     14040
     atggccgcaa gctcaccatc aattgccgag atctcactga cggacaggcg attgaattga     14100
     attggaggat ggtcggctgg cgtcaatacg tcgcggtgtg gtcgaaatat ttgccgctcg     14160
     ctcccctcta tccaaatttc caaatcccca agcccaacca ccggagcaag gatatcacga     14220
     atttctgagc cgaatcggaa ctcgggtgcg aatggaacgg gagcgacttg gccgagatac     14280
     tcatcgacag ctgcagggct catcaacttg tcacttcgca gccgaacaac accccgcaat     14340
     tcgacttcga agaagcggtc cggatagtca gctttcggtt tcttccgtaa aatcgcgacg     14400
     gatcgtatca ggctttgaat atcgccatca ccctcgcgta gcgccgcctt tagccgctta     14460
     caatcccatg tcagttcagc cacactatca tccgacgccg tgcgtgagcg aaaaaccagc     14520
     tcttgcgcgt agcctagtcc ggcgaggcgt ccgacgcctc taaagcctct ggcgtttgtc     14580
     ccacgcttcc cgctggcgcc gagcgcggcc atttttcggg aaaagtcttc gtttgaaagg     14640
     cccgatccat tgtcacggat gcggatactc cgcgtcattg gatcgatggt tattagaact     14700
     ttcccagcct cctcggcgga aattaagccg cggctgcgcg cgtcgtcgat tgcgtctgcg     14760
     gagttttgta catactcgcg gtagattgtc atcgggtcga tgtacatagc gctggaaact     14820
     agttccaaca catcccgccc aatggttatt tcctctaaag gttcgctctg gccatcagct     14880
     ttcgcagcaa gaattgccga acggttcaat cgtgtggtgg cttccgtcgt catgcaacag     14940
     ccctttgctt tggtgcgagc tctgcagtga tagcgatgct ctcttcctca tagtccaagc     15000
     cggcgtcctc cacgcgctcg tcttcggcga gcccgaggtc cgacatggct tccagtcgaa     15060
     ccagttcctt ctgcgtcgcc caaatggtgg tcagctcatc cttggagact gggatataga     15120
     accgcaaaat ccgccggact ttatcgttgg ccgcaaaatc actcagcgtg acgaactcgc     15180
     gcggatcgcg ggaggacaac agctccatca gctctgcccg ctcataatta tcgagagaac     15240
     taaactcggc ctgaaattcg tagagcttat gatcctgatc gtatcgctcg taccaggtac     15300
     gattgaagat gaaatcgtgc ggcatcatca ggatgcgcgc atagtcctcg aacgtgtcgc     15360
     cgaacgcgtg cttgaaaaag tccggcgcgc cactgacgat accgtgggtt gcctgcaaca     15420
     cgatctgcat tgaacgcagt tgatagcgcg accacttctc accgatatgc ccacgattgg     15480
     ggcgatttgt cggctgatag cgcatcggga acgaccagat acgaatgcca agctcttcgt     15540
     tgagggtcac gttcaaacgc atgcgctcga acaaatcctc cggaccgtca tggaaattgt     15600
     acagcatgta gttcgacaac tctgtcagcc catattcagc ggcgtagcgc accgcatgct     15660
     cgtagggttt tttcacgccc agatgatcga acgcgatgcg aagcggctta aggcaaatgg     15720
     tcgacagttc gcgcaaatac atcggatctt tgcacaggat ccgagcatca acgccctgat     15780
     tgaagtcgac ccggcgctga acggcaacct tggcgcccgg tctcatgagc tttgctcccg     15840
     gaacgaatcc gaggtcacgg atttcagcaa tgatttcctt aaatcgcgcc gaggcgacaa     15900
     cattgttgtc catgaggata agatcctttt tcggaccgta atgctcgtca atggcacgca     15960
     ccagatcggt cagcgactcc gtatcacgtt gcatgccttc aagcttcggc acaccacaga     16020
     aatggcattt gcgaatgcag ccgcgcgacg tataggcaaa atatgcatcc cgtaccggat     16080
     aacggtagtc gatctgagaa aggatatcat aatccgggac gagatcctca atcggccggc     16140
     cgtttgtatc actggaatag agttcttccg caaattcgtc gagctgcaga gagaccgccg     16200
     gtgcgtccga cagcagtccc ttgataaacc taatgccgtg ccagcggcgc tcgtccaaga     16260
     accgctcgtg catgagagat gctgcgattc cgccgacaaa gactttatcg gcctggccgt     16320
     ttgccacttc cagcgcgaaa tcgatcgatt gagagatctt gaggtattcg aaggaaaaca     16380
     gcgtggtaac gtaaatgcgg tcccaggcct cgttcatgac cgaacgatcc tcacccttga     16440
     tgaaacgcac gttgtcgcgc tttccccggg ggccgtgata ttgggcaatc ttcatcagtc     16500
     caagcggcgg gtatttgttc ttgtagcccg gctcgataag caggattttc ttattagcca     16560
     ttgctgacaa ctttcaaatg agagcgcttg cgggtttcgc ggatatattc gacggcctcg     16620
     ttgaccccac cctcgccgcc aagtcctttc aggcggccgg tcgttgacca gtcgatatca     16680
     taggcaaagt cagcgaggcg attgacgaaa tagccacggt ccagcttggc cccatcctcg     16740
     gcctcgttgt aaagatcggc agcgatgtcc attaacgcgt atacgccaac acccttggta     16800
     aggatgtgct tgcgcggcgt gctccactgg gcaggaagca cctcggcaac tgcacgccaa     16860
     aaggacatga cgatctgcgt gacggtttcc ggtgagcgcg tcttgagcga ccgggtggag     16920
     ttgagaaatc gctttatggc cttttgcatc gtccgaagcg acgcacgccg ggtcatcccg     16980
     gaagtgctct ctccgccgag atcaagctgt cggcaccaag gcgaatccgg gtcattgttc     17040
     agatgaagag cgataaagat ttccgggcga tctttcgcca ggtctccagc caggtgtgca     17100
     tcatgaaagt ccagcagact gttgctcagg ccttttgcct tgctgttaat ggtactgaag     17160
     acttccatct cttctttgag actgagcccc acgtaacaca taaacggcag ctggatgtcg     17220
     agatcctcaa gacaaccgag cctatgttgg caatcgacct gcgccatgat cttgccggcg     17280
     tccagctcga tctctaaccg agcctgtcca ggtccgacat tctcgacttt ccaacccttt     17340
     tcgtcaggcc gcagattcaa agtgaggggg atcgtcgagg cgccggtctg tcgaatgtac     17400
     cgacggaaat cttggctgtg ctgcgagttg aagcgacgct gatagccaag acctgtgtct     17460
     tcgttcaaca cgtcggcaaa gctgtatcga tgcaggagtt ttgccggtgc aaatcctagg     17520
     agaaccggcc tgtcgaccga gacgccagtc gagcagttga gccacattga ttccgccatc     17580
     gcacccctca gctgcaaaat ctgcattcat tggctgcagt ttctgcattt cgcgcgagca     17640
     agtcaagtgc gaaagaacac gcagattcgt cgtccagcta tttcttgggg ttcaacttct     17700
     gcgccagtgt atcaacccgc cctgaaagct tgccgagctc aaacaggatt ttcttgcggg     17760
     tttcatcctg ggcgtggttg agcgctgatt ctgtctcggg tagggcaagc caattgcgaa     17820
     atttggtgat cttcttcagg ggggtgttgt cagcgcccgc ttcgacggca tgatcgaagg     17880
     catcctcgaa cccttcggtt ccattgacga acttctgcaa cgctttcggc gccgaacaga     17940
     tgattggcag gcggtcgcgg atatcgacgg ccttcgcaat ctcgtcgctc tttatctttc     18000
     caacaacgag gctgtcgaaa gccacatttg cgaggcgggc ctttctgatt ttcgaggact     18060
     tcaaatattc gtcgtaatag ctccacttcg ccgtgtcggc ttcatcatgg tcgagcatga     18120
     attgataaac ggcaatcaga tgttcgacct tgcgctttga gagaccaatt tcgatcgcca     18180
     acttgccggt atcgacgtca tgggttttat ggcgacggta aagaaagcca gcttgttcga     18240
     agggggccca atccttcttt cccttgatat ggtattggcc caacagggca aagatcaaag     18300
     cctcatcaat gtcctgcggc aacagccgca ctttcatgta tccccacttt acaggatcgt     18360
     ttttcgcgag cgctcgataa gctgcaagtc ggctattgcc ttccagcact tccagggtgc     18420
     cggcccgcac cacaaccgga tctgtcaacc ctccatcccg cttgatgtct tggattaacg     18480
     ctttcacatg gtccatatca aggagtttgc gctcgatgtc ggcctggctg ggttcttcgc     18540
     catcggatcg caggatggaa tagacacgcg gattttccac gaagaactgc agatgcttct     18600
     gcggcaaaga tccggtttcg acaggcacct caaccccgcg tattaggatc ggttcgccag     18660
     cctttagcgg atgcttatcc atcgcgttca ttctttctcc tgcgtgttga gtcttagcac     18720
     ctcgcggatc atgtcggcga aggcgtagtc tgcgcgttta tcatattcct cgcggtcgat     18780
     gtcgccctgc cccaattgtg cggccagatg cttggcggac aaaagcgcgt cgacccaggc     18840
     atcgaccgta tccatgccga ttaaattggt aacgaagcag ggcttatcct gcgaaatccg     18900
     atgaattcgg tcctgggcct gcagataatc gtcgaggctg aagctgcgat cgtaaaagac     18960
     agcatggttg gcgacggtga gtgtcagccc ttccttcgcc gcacccggtg ttgcgactag     19020
     gactctggtt tgaggatccg tcttgaaggc agtcaaggct tcctcgcgct tggcaatctc     19080
     gatgccgcca tgaaccaata ctgctccaaa ttctccaagg tggcgacaca gcgcctcggc     19140
     attcatcgta aaattggtcc agacaacgat cttttcccga gcatcgatgg cgcttgtcac     19200
     gagctcatcg agagcacgca tcttgcccgg cacggacctg taagcctggt cgaccatcgc     19260
     cggattggaa gcgacttgga ccagtcgcag taaccgcttg aggatgtcct cggcgtcatc     19320
     cagaacgggg cgtccctgcc gcacgacgat tgccgccagt tcatcgcgga actgggcata     19380
     tatttccgcc tgccgcggtt cgagttcgca ttccagattg cgtatcgttt tgtccggcag     19440
     ctttagccct gcggtctttt tggtctctct gactgaaaac ggccgaacct tctcgaagac     19500
     cgcctcaagt tcgtctgcga aggcttgggc tcgcctatcg tcgttgcgaa gctcattact     19560
     taggtccaag tcccgcttga aagctgcaaa ttcgtcgccg aggctctctc caagatcaag     19620
     aaacttgatc tgtgaccata ggtcatacgg ccggtttgcg acaggcgttc ccgtcatgat     19680
     cactcggcga acaaatccag aagcgagcac atgcgctgcc tggctgatct cggcttccgg     19740
     gttctttatc ttgtgagcct cgtcaagaat cgcggcgacc ttgcgcgttt ttaaaaacag     19800
     ttccagccgc tttctctccg aaacgatggc ttcgtaatgc atgagataga ggcgggccgg     19860
     actattaaac gcatagaaat ttgcgttccg gtcctggccc aatattcgcg ggcgaagatg     19920
     gctgtgatcg gcaatctcgt tgcgccagtt ctcaataagg ctcttcttgg tgacgatcag     19980
     gacggagtcc gctacgtcgt tggcaagcca aaacaacgcg agatcaaggc cgatcttcgt     20040
     cttgcccaag ccttgttcgt gaaaaaccgc ggcataggga aggtccttta cggcagcgaa     20100
     cgcctccatt tgatgcggga aggccgagcg tttggcgtca aggcttgcgg ctttctgtat     20160
     cctcagcatg gcgacctcag caaactacag ccctcatacg gtcaataaca acggtccgag     20220
     tctgagcctc aatgaacggc gccttgagct gtgataatag ccggcgtgcc gtcgccgccg     20280
     cgctcaacgg tacgctcaag acgaaaatac cattcggcgt ttgcgacaaa tagccgagga     20340
     aggcctggat ttggacgcgt gtatggtcgg tctcaagatc ggccttcgtc ttcgcctcac     20400
     cgatcagcgt tgccgttgtt gggacgtccg tggcatacaa atcaggaacg tagccattga     20460
     tccttggcgg ccgttcgcct ctgaccggtc ggacggcgtc attccgtaag caaaggttgc     20520
     ttcgttggcc gagttcgatt tcggcataaa caatcaatgc atcgaccaat ctggcatgga     20580
     cggctgtctc acccataaca tcagcccagt ttgaggctta ataccaattt gctcagttcc     20640
     gcctgagcgt cgatcaacgc ctgagccgtt tcaccgccgg ggtcggcttc aatacgctga     20700
     tgctcatcgt agcgaagagc cgcaatctgg gtcaccagtg cccgagcaag ctgtccgagt     20760
     tgagcctcct gcagcgtttt cgtcaggtcc ggcttttcaa ggacagcttc cgctttcttg     20820
     ataccgtcct tgaggaatat ttctcgggct ttttcattgc gcaaaacgcg aggcaagacg     20880
     cgcacctttt gcaaggggtg caatttaccg ccgtggatcc accgcgcaaa atcgaaacaa     20940
     tcgaagccgg cttgattgat tgcctgcttt atccctgctt tttgtaactc cacaaagccg     21000
     ctgaagcgtg ttgtgtcgaa ctccccatct tcccccacta cggggcggta atacttttca     21060
     atgtcggcgt aggcgttgat gctctcaagc acctcagact ggcgtccgcc gcaataatca     21120
     acgatggtgg caaagggaag gtgctcctgc gtcctcagct cgtaaagata tttcgccttc     21180
     gaatatggat cccatggtcg ggttcccacc aggtgtatct gaagcctgat cgcatgaacg     21240
     gacgcctcgt caatctcgtc atgaacgagc gacggaatat gcgtccagct gcctttgaca     21300
     ccatcgtcga ggaagctttt atagagcgcc accctggtgt tgccttcgac gcagacaagc     21360
     gtgccatcgg cccggcgatt gaggatcacc ggctggataa tgccgccgtt cgtcaggatg     21420
     gattgcttca gcttttcgaa tgtggtgctg cttgaactgc ctggctcttc ctcgttaccg     21480
     gctccgagcg ccaggtagat cgcctcgggt gagggattgt ctccgtacat ttcaaggaac     21540
     ttgcggatgc gggggtttga gcgatcgagc tcgatcgtgt ccactgcaat attttgatgt     21600
     gtacccgcat tgaccaattt gattctcccc ccgctgttgc tagacatttt agtgttgacc     21660
     tgcaggcgat tccaagcagc aacatgagtc cggccgcaac ttttagtgga cagcattaac     21720
     atagcgggca cagtgccgca gaataactac cggcaccgtg gtgaattgcc atggttggcc     21780
     tgaggtttgg ggggtaagct tgagcgagca tgaagcgcag atcgaagcag tggcaaacga     21840
     aagcctcgaa agcttcgcaa tgatatccgg tacggctcgc gaccatttgg aagctgcacg     21900
     tgcgccatct attcaaattg ccgataacag ctggaccaat ccgaatgctg accaaaaccg     21960
     caggcgtatc gaccaagaga acgccgaaac tcatcgtttg ctgatcgaag aacccgccat     22020
     tgcccgggtg agggtcaccg atgaggacgg tgcgaccacc gattattaca tctgccgcac     22080
     gagccccgtc cccctcacaa acaagggcat aaagcttgcc agttatcgct ccccggttgg     22140
     taggctcgcc tcgcttcctg tcggctcgga tcataccctt tttagagacg gccgccccgt     22200
     tacggtcgaa gtcgtggaat ttgcccgctt ccagccacga gtagtcgatg gccaatggga     22260
     tgcgcataac gccgttgtcg ccgggggcga ctatggtcca ctgagcatcg aatcgttccg     22320
     ccggtggctg gagcggatcc tgcccgatgt cgatgcgagt gtgctcgacg ccttgctgga     22380
     agaagaaaat gcagccgcca ttatccgcgc gggcttgcat cgaagcgtca ttaccagaat     22440
     ggatctgcgc gaccagccgt tgctcgacca gtaccaggac gaaattttcc gccttccgct     22500
     aaacagcagg ctgcttttgc tgggcgctcc gggaaccggc aaaacgacga ccctgatcaa     22560
     aaggctcggc caaaagcttg atatcgcctt cctcgaagag gacgagcgcc gcgccattgg     22620
     cgcgacatcg ccgagccgtg aaagtgatta cgctcgcgac tggatcatgt ttaccccaac     22680
     tgaactcctg aaactctacg tcaaggaggc attcaatcgc gaagaaatcc cagcgcccga     22740
     cgaccgcatc agcacctggt cagactaccg cgaggaactc gcgaggaaca ctttccccat     22800
     cctccgctcg acctctaatt caagcagcta tgttctgaag gacaacgcgc tgacattggg     22860
     gccgggatct caggatgatg cgattgcctg gttcgaggat tttgaccaat ggcaaagggc     22920
     agcgttctgg gatgagatgc gcagttccgc aacagctttg agcgaacagg ccgcgcccga     22980
     tgtcgcccag gtcggggcac gactttcttc tgccatcggt ccgcaaggga gcgaaagcac     23040
     gcaggtattt gtcagtctcc ttcccattgc cgaagacatc agggccatgg tggaggcgcg     23100
     caaggccgcc acagacaccg aattgaaaaa gtccctgaac ctgcaggtta accgggacag     23160
     gggctttctc gacagttttg gagccttcat cgaaggcttg tccgatgtga ctgacgacgc     23220
     ggatgatcag gacgaagatg aagaggagac aaaccagccg cgcgtcggca gagcggctgc     23280
     gatgaaccac tatctccggg tcctgcggac gcaggcgcga gcacgcgcgc gtcgaaggaa     23340
     tgttccgaaa gccagccgta ccggccgcat tatcgattgg cttgccggcc ggatgccggc     23400
     cgacccggat ttgcagcgca tcggagaaag tctcgtggtg caatccgcac tcagatggtt     23460
     cgtcaatccg gtgcgccgct acgtcgacgg tgtcccgcaa cgctatcgcc gctttcgccg     23520
     catcaggcag gcagagggat tgtggttcgc tccggacgga catgcagtga cggaccttca     23580
     tcccctggaa gcagatctca tcctgctcgc catgatgcgc agttcagacg aactcgtgcg     23640
     ccgagcccga cggcttgata cgccggaaaa tccggctcag cggattctga cgcgcatgag     23700
     cgaactttac cggactcaag tcctcgttga cgaggcaacg gacttttctc ccatacagct     23760
     tgcctgcatg tcgatgctcg cccgacccgt gagccgttcg ttctttgctt gcggtgactt     23820
     caaccagcgg gtaacggcat gggggacccg gtcgctcgag caaatgaaat gggtgttgcc     23880
     agatattgat aatcggtatg tttcaattgc ctatcggcaa agcaaaaaac ttcacgccct     23940
     agcccgccaa ctagtcgccc ttgatggaga tagtgccgcg gaagttgccc tttctgactt     24000
     cgctgacaac gaaggcgtat cgccggtcct gggaacggga atgagtgacc ttgcagaaac     24060
     ggcacgctgg ctcgcaaacc ggatcattga aatcgaggag accgttcgcg aactcccgtc     24120
     cattgccgtt ctagtcaaca gtgaagttga tgtccgcccg attgccgacg ctctgggaga     24180
     ggttctcctg gataataaca ttcgcgtcat cccgtgcccc gatggtcaag tccgcggtcg     24240
     agagggcgca gtccgggtct tcaatgtcga acatattaag gggcttgagt tcgaggccgt     24300
     ctttttcgtg ggcgtcgaca cattagcggc caatttaccc gacctattcg acaagtacct     24360
     gtatgtcggg gcaacacgtg cggcatcgta tctggggttg acctgcgatc aatttttgcc     24420
     ggatcgtgtc aaacacctcg aaccgctctt tgagcagaaa tggtagggtg gtgaattcgg     24480
     tccgggaaag tagcggttgt cttggaatag attacaaaat cccccacgcc cgaaacctcc     24540
     ccctccccgt catctccctc agccccagct cgcccacaat ccgccgcgcc gcctgcggcg     24600
     tgacgccgag cgtcttcgcc accatcttcg ccgacaccag gggccgtgcc atcaccaggc     24660
     caacgagctc cggcaatttc gaagacgttc gtcgcccctc cagcttccgc tccatcattt     24720
     tgcgggccag cgccagccgg tcatgctcct tcagccctat ctcggcggcc gcgatcagcc     24780
     cttgggcgat cgccagcagc cgggtctccc gatcacgatg cctgcgccga tcgacgggta     24840
     tggttttcag cccgaggttg atggcgacca gatgggcgcc ggtcatgatg ccggctttgc     24900
     gcaggatcga ggcgcacaaa agccggccga gccagggcgc atgctgcagc accaaaatct     24960
     cgttccaggc atcgagggcg acgatcgcct gcagcaccgc cggcagttct tgggcctgcc     25020
     gcaacacagc acgccatttc tccagccgct cctcctcgtc ccagtcgaga tcatagacca     25080
     gcggatcctt ttcggcagca cggcttggac gcttagcgtc ctcgatcgcg gcttcggatc     25140
     gagcaagcac cgcatcgata gcggcatagt cgacgccggg cagatttttc gcctcgtcac     25200
     tatcctcccc cttcccttcc ggaccggccg cgaccgcggg ccgaatgacg cgggccgtcc     25260
     ccgcctcgtc cccgccgccc gacctgatct ccgaggtttt ccgcagcgat cggataccct     25320
     ctaccgacga cgcccagtcc ggcgactgcg cggcgatgcg ccggcgggtg cgcaacacgt     25380
     cgcgggcgat tgtcagctca tgggtcgggg tgcgaatatc ccgcgtggcg tcgtggagga     25440
     cgaggtcctc gaggtgaacc agttcgccgt caatccacag cgaggcgcag gcgtcggtga     25500
     attgggatcg ttcgagaaag cccgccccaa ccggcgaacg tgcaatccgc tcgtcgagac     25560
     gcgtgagcgc cacaccagcg tcgaaagccg gtcgcatcaa cgctgtcatg ctgattttcg     25620
     caagatcata agtcattgaa atcatggtaa acgatttgct aaaggaacac tagtagctta     25680
     ttacggttcc tcacatggca tggttggcgg ttgaggctct aaccatcgat aagtaacgtt     25740
     tatcggaagt gatacgtaca gatggattgt acgcacgggt ttacggtgct atcgtgcagc     25800
     ttgagaggca aaatcggagc gcacgatgtc ccagaccagc tacaagatca gcgaagcgcg     25860
     gaaaaatttc gccgaggtgc tcgagcgcgc caaccagggc gaagaaatca ttatcatgcg     25920
     gggcagtgag atctatgccc gcatcggccc agccgatggc ggcaagcgcc ccttcggctt     25980
     gctgcgccag cgcggcctgc ccgacgacct gttcgacgag gtcgatgccg aacaagtggc     26040
     aatcgacgcc ggcgattgga acgatgatgt cggcgtctgg cagggtggtc catccgagcg     26100
     cgagccccag ccatgaagat tctgctcgac agccacgctg tctactggtg gacaatcggt     26160
     agcgagcggc tgtccgggat ggcccggtcg ctgaccgagg acaaggccaa cagcgtcctc     26220
     gtcagcgccg tgtccttcta cgagctcgac aacaagatgc gtttgaaaaa gctcgatctt     26280
     aggccgcagg aactgcgcgc tgccgtcgct gacagtggcc tacagacact tgccatcacc     26340
     gacctgcacg ccgaactggc ggcaagcttc gactgggatc accgcgatcc ctgggaccgc     26400
     attctcgccg cccagacgcg gttggaacat tgtgccttcg tgtcgctcga caccgccttc     26460
     gatgcggtgc tgcacgaacg ggtatggtaa ggaggttggt gatgatgata ttcgctgatg     26520
     tccaggaagc cgcggaacgc ttggaggagc tcatcgaatt ggcccgtcag gacgaggtct     26580
     atgtgtgccg ggacggacga cctgttgcaa ggctcaccgc gttttcttcg agccctgttc     26640
     tcggatctga ccagcccacg aagagccttg gcgacggggt agcggccgct tcagccagca     26700
     ggatcgccga ggccggaaga ccttcttcgc tcgatgatgt ctgggctatt gctgcgacag     26760
     gcaggccgaa agacgtggat ctgacgtccg cgcacgatga cttctacgac gcagacggcg     26820
     cgccgcgatg agtgtcacgc attctgcatc cgtcaccagc cgcgccgagg ccctggacac     26880
     catcgcagcc gtgctgccga tcgaccgccg tgacaagctc gccgagctct tgaccgacca     26940
     ggatgtcgag acgctgcggc atctcgtcaa tgccggtatg ggcgacaaca cgctgcgggc     27000
     actgacttcc gacctcgcct atctcgaagc ctggtcgctt gcggcgacgg gtagcgccct     27060
     gccctggcca gcggcggagg cgctgctgct taaatttgtc gcccaccatc tgtgggatcc     27120
     gcaacggcgc gaaaacgacc ccgagcatgg catgccggcc gatgtcgaag acgtcttgcg     27180
     ctttcgcggc ttcctgaggt ctctggggcc acacgcaccc gacacggtgc ggcggcgcct     27240
     cgccaactgg tcgacgctga ccaaatggcg cggcctcgac ggcgccttca cctcccctgc     27300
     cctgaagtcg gcgatccggc tggcggtgcg cgccgtgccg cggccacgcc gccgcaaaag     27360
     cgccaaggcg gtcaccggcg aggtgctggc caggctgctc gcgacctgca ggagtgacag     27420
     tttgcgcgac gttcgcgatc gggcgatcct aatggtcgcc ttcgcctccg gcggtcgtcg     27480
     tcgcagcgaa gtcgcgggtc tgcgccggga gcaactgacg gtcgaggcgc cggtcaccgg     27540
     tgaggacgac atccccctcc cctcgctcac catccatctt ggccgcacca agaattccgg     27600
     tgccagccag gacgaggtcg tctatctgac cggccggccg gtggacgcgc tgaatgcctg     27660
     gttgacggct gcaaaagtcg acggcggcag cgtgtttcga gcgatcgatc gctggggcaa     27720
     tgtatcccga cgggcgctcg acccaaaagc ggtcaacgat atcgtcaagc ggcgggtggc     27780
     agaggctggg ctggagcctg gggagttttc ggcgcatgga cttcggtcgg gctatctgac     27840
     ggaggctgcg aaccgcggca tcccgcttcc cgaagccatg gagcaatcgc gccaccgctc     27900
     tgtgcagcag gcatccagct actataacaa cgctacgcgg cgaagcggtc gcgctgctcg     27960
     aatgctctag gtggctccat ctaaatgtcc ggtaatttat cggacattat tcgacaggct     28020
     tgaaaatgaa gaagattgcg catagaaatc tagaaagaac gctatttttc tagacggaaa     28080
     ttatcggaat gagcctcagc atcaaggatc cggaagccca tcgcttggcg caggcgatct     28140
     cccacgccac gggagaaagc atgacccgcg ttgtcaccga ggcgctgcgc gagcggttcg     28200
     cgaagatcga acggcgaaag gggcgtgcca gcgtcgagga gctcctggcg atcgccgatc     28260
     gcgccgcagc gcacgtcaaa cgcccctatg tcgaccatgc cgagttcctt tacgacgaga     28320
     acggcctgcc gaaatgatca tcgatacctc ggccctggtc gcaatcctct accgtgagcc     28380
     cgaggcggcg agtttcgtta agatcatcca tgacgcggag ctcacgcgga tcagcgtcgc     28440
     caattacgtc gagttgtcga tggtggtcga gggtcagctc ggccccgacg gcatgcgcca     28500
     ggccgaggcc ttcttccggc gcgccggcat catcatcgag cctgtcacgc tcgagcattg     28560
     cgaattggca aggcaggcgt ttctcgattt cggacaaggt cgtcacaagg ccggtctcaa     28620
     ctttggcgac tgctttgcct atgctctggc gaaagcgtcc ggcgagccgc tgctgttcaa     28680
     gggcaacgat ttcgctcaaa ccgatgtccg ggcggcgtga tcatggcgga agagagactg     28740
     cagtcaggag ttgaggccct accgcctgcg aatgagcccc tcccctgccg ctgccgcgat     28800
     ggcttttcgc ccgttgttgc gtccggcgca gccggcttgg tggatggcac cctcttcggc     28860
     ctcttcttgg cacgagaaga ttttccgctg ccccgatcga tgtcacgggt gaaggtatcc     28920
     cacgatacgg tgtggcagtt cctgcggcgt gagggattgc ggttcaaaaa aacactgttc     28980
     gcccttgacc gggcgcgcgc tgacgtcgcg caacggcgac agcgctggcg atcctggcag     29040
     tctggcctcg atccaagacg gctggtcttt atcgatgaaa cctggatcaa gaccaacatg     29100
     gcggcgcttc gagggtgggg gccgaagggc aaacgcctgc gcagcttcgc cccgcacgga     29160
     cattggcgca ccctgacttt cctcggcgcg ttgcgctgcg atcggctcac cgcaccctgt     29220
     gtcttcgatg gactcgatca agggtgagtg ctttcgcgcc tatgtcgagc agcaactcgt     29280
     accagtgctc aaacccggcg acatcgtcgt gatggataat ctcgtagcag cctgcagagt     29340
     tttgcccgag cttagctatc tatcggcgcc gcccgcacgg agccgaaggc ctatccaact     29400
     ttccgcccgg ccggcgcatt tgcccgcaga agcgccatca gcattgggcc gatcgcgaat     29460
     tcgccctttt cgcttcgccg cgtcaggcca cgaagatagc caccggccga attaatgtgg     29520
     ccgcctcgct ccaggatgca tgccattacg gtcgcggcgt tttccggacc catcacattg     29580
     gcggcctctt cgtaggccga tggactgacg cccagcatcg atcgaacgat gacggctgcg     29640
     gccatcagat cgcgccagtt gcggattgcg ccatccggcc cataggcaag gatttccggg     29700
     caggcttgca gaaccaggcc gagcgggaag gctttcagtc cgccaccatc attgcggacc     29760
     cccggccgtc gactttgctc ttcctccgtc tgcgcgaagg gatggcctgt ctcacccctt     29820
     cccttcgcgg ccgtcacggt ccctcggtcg ttgtctggct cagctgtcgc gccctgcttc     29880
     gtttcgaagc ctggttcaac ttcagaaata gattcgggat ttgaattctg tatgtgacgc     29940
     tcgatataat cggcattgcc gcgctgtttt gttgatttaa cctgaatttc cagctggtta     30000
     aggatatttg tccgcaggcc cgtcaattca tccagcaaca gttcaagctg tgctgtcgtc     30060
     ggcgatcgcg gcaggccttc gatcaggtcc cggaattcgc ggtataggcc ttgccaatcc     30120
     ccagggatct cttcttcaac ggccgcttcg atcagttttg caatgtcacg gcggcaaagg     30180
     gtgatgcgtt cacgcagacg ctggacatgc agccgctcag ccataacctc ggccgcgagc     30240
     tgttcgatct cgtcggcacg ggcaaggagc ggcgccagcg agaagccgaa cgcctcgtcg     30300
     acctcccctg ccctgtccct gcggacgtaa cgcttgccgt tggggctatc cttgcgcagc     30360
     agaagacctg cgtcgacgag cgcggcgaga tgacgccgca ccgtctgttc ggccatgcca     30420
     tgcgttctga gcgaaagctg gatattcgac gggaagacga tcaaaccgtt tccctgggcc     30480
     agttcgttct tcggataaaa gctcaaaagc gcgttgagca cggcaagcgc ccgatcgcca     30540
     atgccgagca gcggctttgc ttcgcacagc gcgcgaaaca atttccactt atcgacagac     30600
     tgatccggtt tgatctcccc agccatgacc tggcttgcaa gcatgccaag cgtcatcgac     30660
     cgccgcccga agggcgtcgt tacacttccg gtttccatat cttccacctc aacgaggcaa     30720
     aagaaatccg ctcaccaaaa cggcgccaaa aactcttgac agcgattctc ggaagtgcga     30780
     ttctcggagg tgttcaggac tacgaggaaa gcttccgcga cggtgacgtt cgggggcttt     30840
     tttcttttgc gcgttatctc ctatccgaat tgtcagctga caaccggcct aactgcctca     30900
     ttttccctca ttttcctctt cgaactcggc ggcgaggcct accaaccgct gagccaggaa     30960
     ttccgaaaac gccgccgatt tgacggtgat gcgaaaggtt ttgccggacc gggccaccaa     31020
     agcaagcggc gcgccgcctt gggtccggag cgtttgctcg gcccgctgag gtgcactctt     31080
     ctcctctacc gccttccaga tgacatcgaa gcggctgttg gtctccaacg tcacgaaatc     31140
     agcagctctg atggcagcct gcgccttttt ctgcccgccc gtctccctga atttctcggc     31200
     aaacgccaac cagcgcgggc gtccgacctt gggggccggc ccgatggcga gaatgatctc     31260
     gggatcgatc gtctgagcca cctgcaggag ccttgacgtt tccggcttgt ctgtcgccag     31320
     cgccttggaa atcatgtcac ggctgaagcc atgctcgtcc atgcggcgtg caaacagtgc     31380
     ccgctctata aaactcaagt cgacacgcgg gccattctcc tgaccctgtg cgaggatcag     31440
     ctcttcatcg gtgagcttac gtacaacggc cttaacagga accccgatct ctgctgccgc     31500
     ccgcaggcgc cggtggccat aggcggcctg gtagtgcccg gcccttgccg ggtccggccg     31560
     caccagaatc ggaacctgct gtccgctttc ctggatagac tgcttcaatc gctcgaactc     31620
     ggcatccttg tcgaccggga tgcggtcgcg gatgaaggac atttcgaccg cagccggatc     31680
     gatctccagc accttgtcgc cggaagccag cgattcccgc agtgccttgg cggcggctgc     31740
     ttcctctccc agccgtccaa gtgacaggtt catcgccttg accgctcccg aaggccgatg     31800
     cggctgttgc acgcttggca cgtccggccg tgtcggttcg acagcgccga ccatgctctt     31860
     caggatgtcg cgtccttttg ggctcatgtc ctgctccatg cactacgaat gagttgctcg     31920
     acctcggcat tgacgctgtc gacggattcc accccgcggt cataggtctg gcgatgcatc     31980
     gtgtcgcgtc cggcctcgta gatcgtctgt ttcgacaggc cagcatccga gaccgctgtc     32040
     gacttgacca tcatcgaggt cagcacacgc tcgccaaaca ggctgcgcag gaaggcaacg     32100
     atctgcgcct gcggtccatc attggactca tagcgggtga ccagatagcg catccagtcg     32160
     taatcaagat tgccgcctgc ctgcttgacc acggccagaa ggtcggaggt catcgtcagg     32220
     aactggttca tcgacgcaac gtcgagcatc tgcggatgga cggtgataag gacggaggta     32280
     gcggcacaaa gagcagagag cgtcagaaag ccgagggtgg gggggcaatc gatgatgacg     32340
     acatcgtagc tctgctccag cgaatgcagc gcattgccga cccgcatgaa gaacatgtcc     32400
     ttgtcgtcgc ggttggtgtc ggcgagcgcc tttggcgtat cgtgttcgaa ctcgtgcagt     32460
     tcgagattgc cgggaatgag atcaagcccc ggaaaatagg tctggcgaac gatgtcggct     32520
     acgtcgcggc gcgtttcgtc atatttgatg gcaccataaa gcgtctcgtt ttcgccgacg     32580
     tcaaattcgg gttgatatcc gagcatcgcc gacatcgacg cctgcggatc gaggtcgacg     32640
     gcgagcacgc ggtagccgcg aagagccagg aactgcgcca ggtggatgga tgtcgtcgtc     32700
     ttgccggagc cacctttgaa attggtgacg gcgatcacct ggagatggtc acccggccgg     32760
     cgcatcggca gataggacgg tttggtgcgc ccgagatggt ggcgcatcgc atggatttcc     32820
     tcaagcgaga agacccgtcg accggccgcc gtcttttccg gattgatgct ttccacctgg     32880
     gcggcaaggt ggcgaacata gctgtcggta acgccgagca gcttggcagt ctcggtgctg     32940
     ctgaaccgcc gtagcgattt gcgggcgtcg ggcgaaaaca accgctcgaa cagcacctgc     33000
     aattggctgc tgagcatcgt cgagtcctgc gcgatcgtct cgtcgatcga gactcgactc     33060
     gctctcttgg ctttctcaac aatcgcggcc ttagtcggca ttcacgcaaa tcctgataaa     33120
     tcgggtcatt ttgcgcaaat gatcgtgagt ctgccgactc cgtcaagcga tttcttggtt     33180
     agccaatgga taacagacag gattcaacga aaaaatcatg tggaattccg gaatcttagc     33240
     tcaattgtca gctgacaatg gcggcggtgc ccgcacccgt cgatgccaga cgctaacgca     33300
     gttgccgact caccggaaaa caacatccac tgcttgagca cgtcggacca gacaatccgt     33360
     ttctcattta taggcagatg aacggcacag gctttcggtt tccatcccgc ggacaggttc     33420
     gttgccggcg gacttgtcat ttgtgtcctg ggttgcggca tcgcgccgtg gctgcgcaag     33480
     gccgagcatt tgttccagac ggccagcatt gagcggagcg cttattccct tgaaattcat     33540
     gatccatctt tcgtctgcgc atcgattgcg tgaagccttg gagataagcg caatttgaag     33600
     ccgccgagaa ccgccagccg gcgttatcac catcttttcc aagcacgcgc gaaggggagg     33660
     ggagagcccc atcttcaagc gccgatccga aacgcgacct ttggcggcga cgctcgccgc     33720
     tcgggtctct tccccgcgca aggatagaag agtggcgcgc aggagcggcc tgacatgcga     33780
     aaggccccat cttatcggca ccggcgaact gggctatctc ggatcatgcg gcatcgccag     33840
     aatttggaga ctgcgatttg ggttttacca caggcaaggg tgctgctgcg gaccaacggg     33900
     ggaggggacc cgcagcccga attttcgtgc cgatcgaagt cagggagata ctgggaggct     33960
     ggcgtcaagg ggttccggtt cgtttgtacg cagatccgat aatcgccagg ccaggtcaat     34020
     ggcaccagtc tagtcacgtg ccgggttgag cgcgaacagg gttgcagaca tcccaggccg     34080
     tcatcaaccg ccacgatgaa tacagcgcat gctaggcgaa tcaggtttcg gcgagtatca     34140
     tcgacagtgc tcgcagcaat cgtaccgaga tattgctgac gttattgggt agcccgggca     34200
     accagatctc acctccaagt tggcaaagcc gccgtcttct agcggaactt attggcgagt     34260
     tcgcttccgt ccacggaatt ccttcttgtt tacctgctat ttaccataac gcggcacgcc     34320
     ggcggcaaaa ccccatcgcg gatcgcaagc atcgcggccg atccagcgtt ccttacgtag     34380
     agtggcgcga ggcaggcatt ccactatcgc accttcgtgc cctcgcgatt ggtaaagtgc     34440
     gcattgccca accccgtgcc tatggtcagc acagcccatc tcgacacgtc gctcataaaa     34500
     gggatctgcg acaatccctg cacgactgca tcgttgtgca tcatcacgaa tgtgctgtcg     34560
     tcgccgatct caggaatggc cttcatcagt gcggcgggaa ggttgaaact gtcgctctcc     34620
     cagtttccgc ccggcaggtt ttgtccgcca cgttcgattg aaccatcggc tttgatgatg     34680
     ccggggcatg cgatcccgat gatcggcgct ggcttgagat tggccttctc ggccttgccg     34740
     atcagatccc gcaacatcgc cgccaacctt tcgatcgtgg cggtgcggct tggctcatcg     34800
     tcggcatgac gccagatggt ggattcccag acgcttgcat ccgcgaaatt cggcacgtcg     34860
     tcctttccga atttaacgac gccggcgcga acgttcgtgc cgccgatatc aacggcgagg     34920
     atcgcctcgt ggcccttgaa catccagcgc ggcatcaggt ggatcgcacc gatcagtccg     34980
     gcctcatcgg ggtgatgtac gatcggcacg acttcgacgt cgacgccggc cgctttaaga     35040
     atgaccatgg tcctggcgat tgtcagttcg ccaaagtggc tccgacgaaa gccgccgcca     35100
     acgacgatgc gttctgtctt tccccagcct ttgtctttca gaaactttgc tatcacatcg     35160
     gcaaagtctt gcgcaaaatc ctccactgcc cccatgacca acgccgccgc cgccaaatca     35220
     tcgcccttca aaatagcgtc gatttttttc ttggagagtt tctccgtcgc ggtcttgccg     35280
     atcgggtcgt ctccaacctt gcggatgcgt tttctccaat cgtcgagctt ttgttggaac     35340
     gtctttttgt tggcgttgtc gccaacgaag ccatccttgt cacgcagttc gttattgtaa     35400
     tcgtcgatcg ctaccaatgg caggtttaaa gcgccatgtg ccaacggggc attgatctca     35460
     tcacggggat cggaactgct tttggccatc aatgtacctt ctacggcgcg agtgctcgaa     35520
     cgggcggcga gatacaacgc gaactatcct ctggatgttc cggactctga aaaatcacct     35580
     tgcccttgcc ggttggcgac ctagcttcaa tgattgcaga gtttggagaa tgccgtgcag     35640
     gacgatgccg ctacacagga aatgctttca ctggtcttgg aggaaccgga ccgctgggca     35700
     atgtttctcg atatcgacgg aacgctgctc aatcttgcac ccacaccgga tgcgatagag     35760
     gttccagagg cgcttcctgg acaacttcat cgcctgtcga acaagctcgg cggcgccttg     35820
     gcgctggtca ccggacggtc tcttgcttat gcagacgcgc tgttcaaacc ctttgcattt     35880
     ccgacagcag gcctgcacgg cgccgaaatc aggaacgccg ccggaatgca gacggtcgag     35940
     gcgacacctg agtttcaggc gttgaaacat gcgctgaccg ctgaagccga gcactaccct     36000
     ggcgtcctga tcgaggacaa gggcgcggcc gttgccgccc actaccggct ggcgccggaa     36060
     tatgaaaagg tgctcgaaga ccgcatgcac cactatgcgg agctcgccgg gccgaactgg     36120
     gcattgcagc tcggcaagat ggtattcgag ctgcgcccgg cacggtcgag caagggcgat     36180
     gcgctggagc ggttcttcca gtccgacccg ttcaagaacc gctcgccgat taccattggc     36240
     gatgatctga ccgacgagtc gatgtttgcg atcgccaatg cgcgtggtgg cgtttccgtg     36300
     cgtgtcggcg cgatcggcgc tcccagctgc gccacgagcc ggctgtcctc ttctgcgctg     36360
     gtcagaaacg tgattgccgc cttggccgcc tgaggtacgc cgttggacga tgtgcatgcg     36420
     ggttgctgtc gtctttacac cggctgcgca gtgtcaattg tcaaaaaagt atcggtttta     36480
     cccgggaatc gtggtggcgg gcacgacgcg agaccattac actctcctta acaataaagc     36540
     caaaaaggga atttggcgga cggcctggaa cagtccttgg aggaggaaac aatggaaccc     36600
     gacttggaag tggttcagat ccggcccggc gaatctttcg cgacgaaggc gcatggctat     36660
     ccctaccata cggttcgctg gcattttcat ccggaatacg aacttcatct cgtcgtggcg     36720
     acgacgggac gctatttcgt cggcgacttc atcggcgaat ttgaaccggg caaccttgtg     36780
     cttgccggac ctaatcttcc ccataactgg atcagcgatg tcccgaaagg atcgagcatt     36840
     ccgcttcgat gccagctcat ccagttcagc gagaatttca tcagcggtac tatgaaggtg     36900
     ctggccgaac tcgggccctt cgatccggtt cttgaagcct cgcggcgcgg cgtgctcttc     36960
     ggcgccgata ccagccggca ggtggctccc ctgatgaacg aggtgcagca ggcacacggt     37020
     gtgcgtcgta tcgagctgtt catgatgatc gtcggcctgc tcagccgggc gcaggattcc     37080
     cagcttctcg ccagcccgag ctatctgccc gatccatctg gctacatgtc tgccggcatc     37140
     aacaaggcgc tcgcctatat cagagagaac ctgacgaaat ccttcgacga agccgatctg     37200
     gcgacgattg ctgaccagtc gactggcgcc ttttcgcgcg cattccgccg ccataccggc     37260
     atgtcgctgg tacagtatgt gaaacgcctg cgcatcaatc tcgcctgcca gatcctgatg     37320
     agcgatgacc acgcatcgat caccgatatc tgcttcgagg tcggcttcaa caatctgtcc     37380
     aacttcaacc ggcagtttct cgcggaaaag ggcatgacgc cttctcgctt caggcggttg     37440
     ttgggcgaca atatcaacgt ggcaaaggcg gcctagagga gccgaacgag cacgtccaaa     37500
     ggacgaggga ggacgaggag gaggaaccaa tactgacact gacttgaacg ggggcacgcg     37560
     atgagcggct cgcgattgga aatgcttgtc ctcaaaaacg tcaaaccgcc ggggcaggcg     37620
     cgaccgttcc ttcagccgaa cggccacagc agaacagtgc gatcacacac aattttttca     37680
     acgggaggag atggaaatga tgaaattctc aacaaaggcg gcaggcgccg cggtatttgt     37740
     cctgtccttg cttggtggta cttccgcctt tgcgcaaacc gccgttgcgg atgcgacagt     37800
     ggcattcctc atgcccgacc agggatcgac ccgctacgag gagcacgacc acccgggctt     37860
     cgtcgcggaa atgaagaagc tttgtgcgtc gtgcaaggtt ctctatcaga acgccgatgc     37920
     cgatatcgca aaacaacagc aacagttcaa ttcggccatc acgcaaggcg ccaaagtcat     37980
     cgtgctggac ccggtggatt cggcggccgc cgcatcgctc gtccagcttg cacagagcca     38040
     gggcgtcaag gtcattgcct atgaccgccc gatcccgaaa ggcaaggccg atttttacgt     38100
     ctccttcgac aacaaggcga tcggcaaggc aattgcggaa tcgctcgtcc agcatctgaa     38160
     ggcgcagaac gtgccgaccg atggcggcgg catcctgcag atcaatggtt cgccgaccga     38220
     tgcggctgcc gggctgatca aggacggcat tcaccagggt ctggcgagcg gcggttacaa     38280
     gacgcttgcc gaatttgaca cgccgaactg gcagcccgcg aacgcccagc aatgggcggg     38340
     cggccagatc acccgtttcg gcaaacagat cgtcggcgtg gtcgctgcca atgacggcac     38400
     tgggggtggc gccatcgcag ccttcaaggc agcaggtgtc gatccggtgc cgccggtcac     38460
     cggcaatgat gcgacgatcg cggcactaca gctgatcatc gcaggggatc agtacaatac     38520
     gatttcaaag ccgagcgaaa tcgtcgccgc tgccgctgcc gacgtcgccg tgaagcttct     38580
     ggccggagaa acgatcaagg ccgaaatgac gctctacgac acgccggcgc agctcttcgt     38640
     ccctgccgtc gttactgctg aaaacctcaa ggccgagatc atcgacaaga agatcaacac     38700
     cgccgaggaa ctgtgcaccg gccgctatgc cgacggctgc aagaagctcg gcatcaccaa     38760
     ataatagagc caagggaatg cgcggccgga ccaccggtcg cgcttccgat ttttcctttt     38820
     tcgaaaggcc aggcgatgtc tgaaacctct catactcctg acccttcccg tcagcctgtc     38880
     ctcagtctgc gtggaatatc gaagaacttc ggggcagtgt cggcgctcac cgatatcgac     38940
     ctcgacgtgt atgccggcga ggtggtggcg ctggtgggcg acaacggcgc tggcaaatcg     39000
     acgctggtca agatcctggc cggcgtgcat cagccaagtt cgggcacgat cttcttcgaa     39060
     agcaagccgg ccaacctgtc gagcccaagt gctgcgctcg acctcggcat cgcaaccgtc     39120
     ttccaggatc tggcgctttg cgaaaatctg gacgtcgtcg ccaatatctt cctcggcaag     39180
     gaactcaacc catttcagct ggatgaggtt gcgatggaga ttgccgcctg gaagctcttg     39240
     aacgagctct cggcccgcat tccgagcgtg cgcgaacctg ttgcctcact ctccggcgga     39300
     cagcgccaga cggtcgcgat cgcccgatcg ctgctgctcg agccgaaact tatcatgctc     39360
     gacgaaccta cagctgcgct gggcgttgcc cagaccgccg aggtgctcga cctcatcgag     39420
     cgcgtgcgtg agcgcggcct cgccgtcatc atgatcagcc acaatatgga ggatgttcgt     39480
     gccgtcgcgg accgaattgt cgtccttcgg ctcggccgca acaacggcac catgctgccc     39540
     gacgcatcca atgagcagct cgtcagcgcc atcaccggtg catccaacaa ttccgtctcc     39600
     cgccgcgcgt cgcgccgcca ggcgcaaagc caacagaacg aggagggcag gccatgatga     39660
     agaccatcca gaatgagccg gcggcacctg cgcttcttga ccgaagtgac gaaagagtgc     39720
     gccatgacga tagccttacc ggctcgatcc gcgcctttgg ggatcgcatc cgctcaggcg     39780
     atctcggttc gctgccggtc attgtcggcc tggcgatcat ctggacggtg ttccaggcgc     39840
     tcaatccggt gtttctctcg agcagcaacc tcgtcaacat gctgttcgac tgctcgacgg     39900
     tcggtgtcat ctcactcggc atcgtctgca tcctgatggt gggtgagatc gacctttccg     39960
     tcggctccgt cagcggcttc gcctcggcac tggtcggcgt cttctgggtc aaccagggct     40020
     ggccggtggt tctcgcggtc ctcgccgcca tgatcgtcgg cgtcctgatc ggctcgctct     40080
     acgcatttct cttcaaccgc ttcggcatgc cgagcttcgt gtcgacgctg tccgggctgc     40140
     tcgcggttct cggcctgcag ctctatatcc tcggagcgac cggttcgatc aatcttccct     40200
     atggttcctg gctcgtgagt ttcggtcaga tcatggtcat gccggacccg atcgcctatc     40260
     tgctggtggc acttgccggc attgccttct tcttcgctag ctaccgcacc tcggcgcgcc     40320
     ggcgggcggc cggcctgtca gcgaaatcgg cccgggggct gcttctacgc gccgtcatca     40380
     tcacactcgc cctggaagct gtcgcgttct atcttaacca gtcgcgcggc attccgtgga     40440
     tgttcggcct tttcgtcggg ctcaccagcg cgatgaatta tgcgctgacg cgcaccaaat     40500
     ggggacgctc gatgcatgcc gtcggcggca acagggaggc cgcccgtcgt tccggcatca     40560
     acgtctcgcg catctatacg agcgctttcg tcatgtgcgc tctgcttgcg gcaaccggcg     40620
     gcgttctctc cgccgcacgg ctggcgacgg caagtcagca agccggcacc ggcgacgtca     40680
     atctcaatgc catcgccgca gcagttatcg gcggcacgag cctgtttggc gggcgaggca     40740
     gtgcctattc agcccttctc ggcatcatcg tcattcagtc gattgccagc gggctgacgc     40800
     ttctcgatct gtcatcgtca cttcgataca tgatcaccgg cgctgtcctt gccgtcgccg     40860
     tcatcgtcga ctcgctggca cgccgctcgc gaatttcgca cggccgagcc taaagcaact     40920
     gagaaaacag aggaagaaaa tgggacagga tctgtctgga aaagtcgcgg ccgtcaccgg     40980
     agcggcgtcg ggtatcggcc tggaatgcgc caaggctttg cttgccgccg gcgttcgggt     41040
     ggtgctggtc gaccgtaacg aggaagcgtt gcgggaaatc tgctcgaaac tcgacgccaa     41100
     cgccattccc ttggtcatcg atctcaccga tccgaaaagc gtcgaacgga tgatgcctga     41160
     gatactggaa aaaaccggcc aactggatat cttccacgcc aatgccggct cttatatcgg     41220
     cggcgaagtg ctgggcggag atcctgatgc ctgggaccgg atgctcaatc tgaacatcaa     41280
     cgccgcattc cgttcggtgc atgccgtcct gccgcatatg gtcgagcgca agaccgggga     41340
     tatcatcctg acgagttccg ttgccggcat gatccctgtc gtctgggagc cgatctacac     41400
     cgcctcgaaa cacgcggtcc aggcattcgt ccacacgctg cggcggcagg tagccaagca     41460
     tggcttgcgc gtcggcgccg tcgctccagg ccccgtggtc acggcccttc tcagcgattg     41520
     gccgcaggag aagttggacg aggcgctcgc agccggcggc ctgatggagg cgaacgaagt     41580
     ggccgaagcc gtgctcttca tgctgacgcg cccacgcaac attacgatcc gcgatctcgt     41640
     catcctgccg cagcgcgccg acatctgacg aaagtgcatc cgtcttcaac actcgcgaac     41700
     ccactcaaga ggaaacggcc atgatcttcg acagatttcg cctgaacgga caggtggcgc     41760
     tggtgaccgg cggcacgcgc ggcatcgggc ttgccatcgc cgaggcgctc ggcgaggcgg     41820
     gcgccaaagt catcatcacg ggcagaaccc gcaatctggc cgcggaagac cagctctcca     41880
     gggtcggcgt cgattgcgat ttcatcgccg tcgacctgat gaaggaaagc gctgccgacg     41940
     aactcgtcgc tgagactctt tcgcgggcgg ggcggctcga catcctcgtc aacaatgccg     42000
     gcatcgccat tcacggcgac agcggcgaat tctccgatgc catctggcgc gaaatcatga     42060
     cggttaacgt cgacgccgtc tttcgcgcct gccgcgccgc attagcaccg atgcggcgcc     42120
     aaggcggcgg cgccatcctc aatatcggct cgatatcggg catcgtgtcc aacattcccc     42180
     agaaccaggt cgcctataac acctcgaagg cggcggtcca catgatgacg aagagcctcg     42240
     ccagcgaggt tgccgctgaa aacatccgcg tcaacgccat cgcccccggc tatatcgaga     42300
     ccgatctgtc gcgcggcggc atcgacaatc ccgactggtt cccgacctgg cgcagcatga     42360
     ccccgatggg acgcgtcggg cagccggagg aggtggcggg tgccgcattg ttcctctgct     42420
     cggcggcagc aagttatgtc accggcgaag tgctggttat cgacggcggt tatacaacgc     42480
     gctgaaaccc gaagacgggg agggcggctc gcagccgctt ggttggtgcg agcggccgat     42540
     tatcctccgc gcgcgatgtt ctgattgtga cacagatgca gacacttcgc ggctatcggg     42600
     gccttatcgt ctcacgctcg cgcgcagtcc gaaaaccgct cccgtttttc ggcatcgtgc     42660
     tctaatttag gcaatccagc atccactgga cgccaaagcg atcggtgagc ttaccataat     42720
     agcttcccca tggctggacg gcgagtggtg tcgtgatctt gccgccctcg gccagccgtg     42780
     caaagaggct ggcggtactg tcgcggtctt ccatgatcag catgtgggcg gagcctcgca     42840
     tcggctcggc gtcatgattg tccgaagcga agaaaagaac gtcgggtcct tcgaagcggg     42900
     catgcatcac cttcccgcgc atggcttcgg gggcagcgga cattccgtct gcaccgtgcc     42960
     gcttcaattg cgtgacttgg ccaagcccgc attcggtgta gaaagcaagc gcttgctcgc     43020
     agccgttggc gaagaacaag tagttggcaa gctgcatggc ttcactcccg taccgttccg     43080
     gaccatgacg cctcagtgac ccggcccggc gcagcgggtc cggggctttt gcgcattcca     43140
     cagtcattgc gtcgcgccac cttggatagc ggcgacaaga tcggcattgc tatagctgcg     43200
     gctggcgatg ccccacgccc cctcgggcgc gtagatgatg ttcgaccata tgtgttctcg     43260
     cctgagccgg ccctcggcgg cttgttcgac gacgtcggct gctttttcga agaaggcctg     43320
     cctggtctct gcacttacca gcgcaatctc aggcagcttg agttcgatga aagccgcagc     43380
     aatcggcttt cccgcagcaa gcacatgctc gcgcggcagc acgttgatgg tgccgatgac     43440
     attggcagtc atgaaagtgt tgccggtcaa gcccgcggca tcaagcaacg cgtctgtcaa     43500
     tcctgcaaaa gcctgcgcct ggccctccag cgagagcagg ccttcaggta cggtgagcgt     43560
     gatgggcatc ggattgtctc cctgtttgaa ccatgaccgt ttttgatata taccgatcgc     43620
     tctttattca tacacatcga tcactctctt agcaagacat aaagagtgct cgctcttaaa     43680
     aaggacggac atgcgctaca gtgccgagca taagcaggag acccgaacgc gggtcattgc     43740
     cgcggctgga cgggttttca gacaggaagg ctatggcggt gcgggcatcg attcattgac     43800
     caaggcggca ggcgtgacca acggcgcctt ctacggacat ttcaagtcca agggcgaagc     43860
     ctttcgaacc gccgtgctaa ccggcctaga agagctgcgg caaggaattg cgggattaaa     43920
     ggccagtcaa ccgaaagact ggctggcgac attcgtcggc tactatctcg gctataaaag     43980
     aacctgcgat ctgggtgaga gctgcgctct gccgagcctt tcccccgacg tggtgcgcgc     44040
     agacgatgaa acacgaagcg cctatacggt ggaactcaaa cgtctcatcg aggaaattgc     44100
     cgtcggcttg ccggagggtg aggtatcggg tcaacctcaa acgcgccggg aagaccaggc     44160
     gatcttgctg ctcgccatgc tcagtggcgg tgtgaccctc gcccgcgctg cttccgaccc     44220
     ggcgctgtcc aaacgcattg cagacgtcat cgcgaaggct gcgctgacgg cgatagaccc     44280
     tggaaactga tccctccctc agggcagcgc gggcttgaaa tccgtggagg gggtctcgaa     44340
     gacaaatcgc ggctcggcgt cgagaagcgc agtcagttcc gccgcacatc gcttcggcgc     44400
     gacctcagcc agataaaatt tgcaaaggta tggtgatttc gaactcggta ccggcgccgg     44460
     tcgctcgcag caggcggatc gtgccaccat gggagctcag catggcgccg acgatactga     44520
     ggcccatacc ggtgccaccc tgttcgcggc gcgttgagta aaacggctga aagatgcgtt     44580
     ggcgatttac ctcggagata ccgctgccgt cgtcacggac gagaatgacg gcagttcggg     44640
     cgtcggtcga tactctgatt tccaacagcg tggcgccgtg ctgaagagcg ttgtcggcaa     44700
     gattggcaaa gacgatgccg gctgcctcct ggggaagagc aaccgatatt tccgtatcac     44760
     ctgagccgga aacacggagg gcgggaaacc gtccgcgcag tgaggataaa atgtcggtga     44820
     cgctgctttt gccttcggcc acgggcgttt ccgcctgggc aagctccctt agccgctgca     44880
     acaacgcgtc gagccggacg gcatcggcga cgatgttgtc gagaaagtgc aaacgctgca     44940
     ccttcgtcat cggcttttcg gcatcatcgt cacgcagaag ctccgccgcg ccgcggatcg     45000
     ccgtcagcgg cgatttcagt tcatgggaga catgggcggc aaaggaacgc acgtattcgg     45060
     tgcgatcgac cagttttccg gcaagatcaa ggaagctttg cgacagcaca gcgatctcgc     45120
     gcgttccata gctttccagc ggccggattg ctcccttgcc gccgcgggcg atctcttccg     45180
     ttcgggcgat caaagcgtcg ataggccctg tgatggtgcg cgtcagcaca taagcaacgc     45240
     cgagcgtcag catgacgacg acggcgaggg cgccgatttc cgccggcgcc atccggttcg     45300
     aactcgcttc cacggcgcga aaccagatga cgatcaggat tggcagcgcc atgaccgcga     45360
     gaagcacggc gtagacaatc agcgccagtg tcggccgcca tttcgtcctg actttcggtg     45420
     ccgacatcag gccttcctcc cgatttcacg gccgagtttg aagccgatgc cgcgaacggt     45480
     tgcgataatc ccctggccgc cggccaccag gaacttggcc cggatgttgc ggatatggct     45540
     gtcaatcgtc cggtcagcaa cataggtacc ggcgccatag gccgcttcca tcagttgttc     45600
     gcggctgaag accatatcgg ggcgtgacaa caatgcgtcc aggattgcga attcaagcgc     45660
     ggtcattgcg atggtgttct cgccaaacat gaccgtcctg ccgcggcgat ccaggctgag     45720
     ctcaccggcg acaagggtgg cgtggcgtct gtcaggctct gccccattgc tgctgcgctt     45780
     caaaatcgcc ttgaccctag ccacgagttc gcgcgggctg aacggtttgg tgacataatc     45840
     gtctccacct atttcgagac ccagtatcct gtcgatctcc tcgtcacgcg ccgaaagaaa     45900
     caggatcggc aatcccgacg tcttgcggat ctggcgacag acttcaagac cgtccatctc     45960
     gggcatgccg atatcgagta tgatgagatc gatgttgcca cggcggaagg ccgccatcgc     46020
     ctcggtgccg ttgcgggctg ccatccaggc caggccagcg cgctcaaggg cgaagcagat     46080
     cacgtcgcgg atgtgaggtt cgtcatcgac gacgagaatg cggggcgcca tcaccggtcc     46140
     tgcgttgata tgtcgtgcct gttgttatcg ttctcgcact atcttgcaat ggcggcagga     46200
     gacagaagat aggtctccag ccgcgaagaa cgaaaactcc agctccgcca gtcgcggggg     46260
     cgatgctcga atttccagac gagcgagccc cggataagct gtgcttcgct gatcttgtcg     46320
     gttctgtatt ccggtagcgc gcggatatgg agatcaaggg ccggaatggc ggaagggcca     46380
     agcgtggaga gataataaat atcgagcggc gggccatcgt ggctgatctc ctggctgtgg     46440
     gcgacattga agcgggcgat gacatcaggg agatcaatga aggcactgat atagagcacg     46500
     gcaatcaggg aagcgaggtt ggcggcgatc agccactcgt tggatcggtt gaacagaatg     46560
     cgcagcagga tcaagacaag gccgatagcg acgaggccca tccagagacc ggcggcaacg     46620
     cgcagttccg tcagcgaata ggcctcgacg taaagtccaa gccgcagcat cgaggacagg     46680
     cagagaagga cgttctggcc gatccaggcg tggacgaggc cgcggatcag cgaactttga     46740
     tcgccggggc cgccgcgacg catggcgagg agaacaaaac cggcggccag aagcgccgtc     46800
     gcaatcagcg gataggcgcc gcgatgagca tattcggcat ggctcatgtg atcgggcagg     46860
     tctgcgccgc cccagagata gacgagatcg agaagtgtct gcacggcaaa gagggcgttg     46920
     aagaggaaca gcgaccgcag cagggaggcc tggccgagcg gtgcattcct ggtcggcacg     46980
     atgacgaacg ccctgccggc ttgcgacctc gcagtgcgac gcttcaggcg cggccgcaat     47040
     agcgcccaga tcacagcggc gatcatcatc cagaagccga tccgccacag gtcgagaaac     47100
     tgcaacagaa cggcaaaacg gatactgcgc aacgcgatct cgataagtgg gttcgccgct     47160
     gcaaagagga acacgaagac tgcggcgaga gcgagcggca tgatccagag gccgacgccc     47220
     tgccaaacga cggtgaagga gaaacgtttg gccggcgcct tgagatattt cctaaaatcg     47280
     tcggcaagcc gcaagggaat gatgagagtg aaacggagaa acaccagcgg tagaccggtc     47340
     agattgcgag gcataagcct ggcgccgacg agagcaaccg ctatcagcgc gctgaggcaa     47400
     agggcgatgc cggttagtga gggggcttcc agtagaggtg ccgatgccag aaccgaaaaa     47460
     ccaaacagga gagcagcgat tgacggcgcg cggatcttcc cggccaaaag tagaattccg     47520
     gcgcagacgg cgagcgcaaa caggaaaagg tttatgccgg gcatctcacc aaagatcaga     47580
     aaatcagcca gcgccaccag cgcaaacagg ccgacaattc ggctactgcc acgcctgatg     47640
     ggcattgctt ccgtcagcgt gtcggttgtg tccattggtg ctcctctcgt agatgccgct     47700
     tttcgatgac gatgagcatg tctaccgggc tggcgttaga ggcggtttct cgcggccagc     47760
     ctgcctccgt cagccaccat ccgtcattgc ggaggcgatc tggcaaagcg ggcggtgtga     47820
     cgccgggcgg gatgtggctc ttgctcatgg cggaagaatg ccgcgccgaa ttgcagattt     47880
     tgtgcagaga gtaagcagca tttcaggaaa atcgctcgga cccatcaggg tatgcagtgg     47940
     ccctatcaac cacatcccgt atggaaaccg ctatcgatgc cagcggcgtg atcccgacca     48000
     gataaggcgg cagacccgat ggccgtaaga tcggcaatgc cccgtctaac cgcgtgtcct     48060
     cgccatcggc gatcagcaaa gcctggccaa tggcatcggc cagccgggtg gacggctgtc     48120
     gcagatatgg gccgcaggcg acggtctctc cgacggccag ggaaaatgcc gtggcaggat     48180
     gaagagcgtc acccgatcag gcggtgtctt gcaccaccgt ctcgttcacg tgcgaagata     48240
     tcgaagaaat ggagaaggcc ttatctgaac cttggcgcgc gcttggcatt gtgaagcaat     48300
     tcggaggcgg tcgcgaacgg cccgaagagt ttgagcagca gcgcttgttc ctcggcatct     48360
     atgcggtgac gagcgcagaa ctccgtcacc gaccagactt tggtcagatc gtctgtttcg     48420
     acttgcctgg gttcgatgtg ttcggtcaac ggcgtgtcct ccgaacatcg agactacgcc     48480
     acgccggcat ttataagaac tagctaaaaa gagctatgcc gatctgcaga ccttcaaccg     48540
     aatatgattg aaccccgcct ttaccgcgtg cgtaacaagc ggacatacga agacgcccgc     48600
     cgattgcgcg gcgggcggtg tgtctcactg attattgcaa ctgatcaagc aagatgcgcg     48660
     tcggtgcccg tgatgttgag cgtcagaatg ccagcgtccg tgtggccttc gccatcggag     48720
     atcttgtagt actggacggt ttccgtgacg ttctggccgg cagccaggtc ttccgtcagc     48780
     gtataggtga attcgccatt cggcttgacg tggaagatgc catggtcgcc gacgatgtcg     48840
     gtaacagcgt cgaggccgct tttggcgctg acgttcgtgc cgtcgaactg acggaggaag     48900
     agcttgccgt tgtcgccggc aatgtcgttg tccagaacgt tgccgccgat ggcgctacct     48960
     tcgttgaagc tgtagtggtc gtcgacagca atcggcttta cctgggttac gccctggatg     49020
     ttcagggtga agaggccgac atcggtatga ccgctgccgt cggaaatctt gtaggaaacc     49080
     ttctcctggt acgattcgcc gttggcaaag ccaatcttgg cagcgtcgct gaggacatag     49140
     gtgtagctgc catccggctt aacgaagaag gtgccgtagt cgccctggat ctcggtgacc     49200
     tggctgttgc cggccttggc gccaacgctc gcgccatcga aggcgcgcag gaagagatgg     49260
     ccgttgtcgg atgaatcgtt ggaaagcaga tttccggaaa taatatcggt ttctttgaaa     49320
     gttgcactat catcagttgc atgtatcggc gaagccatag ctctctcctc aaattgttta     49380
     ttggcgggtc aatttcgacc tcagcgagcc gctcctttaa caacctatta atactacaag     49440
     tcaatggcct atttaacaga aggttaattt cgacgcggaa ctccccgttg cttccattcc     49500
     ggcgaaataa tgtcacattc aagccaaatt gaaggaaatt cggcagaaac tatacccggc     49560
     taacttgaat aaaatggcgc agagtatatc tgaaggcgat tggcgatgcc cgcgccatgc     49620
     catccgggct atgcgttgca attgtgctcg ccgagcccta tgttgctgac gtacccgatc     49680
     caagcgaaga tctcagccgt tgccggctgg tgactgaggc gcttatgcat cggcgcgcgc     49740
     cctaaggctg cgtgatgggc aatcccacaa acaatcgata acgccggcca aggctggcaa     49800
     aggatttctt tttgaacaac acacatacag ccaccgtggt tgcggcggcg aatccgcgtg     49860
     aggatatcga ggctgtccgc agtgctccca ggaactggaa gccgtttccc tgccttctca     49920
     cccgccgcga attgcaggct ctgatcgccg agcagctcgg ctgagcgacg atcagagcat     49980
     cacccaaaca aggagaactc gaaatgcagg tcctcgtcag agacaataat gtcgatcaag     50040
     cgctcagggt cttgaaaaag aaaatgcagc gcgaaggtct gttccgtgaa atgaaggaaa     50100
     ggcgcgccta tgaaaagccg tccgaacggc gcgtcaggga aaaggcgcag gcgatcagcc     50160
     ggcagcgcaa ggctacgcgc aagaagatgc agcgtgaagg cctgctgccc ggcccgaagc     50220
     ggacggccgc tgcccggtaa cggcctcatc ccaccggcct tcccgggctt tggtggttac     50280
     attacctgaa aggatagaca atggacgaac tcaatagcct caccgtttcg gaagaacgca     50340
     tcgaggattg ccgcgatgtc gtggagccgg atttgcagga tttgatccaa cgcaccctga     50400
     catcaggctt ttccctggag gaaatcctca tcgccgtcag cgaactggtg gccgaagact     50460
     ttgcgatggt catgaaaaca ccgagcgtcc attgatcgac tgtgtgtctc gaccgcctcg     50520
     ggaatgagct cattaggccc gccaccggga acatagacct cggcagatgg ttacctcgtc     50580
     tcttgctcag atggagatga tgatggctaa cagcgacgag gcgacacggg tatgggaatt     50640
     gatcgacaag atcgggtttt gcatgctgac gacccgcagc ggcgacgatc tgcgagcccg     50700
     cccgatgtcc gcctacaccg cgcagctcga gaatgcgatc tattttctga cggatgtcag     50760
     tagtcacaag gacgatgaga tcgcccgctg gccaaacgtg tgcctggcct ttgccgacac     50820
     caagggacag aaatatgttt ccgtatcggg gacggccgag gtgcagaacg accgggcgaa     50880
     gatcagggaa ttatgggcga cgccggcaaa ggcgtggtgg gacaatcccg acgatccttc     50940
     catccgcatc ctcaagatga ccccgtcttc ggccgaatat tgggacagcc caggcacgat     51000
     catcagctat atcaagatgg ccgccgccgc ggtctcgaac agcaaacctg acatgggcga     51060
     caatgccgag gtcaagctct aacgcataga agcgctcaac gacgttccct cggccgaaaa     51120
     atatcaagcc tgattggctg ttaacaggca ccctggtggg ctcatccacg gcatgaccat     51180
     gcttgcgatc gatgggctct cggtgcccga gaaacttccc gtgatgcagg ttcagtcgag     51240
     cgagaactca gcgcgagtcc aaaagcatga agttagtgtg agagagcttg ctagcaaacc     51300
     gatcattggt ccagcctcgc agctgcaacc gcgtgcggca tcaggaatgc ggcaatctcc     51360
     gcgatgacgt ctgtcagatc gccaggattg tgtgcaacgc cttcaatgaa agcgcgccat     51420
     tgccgctgct tttgctggtc cttgccaaag gcgtccgtta gggcgtcagg taggttggtg     51480
     gggatcgatg tctcgcggcg cttaaaggta gcggcgattg cacgcgccag ccgatcatcg     51540
     ctgaagtcga aagacctgct gaggatccaa atgtcgtaga aatccttcat gcggctgtct     51600
     actcgcccca gcatcaccat ggcctgaaac ttctcggcaa tgaccgtttc ccgcgcatag     51660
     gcccggagcc gcggcatcgg aaaatcgagc atggaaggat aatccaggat ctccactccc     51720
     ggctcaagcg catcgccaaa cccgatgtcg atcgtcaggt tgatccgggc tccactgatc     51780
     gtagcgatca cccgcagcct gagcccacca tagtccagtg cctcgcgaat gcgatccaca     51840
     tgcagcgtat cgggatcgaa cgtgacgcca tcgtcggcct cttgcgccag aatttccaaa     51900
     aatgtctcaa gcatcgggtc cggactcgga tcaccgaaac ccaaaagatc gaggtcgcgc     51960
     gtgcctcggt gcgggtcgtc gaaccaactc attatcaaca tcgccccttt tagaacgaag     52020
     cgattggcgt ggggcgactg actgagccgg aacaataacc gttcaagagc gaaacgcgtc     52080
     aggaccagat caaagctttg cccgcttgcc ttggcgaggt gcaacaggcg ggctcgcacc     52140
     gaggcgccga cgtttctgat ttccttagcc attggcggtc agcgcctcga ggtacggccg     52200
     gatcacggat ccgacgccac cgcgttcggc ctggttggcg atttcgccag gactagtcct     52260
     tcgttgccgc agtgcctcct gcagcccctc catcgctatc gaaaggccga tcttgttgcg     52320
     atagcgaaag caatcggcga ttgtcttggc tattccaaag accttcacgg gaacgccttc     52380
     gatgacatgg gtttcgacgc tttcgttgag aaggctttcg gtgaaacgta cgatgcgcat     52440
     agcgggaccg tccggtttcg gggcccagtc cttacggcct atggcaagcc agatttgtct     52500
     cggaagctga tccgtcaggc cgtggaatgc caaggccgaa acgaggcaga taacggcttt     52560
     cggcgcgcgt ttggcaacct ctgccatact gtggttgaca tcaagctccg catcaggaag     52620
     ttggtagaga ccgcgggcaa gccgcagcac ctcgccatcc cgttccattc ggctcattgt     52680
     ggcccctgtc acacctgcat tacgcagttc cctcaaacgt gctattccgc gctccgttag     52740
     cacggtccgg gcgatttggc gttgagtgtc ggaactgggc attgatataa aagctcggag     52800
     aatgggatct gttgtcctag gatttgtatc acgatcccta aaggcgagaa agccatcgct     52860
     tcgtgaattc tttcaccgtg aatagttgtc tcgattggat gagaactgca aacccggtgg     52920
     ttggcgagag caggggtgta gcctcgccga gacggacacc tagccaagtg acgcgtgaaa     52980
     gcaatcgtgg ccattggtgg gacaatcccg acgatccttc catccgcatc ctcaagatga     53040
     cccccgtctt cggccgaata ttgggacagg cacgatcatc agctatatca agatggccgc     53100
     cgccgcggcc tcgaacagca aacctgacat gggcgacaat gccgagatca agctctaacg     53160
     catagaagcg ctcaacgacg ttccctctgg ccgaaaaata tcaagtctga ttggctgatg     53220
     ccttgacgaa gtcgatgaat gcccgaagcg gtgccggcac cagccgacgt ccgggataat     53280
     agaggaacgg cccggaaaat cgctgccacc aaggttcgag gatgggctcg agcgcacctc     53340
     tgtcgaaatg cggacgcagc cagtcctcga agaggcagac gatccctgtt cctgctatcg     53400
     ctgcatcgac ggccaggtcg gtcgcgccgc cgacccgcac gatcagcggt cccgttggat     53460
     cgacccgcac gatctcgcca tcgcgctcga actcccaggg cgccgtcatc gcaccgctgt     53520
     cgaaacggcc caatatgcag gcgtgagcga gcagttcgct cgggtgttgc agacggccac     53580
     ggcgatccag gtagtcgggg gaggctgcga tggcaaagcg ctggatgcgt gggccgatcg     53640
     gtatggcgat catatcctgc tccagccgct cgtcatagcg gatgccggca tcgcagcctg     53700
     ccgcgatgac atcgacaaag ctctcgtcgg tcaccacctc cagccgaata tcgggatagg     53760
     cggcgaggaa cggtgggacg atggcgggca gtaccagccg cgccgcgctg accggcacat     53820
     tgaggcgcaa ggcacccgcc ggcctgtcgc gaaatccatt gacgacgtcg agggcagctt     53880
     ccacctcgct caaagcaggg ccgagccgcg ccagcaagcc cttgcccgct tcggtcggca     53940
     cgacgctgcg cgtcgtgcgg ttgagcagcc tgacaccgag ctggccctcc aggcggcgca     54000
     ccgcttcact gaggaaagag gcgctgctgc cgctgacgcg cgcgccctcg cggaaaccac     54060
     cggcacgcgc caccgcaacg aaagcattga gatcgcccag atctgtcttc actgttcgcc     54120
     actccgcaca gcccgtgcag attatagcca attttcatac gccccgacaa tgtttatctt     54180
     gggggtgtca tctattgaaa ggagtacact catgtccact atcgatcagt ccggcacgtt     54240
     caacctcggc ggccgcagcg tgaagcggct cggctatggc gccatgcagc ttgccgggcc     54300
     cggcgtgttc ggaccaccca aagatcatgg tgcggccttg gccgtcttgc gagaagcggt     54360
     cgcgagcggg gtaaaccaca tcgacaccag cgacttctac ggcccgcacg tcaccaacca     54420
     gatcatccgc gaagcactgc acccctatcg cgacgatctc gtcatcgtca ccaagatcgg     54480
     cgcccggcgc ggcgcggatg gatcgtggat tccggccttc tcgcgcgaag agctgacgga     54540
     ggcagtgcac gacaacctcc gcaatctcgg cctcgatgtg cttgatatcg tcaacctcag     54600
     gatcatgttc gacgtgcacg gtccggccga agggtcgatc gaagcgccgc taacggtgct     54660
     cgccgatctg cagcggcagg gcctggtgcg tcacgtcggg ctgagcaacg tcacatccaa     54720
     gcagattacc gaagggcgtg ggatcaccga gattgtctgc gtgcagaacc agtacaatct     54780
     ggcgcatcgg gccgacgatg ccctgatcga cgatctggcg taccacggca ttgcctatgt     54840
     accattcttt ccgctcggcg gcttcagccc gctgcagtct tccactctgt ctgatgtcgc     54900
     cgcagggctc aatgccacgc cgatgcaggt ggcgctcgcc tggctgctgc atcgggcgaa     54960
     aaacatcctg ctgatccccg gcacttcgtc cgtcggccat ctcagagaaa acctcgccgc     55020
     cgccgggctc gtgctgccgg atggggctct caagcagttg gacggcgttg ctggcagcgc     55080
     cgcctgaggc actccgaaag cgcaggcgcg acgtcacgct cttaacgcgt gctcaggctt     55140
     tcgcccagtt gcaggctgat gacttccgtt ggtggagcga gaggtcgcag gccctcgccg     55200
     tccatgtaaa gaaccctgtc ggcggcagcg atagtttcct gccggtgagc gacgacgatg     55260
     cgagtaatgc cgagtgagcg tatggaatga ttgacgcgcg cctcgttggc ggcgtccatg     55320
     tgagacgtgc cttcatccag gaaaagcatt ttcggctttc gataaagcgc gcgcgccagc     55380
     agcacgcgct gcttctggcc gccggagagg ctcgatccca tgtcgccgac gagggtttca     55440
     tattgcatcg gcattttcat gatctcgtcg tggattgccg aagcgcgtgc ggcatcggcg     55500
     atggctgcgg gatcggcctg ctcggcaaac agcgtgatat tgtccgctat cgacccggcg     55560
     aagagattgt cgtcctgcag gacggctgcg atctgatccc gaaagctctt gtgaccgaac     55620
     tgctggaggg ggagaccgtc aacggccacc tcgccggatt gaggcaacag cagcccgagc     55680
     atcaccttca ggagtgtcga tttacccatg cctgacggcc cggtgatggc cacatgttcg     55740
     ccggcttcga cggaaaggtc gatctcctgg agaacgaagg ggtcggttgg ggaatagcgg     55800
     taggaaacgc ttttgagctc catgcgtcct tttaattccg tgacggccat ggaaccggcg     55860
     gcaaagcttc tgtcatcctc ctccagggcg atatcggcca agcgttccag atgcagccgc     55920
     aacatcaaga acgccatgcc ctgatcgacg agattgccgg ccttgtcgag gaactgacct     55980
     ttataggcga ggtaggcgaa aaccatgccg acgctgaagc cgccattcat gatgaagccg     56040
     attgccagat agatggtgac gacattctcc aggccgaaca acaaggcatt gccggtcgtt     56100
     tgccagatgc ctatgcgcga ggagcggatg ttggcgttga cggcatccgt caacaacgtc     56160
     tgccacatgg catgccgcat cgtttcacta ttgtagagac gaaaggtctg gatgccgcgt     56220
     atcgtttcga taagggctgt ctgctccttg ccgtgggcga tgatactgcc ttcctgcgcg     56280
     cggcgttcga acgagaagga tatcaggcga acgacgaaat agagaaagaa ggcggtcaag     56340
     gcgatcattg cgagcttggc actgtagaag aacatgattg ccagagtcgt cagcgcaagc     56400
     agtccatcca ccagcgttcc cgcaacgcct tccgtcagca tcttctgtat cggcgtcacc     56460
     gactggaagc gggacaggat gtcgccgacc tcccgcttct ggaaccagtc gagcggcagc     56520
     cggaacagtt tcctggcgat attcgaggcg atgccgaaac ctaacgcgga gcccgccgcc     56580
     aggatcacga aggagcgaag gaaactcgcg ctggtattga aggcggtgaa gagcccgaaa     56640
     ccaagcgcaa gcaccgcaag cagatcgtgg tcgagcgccg gcagcgcgtt gtctatgccg     56700
     acctgcaggt agtagggcag ggcaagcacg tagatctgga gcacgacgct gaggacgatg     56760
     acctgaagga acgagcttcc gagcccgttg atccgcgtcc agagctgcga ccagcgcaac     56820
     accgtacgct ccgttatctt ctcgaatgct tcgtttggcc tcaactccag cgcaacgccg     56880
     gtaaagtggt ccgatacctc agacatttga agccattcac tgcgaccagc cggatcgtgg     56940
     atcagcgcct tgtcacccga aacccgctcg atgacgacat aatggttcat gttccagtgg     57000
     aggatcgccg gcaatgcgag attgggcagc tcttccagcg gcagcttgac ggcgcgaggc     57060
     aggaggccga cttggtctgc gatcttgatc aggctcgaca gcggggctcc ccgaaatgac     57120
     ggggtgaaac gtcggcgcat cgtcgccaga tcaacgtcgt gcccgtaaaa gctcgccatc     57180
     attgccagac aggccagacc gcattcgctg acctcattct gacgaatgag acgaattcgt     57240
     gaatttgaaa agaacccggc ctgaagtgct ttggaagaca atcgcaggtc ctatcgtcgt     57300
     tgaagggcga acaacggctc gaacagccat tccagtagag attggcgcgc ggtcgcaatc     57360
     cgggcggaca aggtcatgcc gggaaacagc gcctgctgct ttccgaaggc cgtgatgctc     57420
     tgtcgctcaa ggtcgaccgt cacgagatag ttcaggttgg tgctcgcgcc gctgccacgg     57480
     ttgatcgggc ttttcgacag gctcttgacg cgacctgcga tcgtcccgaa gctctggtaa     57540
     gggaaggtat cgatcgccag ccgtacctcc tgcccgacct cgacaaaacc gacggcggcg     57600
     ttgggcacgt ccagttgcgc atgcaatgtt gcattcagcg gcacgacgct catgagcgcc     57660
     tgctgcgtgt tcagcggctc gccgatcttg gccgtgaggg cagaaaccgt accgccgatc     57720
     ggcgatctga tcacataggc acgggactgt tcattggtgg cgaggccgcg attgatatcc     57780
     tcacgctgcg actggagtgc tgcgaccttc tcgtttgagc gcgccttgac ctgatcgagc     57840
     attcgttcgg catcggagag atccgaccgc cgttccgtca acgtgctttc cagcaccgcc     57900
     atttgctggc gccgctcggt gagcgaatct tctctcaaag tcacgtctcg tcgtggaacg     57960
     atacccttgt cgaccaggcc gcgaatgcgc tcgacatctt tctcgatcga ggtgatcagt     58020
     tccttttgca aggcgatctg gctttgaagc ttgtcgatct gcgtctggta gccggatatc     58080
     tgggcgctaa attgcgccgt ttgggcaatt tcatcatttt tgacttccgc cagctgctcg     58140
     ctgatgctcg cattctgccg gtcgagcatt tcggcgactt tttcggaggc tgattcaccg     58200
     ctgaccaggt agtcctcgga gcgcacggcc accagttcct ggccttcttc gacttgatcg     58260
     ccgtctgcga ccatcatctt catgatgacg cccgggcgcg agggcatgac gaccgccacg     58320
     cccttgtccg gctggataat gccggttgcg gtgacaatgc gggaatagct tgcgatggaa     58380
     agaaagatca gaacaacgat gaggatgccg gccatcagat agccggtgac gtgccacccc     58440
     attggtaccg ccatcgacac cgttcccgtt aaacgctggg actgccgttc gagggcttct     58500
     cggcgaaaca ggctcattga gatcagatat ggtcgttagg ggaaggaagg gtgccccgcc     58560
     attccggcgg agccccatgt tttaaagctt aggcaaaggc tctcgccagt ctgtagacac     58620
     cgtagacgcc aagggcagcg ccaccgaccg caagcgctcc gacgccgaag gcggaaatgc     58680
     ccacgcccgc gccgatcgcc gcggcgtacc cgagagcgcc accacctgcg agtgcggctg     58740
     ccccgtcgat tgcgccccga acaccggagc tgacgccacc gccggatacg tgttccatct     58800
     cggcgctgga aagttctttg ataccctgca cttaactcac catttgcttg tttcgggaag     58860
     gtagtcgaaa acactacgtg cacgggaaaa ttaggtagca tcaagaaagc gtcaacctgc     58920
     agacgatgac ttttgaagac cgggacagga ttaaatatag gattcaatca taacggccgg     58980
     gagatttacg cctcccggcc gttgaaaacg tcacaggcct ttcaagccag acgataacat     59040
     caggatgatt tcttgacgaa aagctcgtag gcgacaaagg tcgcgaccat tgccaggaaa     59100
     accccgatcg ccagcggata attggcagcg gcattcgggt cggtcagctt gggaatgccg     59160
     atgacggcgc ctgccgccaa gaccgccgat aacgcaactt cctgcacgat caattttgag     59220
     aaggctgtca tgattgacct cctgtcgcct cggtcttctc cacccaaagc ggagcccagt     59280
     ccttctgctt caccacgctg ccgatcagga agcatagcgg ctcgccgata aggcgcacca     59340
     ccttgccgcc aagcgagccc ttcggacggc gcccggcctg gtaggcaatc tccagagccc     59400
     gcgctctggc gagaggatac atgatttttt ccgcgagcgg gcttcggcgc atcaggtgga     59460
     cataggggat cgcccaatat tgatatccac gaaccgtcgt ttgcgacaga gactgatagg     59520
     tgaattccag atccgcccgc caaagatcgc ggtcaagcat gccgcgtcgg aagaaatgcg     59580
     tgcagatgac acgaccgctg ctattgccgc cgccggagag gccgccatta tatatgctgc     59640
     ccgacgcccc tgctgcgaac cctgcagtgc cggcaatccc ggctttgccc agacttccgg     59700
     tggtcgcaaa agtgccgccg gctgcgtatg ttccgcctat cagcccacga tcgacatggc     59760
     cgacccatga gccggcaccg ttcacggcgt cgatttcaaa atcttcaagg ggatggatgt     59820
     aatatccgct ggtatctgca ttaacactct gaacgtcaac cataggtgcc tccgaggtaa     59880
     agccaaaacc cgccatatcc ggcgcgccaa ggggaggtta gagcaatcag ggagagtatc     59940
     aaggctttgt tctcgcggtt tatactcggc gagcgagcat atttcgcgcg ccattgccga     60000
     aacgcccctg aatccagtgc tttgacaaga aggccagcgg atcgattttt tttgccttgc     60060
     cgccgagttt gcggctgaga aatagctcga tttcgcgggc gcgcaccagt ttggtttgcc     60120
     agccggcata gccatggccc tcccgatcga agtatagcgc cgtgacatcg cgacccgtct     60180
     cgcgcaacgc cttctcgaag gctttcgtct gttggcaacc gacgaccgga tcttccattc     60240
     cggcggtgag cagaaacgat ccgcgcaatt tctttgcatt gtggagcggc gagaattcct     60300
     gcatctgcgt gagatcgccg ggatcatcag gattgccgaa gtagcggatg acctggccga     60360
     ggaacaaccc ccagccgacc gggttgttct gcatctggta gggcagatcc aggatcgcgt     60420
     agtcgatgat tgccgcggaa aagagcttgt cgtcggccat tgccagcgcg gccatgaaac     60480
     ctccgtagct ttcgccggcg accgcaagct tgccttcagc cgcgatgcct tgggcgagca     60540
     gccatcgccc ggcatcggcg atatcgtcct gcatctttcg cccaaactgc cgatagccca     60600
     gagattggta cctcttcccg aagccggtcg agccgcgata gttgactgac aaggtcgcgt     60660
     atccgcggct tgcgagaaag ctcttctcga tgttgtaacc ccagctgtcg tggcgcgccg     60720
     ggccgccgtg agccattacg acggtcggca caggatgagg tgagccagcc ggaagcgtca     60780
     acaatgctgg tatctcctca ccatctccgg ccgtgaagta gacaggcttc gtaactgccg     60840
     aaaatgccga cttgcgcttt tccgccggcg cggaaagcag cgtcttgctc ttatccgcca     60900
     agtttaacag atagtgctgg tagggtcgtt catcatagga gatcgcgacc gtgagcagcg     60960
     caccagcctt ggaagaacct gagatttcga cgtcggcatg cccgttgcga tccagaacca     61020
     gctcagtgaa gatcgttcct ctttccgaaa gggcgatata tcgtggatag ccgtcgcgaa     61080
     tgacggcgac gtcagccggt tcggtgggcg tgaagcgcag cgcgtctgaa acatcgacat     61140
     cgccgtcctc gaccagcacg gtttctccac cggtaaccgg gtccagcgaa actaacgcga     61200
     tcttgtcccg ctgacggttg gaaagcgcct cgaaggcatt gcctgacctg tccgtacgcc     61260
     agatgaccag cgtgtcatcc ggctcgagtg tcgccatctc tcgccacggc ttgtcggcgt     61320
     taattcggtg aaggtatcgc ctcattcccg aggcagtcag ctcgacgcga atgcatggaa     61380
     cctgcgcctc attcaacaac cagctttcgg tcgagccgtt gttttgttcc aagagccgct     61440
     tgtcgcgtcc gtccgcactg gttgcataga gatcggcgac ggcggggctg cgatcgtaag     61500
     aaaccaggaa ttggttgtct gcggcgtgtc gagggtcgac gatcacctgc cacgtttgga     61560
     aatctcgtgg agtaacgtcg gtgcgtgtcc cgggtcgcct gggatctact tcccacagac     61620
     ggtctttctc ggtgagaacc aaaaggtcag cgtattgccg ccagccaaag tgggaaaggg     61680
     cacctttgaa cgtggcgatg atgttgagtt ctccgccgga aaattctccg acgaagacgg     61740
     cgcgagcgcc gcgtttggag ccccaccatg cgatgagggc gccgtcgaaa cttggttcgt     61800
     atccccacgt ggcacgtcta tcggcgtaaa atcggctact ggaaagcaag catttccctc     61860
     actcgtccac tctgaggcac ggtcgacgga acctcactct tgaagcggaa cctagtgtcg     61920
     ggcggggaat ggtccagagg cagcacgccg cgagagccgc cccctgaaga tcagggcgcg     61980
     gcgaatgcca tgctttcaat agcgctccgg cacgagcatt tcaggcggaa ccggcgccct     62040
     gttgtaatcg gcgtgacgga tgcggtccgg caactggatc tcgggttttg gaacatcctc     62100
     gtaagggatc tgctcgagaa gatgggcgat gcagttcaaa cgcgcccgtt tcttgtctac     62160
     cgcctgcacc acccaccaag gtgcatcctc cgtgtgtgtc cgcgccagca tctcttcctt     62220
     ggctttggtg tattcctccc aatggacccg gctttccata tccatcggtg agagcttcca     62280
     ttgcttcagc ggatcgtgga tacgcatctt gaagcgaaat tcctgctcct cgtcggtgat     62340
     cgaaaaccag tatttgatca acacgatacc agaacggacc agcattcgct cgaattcagg     62400
     caccgagcgg aagaactcct cgagttcttc gtcggtgcag aaacccatca cgcgctcgac     62460
     accggcgcga ttgtaccagc ttcggtcgaa gaggaccatt tcgccaccgg tcggaagatg     62520
     cgggacataa cgctgaaaat accattgatg gcgttcccgc tcggtaggag cgggcagcgc     62580
     gaccgtccgg cagacgcgcg gattgagccg ctgggtcacg cgcttgatcg cgcctccctt     62640
     gccggccgaa tcccggcctt cgaaaagcac aaccaccttc agcttcttgt gctgaaccca     62700
     atcctgcagc cgcaccagtt cgtgctgcag acggaaaagc tcccggaagt agatctttcg     62760
     ctcgagcgtc tgctctgccg gttccgacat tccttcggcg accagatcgt caagccggtc     62820
     ttcctccatc tgcatttcca gctcttcatc gaagctgtcg gcgatttcgg cctttatacg     62880
     gctgagttgg tcctgaggtg tttgagacat gggctttccc ttcctgcttt ttttgacagg     62940
     agcatggcac tgcgaagttt gtgtgacggt tcaggtacgg aaagctggat tgtcctacgc     63000
     cacggccttg acggcgatgt ctcacttccc ggtctggcgc caacgcgcgg cagcctgctt     63060
     catcagcttg gcgtattcca cctccgtggc atcatccagc gggaacatgc actcgatcct     63120
     caattcctgg gtcgttatcg tctgcgcagt gccgaccgtg gtcaccagcg agaagaagct     63180
     gaaaacctgc ccgtccttga cgaaggacaa ggggatgacg ggtgtgctgt ccgctgtcgt     63240
     cgagaccttc caggcactgt ccacattcgg ataggcgagg agcgcatcga tcagcgcctt     63300
     cgtgtgcatg tcaatgacgc ggcccacgga ctctctgaat acccgcgcca tcagactttc     63360
     tgcagtttcc tcccagtttg ggatgaaggg ccgcaaaccg gccggatcga acatcagatg     63420
     cagcagattg cgcggttttt cccgtgccgc catgtcaatg aagttattga agaagccctg     63480
     cgtcgcgtcg ttcgtcatga cgacgttcca ataccgatcc atgacaactg ccggaaacgg     63540
     ctcgtgctga acaagcatgc gccttaacgc gcccgtgacg cctttcattt caacatcgtc     63600
     gataccgcct tcggcgtaaa tcggggcgta accggcggcg agcaataacg tattgcgctc     63660
     tcgcaacggc acatcaaggg cgtcggcgag atgcagcaga ttgtggcggc cgggcgtgct     63720
     tcggccactt tcgatgaagc tgatctgacg ctgcgatatg ccggtgtcga gtgagagatc     63780
     cagttggctc ttgccgcgcg tgtcgcgcca ggcgcgcaac tggatgccaa gctcgttcgg     63840
     tactgcgctt gaaggactgt gcgtcgagct catcttatgg cgatctccgt ctgtgtggct     63900
     aatggccggc gggggcaata acgctcccgc cagctgcgat atcgatcaga aagcaaccgg     63960
     gccaaccgat ccgtaccagc agccgacctt ggccggctct cgttcatcca tatagaagaa     64020
     gtgcgtcatc accggtttga caaccggttg agcctcgtcg tcgggcgtca ttgtgacagt     64080
     cccgcgaaag attttcagcg agccgccgtc ccaatattcc gcgacgtcgt gaagcgctga     64140
     gaaacccgtg tcgatgaagg cgcgcaggtt ctcacgaatg gagtctcgcc ccttccagtc     64200
     ggcgacgccc agattgcagg tcgcatcctg tgccaggcag tcaaagcctc cgccaaaggt     64260
     cttgtcatcg atctccttcc agaaggccaa cagccattca gggggttctc gtttggtaaa     64320
     attcatggtc gtcatcgtcg ttctcctcgg ccgctttgta cgggtgacgg cagttgagcc     64380
     atcgacatcg gttgtcggcc gcttctgttg acaggattgt tcctcctgca ggaaggccgt     64440
     tcactaatat cgcgggacag ggaatgccct caattacatc aggtgtaatc aacggggcga     64500
     gaatgcgtcg tccttcaaat tctcggcaaa gaacgcacat ccggaccttt cattctgcac     64560
     aaagcgcttt cgtaactttt gttgtgtcga ataacgggat atgttaccaa tcgtgtcagt     64620
     gtcatggaaa tcacacgggt atcgaaggcc aaggttatga atgatgtagt cgatacggtg     64680
     gtggtcggcg gcggggccgc ggggctcagc gccgcccttt ttttgggaag agccggccga     64740
     tcgacgcttg tattcgacgg cggtaaatcg cgcattttca gcgttgaaga ggtgcgggag     64800
     catctgggct tcgacggcat gccgacagca gcgttcatgg cgcaagcgcg tgcggaagcc     64860
     gtccgttacg gtgcggacat cagatccgag cacgtccatt ccatcgtgcc tcgtgaggac     64920
     ggattgttct gggtcgaagc cacgggatcc agagtcgcag cacgcacgat cgtcttggca     64980
     acgggagtga tagacgacct tccaccactg tcaggcttgc cggaagcgtg ggggcgtgac     65040
     gtgcgtgtct gcccctgttt tgacggctat gaagttcgag gcaagcgttt cgtggtgttc     65100
     ggattgccgg aacgcctggc gcatatggcg tcctgggtct ggatgtggtc gcgtgatgtc     65160
     actatcgtct cacggcacag gttcaatgaa gccgacgcgg aacgcttgcg gcttctcgat     65220
     atcaacatca ttccggacga aatcaccggg ctcgtccatc gagacggcaa gcttgttggc     65280
     gtttcgacgg cgagcggcgg cggggaaatc gcctgcgatg cgacatggat cgcggcggag     65340
     attcgggctg catcgggcct cgccgcatcc ctctgcgagg tcgatgagat cggtctcgcc     65400
     aggaccgaca aggatggccg gaccagcagg tcgggcgtgt ttgccgttgg caatgcggat     65460
     aacgcggtcg ctcatcttgc gcatgcatct gcggcaggca cagctgtcgg tcccgtggtg     65520
     acgatgtacc tcctcgaaca gatccttgcc gagcgccgaa acaccaaagc ggcgtgaacg     65580
     atctagcagt tcagccgttg cgggcgccta cagccgtcct gtccggtact ggtcgacaag     65640
     attccggcag gcgcggatcg tcaggaccat gacggtgagc gtggtgccgg cgatgccgct     65700
     gccggggaag gcgctggcgt cggtgacgat gaggttcggg gcatcccaga gctgattata     65760
     ggggttgaga accgaagcct cacgggtttc gcccatgcgc gcgccgcccg tctcatggat     65820
     tgccgctccc atgcacatgg tcttgcgaaa ccatttgcgg aacatgaagc ggctgaagac     65880
     atcggcttcg ggaaatgcgc ccttgcccat ctccttgagg ccggtcggcg agccgatgaa     65940
     ttcgaggtcg ccgccgacct ccttgatcaa tgcgatcagc gtttcttcct gccttctgag     66000
     cagcgcctgc tcctcctcct gcatgacgca gcggatatgc ggcacgggaa tgttccaggc     66060
     atccctacgc ctgacatcga gcgtgatgcg attgtcggca tagggcagca tgcggccgaa     66120
     gccgaagaag gcgagacgtg catccgtgtc cacggagacc ggcgcgcggc cgacgcttcc     66180
     ctggtagtcg aaatcgccgc gggccgcgtc gctctcgccg aagcggggaa tgaagatccc     66240
     gcccgacgga ttatagaacg ggtcggtcgg cgcggactcg tcgggcgccc aaccctttgc     66300
     cttggagaag gagccgaagg cgaggcatgg aagctggtcc atgaaatagc ggccgagagc     66360
     gcccgaactg ttgccgagcc catcaggatg tttcgccgac gccgaattca agagcagccg     66420
     cacgctctct atcggcgagg ccgaaagcac caccgtcgcg gcgcgaaccg tcgataccgc     66480
     accggtgttg cgatcgatat attcggcgcc ggtagcgcgg ccggtcttct cgtccgtggt     66540
     gatgcggcga acgacggcgt cgtagcggat ggtcagctca ccggtcgcct ttgcatctcg     66600
     cagcggtcgc ggcatccggt cggcgtcagg cgcgatgtag cgccaggaga cgacgtgcct     66660
     ctccggccag cggttttcga ccgcctgctt gaagatctgt tcggcgggcg tcaggcttgc     66720
     cggcttcgca tagatgccat ccggcagcgt ggccacgttg tccttgttgc catagagccc     66780
     gagataggcc tcgacctcgt cgtagaaagg cgccaactca tcataggaga ccggccagtc     66840
     cacacccttt ccggcacgtg agcggatctt gaaatcgtcg tcggtccagc gcagcagcac     66900
     ccggccgaaa ctgtggaggc gcccgccgcc ctggcggccg cggatccaga ggaagggttc     66960
     gcccttcggc gtcgtatagg ggttcttgcg gtcgttgacg aagaagtggc tgaagcgctc     67020
     ggtgaaaaac gccgcgcgcg cctggatcgg ctggcccttg agagtggccc gcgcacgctc     67080
     ccagatattg atgctgcttg ccggcgcctt cttgcggacg ggatcgaaat ccttcggtcc     67140
     gacggcgggg ccggcctcga gcagcagcac cgacaatccc tgtgccgtca gttcctttac     67200
     cgcgaatgaa cccgccgcgc cggaaccgat caccagcgca tcatagacga tctcagacat     67260
     gtcttttcta atcctgtcct tgagcaatcc tcaaaacggc acgaaaagcg ccaggaattg     67320
     cggggaaaca aaggggtggc gcgtcacagc cgcgatccgt cagtgccgaa gagggacgcc     67380
     ttggcgatat cgagcccggg agccacggga tcgccaggct caagcgtgac atcgcccatc     67440
     agccggagcg ataggctctg gtctgcccag tcgaaccaga cgacggcgtc cgaacccatc     67500
     ggctcgacga cggaaacgcg ccccggaatg gttggcaggc cgctcgtggc gccatcgagc     67560
     acaaggtgtt ccgggcgaaa gccgagagta gcaggccctt ctgctgcgtc cgctcggaag     67620
     gaataaccgg agagatcgac agtgaactcc ttgctccgga agagcggcgc gccgttgccg     67680
     ggctcgatcc ggccctcgat gaaattcatc gccggagcgc cgatgaagcc ggcaacgaag     67740
     agattggccg ggcggcggta gatctcggcc ggcgaggcga gttgctggat gacgccgtcg     67800
     cgcatgatgg cgatccggtc ggccagcgtc agggcctcga cctggtcgtg ggtgacatag     67860
     atcatcgtat tgccgaggcg ctggtgcagc ttcttgatct cgacgcgcaa ttcgttgcgc     67920
     agcttggcat cgaggttcga cagtggttcg tcgaacagga agacatccac ttcacgcacc     67980
     agcgcccggc cgatggcgac gcgctggcgc tggccgccgg aaagctcggc cggacgccgg     68040
     tcgagcagct tgtcgagttg gagaagggcg gcggtgcggg aaacacgggc ctcgatttcg     68100
     gccttcggca ggccggcgac gcgaagcccg aaggagaggt tcttgcggac cgacatacgc     68160
     ggatagagcg cgtaggactg gaagaccatg ccgatgccgc ggtccttcgg ctcctcccag     68220
     ctgacgttcc tgcccgagat ccagacctcg cctgatgtga tgtcctggag accggcaatg     68280
     gcgttcagaa gcgtggactt gccgcagccg gaagggccga gcagcaccag gaactctcgc     68340
     gacgcgatgt cgatcgacat cttctcgatc actgtatggt cgccgtaggc gatcttcagg     68400
     tccttgacgg agacggcaga ttgcatggaa gtgttacccc ttgactgcgc cggccgcgat     68460
     gccgcgcacg aaccagcggc cggacaggaa atagatggcg agcggaacga tggcagtgag     68520
     gatcgtcgcc gccatgttca cgttgtaggt ccgctcgccc atcgtggtgt tgacgatatt     68580
     gttgagttgc acggtcatcg gcaggttgtc gcggccggca aagacgagac cgagcaggaa     68640
     gtcgttccag atgccggtga actgcagcat ggagaccacc acgaccatcg gcacggcaat     68700
     cggcagcatg atctcgaaaa agatgcgcca gaagcccgcg ccgtcgacgc gcgccgcctt     68760
     gcagagctcc tccggcacgc tgaggaaata gttgcggaaa agaagcgtca ccagcggcag     68820
     accgaagatg acatgcacga gaatgatgcc agccagcgaa ttataaaggt caatattcgc     68880
     catcgcccgg accatcggat agaggaagat ctggtagggg atgaggccgc cggccatcag     68940
     caggccgaag agcaggtttg ccccgcgcgg ccgccagagc gacagcgcat agccgttgac     69000
     ggcgccgatg aagaccgaga gcgcgaccga gggtagggtg atcgccaccg aattccagaa     69060
     gccgctgcga atgccgacgc agacggttcc catgcaggcc cccgaccagg cggttgccca     69120
     ggcagaaaaa tcgagcgtcg ccggcagggc aaagatctgg ccgagccgga tttcgggcat     69180
     cgatttcagc gaggtaacga ccatggtgta gagcggtaaa aggaagaaaa gcgctgcgac     69240
     gacaaggaag gcatagaggc cgatgcgccc ggcggtgatc tgtgccggct tcgggccgtt     69300
     cggatgaaga cgtgccatca cgcggctccc ttggctttgt cacgcatgtg catgatgtag     69360
     cggaacgggg cgactgcgat gatcacgccg aggacaagca ccgtcgcgcc ggctgtggcg     69420
     aggccgaggt tctggcgccc gaacagattg tccatgatga atttcgccgg cacctccgtc     69480
     gcattgccgg ggccgccatt ggtcatggca acgacgatgt cataggtctt gatcacgccc     69540
     atggcgagca gcatgccggc cgcggccagc gccggcccga gctggggtag gatgatcgag     69600
     acatagatcc gccagacagg gataccgtcg atccgcgccg ccttccattg ctcgccttcg     69660
     atgccgcgca tgccggcgag cgcaatgacc atgacgagcc ccgcgccctg ccatacgccg     69720
     gcaagcacca gcgcatagat cgccatgtcg cgattgacca cccagtcgag gacgaagctt     69780
     tcccagccga gcgaacgcac gctcgcctgg atgccgagcg tcggattgag catccattgc     69840
     cagatcagcc cggtcaccac gaaggacatg gcgtagggat agaggaatat ggtcctgaag     69900
     gcgctttcga agcggatctt gcggtccagc gccgcagcca gcaggaagcc cagcagcaaa     69960
     cagcctgcga cgtatagcac gccgaagatc aacacgtttt gcagcgaggc cagccacttg     70020
     gcggaagaga agagcttcga atactgcgcc aagccgacat aggtcgagga tggaaaaagc     70080
     gtcgaattgg tgaaggacag gcggatcgac caggccatgg tgccgataaa gaccacgacc     70140
     gcgacgaacc atgtcggcaa aagcgcgatg gtcgcggaaa gattgggctt gcgtttgatg     70200
     gacatcggcc agctcgttga cggagtggaa agcagggcgc gccgccgcgc gaggcggcgg     70260
     ctggcagccg tggcgccgac atcaggtcga cgccacgggc tactatccta ctcgaagatg     70320
     gcgaagaaat tcccagctgt ggagaccgta tcgtccgagc cgccgctcca gtattcgtcg     70380
     acgaagtcat cgagcgcgcc aacctgctgg ggcgtcagca cgatcgcctg gtccggcacg     70440
     atcgcaccgg ctgccatcag ctcgacaccc ttctgggcgc agacgtccag cttcgacttg     70500
     tcgacgtcgg cgcgcatcgg aaccgaaccc ttcttgaggg cgaattcgac ctggacggcc     70560
     ggatccatga cgacttcggc gagaagtttc tgcgccttgt cggtctcggc cttgccggtc     70620
     ttggggaacc agagggagtc ggcgatataa accatgccct tcgattccgg cacgatcatg     70680
     cagccataat ccttgcccgg ctccttgccg gcaacggtga attcgccctt ggcccaatcg     70740
     cccatgaact gcacgccggc cttggcggtg atcagcatgg cggtcgcgtc gttccagttg     70800
     cgcccggcgg caccggcatc gacataacca cgcagcttgc cgaggatttc gagggtcttc     70860
     ttcacgcctt cgacggatgc cgggctcttg tccttatcga catagatctt caggaagccg     70920
     tcgatcccga cctgcgagag caggatcatg ttgaagacct tggtttgctg ccagggctgg     70980
     ccaccccaag cgaccggaac catgccggca gccttcagct tgtcgagatc ggcaaagagc     71040
     tcgtcccagg tcttgggctc ttgcgaaata ccggccttct cgaaggcttc cttggaatag     71100
     aagagccagc tttcaccatg ggcgccggtc ggcgcaaggt agaccttgcc gttataggtg     71160
     atgagatcat ggatcgattt cggcagggcg tcagcccatt tgccggcggc cgccacgtcg     71220
     tcgatcggat tgaacaggcc ctggttgatg aaatcggcgg cagcgagacc gatgacgccc     71280
     tgcttggcgc cgggcgcatc accggcgacg atccggtttt ggaaggcggc atcggccgca     71340
     ccgaagccgg cgatcgagga atccttccag acgccgccgc gcttttcgaa ctcggtcttg     71400
     atgacgttga gggcggcagc ttcgccgccc gacgtccagg acgacatgat ctcgatcgtt     71460
     ggcttgtcct cggcatgggc cgaggcgaag agaccggcga atgccacgcc ggcaagaaaa     71520
     agcttcatca tggtcttcat tgttccacct cttgaaaatg ccctctttgc ggggcgttcg     71580
     ttgtcttagg gatgactgtc agcgatagat cggcaggagc gcctgccgga cgagcgtgag     71640
     cccgttggcg atgtcgcgga cgggatcggg cgcggcatcg agttcgagga tcgcccagcc     71700
     ttcataggcc cggtcgcgca gcagccggat ccaggatggc cagtcgaccc gtccgaggcc     71760
     gaagctgcag aaatagggct ggtggcgttc atggatgtgc ttgtcgatcg gcgtatcggc     71820
     gggcatcggg ccgatcgcat ccttccagtg agcgatgatc atgcgctcgt gatggcgatc     71880
     gacgagttgg acgggatcgg agccggcaac gatgatatgg gccgtgtccg ggcacatgtg     71940
     cacgtaggcc gggtcggtca aaagcatcat cagatcgacg tcgcgcgcgg cggcaaagat     72000
     cgagtgcgcc tcggtgtgca gcgccagccg cacgcccctg gcatagaggg tcgcaccaag     72060
     ccggttcaga aaatcggcga tcaccttggc gcggtcgaaa tcatggaatt gcaccggctg     72120
     ggcgccgagc gtctggcgca gcggcgcgcc gatcaccatg atgtcgctgc cgcaggcttt     72180
     caggaagtcg gcatatcgtt ccgccttgtc gatcagcgcg cgctgggcct cgggctcagc     72240
     gaaatcgccg gccgcctcca gttccgcgaa gaagccactg cacagcgtca ggccgcgtct     72300
     tgccagttcg gctgcaaagg cgtcgacgga accataggtc ttgatggcgt cctgccagtt     72360
     gaagggagag aacgtcagct cgacaccggc aacgccggag gcctggacgc tgtcgagtat     72420
     cttgtcccag aagtcacggg gctcggcgcg ggcgtagccg acgatcgcct catggctgtc     72480
     gacgccccag aagccgggat gaaagaatgt cacgagatcg acaccgaagc gcagcctgtc     72540
     agtagccata atttgtccat ttctcgaggc atgacctacc agcgtgcgga agtgccgttc     72600
     cgcatccaat aaatcatggg ttttcaaagc attaagaaat ggcaatcgtt tgccatggct     72660
     agataatagc caagccggtt ttttaagcaa gcgatttttg gcaaacgttt gctataaatc     72720
     gctccctgtc ttagagttgc aaatcgaagc atccgggaga ccgaaataaa catgaataaa     72780
     aacaaggatg tggtgggaga ggagccatcg ggtgcattga tggccgatgt cgcgcggctc     72840
     gccggcgttg cgatatcgac agtcagccgg gcgctcgcca atcccggccg ggtcaacgag     72900
     aagacgcgcg ccaggatcaa tgccgcagcc aggcaactgg gctatacgcc gaacgcgatg     72960
     gcgcgcggcc ttagggtcgg caaatccaac gtcatcatga tcattctgcc gggatcgctc     73020
     tactatggtg cttcccaggt cattccgcag gtgctgcaga gtatcaatca atcgctgatc     73080
     cagggcggct acaacctgat gattgccaac ctcgatcgcg acgaaatttc cgaacggcat     73140
     atcctcgacc tcgccttcgg cggcagcgta cgcggggcca tcatcctgtc gtcgaagctt     73200
     ccggaggtcg acgggcgctc gctggccaat tccggtctgc cgatcgtgtc gatgctgctc     73260
     gacatgagcg atgccggcct gcagagcgtc gtgacgaacg accgcgaagc cgtgcgcgac     73320
     gtcacggccg aactgatccg attgggtcat cggcggtttt tctatcttgc agggcctgaa     73380
     ggcaattatc acgatgtcga gcgttacggc ggcgtgctcg aggcgctcga ggcggcagga     73440
     ttgtccgagg aggcggtgcg tcgctcgggt ggtcatctcg attatcagca cggcttcgac     73500
     attggcgtcc aggcggcgga cgatttcgcc gagttgaccg aaaagccgac agccgtcatc     73560
     gcgaccagcg atgacatggc catttctttt gtcagccgta tccagggcgc gggcttgcgc     73620
     attcccggtg atctgtccgt cgtctctttc gacggctccc cggtctgcga attctgctcg     73680
     ccgccgctct cgacgatcaa gcagccggtg gaagagatgg ggcgcgcggc ggtggatctt     73740
     ctgctcgacg ccattgacca gcggcagaat acggcggcgg ttcgcaccgt catccgaagc     73800
     agccttatcc tgcgcgaaag catcgccgct ccgaagagct gacgatgagg agccgacgac     73860
     gcacagaagc gcatgggaac gcatgccgcg gtcagtcgac cggccttcac ttcacggttg     73920
     gaaagccttg taacggtctt gaaccgttag aaaagcattg tgcattcgtt gaacgcattc     73980
     atagacaaac accgcgggaa agcttaggtt agcgctaggt aataccttta actaaggagg     74040
     cctcatggca tcgccgacct cgctcaaact cgatgatgag ctaaagggcc gcgttcagca     74100
     actggccgag gctcgccgcc gctcgtccca ctggatcatg cgtgaagcta ttgcgcaata     74160
     tgttgagcgc gaggagaagc gtgaggcgct gcgacaggaa acgcttgacg cctggcatga     74220
     atttaaagcg acgggactgc atgtcaccgg cgccgaggtc gaaagctggc tttcgacttg     74280
     gggaactgac gacgagttgt ccgcacccga atgccacaag tagttttctc cccggccgca     74340
     atccgcgacc tcgagcggct ccgagagttc ttacgactga aaaacccatc ggccgccaag     74400
     cgagcaggcg aaactatact caaaggcttg agagccctcg gcgtacatcc ccatattgga     74460
     cgcctcatcg aggacttgcc cgagcaatac cgggagtggc tcatcgattt tggagatagc     74520
     ggatacgtcg ctcgttatcg tattgatggc gatattttga tgatcctcgc ggtacggcat     74580
     cagaaggaag cagggttctg atacggacgc cattgccgac catcggttcc cgcaaggccg     74640
     attacgctcc atcaaaactt cgtctgaccc catcagccca tacgtcgtgc tacgaaaaat     74700
     cacaacaccg ggcgacttga aacttcgggt ctgcgcggtg gaattctgaa attccgagca     74760
     cgcatatgga cctctcgaag atcaagacgc tgatcgactt tgtcggacga tcgaacattg     74820
     ccgagctgac cgtgaccgaa aaggacgtga cggttcggat tttccgcacg tcgccgggtc     74880
     aggaggctgc tgccgagccc gcgcaaaagg caggatcgac gacaagcttt gccgatgatg     74940
     cgggctccga tgcgtcgtcg aggctcgaga aaacttccta tgcggtgaag gcgcctgtct     75000
     tcggcgttct gcaccggacc ccggcacccg gggaaccgcc attcattgca atcggtgacg     75060
     aggtggagga ggggcagacg cttttcatca tcgaggcgat gaaggtcttc aacacgatcg     75120
     ctgcgccgcg gtcagggcgc attacgcacc tcaccgaaat cgacgagggc gaggtcgaga     75180
     ccggcgacct gttggcggag attgcctgat gccggaaacg actgaacgat ccgcgaccga     75240
     ccgcttcgat actgttctga tcgccaatcg tggcgagatc gcagcccgga tccagcgcgc     75300
     ctgccatgag ctcggcctga agacggtcgc catttgctcc gaggccgaca ggcaagcgcc     75360
     ttacggcagc accgccgaca gctttctttg catcggccca tcgaccgccg ccaagagtta     75420
     tctcaatcag gatgccatcc ttctggcggc gcgtcttgcc ggcgcaggcg ccatccatcc     75480
     aggttacggt tttctgtctg aaaacgccgc cttcgccgac gccatcgaaa aggcggggct     75540
     gaccttcatt ggtccgaccg cgtcatcgat tgcgattatg ggcgacaaga tcgcggcaaa     75600
     gcgcgcgatg atggcggccg gcgtgccctg cgttcccggt ccggacacgg cgctgcccga     75660
     tgaccccgcc acgatcgagc gcatagcgct ggaaatcggg tatcccgtca tcatcaaggc     75720
     agccggcggt ggcggcggac gcggcatgcg tgtcgtgccc aaggccgatt tgctgcatga     75780
     agcaattgcg ctgacacggg aggaggcccg caaggccttc ggttccccct cgctctacat     75840
     agagaaattc ttagagcatc cgcgccacat cgagatccag gttatttgcg acgatcacgg     75900
     caatgccgtg tggctgggcc accgggattg ctcgatgcag cgccgccatc agaaagtggt     75960
     ggaggaggcg ccggcgccgg ggatcgcacc cgacatcatc cagccggtcg gtctggcttg     76020
     cgtaaaggcc tgccttcaga tcggctaccg gggcgtcgga accttcgaat tcctctatga     76080
     ggacggcgct ttctatttca tcgagatgaa cacgcgactt caggtcgagc atcccgtcac     76140
     cgagctgacg agtggtgtcg atatcgtcca ggcgcagata agggcggcgc agggccacgt     76200
     tctcgatctc acccaaggcg atgtgacatg cgagggccac tccttcgaat gccgcatcaa     76260
     cgccgaggat ccggaaaatt tcctgccgtc ggcgggtgtc gtcacccatc tggcgttgcc     76320
     gacgggacca ggcatccgcg tcgatacgca tattcatgcc ggctacaagg tctcgcccta     76380
     ttacgactcg ctgatcgcca agctgatcgt tcatgcgccg acgcgggcgg aagcgatggc     76440
     aagaatgcgc gaggcgcttg cgggcactga ggtcgagggg atttccacca acatcccctt     76500
     cctgcgcgcc ctgttcgagg atggcgcgtt cgcgcgcggc gagacggata tccattatct     76560
     cgaacaatgg ctgaaactgc ggaggggggc atgagcgcga tcgatttcag cgatccggcg     76620
     acgattgcat tgctcaccga ggcactgacg gccgccggtg tggacggact tgaaatctcc     76680
     cgaccgggcg gacagcttcg catcgtcgtc gccggaaaag gcggctcccg gatcagctcg     76740
     accggggcga cgtctcctgc tcccggtttg gctcccggct ccgcatcggc cgtcgtgaag     76800
     gcgccgatgg ccggccgctt ctgtgtcgag cacccggccg cctccgccgt gccgcaagat     76860
     ctgccgcgct ccgtatccga tgcggatatc gtcggctttg tcggggtagg gcacatcctg     76920
     cttccccttc gcgccggacg ttccggtgtt ttgaccaggc tgctcgccga gcctggtgcg     76980
     ctggttagct tcggtgatcc tctgttcgaa atcgagctcc agtcatgatc gtcacgacga     77040
     acagacatgc atcgcaacgc gagatcgttc cggccaccaa aagcctggcg cgggtttcct     77100
     cgatcggcgc cagatccttc ctgctcgagg cgcccggcga cttcgatctc atcgcacagc     77160
     ggcggatctg ggctttgtcc cagaccgtga aagactgggc ggaccttgcg gaaaacattc     77220
     cgggcatgac caatctgctg gtgatcttca aggagacgcc cgaggatcct gatgcggtgg     77280
     tcgcccggct gctggaggca tgggagaatg cccgcagcat cgatctcaac ggcaagaccg     77340
     tcgagatccc tgtccattat ggcggcgaat ttgcgacgga tcttccggcc ctttgtaatc     77400
     tctcgggctt gagcgaccgt gaggtcgtcc gcatccatca tgaagcgacc taccgtgtct     77460
     tcgccttggg cagcgctccc ggtttcggtt atctgcatgg tctcgatccg cgcatctaca     77520
     tgccgcgaaa gaccgtgccc tcgctgaaga tgccgaaggg ctgcgtgacc atcggcggta     77580
     tgcagaccgg cgtcgccatg ctcacaggtc ccaacggctg gaattccatc ggcttcgcgg     77640
     cacttgagat gttcgacccc atgttgccga gccccgccat gatggcgccg ggagatacgg     77700
     tgcggttcct gccggcaagg atcgagctat gatcgagatc atggaaagcg gtccgttcaa     77760
     cacagtgcag gatcttggcc gccccggcta tcgcgacatc ggcgtatcgg cgagcggcgc     77820
     gatggatccg cttgcggtcc ggatcggcaa cattctcgtc ggcaacgacg aaaacgcagc     77880
     cgcgatagag gtgcagacct tcccgttcag cctgcgtttc gaacggcgca tcgcctttgc     77940
     cgtgaccggc gcggacggca attctcatct cgacggatcg gaactgcttg cctggtgcgc     78000
     ttatatcgcg gagcccggac agcttctcga actgaaacag ccgccgctac tggcgcgctc     78060
     ctatatttcg ctcggaggcg ggctggacat ccccgttgtc atgggttcgc gaagcacgtc     78120
     gctgcgcggc agcttcgggg gcaatgcagg ccggcctctg gcgaagggcg atcggatcgc     78180
     ggtcggggag gacgcagaaa tgattatgct gccggcctcc gggctcgccg tcgtcgaacc     78240
     ggccgtggcg ctgcgcgaag tcttcccggc tgctgtcgac ggcacactgc cgatccgcgc     78300
     cctaccggcc ggcgagcatg atcttttcgc cggagatggc gaagccttct ggagccagac     78360
     ctggaggatt tcctcgcgaa gcgaccggac gggctatcgc ctgtccggcg agccgatcaa     78420
     gccgacagcg tccatcgaga tgcgctccca cggtgtcgtg cccggcgtga tccaggttcc     78480
     gcccggcggc gaaccgatcg tgcagatgag cgatgccaac accgccggcg gatatccgaa     78540
     gatcgccggc gtgatcgaat gcgatctctg gcggctcggc caagcccgga tcggcgcccg     78600
     gctgaagttc gttcgctcga cgcatgcgga ggcgcgctca gttgaacagg ctgtcgccgg     78660
     ctatgtcgag gacgtcaggc agacatcccg actggtcaag cgcgccttga aggcgatggc     78720
     ctaatgcgtg tagcccaaaa ggccgtcaaa aggaggaact gatgaagatc gatctgaatt     78780
     ccgacatggg cgaaggattc ggtccctacc ggctgtgcga cgacgaagcg atgatgaaac     78840
     ttgtctcgtc ggccaacatc gcctgcggtt tccatggcgg cgacccggat acgatgggac     78900
     gcatggtccg gcttgcgaaa ctgaacggcg tcggcatcgg cgcgcacccc ggtttgcctg     78960
     atcggccggg tttcggccgg cgcgaaatac cgtttccggc agacgagctt cgccagcaga     79020
     tgctctatca gctcggcgca ctgatggcga tcgccaaagc cgagggtgtc actgtctccc     79080
     atatcagctt ccacgcggct atgggcaata tggtcaaccg cgatcctgtg ctggccgatc     79140
     tgatgatgga tgcgatcgcc acggtcgatg ccggcctcgt cgtcttcgtc acttcaggca     79200
     gcgagatcca gcaggcagct cggcgcgcgc gtttgaagac gctggcgctt ttccttgcgg     79260
     accgggctta tgacgctggc ggcagacttg tcgcgcgcgg gctcgctggc gccgtcatca     79320
     aggacgaggc atcggtgcgt gcgcgcgtac ggaaatttct gctcgaagga actgtcgaga     79380
     cgatcgacgg agcggtgatc gcaatgccgg cccgctccat tctcgtccat agcgacacgc     79440
     ccggcgctct cgagcttgcc ggcatcgtgc gcggcgagat cgaagccacg ggtgctgcgc     79500
     tcgcgcctgc cgccgaactc gccgactgac gcaatcccga tcgcccgcgg gcgtttcccg     79560
     ttcccatctc ccatcgaagg accatgtcga tgtccgtcat cgctgaccgc ctgaaaaacg     79620
     tctccatctc cgcatccgcc gccatgaccc agcgcgccag ggaactggcc gccaaaggca     79680
     tcaaagttgt cagcctctcg tcgggcgagc cggatttccc cactccggcg cacgcgatcg     79740
     aggcggccta tggggcagct cttgcaggcg atacgaaata tcctccgatg gacggtacgc     79800
     cggtgctcaa gtcggccatc atccggaagt tcaaacggga caacaatctc gactatgatg     79860
     ccagccagat cgtcgtctcg ggcggcggca agcaggtgat cttcaatgcc atgctggcaa     79920
     cctgcaatcc cggcgacgag gtggtcattc cgacgccctc ctgggtcagc tatgcggata     79980
     tcgtcaagtt cgccggcggt gtcccggtcg ccgtcccgtg ccacgagcag accggcttca     80040
     agctgcaccc cgaggatctg gaggcggcga tcacgccgcg caccaaatgg ctcttcctga     80100
     atttcccgaa caatccgacc ggagccgcct gctcccgggc ggagatggct gccatcgccg     80160
     aggtcatgct gcgacatccc aatgtctgga tcatgaccga cgatatctac gaacacctgg     80220
     tctatgacga cttccagttc tgcacgatcg ccgaagtcga gcccaggctc tatgatcgcg     80280
     tcctgacgat gaacggcgtt tccaaggctt acgcgatgac aggctggcgg ctcggctttt     80340
     gcgccgggcc gaaagagctg atctccgccg tcagcaacgt caacggacag aatggcggcg     80400
     gcatcgcgac gctgacccag gctgcggcga ccgcggcgct cgatggtcct caggatctgt     80460
     tgaaggagcg tgccgcgatc tacaaggaaa gacgcgactt cgttctcgac agattgtctg     80520
     aggtggaagg gctgcgctgc cataggcccg aaggcgcttt ctacatctac cccaatatct     80580
     cggggctgat cggcaagacc agcaagggcg gtcggaagat cgaaaccgat gtcgatttcg     80640
     tcatggcgct cgtcgacgag catcatgtcg cgaccgtgca aggggcggct tacggaatga     80700
     gccccttctt tcgcatttct tacgccacga gcatggagaa actcggcgaa ggatgcgcgc     80760
     gcatagccca gttctgcagg gatatgcgct gatcggcaac gcgctttaga tctgaatttc     80820
     ggatctaaag caaagaaatg gagcatgatg tcgtccgaaa accgctcaca cttttcggca     80880
     tcatgctcta gcgtttcaac cgcgccgtca gctcgagaag gatgtcgcgg acggcaaggg     80940
     ccggttcgga caagggattc tgatcggaca cacacagcga cagggtttct tcgatccgcg     81000
     gcgagacgag ccggcagatc agcggctcgc tcgattccga tacgatgcgg tcggcgatgg     81060
     ctttgggcat gatcgtcgcg ccgagaccgc tgcccaccgc gcgggcgagc gtgcggacga     81120
     tttcgacttc cgccacgact ttcaaattgg tgcgggtgcg cgtgaaggcg gtatcgaccg     81180
     cgcggcgcac gaaattatag gccggcggca acagcagcgg catcccgtcg agactattga     81240
     ccggaaccgg tttcgcatcc gcctcgatcg caaagtcccg atgggcgaca aggaaaaact     81300
     cttcgctcag aatcggctcg aaccggacgc ccttgatcgg tccggttcca tggagaagcg     81360
     ccatctccag ccggccgttc atgatcatct ggctataggt ctggccgacg ctttccgtca     81420
     ggtgcagcag aataccggga tgccgtttgc gggtctccgc caggaggtcg accgacagcg     81480
     tggccgcact gctgaacggc acgagaccga cggacacacg cccggcaagc gaattcccgg     81540
     ctgcggaggc atccgcttgc gcctgctcca tctgccgaag gataatctgc gcatggcgat     81600
     acaccgcgtg tcccgcgtcg gtcatgctga cgccctgctg gctgcggatc agcagcttgt     81660
     ggccgaaatg ctcctccagt gccgcaagct gctggctgag ggccggctgg gcgatgtgca     81720
     aaaggtccgc cgctcgcgtg atgctgccgc tgtcgacgat cacgatgaaa gatttgaggc     81780
     gtctgatgtc catgaggatc ggggtaccgt tctgatctgc gcggcttaca tttgcagaca     81840
     cgcattgctt ttgcaacgcg acgccgtcgc tgctttcctc aggcccggac gcagcaagct     81900
     gaagcccggc atcagctctt tatcttcttc agcagcctgc gccagctcca taaccgttgc     81960
     ttattgctcc agagataatc ggtcttaggc aaggggttta agcttcgcta ctgtctcaat     82020
     caacaacaag ggaacgacaa tgccattctc cgactacaag accgcactgg tgaccggcgc     82080
     atcctccggt atcggcgcag ccgtggttga gcggttccgc cgggagaaca tcgaggtcca     82140
     tgccgttgcc cgcagtgccg aagcgctgca gcagctggcc gcgcggacgg gctgcctcgc     82200
     ccacgtcatc gacgtcaccg accgtcaggc catggcagag ctcacacgtc gggtggagtt     82260
     cgatattctc gtcaacaatg ccggtgtcga ccggccgaag aaattcctgg aagccgacga     82320
     gggcgatatc gatctcatcg tcgacgtcaa tctccgggcg gttctgcaca tctgccggct     82380
     ggtcgtgccc ggtatggtgg cgcgcgaccg cggacatgtc atcaacatct cgtcgatcgc     82440
     cggcgcctat aatttcggcg gcaactcatc ctatcacgcc accaaggcag gggtgagcat     82500
     gctgtccaac cagctgcgca tcgacgcttt cggcaagcgg gtacgggtca cggaaatctg     82560
     ccccggccgg gtcgccactg acatcttcaa tcacgtccac ggcgatgacc ccagcatccg     82620
     cgaacggttc atcgacggct tcgaactgcc gcaggcgacc gatatcgccg acgcgattgc     82680
     cttcgccata gcagcccccg tcgccgtcaa catcggacat atggaaatca caccgacgct     82740
     gcaggtcatg ggcggcctgc agacggcaaa gccccaacct gcggcgaagc tggatcaatc     82800
     cggggagcca aacccgtgag cggtttcgac ctttcggcaa tcctgggaaa tccggaatat     82860
     accgccatgc tgctgcatgg catcgagatg accttcatca tctacgccgg ctcttggtcg     82920
     atggcgatgg cgctggcact tctgctgctg gctttgcgtt tgtcgccctt tcgtttcggt     82980
     gatccgttag tcgctgctta cgtatcctac caccgtaacg tccccaccct ggttcagctg     83040
     atgctgtggt atttcgggat tttcaccctg atgccgagcg gggtagccga atggctggcc     83100
     gtccataatg ccgaggccat cttcgcggtg atcgggctcg ggctctgcca ggcggcctat     83160
     ttcagcgaag atcttcgttc gggcgtgcgc tcggtcagtc caggccagat gcaggcagcc     83220
     cgcgcgcttg gccacggtta tgtctcggcg atgcgtttcg tcatcatgcc gcaaggcgtg     83280
     cgcaacgcgc tgccgccgct catcaatcac agcgtttccc tgttcaagaa cagcagtctc     83340
     gccgtcgtca tcggagcctc ggaactgacg catgccgtca aggaaatcga gaacctcagc     83400
     ttccggacct tcgagatcta cctgatcggc acagttctct acctcttctt ctcgctcgtg     83460
     atcatgagca tcggcgccta tctgtcgatg cgcaccgatc ctgccaggag tgcgcgagca     83520
     tgatccacga catgatcgcc atcgtccaag actactggct gctgctgctg atcggccaat     83580
     atccgaacgg gccgcttggc gggctcgcca acacgctgat cctttcagcg ctcagcatcg     83640
     ctctcgcctt tccggtcagc atcctgttcg cattggcgcg gctctccagg tcgccgctgc     83700
     tgcgctggcc ggtcaccgcg ctcgtctatt tcaccagggg cgtgccgctc ttgatgctca     83760
     tcctgtggag ctatttcctc gttccgctgc tgaccggcgc cgatgtgccg agcttcgtga     83820
     cgatgctgac gacactcgtg gtctatcaaa gcgcgttcct gagcgaagtc gtgcgtgccg     83880
     gcatcgttgc gctcggaccg ggccagatgg acgcgggacg tgcgcttggt cacggttatt     83940
     taggtgcgat gcgcttcatc atcctgccgc aggcgctcta caacatgatc ccgagcatca     84000
     tctccacctt tgtctcaacg atcaaggaca cgacgctcgg ctacgtgatc aacgtgccgg     84060
     acctaacctt tgccgcaagc caggtcaaca accagctcct gacgcagcct ttccaggtct     84120
     tcctcattct ggcgatcgtc tacttcgcca tctgctggac gctcacctac ttcgcaaatc     84180
     gcctcgagcg gagcatcacg cggcggcgtg cgggactttc caaccttcct gccgccgccc     84240
     tggtcgcgcc atcgaaaatc atatcggagc agccatgacc atgtcagttt cagcccagga     84300
     attgcagacg atccggcttt cgcaggtctg caagagctac ggcgactacc cggttctgaa     84360
     ggacatcgat gcacaggtct cgcgcggcga agtcgtggtc atctgcgggc cgtccggttc     84420
     gggaaagtcg acgctgatcc gcacgatcaa tcgcctcgag gagatcaaca gcggatcgat     84480
     tacgctcgac ggccaaaaca ttcatgccgc catgcgggcg aaggaactca atgcgctgcg     84540
     cagccggatc ggcttcgtat ttcagaactt caacctgttt ccgcaccttt cggtggtcga     84600
     aaacgtctcg atgtcgccaa tccgggtgaa aggcgtggcg cctgacgtcg caaaggacaa     84660
     agccctcaag cttctcgatc gggtcggcct tgccgacaag gcccgggcct atcccggtca     84720
     attgtcgggc ggccagcagc agcgggtggc tatcgcccgc gcccttgcca tggaaccgcc     84780
     ggtgatgctg ttcgacgagc cgaccagcgc gctcgatcct gaaatggtcg gcgaagtgct     84840
     ggccgtcatg aagagcctgg cgtccgaagg catgaccatg ctctgcgtca cccacgaaat     84900
     gggtttcgcg cgcgacgtcg cagatcgggt ctggttcatc gatgccggcc agatcctcga     84960
     aatggcgacc cccgaggact tcttcaaaaa tccaagccat ccccgtgcgc agcgattcct     85020
     cgctgatctc aggcattgat accaaccacc aaaaacaaag gagaacagca atgaactgga     85080
     aatgcctaac cctcaccgcc gcatttgccg gcatggcggc cgccttgccc gcaaaagccg     85140
     atcagctcga caacatcatg tcagcgaaaa ccctgcgctg cgcgactttc gccgacgttc     85200
     ctcccttcgc ctctcccgat ccgaagaccc gcgaaatggc cggattcgac gtcgacctct     85260
     gcggcgccat cgccaaggaa ctgggcgtca aggctgaaat caagccagtt tcggtcgagg     85320
     cgcgcgtgcc cgaggtcaag ctcggccgcg tcgacatcac cgttgccaac cttgcctata     85380
     ctctgagccg cgccgagcag atccagttca gcgatcccta ttatctcgcc aaggaaatgc     85440
     tgatcgtgcc ggcggacgat gccggcaaga agaaggccga ttatgcgggc cagcgcatcg     85500
     cctcgaccaa gggttcgacc tccgagatgt cgatcaagct caacaaatcc gacccactga     85560
     ccttccagga taccgcctcg gcctatctag ccgtccagca gggcaaggcg cgcggcatgg     85620
     tggccaacac catgacgacg accaaattcg tcaatgaatc gaagagcaag ggcaaggcaa     85680
     tgcggatgat cgaggagccg atgctgtacc agccgatcgg catcggcatg gccaaggatc     85740
     agccggcgct gaccgccaag atcaacgaga tccttcgcaa gctcgacaca tcgggcgaga     85800
     tcaacaagat ctgggacaag tggctcggtc cggataccga atacaagatg acgcgcaccg     85860
     acaaggtcgt atcgctctcc gagctgaagt tcgacccgat cccgtaagtc gaccggcttc     85920
     ggcgtcatcc accgacaacg tccaaacgaa ttgagacggc ggggcatgcc cgccgtcgac     85980
     caaaaatggg aggcatccgt gatccatatt aaagatatcg ccgaacggcc aagcaaagcc     86040
     gatatcgacg ccgtttccaa attttcaccc gcgacgatcc acgaagccca agggcgccgc     86100
     ggagcccttt cctcccgcct caagcccgtc gactaccgca tgaaactgtg cggcccggcc     86160
     ttcacggtga aatgcgcgcc gcgtgacaac atcatgctgc agctcgccat caactacgca     86220
     aagccgggcg atatcatcgt cgtatcggcg ggcgaatacg aagaggccgg atccttcggc     86280
     gatgtgcttg ccaatgcctg ccttgcaaaa ggtatcggcg gtctcgtgac cgacaccggc     86340
     gtgcgcgaca cgctgcaact gagggagctt ggcttcccgg tcttctcgct cagcgtctgc     86400
     atcaagggga cggtgaagga aaccatcgcg gcggtgaacg acacgatcat cgtcggcggc     86460
     gaaatcatcc atcccggcga catcatcgcc ggtgatgccg acggcctggt ggtcgtgcgt     86520
     cgccaggaag cgcaggaagt cgccaggctg tcacagagcc gcgaagatgc cgaggccggc     86580
     tatatcgcgg catataagca gggcaaatcg gtcatcgagg tcagcaatct cgaaccggtg     86640
     ctgaaagcca agggtctcgt cgtcgacatc tgagacgaca gcgcaatagc catcagccct     86700
     gccactttat aaagcggctg gccttttcgg ccagccgcct tatgcaagaa cgctaccagg     86760
     caggcgccac gcctccaaga tcggtctgga cactattatg gacgcatgtt ctataaaatg     86820
     gacagattcg acgggagctc gccatgcatc tttccatgtg gacttatccc tgggacatcc     86880
     aggaccaggg gcttgcagca ctcgccgccg agcttcgcgg ccgcgccggc ctgaacacgg     86940
     tcagcctggc gacctcctat catgccggcc ggttcctgca gccgcggagc ccgcagcaga     87000
     aggcctattt ccccgaggac gggacggtct acttccggcc ggatgaaagc ctgtggcagg     87060
     acaagctgat ccggccgctg atggctggga atgtcactga gcgcggcgac atgctggaaa     87120
     ccctcgtcca gggacgcgag gcgacgggtc tcaaggtctc ctgctggact gtctgcctgc     87180
     acaatacccg cctcggcatg ctgcatcccg atcatgtgac gcggaacgcc ttcggcaatc     87240
     ccaactatta caatctttgc ccctccagcc cggcggcgcg ggcctatgcc gtcaccctcg     87300
     ttcgcgacat cacgaccaac taccggcccg atatggtgga gctcgagagc ccgaatttca     87360
     tgggcttcgc gcatgaatat catcacgaaa aagacggtgt cggcctgaac gccgaagacg     87420
     atttcctgct gtcgctctgc ttctgcgacc attgcacggc gcgcgccaca aaggccggtg     87480
     tgccggtcga aggcgcgcgc ggatcggtcg cgcgcttcat cgccgaactt tgcgaacgag     87540
     ctatcccgga acggcagttc ccggactttc cggccgccgg catcgatgcc tttcgcgacc     87600
     atccagatct gcatgcctat ctcacctggc gcagcgaacc ggtgaccagc ctgatcgacg     87660
     agatcaaggc ggccgccgat ccggcaaccc gcatcgtgct catcgacctg aaggacggct     87720
     ggctcggcgg cgtcgatctc gcagccgtcg gcaagctctg cgacggggcg atcctctgct     87780
     gttacgacat ggagccggac gccgtcggcg atgtcatccg gaccggccgg gcggcaattg     87840
     gaccgggcaa gttcctcgcc gtgggcctgc gcgtcttcta tcccgaggtc agcgggccgg     87900
     cgatcctggc cgcacgcgcc aaggctgccg tcgatgccgg cgctgacggc gtgaacttct     87960
     acaattacgg cctgataccg gcaaagcgtc tcgactgggt caaggcagcg gtcgacgcaa     88020
     tcgcttgagc agatcagcgc ttctcaggat gcaatgggtt cggcgacctg gatcaggcag     88080
     tcgccggcct ggctgtcgca atgcagcctg tgggaaatga caatgccgct ctcggcaaag     88140
     cgcagctctt cctccggctg ttcgaggcgt tccagatcat gataccatcc ggcaaactcg     88200
     ccggcggcaa cggtggcgcc gagggcaacg gccggctcga accagcctct gtggttcgca     88260
     tggatgccct ggctgtgcct agatagtgaa agcagctgca acggtcccgg ctcggcgagc     88320
     ggcacgcgcg acaggaccgg atgcttcacg atgccgagtg tgacgagcag ccggtcgatc     88380
     gcggccgccg tgaaacccat tgtctcttgc gtcacggtgc cgccgccgcc gaactcgccg     88440
     gaaagaccga tggttccggc ccgcgcggcc gcccccatcg atgtcggtgc ggtcggcccg     88500
     ttatcggcga cgaaggcatg cgcggcaccc atggcgcgta tcagtgaagc ggatcgttcg     88560
     aagcgggcgg tatcggcctg ccgctcgatc agcgtgcagg gcaggtgggc catggaggtg     88620
     ccgcccgaat gcagatcgag cacgacgtca tggcggggaa agagttcgtg ttcgaggaaa     88680
     tgcgccagac gcgccgtcgg cgagccgctg ggatcgccgg gaaacgctcg attgaggttg     88740
     ccgccgtcga agggcgagca gcgcttggcc gccatcaccg ccggcaggtt cgccattggc     88800
     aggatggtga cggcgccgcg gatttcggcg acatccagca gccgcatcag ccggccgagc     88860
     tggagttcgc cctcatattc gtcgccatgg ttgccggcca tcagcagcaa agacggcccc     88920
     tcgccattcc tgaggcaaag gatcggaatg cggatctgat aatagggcga ccggtcgatc     88980
     gaatagggaa tggcgagatg gccggcctgc cggccctcgc gcgaaaagtc gatcggattg     89040
     acgagaccgc tatgcatgat gtctccagtg cggcggttgc gatgccgtca aagggcggcg     89100
     acggcagtca tttcgacacg cagatcggga tcggcgagac gagcttcggt gcaggcgcgg     89160
     gccggcgggt tttcgatgtc gatccagtca tcatagacgc tgttcatcgc ctcgaaatcg     89220
     acgatcgccg gcaggaagac gttgacggcg atcaggcgcg agcggtcgat accggcttct     89280
     tgcaaaaggg cgtcgatctt gccgagcacg tcgcgggtct gatccttgat atcagccttg     89340
     cgattttccg cgacctggcc ggcaatatag acgagaccgc cgtagctgac ggcttggctc     89400
     atacgcgaac ctttctgata acgctggatc atggcgggtt ttccttttct tgcttttgga     89460
     gggagagttc agccgaagct ggtcagatag gccgccgtca ccgaatggtc cgggtcgagg     89520
     ccgtagagga tggcatgccg gtcaaggcag gtgcagggat gggagatgcc gcactcgatg     89580
     acgtcgccga ccgcgacgtc gctgccgtcg gcaagggcga cgaaggcgtg ttgatcgttg     89640
     aggcgaaaca cgtcagcgct ctcgagatcg gcaagacgcg cgccattgcg atagagcgcc     89700
     aacggccgtg gcaggccttg gtccatggcc acgtcgcgca tacccatgcc gcagatcgcc     89760
     agccgcggct ccggccgaga gaggacctcg gcccagaccc gcagcgccgg acggaaaccc     89820
     gcggccgccg agatcgtctc gccgccgatg cggaagccgc cgcgtgcatc gaggccggca     89880
     aggccgcgct cgtagatgcc gtgatcgtgg aagaagatcg cgccgctgcg cagcaccagc     89940
     cggcaggcgg gatcggccgc aacggcggct gaaagcctgg caatcacgag gtcgaaaaac     90000
     accgagccgc cggccgtgac gaggagcgac cgctcgtcgc cgatgcgggc gcgcagcttc     90060
     ggcaggaaat cggatgtcac cgccatcagc gcgtcgatgc gacgcatcgt ctcttccgca     90120
     tcggcggtcg cggccgcacc ttcataggcg gcgatgccgg tcagccggaa ggccggcgtc     90180
     tccgcggcaa ggatcgcctc cagaattgcc tcggcggcgg cgacgccgcg ggcaccggcg     90240
     cgaccggcac cgaactccac cagcagaccg aggggcggca gatcgacacg ctcctgccag     90300
     gcggagcgaa gagcctcgac cagcgccgtc gaatccacga agatatgaag ttccgcatcg     90360
     ggatagtggc caagcagggc cgcgagccgg cgggcggcgg cggccccgcc gatctcgttg     90420
     gcgaggatca gccggcgctg tcccgccttg agcaggacgg cggcctggcg gatatcggcg     90480
     accgtcgtac cccaggcgcc tgccgccaga agtgcctccg ccagcgccat cgacatcggt     90540
     gtcttggcgt gcggcgcgat atcggcgccg tggctcatca cataggccat catcagttcg     90600
     acatttcccg tgaaagcctg ccggtcgagc gagatcagcg gcagggccat cctgccgtca     90660
     tagggcttcc atccctgctt gccgattgca gcaagcggaa gcggcggatt gcccggcgga     90720
     aagccgcgca cctgctcgtc gatcagcacg ttttccgtcg caatatggag gtcagacatc     90780
     gcagccactc ctgatctcgg ccgggtcggc gatgccgagg cgataggtgt cattggcggt     90840
     ggcaaagaac agggcgcgct gctcgtcgta agagagctct gaggcgaccg ctcggaaaac     90900
     ctggtagacc tcgtcgaagg aggcgtgcaa gcccgcaacc ggaaagtcgc tcgcgaacat     90960
     ggcgcgcgcc gggccgaaac aagcgaggca atgctcgatc accggccgca ggctttcgag     91020
     cgtccactta ttgtcatagg cgacgaggtc ggaaatcttc aggcgcagat tcggcaaact     91080
     gccgagcgcc cgcagaccac ggcgccagag cgccatgccg tcctccgtcc ggtcagccgg     91140
     gctgccgccg tggttgagca cgaaaagcgt ttgcggaaaa gcacgcacca gttcgagcgc     91200
     ctcattcatc tgccagggat aaagcataag gtcgaagacc agtccgagcc gcgtggcatg     91260
     ggcaagtccc gcccgccagc tgggatcgtc catgcggttc gggcgcggcg caaaactctt     91320
     cgccgcttca ggatgccagc tcaaaatatc acggatgccg acgacattcg ggttcgccgc     91380
     ttccgtctcg agcaggcgca tggcgtccgg cccgtcgaga ggaacgcccg cgatataacg     91440
     gcgcgccaca ccggagctgc ggtcgaggcc atccagccag cggctctcgt ccagcgggca     91500
     ggcaacggac cagccggcct ccacatgcac ggttgcaatt acgttctggc gggcagcatc     91560
     ggcgcgataa tcgtcgatgc cgtagtcgcg caggatcggc gcgaggcttc cgaaaaccat     91620
     ctcttcgccg gaagctctgg ccttctgcag ccagggatgg cgttgcaggc tgaggtccca     91680
     gaggtggtga tgcgggtcga tcaccggccc gtcatagagc tccgtcatct gcgcgcctcg     91740
     cgtccggaaa ccagcagaag agcgaggatc aaggtgccga acatgatcga ccgccagccg     91800
     ggggaggcat tgacgacggt gatcagcgcc gtcgtcgtca caagcaggat tgccccggga     91860
     atggtgccgg cataggtgcc gcggccaccg aggatcgagc tgccgccgag cacgacggcg     91920
     gcgatcgagg tcagcagata ggggtcgccg atgccgacat aaccttgccg gttcatgccg     91980
     agcacgagaa tgcccgcaag ccctgcgaaa aagccggaca gagtgtggac gatcagcgtg     92040
     tcgcgggtga cgcttacgcc ggaaagtcgg gccgccagcg ggtttgcccc aagcgccagg     92100
     aaacgggcgc cgatcggcat gcggtggacg agcagcagga cgacgatcga gacgacaagc     92160
     cacaggataa tgcctgaggg aatgccgagc ggccgcgcct gcccgagcag aatgaccgcc     92220
     ggattgctga cggtaaccgc gctgccgccg gcgacgatga cgagcagccc ctgcaggaag     92280
     gtcgccatgg ccagcgtcat gatgatcggc ggcacgcgaa gataggcagc accggcgccg     92340
     ttcatcaggc cgatagccgc ggcgatggca agggccgccg cgatgccggc gaggccggtc     92400
     gggtcccagg ctggcgagat cagcggcagc aggatcgccg tgactgttat gaccgcgccg     92460
     acggagagat caatgccgcc catcaggatg acgagcgtct ggccggcggc ggcaatgccg     92520
     atcaccgcgg cgagttcgag caggtagcgc aggtggccat aggcgccgaa accacgcaac     92580
     gtaaagcttg cgacgatcca gacgagcgcg accagaagga aggtcagcag cggcggattg     92640
     cggaacgcgg acctgatgat attcatcgcc ttgccctcca agccccaaga agttccggca     92700
     cggcgaccgc gccgacgatg atcagacctt gcgcgacata ttgtgcgacc ggcgggaagc     92760
     ccaggaagaa catgacgttg atcatcaccg agagcagcag gctgccgcag atcgcgccgc     92820
     gcatcgtgcc cttgccgccg aggaagccca cgccgccgag cacggcggcg gcaatcgagt     92880
     tcagcgtgaa gggcgtgccg ataacaggat cacccgagcc ggtctgcgca gcgacgaaga     92940
     gaccggtcag ggcggcgaga agaccggaca gcgcgaaggc tgcgaccttc acccgttcaa     93000
     ccgggacgcc ggagcggaac gcgccgaccg gattgtcgcc ggccgcgtag atgccgaggc     93060
     cgagcggcgt tgcaagaaag gccttccaca gtaccaggat cacgacgagc agcaggaagg     93120
     cgacgggcgt gtggccggcc agtaccgtcg acagccaatc gggaatgaac ccacccggcc     93180
     gcggcagcag gatgagtgcg accccgccga tgatgaagga gccggcgagc gtgacaatga     93240
     ttgcaggcag cctcagatag gtaacgatga cgccgatggc ggcgccgatc aaaagaccgg     93300
     cgagtgcgac cgcaagaatg ccgcccggca cgccgagcgc cccttgcatc gtcgtcgcgg     93360
     cgatcaccgc tccaaggctg acgagcgggc cgattgcgag cgtgatgccg ccgttcagca     93420
     tgagcagcgc ctgcgccatg gtgacgagcg ccagcgggaa ccagttctgc gtgaacttgg     93480
     agaagccgcc gatcgaaagg atgccgggaa agagcagcgc atagaggatg agaaaggcgg     93540
     cgacaaccag atagaggccg gcaaggccac ggttgcggcg aagctggatc gagccgtaga     93600
     gccgggatga tgaacttgtg ctcatgctgc ctctccctgt gtcgtggtgg taatgcccat     93660
     ggccgcaccg acgatcgctc cttcgctgat ttcatcttgc gacagcaccg cggcgacgac     93720
     gccctcgcgc agaaccacga cacggtcgca gagatgcacc agctccggcg tatcggagct     93780
     cgccagaatg acgagccgcc cctcggtggc gaaggcacgg agcatgagat agatttcccg     93840
     cttggtctcg atgtcgacgc cgcgcgtcgg atcgttgagg agcagaacgg agggatcgag     93900
     cggtagccat ttggcgagcg ccaccttctg ctggttgccg ccggaaagcg cctggaccgg     93960
     gcgggccgtg tcgcccttga tcgtcagccg gcgcgccaga tcggcgacca gtccgttttc     94020
     cgccgatcgg tcgcgtaagc ccttgcgggc gagccgtccg agcgagggca ggatgagatt     94080
     ggaggcaatg gaatgcggca gcaccagccc ctcatgcttg cggtcggccg ggacatagac     94140
     gatgccggcg gcattcgcct cgccgacatt ggcgggcagg gcgggtttgc cggatacttc     94200
     cgcccgatcg gccgaggccg gaatcgcgcc gtagagaccg agcagcaggt cttcctgccc     94260
     ttgtcccacg agcccgccga tgccgacgat ctcgccggcg cgggcggaga aatcgatgtc     94320
     acgcaccatg ccggcggaaa aaccttcgac gctgatgcaa atcgcgccgg gtgccgtgac     94380
     ggagcgcggc gggaacaggt cgccggtctc ccggccgacc atcaggcgca ccaacccttc     94440
     gccgtcgatg ccggacagcg actggtcggc ggtgaccagg ccatccttca gcaccgtgac     94500
     atgtgaacag agcgcctgca cctcgttgag gcggtgggaa atatagagaa gtgcagtgcc     94560
     gcgatctctc agcgtctcga tcaggcgggc aagaatgccg gcttcgtgcg cggagagcga     94620
     tgaggtcggc tcgtccagaa tgagcacacg cggcttgcgg aacagtgcct tggcgatctc     94680
     caccatctga cggcggccaa gtgccagatc ggcgactggc atgtcgagcg gctcggtgag     94740
     cccgaccata tcgcagacgt ctgacacgcc gcgatgaagc gctctgtaat cgataaggcc     94800
     gaaccggcgc ggaaaggcgc cgagccctat gttttcggca atcgacagac tggccgtgag     94860
     gctcagctcc tgctgaacga cggcaatacc cgcaccgcgc gcagccgccg ggctgaagcg     94920
     ctcgactggc ttgccgtcga cgaggatgga accgctgtcc ggctggagag caccggacag     94980
     gaggttgatc agcgtggatt tgccggcgcc gttttcgccg agcagggcgt gaaccctgcc     95040
     cggcagaagg gcaatatcga cgcccttcaa aacgggattg ccgaaaaatc ccctgaacac     95100
     ctgccgggct tccagcaggg gtctttcttc cgtcatgacg gctttcctca acccgagtta     95160
     cttgggcgga ttacttggcg gcaagcagct tgtcgaagag cgccttgtcg tagtccgagt     95220
     agatatagcc gtccgccggg aacttgtcgg cccgggcgag gtagctgccg atcgtgctgt     95280
     cgtcgatgac aggcagcggc accttgacga aggccggaac gtccttgcct tccagcgcct     95340
     gcacggcggt gtaaacagac agcgcgccga gccagttggg ctgcatggtg gcccagccct     95400
     tcagtccctt ctccttccag agctccagga actgccttgc gttttcgcct gttgtcggca     95460
     cttggtcgcg gccctgacgc tcgaaggcca gcaccgagcc ggccgatagc gcgccgccga     95520
     gcgacagcac gccgtcgatt tcgggattgg caaagagcag actggtcatc gcttcctgtg     95580
     ccggggcgac gttatattcc gtgttcgtct cggtgatcac ctggagaccg ggattggcgt     95640
     caaggaccgg ctgggcgccc ttgcggcggt cgtcgctcac cgaaatgccg gccgggccgt     95700
     tcatgatgat gatcttgccc ttgccgccga gctggccgac catccacttg gcagcggtcg     95760
     cgccccattc gttggaatcg gtgttgatct tcgccgtcac cttgtcggta ttgaccagac     95820
     tgtcgaaatt cacgacggca atgcccttgt cgcaggcatc tgatatgacg cggtcgagcg     95880
     cgttggagga accggcgatc acgacgatgg cgtcgacatt ggcgtcgatc atcgactgga     95940
     tatgctggat ctgggtctgg gcgttaccct gcgcgtccgt gatcatcagg tccttcacca     96000
     ggcccgcctt cttcagctcc tccacttcgg ccgtgatggt gccttcggtc tgcttcatcc     96060
     aggtcggcac cgaatagatg tttgcccagc cgatcgtata gggcgctttc ctgtcaccct     96120
     tgatgcaatt ggcggcggcc gaggccgtac cggccgaaaa gacgaggagt gcggccgcgg     96180
     cggcagcacc ggcgagaagc tggcggcgta gcgaagcgga aatgccgttt tcaagattct     96240
     tcatgtcgat cccctttttt gtgtgcggca gcgttgacgg cttgccattg gtgtccaata     96300
     taatgtacat gtgatctata taccggacga ggcgatctta tgccgatttt tctacctcgc     96360
     aagaggggtg ggaaaatttc attcgcggcg aatgacggga tcgattgaca gatgcggcag     96420
     tcggcttgaa aagcttggcc ggacaaaaaa gggatcgata gaaatggatg cagttcagga     96480
     cgaagcagcc ggtaaacgcg cccgagggct cgaccgcgcc ttcgagatcc tcgatttcct     96540
     gcgccagaaa cggcaggccc tgaagccgaa tgaaatcgcc gcgcagatcg gcgcgccgcg     96600
     ctcatcggtt tacgagctcg tcaacctgct gctgcagaat ggtatcctgg aattcaccgg     96660
     cggcgagggg cgtgtctatc tcggccgcaa actgtatttc ctcggcgcag cctatgagaa     96720
     ccatttcgac ttcacccgcg aatgcgaggc ggcgctggaa cagcttgccg acgagacgcg     96780
     ggagacagcg cagttctgca tgctggatgg aaacagatac acggtcgttc gcatgcgcga     96840
     aggcgcgcgc cccttccgca tttcgacgga tgtcgggcag tcggtgccga tcccgtggac     96900
     ggcgtcgggc cgcctgctcg tcgcacacct gtcggatcag gacattctta acttcattcc     96960
     gccgcaggat tttcgcctgc cgaacggcga atggcttgag ccgcaaacct tcatcgccga     97020
     ggtgcgccag gccgagcgcg aaggtctctt caccttcaac agcatcgtcg acagcttcac     97080
     ccactgtttt gccgtaccgg tgcggggcga ggaaggccat gcagccgcaa cgctctgcct     97140
     cgtcacgcca cgcgacgatg gcatcgccaa ccgggaccgc tacctcgact gcctgaagaa     97200
     ggccgccgcc ggcctcgacc atgccccgac ccggccaaaa cgaggctgat gccctgagca     97260
     catcaaggca ttgatctcag gtagcacggg cgttcgtgcg aaaaccgcca ttcccttgca     97320
     tgctcgtcaa actggatcct cgctccggcg gggctgcaag cgggcataag acgctcagaa     97380
     gacctattgc catttgtcgt ctcggccggg ctcttcgcca cgcccgcagg tcccatctgc     97440
     cggtccgcgc ccgcataccc cgggatagtc gccctgaccg ttgatttcca atttcatgcc     97500
     aaaccgggaa atctattcac ccttcctccg aaactacgaa attcagtttc tctataaatt     97560
     ctatggagaa cgtattttag caacccaaca gccaattgaa tacttggccc tggggaagac     97620
     cgggctgttg acggaaaacg gagaggacac gaaatgacac ggaaaatcag gcttggggca     97680
     tttcttcccg gtggcggaca gcatgttgcg tcatggcggc atcccgacca gccggcagac     97740
     ggcgcgacca gtttcgagtt tcacaaacgt cttgccttga cggctgagcg tggcctcttc     97800
     gatgcatatt tcctcgccga cgggctggct gtcggttttg gcggtgcgcg tgaaggcggc     97860
     aacgcccgcg tggccggctt cgaacccgtg acattgttct cggcccttgc gcctttcacc     97920
     acccatctcg gctttatcgc cacgtcctcg accacttacg aagagcctta cacgaccgcc     97980
     cgcaaattcg cctcgctgga cctgatctcg gagggccgtg ccggctggaa tgttgtcacc     98040
     acgacgggcg acctgacggc gcagaacttc aaccgcgata cccagcttcc gcatgcagac     98100
     cgatatcgcc gcgccgccga acacgtcgat gttgtccgca aactctggga aagcttcgag     98160
     gacgacgcct tcatccggga caagcaatcc ggcgtcttct tcgatccggc gaagctgcac     98220
     gacaccgatc accgcggcga acacttcagc gtgcgcggtc cgctcaacat ctcgcgatcg     98280
     ccgcaggggc atcccgtcat cgtccaggcc gggcaatccg aagatggacg cgggctcgcc     98340
     gcagcaacgg ccgaagtcat attcaccgcc catcagcata tcgaaaccgc ccaggagttc     98400
     tatcgggata tcaaggcgcg cgcccgcgct ctcggccgaa accccgatca tatcctcgtc     98460
     atgcccggcg tatccgcttt cgtcggtagg accgaggcgg aggcgcgcga gaaatacgac     98520
     cgcctgacgt cgctcatcgt cgaagaggac gggatcggcc tcctcaatgg cctgaccggc     98580
     ggcacgctcg acctgcacgg ctatgacctc gacggccctc taccgccggc gccgccgacg     98640
     gaaggcatga agagccgcca ggccctcatc cgccagatcg ccgacgaaaa caacttcacc     98700
     atccgccagc tctatcagtg gatcgcgtct gcccgcggtc actacaccat cgtcggaaca     98760
     cccgaacaga tcgccgatac gctgcagaag tggttcgaga acgaagctgc cgacggcttc     98820
     aacattctgc cgccctggct gccgacggcg ctcgacgatt tcgtcgatct ggtcattccg     98880
     gaactgcagc gccgcggcct gttccgcacg gcctatgagg gcaagacgct tcgagaaaac     98940
     ctcggcctgc ctttcccgac caatcggtgg gctgcagaac aagcagatct ccaggcagca     99000
     gagtgaggag cggtcgatgt cctatgaaat caaccaggtt cttccgagaa gcttcggccg     99060
     cctgaaaaac agcgaaagcc atatttccac tctcgccttg caagtgcgcg gggtgctcgc     99120
     atcgcttttg ccgcgctacg gccttctcat cggcttcctc gtattctggc aggtgtcgag     99180
     caccaggggc tgggtcaatc ccgctatctt cccgcccctg gacgtgatcc tgtccgctct     99240
     ttggaccaat cttgccaacg gcgcgctgct cgatgatatc gccatcagcc tgcagcgatc     99300
     cggaactgcc ttcgcctttg ccgtggtgat cggcattccg ctcggcctgt tcatgggcca     99360
     ggttcgtgcg gtcgaacagg cgctcgatcc gatcctgcag ctcttccgcc agacctcggc     99420
     gctggcgctc tacccggtct tcatcctgct gcttggcctc ggcgaaacat cgaagatctt     99480
     cgtgatcttc tgggccacac tgtttccggt gctgcttgcc acgatcggcg gcgtcaagga     99540
     agtggacaag aagctcatcg agatggcgcg gacctatggc gccggaccgc tgaccatctt     99600
     ccgccgcgtc atcctgccgg cgtcggtacc ggcgatcttc gtcggcctgc gtctttcggc     99660
     gacgacggca cttctgctgc tgattgccgc cgagatgatc ggcgccaaca agggcatcgg     99720
     cttccaggtt atgaatgccc agtacaattt ccagatcccg ctgatgtttg cagcgatcct     99780
     tctgctcgcc ttcctcgggc ttgccgccaa tgccttgctc gttctcttgc agcgccgtct     99840
     ctgccgctgg tctcagccga gccgctgacc tgctttcccg attttcctct tccgaaaggt     99900
     cccaccagat gacattccac ccccgccacc ttctcctgcc ggcagtgatt gctctcggcc     99960
     taacctcacc cgccgcggcc gctgatacgg tgaagctgcg ctatctcgcc agccagggtg    100020
     gtcttgccgc tcatgaactc gccgccgaac tcggctactt cgacggaacg ggcatcacgc    100080
     tcgaaaatgt cggctacgcc cagggcggcc cggcctccct gatcgccctg gcatcgggtg    100140
     atgtcgagat cggcagcgcc gcaacttccg ccgtcctgaa ttcgatcatc ggcggcaatg    100200
     atttcgtcgc cgcctatccc tcaaacggca tcaataacga ggtgcagtcg accttctacg    100260
     tgctggaaga cagcccgatc aagagtatca aggacattgc cggcaagagc atcgcggtca    100320
     atacgctcgg cgcgcatctc gactatacca tccgcgaagc cctgcattcc gtaggcctac    100380
     cggcggacgc agccaatcag cttgtcgttc ccgggccgca gctcgagcag gtgctgcgct    100440
     ccaaacaggt cgatattgcc gccttcggct actggcagac gaccttcgaa ggggctgcgc    100500
     tgaagaatgg cggcctgcgt ccgattttcg acgataccga cgtgcttgga gacatcgccg    100560
     ggggcttcgt ggtcctgcgc cgcgatttcg ctcgcgaaca tcctgaagct gcaaagattt    100620
     tcgtcgagca gtcggctcgc gctctcgatt acgcccgcga gcatccggag gaaaccaaga    100680
     agatcctcgc caaggcgctc agcgagcgtg gtgagaacgc ggatatcgca cagtacttcc    100740
     gaggctatgg ggtgcgtgcc ggcggcctgc cgatcgagcg cgacatccag ttctggatcg    100800
     acgtcctggt tcgcgaaggc aagctgaagc aaggccagct ggccgccaag gacatcctct    100860
     tgaccgtcga cgccaagccg gcaagcaact gaggaatgat gatgagcatc gctgaggaca    100920
     cgcgccgcgg ggaggtgacg atccgtcacc tctccaaatc ctacaggttg aacgggacac    100980
     cgctgcaggt tctcagggat atcaacctcc acgtccgctc cggcgaaagc ctcgccatcg    101040
     tcggcgccag cggctcgggc aagacgaccc tgctcagagt tctggcgggt cttgaggact    101100
     ccgacacggg agaggtcctc gtcgatggca aggcggtgcg aggcgtcggc acagagcgcg    101160
     ccgtcatctt ccaggagccg cgccttctgc cctggctgac cgtgctcgac aatgtctcct    101220
     tcgggctgga aactagcggc ctgtcgcgtg agcaggcgag gggacgggcg cgccactatg    101280
     tcaagctcgt cggcctgcag cagttcgagg ctgcctatcc ccggcagctc tccggcggca    101340
     tggcccagcg cgtcggcatc gcccgggctc tggccgtcca gccggagatc ctgctgctcg    101400
     acgaaccgct cggcgcgctc gacgcgatga ccaagatcgg catgcagcaa gaactcgcac    101460
     ggatctggcg cgatgaggat gtgacgacca tcctcgtcac ccatgatctc gaggaggcga    101520
     tctatctggc cgaccggatc ctgatcctgc cacgggagaa gggcggcgag ccgcgtctga    101580
     tcgaaatcga tctgccccgt cctcgcgacc gcagcgcacc ggaattcgtt cgacaccgcg    101640
     aagagctgct gaacctgttc ggactgcact gacgtcttca agcgtcagcg cgcgccgcat    101700
     gggacctgat ccatgcggcg cgcggcagta gcaatagcga tgcggaggac gcccgcggac    101760
     cgctaccgcg acttgctctt cgagctggcg gtgagatacg ggcgccgatc cagttccgcc    101820
     gacctgtagg aactgcgcag ccgcagcaga tccttgcggg cgatcaggcc gcacaatttc    101880
     cctgaggtcg gatcgacgat cggaatgcgt ccgtcgccgg tcgacagcat cagatcggcg    101940
     atgaatgcga ccgtatcatc aggatgcccc accggaacgg aatcatccgt cacgttttcc    102000
     gcgagcgtct ggctggcaag gtccggattc ccctgccaga gcagagcgtc ggctctcgat    102060
     acgacgccgg ccagcctgcc tgtcgcatcg accaccggat agatccggtg cgtcttccgc    102120
     tgcgaggcaa agaaatcgca ggcctctccc atcgtcatgg cgacgggaag cgtgtcgaca    102180
     tcgctgatca tgatctcgct tgcgcgcgac agttcgaacg ggtcgacgcc atattcgcgg    102240
     gtgatgtgct gaccgcggcg ggcgatcttc tcggtcagga tcgagcggcg cagcaaaagc    102300
     acggtgacgg cataggccac cacggttgcg gcaagcagcg gaacgagcgt gctgacgtcg    102360
     ccggtgatct ccatcgcaaa gaaagtgccc gtcagcggtg cacgcatggt tccacccatc    102420
     atcgccgcca ttccgagcag cgcccagaag ccgggatcat tgcccggcat gacaagaccg    102480
     accagccatc cgagagcccc gccgaagatg aggagcggcg caagcacgcc accggaggtg    102540
     cccgacgaca gggcaaacag ccagatgatc gtcttcacca gcaggatcga catgacagcc    102600
     ggggcgagca gccggttgtt gagcaagcca tcgatgatgt cgtagccgac gcccattgcc    102660
     cgcggttcga tcaggccgcc gagaccgatg acgagaccgc cgagcgccgg ccaccacatc    102720
     cagtggatcg gcaaggcttc gaacaggtcc tcgatccggt agagcagcgt cgtcagcaat    102780
     cccgattgca ggccggagat gatgcccatc gccgcacagg caaaaatacc ccaccagggc    102840
     aaggccacct ggaagtgggt cgggaacagc gggccgacgc cgaacagcag cgggcgccag    102900
     cagatcgaca cgcaggcggc aacggcgacg ggaatgaagc tgcgcggctt ccattcgaac    102960
     aacagcagtt cgaccgccag catgaccgcg gcgatcggcg aaccgaaaat cgccgtcatg    103020
     cctgcggccg caccggcgac gagcagcgtt ttccgctcgg ccgcactcat gtgaaagaat    103080
     tgcgcgaaca gcgatccgat cgcaccgccg gtcatgatga tcggcccctc ggcgccgaac    103140
     gggccgccgg ttccgatgga aatggcagac gacagcggct tcaggaccgc gaccttcggc    103200
     gacatccggc tgccgccgat caggatggcc tcgatcgcct cgggaatgcc gtggccgcgg    103260
     atcttctccg acccgaaacg ggccatcagt ccgatgacaa gtccacccag cggcggaaca    103320
     agcaccaccc acagcgagcg cggcaccgca gccagagagg caggctggat gccgatctgc    103380
     ccgaaccaga tgacattcgt caccagcgca atgaggctga cgagacacca ggcggcaaac    103440
     gcgccggcgg tgccgacaat gatggacatg ccgaccagga ggaggacccg cctgtcggtg    103500
     gtgaaatcgc cggcctcgcg ccgggaaaga ccgccggtga aatcgtgcgg ccggttgttt    103560
     ggtggatgct gcgccatgga agcctctgct acgccggaaa tggatacgct tgaggcgcgt    103620
     caatatatcg tgatacgata taaatcaatg ggtgaaagca tgaaggcgaa aatgtcccat    103680
     gaagatgcct cacttgaccg gctggcgact gcccatctat tcgaggatgg cggcatgcgc    103740
     tgccgacctt ggcggccgtt gcggcagagg agaagtgctt tgaagaagac cgcgccgccg    103800
     ctgaggcaag aggattacga agctctcgcc gacctcagat tcgcgcttcg ccagttcatg    103860
     gacttcagcg cctctgccgc ccagtcggag ggattgcccc cgcagcagca tcaggccctt    103920
     ttggcgatca agggacaacg tggcgatgcc atgaccatcg gcatgctagc cgagcggctg    103980
     atcatcgcgc cgcatacggc gaccgagctt gtcgggcggc tgtcggatgc cggactggtt    104040
     gaacgtcatg ccgatccggc cgacaggcgc cgccagacgg ttcttctgac ggataaggcg    104100
     gacgcgcttc tgacgcgact gagcgccgtc cacctttcgg aaatcaggga gatggccccg    104160
     aagttgatcg agcttctgct cgagctccag aagacggcgt caaacaccaa atgacaattg    104220
     cgacatagcc gatctcctga cgtgccgctt caatccaaaa gcgtcttctt caggcgatgg    104280
     atatgggcgg cgccaatgcc gcagcagccg ccgatgatgg tcgcgccggc ctcagcccag    104340
     gagcaggcat agcgcgagta ggcatcgtca tttaggtcgt tgcgggtctt atgcaggcct    104400
     tcattggcgg ctgcctcgcc ttgctcccct tcgaaggcat tggcatagac gccgatttcg    104460
     atgcgcgcgt ccattgtccg gaacacgcgc gccgcggtct ccacggccgc ctgcatgacc    104520
     tcaggcttgc tgcaattgaa caaaagggct tcggcgcccg atgaaaccac ccaggatgcc    104580
     gcgtcctcga ccctttcttc ggagcgaagc ttcggttcgc cgccccttat ggctacctcg    104640
     ttatctgcca gggtgaacga aatccagagc ggcttgcctg acgtcgccac cgccttgcgg    104700
     acagcctctg cctcggcaat caggctcaac gtctcaccga gccatatatc gacgaaggga    104760
     gaaagatttt cgacaagcac ctcgagataa tcctgcaccc gtgaaggctg aaaattctgc    104820
     ggctcgtatg agccgaagat cggcggaagc gaaccggcaa ccagcacctt ccgatccgtg    104880
     acggcatcgg ccgcctcgcg cgccaagcga ccggcgagac ggatcagcgc tggcccttcc    104940
     ttccagaacc gatcctcgcc gatgtgaaag ggcacgagcg catagctgtt tgtcgtaacg    105000
     acctcagagc cggcggcgat gaattcctgg tgtaccttac ggacgatatc aggcgcattg    105060
     atcagcgcca atgccgacca ttccggttgt ttcagctcgg cgcccagccg caacagttcg    105120
     cggctcatgc cgccatcgag aattcgcatc gtgctcatga agaggtctcc attcaggctg    105180
     tcgcgccgtc atcggcggcg ggcttttgca taacaaggtg ggcgagatgt acgtggttcg    105240
     tgcgtgaggg aactcatgac cagtctcttt cccgtcggcc tagcggcgaa ccggcacctg    105300
     cgcttcgaga cctcgaaaga cgcgggcgat tacggcggtc agcgcgagat agaagagggt    105360
     gacgaccagc agcggttcat agacgagcag cgtgtcctgc cgaaccttgt ttgccacggc    105420
     atagagatcc atcaccgtca ccgtaaaggc gagcggcgtc gccttgagct gcatgacgat    105480
     ctctcccgca atcgtcggca gggcgatgcg aatggcgcgc ggcagccaga tgcggcggat    105540
     cagcatccag ggcgacaggc cgaaggcccg gcccgcttcg agctcgccct tgggaacggc    105600
     gagcagcgcg ccgcgcaaca cctctgcctc gtaggctgcg tagttcaggg taaagctgac    105660
     ggcggcgaag aagaagccct cgcgcaggat cggccagaag aggctctggc ggatgccggg    105720
     gaccatgggc agcagcgagc ccaccccgta gtagagaagc catagctgta tcagcagcgg    105780
     cgtgccgcgg aagaaggtgc agtaactgcg cgccaggagc cgcgtcagcc tgccgccgct    105840
     gacctgcgca aaggcgaggc ctatggcgat ggcgaagccg aacaccacgg agatcaccag    105900
     caggcaaaca gtctgccagg cgccggtcag aagcagcggc caataggaag agatccaggt    105960
     gaaattcatg gggcgctttc ttcaggcaag gcgcggctgc ccccgccgta cccgtgcctc    106020
     gatcagtttg aagacgacgt tggaaacaag cgtgatggcg agatagagaa gggccgaagc    106080
     aaggaaaaag acgaagtaat gcttggtgct tgccccggca agacgggtgg cgagcgccag    106140
     ttcctggtag ccgacgaccg cgaccagcgc gctgtccttg gtgaccgaca tccacagatt    106200
     ggcaagaccc ggcagcgcgt ttggcaggag cgccggcagc aggacccggc ggaacctcag    106260
     taccggtccc atgccgaagg ccttggcggc ctcgatctgg ccgacgggaa tggcgaggat    106320
     cgcgccgcgc agcacctccg tcatgtaggc accctggacg aaacccagca ccgcaacggc    106380
     cgccacgaac ccattcacat tgaccggcgg cagctccaac gcggcgagca gccggttgag    106440
     gccatcggtg ccggcataat agagcccgac gatcaggatc agctcgggaa cggcgcggat    106500
     cagcgtggta tagagatcaa gcaggaggcg gagcatgcgg ttgcccgaaa gctttccaag    106560
     cgcgccgccc gtgccgagca gcagcccgat cgcgaaggcg caagcggaga tggcgaccgt    106620
     ggagaccgca cctgccaaaa ggacgccgcc ccatcccgga ggatagggag acagcaggtc    106680
     cagaatacct tgttgcgtgg tcgccatcgt tccggctgct tactttgcgc cgtagatgtc    106740
     gaaatcgaag tatttcttgt tgatggcgtc atactggcca ctggcgcgga cggcagcgat    106800
     cgccgtgttc agcttggcct tcagctcagt gtcttccttg cgcaggccgc ccgaaacgcc    106860
     ggcgccgaga atctccttgt cgtcggcaac gtcgcccatc ttggcgcagc aatccttgcc    106920
     gccatcgctt ttgaggaaag cgtcaagcgc cagtgaatcg ccgaagacat agtcgatacg    106980
     gccggaggcg agatcctgga acgcttcgtc gagcgtctgg taggtctttt cctcggcagc    107040
     ctcggcgaaa tacttcttgt aatattccga ctggatcgtc gacacctgga tgccgatggt    107100
     cttgcctttc acgtcctcgg cagtggcgcc cggcttctgg tctttggggc cgatcaaggt    107160
     gctcggcgtg ttgtaatatt tatcggtgaa gtcgatcacc ttcgagcgtt ccgcggtgtt    107220
     cgacatcgac gaccagatca cgtcgaactt cttgctctgg agagccggaa tgagaccatc    107280
     ccaggaaatt tcgacgatcg agcatttctc cttcatctgc tcgcacacag cgttcatcag    107340
     gtcgatctcc catccctgcc attggccgga ggcgtccttg gcgaagaagg gcggatagga    107400
     ttcgttcatg acaccgaagc ggacttcggc ctgtgcggtg acggcggaaa gcacgagtgc    107460
     cgcgccggcg aacagtgtgg ggagcagttt cattcgcagg attctcctgg tttgtgttgt    107520
     gttgtcgatg agagctcgaa gtgcatcagt gggcgctgag gccggtgaac tcccggcagc    107580
     gggcgctgac cggcgccccg aagatctgct ccggcgggcc ttcttcctcg atccgtccct    107640
     gatgcagaaa gagaacacgg ctcgagacgt cacgggcgaa gcgcatttca tgcgtgacga    107700
     tcaacatggt ccggccttct tccgcgagat cgcggatgac cttcaggacc tcgccgacca    107760
     gctccggatc aagcgccgat gtcggctcgt cgaacagcat gacagcaggg tcgacgcaga    107820
     gcgcccgggc aatcgccgcg cgttgctgct gaccgccgga gaggaaagcg ggataggcat    107880
     ggcgcttgtc gaagagcccg accttgtgaa gcagggcctc ggccttttcg atggcctcgc    107940
     gtcgcgaaat gcccatgacg tgcactggcg cctcgatgac gttttccagc accgtccgat    108000
     gagcccagag attgaaactc tggaagacca tccccagtcc ggtccgcagc cgttcgatct    108060
     gccgccagct gcgcggctgc agccggccgc cccgccccat cttcagcgcg atctcctcgc    108120
     cgtttacggc aatgcggcca cgatcaggcg tttctaggaa attgatgcat ctgagaaaag    108180
     tgctcttgcc ggagcccgac gagccgatga tcgaaattac atcggacttc tcggcctgcg    108240
     ccgaaatacc cttgagaacc tcttgcgagc cgaagctttt atggagatct tcgacgcgaa    108300
     gagcaggaaa gggttgatct gccatgcatg gttccgggtg aattgagctt gcgaaggata    108360
     atgacaaaat aacgcggttt tttcgcgcag ttttcaccta ttctgcatat tttatgcaaa    108420
     ataatcttcc tcatgcggca agtacggcag aatgcgcgaa ttgctgcggc gagaactagg    108480
     attggacaat ggaacagctg gatcgttttg accgtgacat tctcgatatc gttcagcgcg    108540
     actgccagct gaaagccgaa accattgccg aacggatcgg actgtctgtt tcggccgtgc    108600
     agaggcggtt gaagcggctg cgcgaggaag ggatcatcaa ggcggaggtg gccgtcgtcg    108660
     accgcaaggc gacgggcaca gcgatggtgt tcatcgtcgg gatggagatc gagcgggata    108720
     attacgacgc gctggcgaaa ttccgcctct gggcggagaa gcaggatcac atacaacagg    108780
     tctattacgt cacaggcgcg gtcgatctga tcgcgatcgt caccgcccgc gacgtcgagc    108840
     attatgacga catcgctgcg ctgatcatgg ctgacaatcc gcagatccgc cgcatgcaca    108900
     cgaatgtcgt gctgcgcgac gtcaagctcg gcctgttcgt gcccctggac tagcgcgcac    108960
     gccatgctcc gtcggcagtg gttccggctg ccacagatcg ggaaccgaca agccgctgga    109020
     ctcgcatttg acaaagggca taattccggg cgcaaattct cgggaggaat gatcgttgac    109080
     gttacgacac cagatcatcg cattggcgat cgtcccgctc gtcatatcga tccttgcgat    109140
     caccaccttc atcacctggc aatcggcaaa cctcgccaag aacagcatcg acacgttcga    109200
     gcagaacatg ctgaagacca aggaagccga gatcctcaat ctgaccaacc ttgccctgtc    109260
     cgccatccag acgatctatg acaatgccgg tgccgacgac gaagccgcca agcaaaaggt    109320
     ggcggcgatc ctgacttcgc tcgactacgg caaggacgga tatttctttg tctacgatta    109380
     tgacggcaac aacatcgtcc atccgcgcca gagtttccgg catgggcata attggctcga    109440
     tcttaccgat ccggatggcg acaaggtcat tgccgaactg atcgccacgg caagagcggg    109500
     cgggggcctg catcagtaca aatggcagaa accatcgacc ggacagatcg cagacaagct    109560
     ctccttcgtc gtcagtctcg acaaatggca atgggtcgtc ggcaccggtg tttatctgga    109620
     tgacgtcttt gcccaaagcg ccgccgccaa cgccggcatg cgcgccaaca taaaacggac    109680
     ctttatcatc gtcgcgctga tcgccgtgcc ttcggtgctc gtcgttttca ccacctgcat    109740
     gctgctgacg ttccacgagc gccgcatggc cgacagccgg ctcaaggccc ttacgcagcg    109800
     ggtcatcgat acccaggaag aagagcgcgc acggctggcg cgcgagttgc acgacggcat    109860
     ttcccaaaat ctcgtcggcg tgcgctatgc gatggatctt gccggccgca aggtgaggac    109920
     caatgtcgac gatgcagcac tgacgatcga tcgcggtgtc gaggcgctga acggcgccat    109980
     caaggaaatc aggcggctgt cgcacgacct gcgcccgcgc gtgctcgacg acctcggcct    110040
     gacggcggcg ctcgaggcac tctgctatca ctttgccgag cggacgggca tcgagacgaa    110100
     gatcgacgcc tcaagcttca ccgacacgct gaaggccgaa gccaataccg cgctttatcg    110160
     tgtcgcacag gaagcgttca acaatgtcga acgccactcg ggcgcctcca agcttgcggt    110220
     caaggtctgg agcgacaacg gccgcgcccg catgacggtc accgacaatg gcactggctt    110280
     cgacggcgcc aaggacggcc tgtccggcag atcgggtctc ggcctgcgca acatgcagga    110340
     gcggatggcc cacttccgcg gcctgctgct gatcaacagc agcgagaccg gcacgacgct    110400
     gacggcaatg ctgccgaaat cagccaatcg tcccgccggc aagcgggcag aagcggcatg    110460
     acagaacgcc cgaaaatcag ggtgctcttg atcgacaacc acccgctggt gctggacggg    110520
     ttgaaggcgg tgctcgaaac attcgaccat atcgaagttg ccggcacggc cgggctcgcg    110580
     caaacggggc tggagatcgg ccggcaagtt ctgccgcagg tcgtgctgat ggacatcaac    110640
     atgccgaagc tgagcggcat cgatgcgatc gagttgttca ggaacgaact tccccaggcg    110700
     cgggtcgtga tgctctccat gcatgacagc cgcgagtata tttcctcctc ggtcatgcat    110760
     ggcgctgccg gttacatcct gaaggacgtt tcgacagacg agatcgtctc ggccatcgag    110820
     accgtagcgg gcggggggac atatttctcg tccggcgtct tcgacgcgct gatgggcgaa    110880
     cgcgccgagg agggtagcga tcccctgacc ccgcgcgaac gcgacattct cgggctgatc    110940
     gttgccggca gaagcaacaa ggagatcgcc gaaacgctcg ggatcacctc cgccacggcg    111000
     gaaacccatc gcaagaacct caagaagaag ctcggtatcg ccaccacagc gggcctcatc    111060
     cgctatgcgc tcgatcacgg catcgtctcg aaaaccgggt aaatcgcgtc tacccacttc    111120
     tgggtaggcc ccggcatttc agcgccgcgc ccatcttgtg agaacaaaac caccgccata    111180
     ggactccatc cacggctggc caagtgcgag ccgttgggag gaattcacat gcgttacatc    111240
     agcttccgat cggtcggaaa acctcgagcg acccgagccg ggcctgccgc ggccgccggc    111300
     tgacagacct gccttccacg ccgacaactg gaacatggcg accgccgacg cggcgcctga    111360
     aaggtatccc gacatggaaa aaccacgtag caaggcagcg ctctggctgc ttgtcattcc    111420
     ctatctaggt ctgctctggc caccatttta caatgtccgc gagccatctc ttttcggctt    111480
     tcccttcttc tattggtatc agcttctctg ggtgccgatc accgcagcgc tgacctggat    111540
     cgcctatcgg agcactcgcc atgacgactg acatcaacgg cacggcgctt gccgtcttca    111600
     tcttcttttt cgtactcgtc accgtcatgg gcttcgttgc ctctcgttgg cgtaagccgg    111660
     aaacgctggc gagtatagac gaatggggcc tcggcggacg caacttcggc acctggatca    111720
     cctggttcct ggtcggcggc gatttctata ccgcctacac cgtgatcgcc gtcccggcgc    111780
     tggtctacac ggtcggcgcc tacggcttct tcgcgctgcc ctacaccatc gtcgtctatc    111840
     ccttcgtctt catggtcatg cctgtgctgt ggaaacgcgc caaggatttc ggctatgtga    111900
     cggctggcga cgtggtccac ggtcaatatg gatcgcgcgg gctcgaactt gccgtggcgg    111960
     caacaggcgt catcgccacc atgccctata ttgccctcca gctcgtcggc atgacggcgg    112020
     tgctgaaggc gctcgggctg catggcgaat tgccgctggc gatcgccttc atcgtgctgg    112080
     cgctctacac ctactccgcg ggcctgcgcg caccggcgct gattgccttc gtcaaggaca    112140
     tcatgatcta tatcgtcgtg atcgccgccg tcgcactgat cccgtcgaaa ctcggaggtt    112200
     acgcgaatgt ctttgcctcg gccgacgcgg ctttccaggc caagggttcc ggcaacctgc    112260
     tgctcggcgg caatcagtat gtcgcctatg ccacgctcgc cttgggttcg gcgctcgcgg    112320
     ccttcatgta tccgcatacg ctgaccggca tctttgcctc caacagcggc aaaacgatcc    112380
     gcaaaaatgc gatcatgctg cccgcctata cgctgctgct cggccttctg gcgctgctcg    112440
     gctatatggg gcatgccgcc aacctgaagc tcgacagcgc caatgacgtt gttccgacgc    112500
     tgttcaagac gctgttttca ggctggttct ccggctttgc ctttgcggcg atcgccatcg    112560
     gtgcgctggt gccggcggca gtgatgagca tcggcgccgc caacctcttc acccgcaatt    112620
     tctggaaagc ctatgtcgat cctgatgtca gcgatgcggg cgaggcgaag gtcgcaaaga    112680
     tcacctcgct cgtcgtgaag atcggggcgc ttctcgtcat catcttcctg ccgacgcaat    112740
     tcgccctcga cctgcagctg ctcggcggca tctggatcct gcagacgctt ccggcgctgg    112800
     tcttcggcct ctataccaac tggttccgtg cacccgctct gcttgccggc tggttcgtcg    112860
     gcttcggcgg cggcactttc ctcgtctggg atgccggttg gaagcctctg catctgatca    112920
     gcctcggcgg cgaacccttc accgtctata ccggactgct ggcgcttgcg gccaacatcg    112980
     ccgttgcggt cgtggtcaac gccttgcttc cggccaaggc tccggcccgg gcataagatg    113040
     caaatgcgaa gggcagcaaa cgctgccctt cgcaaaaatc attcggcttt gctttccagt    113100
     atcagccgga aagagatcag agcgacttaa aactcttccc aatcgccggc caatgccgca    113160
     ttcccattcg tctggaacga cttgcccact ttggcaatca tctgacgcgc gggcgagggc    113220
     gccggttggg cgcgaggcgc tgcggcagcg ggcggcgata cccgtttcgg tgccaccgct    113280
     ccgccaatgt tgaactggcc cagcagctgg aacagcgcgt cggcttcctt ggcaaggtta    113340
     tgagccgccg ctgtggcttc ttcaaccatg gcggcgttct gctgtgtgcc ctgatccatc    113400
     ctgttgacgg cggtattgat ctctttcagc ccggtcgcct gctcctgcga ggcgccgacg    113460
     atggcgccca cattgccgtc gacctgctgt acctgctcgg caatctcctt cagcgccttt    113520
     ccggtctcgc caaccagggc aacgccgctt ttgacgtggc cattcgaagc gttgatcagt    113580
     tccttgattt cttttgccgc cttggcagaa cgttgcgcca attcacgcac ttcctgagcc    113640
     acgacggcaa agcccttgcc tgcgtcaccg gcacgggcgg cttcgacgcc ggcattcagc    113700
     gccagcagat tggtctggaa cgcgatttca tcgataacgc cgatgatgct gccgatttcg    113760
     gtggcggagg attcgatctt gcccatggcg tcgaccgcat cccgaacgac gctgccagag    113820
     cgctccgcgc tgtccttggt tttgcgaacg agctggccgg cttcctgagc cttgttgctc    113880
     gagtcggcaa cggtggtcgt aatctcttcc agagcagcgg cggtttcctc gaccgaggct    113940
     gcctgctgtt cggtccgctt ggcgagatcg tccgaggcag agcggatctc ctgtgcaccg    114000
     cccgcgatgg cgctggcgtt ctgagcaacc ttctgcatgg cggcacggag cttttcgacc    114060
     gcggaattga agtcggctct cagcttttcc agggacggaa tgaacggagt gccgatctgc    114120
     tgtgtaaggt cgccatcagc cagcgcctgc agcgcgtcgc caagctggcc gacagccttg    114180
     tccgtctgct cggcgagcgt acggcgttca tcggcatcct gctcgagccg atgccgctcc    114240
     gacacggctc gcttcgcctc agcgtcggct tcccgttcgg cctttgccga aattgcgtcg    114300
     cgcagccccg ctaccgcccg tgcaagcttg ccgatctcgt cgccgcgcgc ttcgaggcga    114360
     cgatcgccgt taagattgcc gtcggccatc gctttcagcg aaagctgaag ttttgccagc    114420
     gggccgacga tcgtgcgtgc ggtcacggcg gcggcaacca gtgaaagaac agccgcaatg    114480
     ccaagcgcgg tcagggccaa tggcttgaag ccgcttgccg tgctgcgaac ctcgccgcca    114540
     atcgatttgt tcagcgcttc ctggtagtcg atgaatttgt tgatggcgcc aagccaggca    114600
     acgaaggccg gccgggcctg ttcgagcagg atcttgcgag cggcctcgcc gtcgcctttc    114660
     tcctgcagcg caatgatctg ggcgaccaaa ggattggtct tcgcctggat gtctgcaatc    114720
     tcaccgagaa tggtcttttc ctgttccgtc gcgccggccg gagaagcaac catatccgcc    114780
     atgcgctttt cattctcggc gtaagacgct gccagctttt cgatcaatgc ctcggcggtc    114840
     ttccgttcat cgtcagacgt caccagagtg acgtcgcgaa tagcgatcgc ccggtcatgc    114900
     acgctgccgc gatagttgat ggcaaaccgc tgcttcacgc tgttgacgtc gttgatggtt    114960
     ccaagcttat cgttgatctg cgcaactttt tccgtcgaat agatggtcaa gccgaccatc    115020
     agcaaaagga gaacgctgaa gccaagcgcc aagcgcgcca caaccccgaa actcatgata    115080
     ttcttcatat gcactctccc ctcgcggtga ggtttgttgg aaggatgtct cggcagccag    115140
     gattgcttgt catatctcgt tcgaatgcag agcctcggtg tctccgagtg catccgacag    115200
     gcacctcggt gcccggaatc gcgcttgaga tacgggacat ccgtcaaagc aataaaagcc    115260
     gatttcatgc gaaattcggg cgcctgaccc gccatcatgg cggagctgac gaacctcaaa    115320
     gaacgtcgtc ccgatatcca aaaaattagc ggaatatatt ttagagagtg taaacggacc    115380
     cgacggagca tgctatatcg ccatatctgg atagcatttg cgtttttcgg atggactatt    115440
     tgaggagcgc tctcccggtg gttgcgaaat cctcggactc ccctgcataa caaggcgctg    115500
     cggcttgcct gcgactagcc gacgccgttc tggcatcggc tagtgatttg ccgaaaggtc    115560
     tcggcagttg gcatgaattg cagctgcggt gccgcagctc tggtgctccc gcctcagcta    115620
     cgtagcagcg gaagcagctg atcgccctgc cgcttgattt cggagagata gggcgtgtcg    115680
     gacagcacga agtgggtgat gccgagatcc tggtatttgc gcagcgagcg ggcgacgtct    115740
     tccgccgacc cgaccagcca ggtggtgccg gctccgccgc cgccgaattt gcccggcgcg    115800
     gtatagaggt tgtcgtcgag gacgtcgccg cgctcgtgca gatcgagcag ccgctgctgg    115860
     ccgacggcga gcacccgctg gtgatcgtgc cagccgctgc ccttgcttct cgccatctcg    115920
     gcgaccttcg cctcggcgtc agtccatgcc tgttccgtgg tgtcgcggac cagcgtcgtg    115980
     atccgcaggc cgaactccag cggcgggagg tcgcggtcca gctccccgct caacgccttg    116040
     agccgcgcga tccgttcgcg gacaccctcg agcggctcgc cccagaagag ctggacatcg    116100
     gcctcggtgg cggccacccg ctcggccgcc tccgaagcgc cgccaaaata gaatttgggg    116160
     tgccgacggt cgtcgcgaac ctggatgcgt ggcaccacgg tggattcagc gacgcggaag    116220
     ttctcgcccg cggatgtgac gttttcttcg gtccataatc tgcggaccag ccgcatgaac    116280
     tccttggtcc tggcataacg gtgtgcctga tcaccctcgc tgtcgccgta ggcagccagg    116340
     ttgtccttgc cagacacgat gttgatccgc acgcggccgc cagtcagatg gtccagcgtc    116400
     gccgctgcgg aagcgaagtt cgccggtcgc caatagcctg ggcggatcgc aatgagcggc    116460
     tcgaaggtgg tggtccgggc ggcgagcgag gccgcaacgg tgaacgtgtc ggggcggccc    116520
     caaccggtgc cgatgagcgc gcccttccag ccatgctctt ccagcgccct tgcttggctg    116580
     gtcagcgtat ccaggctgtt gtggttctcg acggcggaat caccgcgatg accggctttg    116640
     acgtcgttcg gaatatacca aagaaattcg gaattattgc tcatgcgatg ctgcggttct    116700
     gtgtgtgatt ggaacaaaac gagggggagg aaggcccctc tagagatcat acggccgcct    116760
     gcgcctgctg ctgccccgcc tgaaccacaa agccatttgg cgggcgttga aggccaaggt    116820
     tttcccgcag cgtcgtgcct tcgtattcgt gccggaacag gccgcgcttg cgcaggatcg    116880
     ggacgacctg atcgacgaaa tcggtcaaag cggtgggcag gatcggcggc atgatgttga    116940
     aggcgtcggc agcaccgttc tcgaaccagc tttgcatcgc atcggcgatc tgctcgggtg    117000
     ttccaaccac cgtccggtgg ccacgagcgg tggcgaccgc cagatagaac tggcgcagcg    117060
     tcagattgtt gcgcgatacc agatcggaaa ccagcttgag gcggcttttg ttgagttcgg    117120
     tattatcagg caggggaggg gcgggatcgt ccagcgagta gccggaaaga tcgacgccct    117180
     tgtagtggcg cgcaaggata ttccaggcga tggagggatg aaccagcgat tggagatggt    117240
     cgtaattcgc ccgggcttcc gcttccgtgc cgccgagcac cgggaatatg ccgggactga    117300
     tcagcagttc gtccggccgg cgtccgtagc gggcgagccg ccctttgacg tcggaataga    117360
     attcttgcgc atcctcgaag gtctggttgg cagtaaagat catctcggcc gtgcgggcgg    117420
     caagttcgcg ccccggttcc gatgcgccgg cctgcacgat gacaggatag ccctgcaccg    117480
     ggcggccgac gttgagcgga ccggccaccg agaagaactt gcccttgtga tcgacgagat    117540
     gcaccttgtc aggatcgaga tagaccccgc tttccttgtc gcggataaag gcatcgtcct    117600
     cataagaatc ccacaggccc ttcaccagat cgacgaattc ctcggcccgc tcataacgat    117660
     cggcatgggc aggatggccc gcgattgaaa aattcttcga aacatccgca cccgtcgtga    117720
     cgacgttcca ggcggcgcga cccttggaaa tatagtccag cgacgcgaac ctgcgggcga    117780
     gaaggtaggg gtcctcgtag gtcgtcgatg ccgtggcgac gaagccgata tgtttggtca    117840
     cctgggagag ggccgcccag agggtcagcg gctcgaaatg cgcgccctgg gcggtgcgac    117900
     gaagcgcttc cggatccttg gcgcggtccc atccagccgg actgtcggcg acgaagacga    117960
     gatcgaattt gccgcgttcg gcggtctggg cgagctcgcg gtagtgatcg atattgaggc    118020
     cggcatcggc ctgtgcctcc ggatggcgcc aggcggcgat atgatggccg gtcgccatga    118080
     tgaatgcgcc aagccgcatt tgccttttcg atatgctcat tggcttatcc tcctcaaatt    118140
     gaactgttgc tgatgtcagg cggccttgcg gcccggaagc tcgaccccga gccggctgag    118200
     gagatggatg cgggtttgcg caaagctcgg atcaccgtga tcacggggcg tcggcagatc    118260
     gatcttgaga tcctcgatga ggcggccttc gtcgagaacg agtatccggt cggccagcga    118320
     aatcgcctca tcgacgtcgt gggtgacgag cagtacggca ggacgatgtc ttgcgcacaa    118380
     ctcccgcagc agatcgtgca ttttcagccg ggtcagtgcg tcgagagcgc cgaacggctc    118440
     atcggcgaga agcagggccg gttcgcgcac cagcgaacgg gcaagcgcga ccctctgctg    118500
     ctcgccaccc gaaagctggt tcggccacgc cgtttcccga cctgcaagtc ctacctccgc    118560
     caaagccttc cgcccggcct cctggccgga ggcgccggtc aagccgagcg tgacgttctg    118620
     gatgacggtg cgccacggca gcaggcgggc atcctggaaa accaccgaaa ggctctccgg    118680
     cgtctcgagg gtgcccgttc cctcgacacc atgatcgaga ccggcaagag ccctgaggaa    118740
     cgtgcttttg ccggagccgc tgcggccaag cagggcaacg aattcgcctt cctcgatatc    118800
     gagatcgacg ccgtcgagga tcgtcttcgt cgcaaaccgc cgtgcgaggt ctcgcacgtg    118860
     gacggctttg tttgcgggct tcagtttgcc agggtgcggc gccatgagag ggccctccgt    118920
     tcaagcaggc ggacgagacc gtccgagacg agaccgagca gtacatagac caccaggccg    118980
     acgagaatga cgtcggtctg cccgtaattg cgggcaagat cgatcatgta accgagcccg    119040
     ctggtggcgt tgatctgctc gaccacgacg agagaaaccc agcagagggt gacggcaaac    119100
     cgcagaccca gaaggaaacc cggcaaagca cccggcagca ccacctgaag aatgaagtcc    119160
     ttctggctca tgcgcagggt ttcggccagt tcgacgtaac ggctgtcgat gctgcggagc    119220
     gcattgtggg tgtggatata aatcggcacg atcacggcaa gcgctatggt tgtaaccttc    119280
     atgctctcgc cgatgccgaa ccacaggatc agcaagggga tcagggccag cgtcggtatc    119340
     gcgcgcttga tctgcaccgg cccgtcgatc agggcttcgc cgatccggga aaggccggcg    119400
     atcaacgcca ggatcgtgcc gatcagcaaa ccgatgctaa ggccgagcag ggcgcgtgtc    119460
     gccgacgtca cgaagttatc ctgcaggcga ccctgctcaa tgagccttac gaaagcctcg    119520
     gccaccgtcc acggcgccga caggatacgc gggtcgatcc atccgagcgc cgagccgacg    119580
     acccaggtca agacgagtaa tgccggcccg atctgcagtc cgaaagggat cgccggtccg    119640
     gggcctaacc tgcgcctggc tcgggggccc gtggagccag ccggttttac caggccagaa    119700
     cctgcccgca caattctacc gccggacgac cgcgactgtt tcgcctcatc tgcatcccaa    119760
     gtggttgcca tgcttcaaat ctcctctccg aaggggtgtc gagcgttact ggctcttggc    119820
     caaggccgcg gcgccgagct tttcgaagcg attgtcgaaa atctgctcca cattgagggg    119880
     cttgttgccg agctcgtctg ccagtagatc gatggtttcc tggtggcgct tcttcacttc    119940
     gctccaatcg ctgggaacga cctgttcgcc ggtcaacttg acgagatatt ccccgtcctc    120000
     ctggctcaac ccctgctgac cgacgtaata ttccttgatc cagaggtccg ggttccggtt    120060
     cacccattcg gtggcgcgtg cccacaggcc gacgtattcg gcgagagctg ccgccttggc    120120
     gggatcatcc agaacccatt gcggcgcata aagatggctc ggatcatccc gcaggccatg    120180
     ttccacgagg gtcgcgccat cgggtccgta ttgggtgatg tagcgcctga tgtagacgcc    120240
     gccgagcggt gcgatgtcga cctgcttgct cgccagtgcc ttcgggtaga cgtcactggt    120300
     actcggcagt tccaccagag tgacgtcgcc gctcttcaag cctgcggcac ggagggcgcg    120360
     gagaacgagc gtgccctgtg cctgacccgg gctgaaggcg atgcgcttgc cgcggaagtc    120420
     cgcgagcgtc ttcacggccg cacctggcgc gatgccgaag cggtagatgg gattggcgat    120480
     cgggtcgcgg cgttcgcgat aggcgatgtt gcggacgggc agattgttcc agttggcgaa    120540
     gatcgaaggg atctcggcca ccgacccgac atcgagtgca tgggcgcgga aagcttccga    120600
     cgtctgcggc ccgccgctga tattggccca tttgacctcg aaactgagct ccttgccgag    120660
     gcccgacact tcgagcgctt tctgcgtgac cggatcgccg atcgtcagca ccgtgcccgg    120720
     cggcactttg ggaagcaggg gagcgtctgc ctcggctgcc gccggaccgt gaatggcact    120780
     gagaccaagc agactgaaca acgcaatttt gaatgtcttt gccaatgtca tcgtcgatct    120840
     tcccgtttcc gattgctgat tgcaggagcg atgcacggta agatggaatg taatctacta    120900
     aatcgataga ttatttagtt taatgaaagt ggcgctggtg aaaaattgtg ctcaaaaggc    120960
     gggaaaccga aaccaccgcg tccggcgcgt cggcacgagg gtcgatgtat ccaggcgtga    121020
     aaaaagcgcc tgggacgttc gtccacggcg ctttacgggg ccttgtttaa ccctgctctt    121080
     gataaaggct tggcagcaaa ccgcagtgac cgcccttcag acgccaagcc gtcgcggacg    121140
     tcgggatcgc ctgtgtcagg cgctatgcgg cgcgtattcg ttggccgaga agacgtgatg    121200
     atgcaccttg ccagtaaaga gctgcaggag ttcgccggtg acctcacggc tctgcgaccg    121260
     cacatcggag agaagtgccg cgttcaccgt gtccatatcg ggataccgaa tggcgagcgc    121320
     catggcatag atcggggcgc cttcgtcgcg ctccatcccg tccagcaccc ggatttcctc    121380
     ggcgcctgga aatttcgtcc agagagggac gagccgctgc cgcacgaatt cgcggaattc    121440
     ccgttcttta ccgggatgga tttcgccttc aaacaaagca taacgaatga tcataggttc    121500
     tcttttccaa aactcgccgg agctggatcg atgttggcgt gttatcgtga ggtcggggcg    121560
     tatcgatcga tacgccccga ttggaagggt tatttgcccc agattttctt gtattgatcg    121620
     cgatagccgt tgtcgggatc gaagctgttc ttcggcccac cgtcaaactc gacgttctgg    121680
     ctggtcacca catggagtgg cgacacgtag ccggaccatg gcgctttcgc aaaggcgcgg    121740
     ttcaattcgt cgacgagctg ccagccctga aggttgagcg gctcggcgac cgtgacggct    121800
     tggaattgct tggcgcggat acgctgatag gcgctttccg acccgtcgcc ggctgcaacg    121860
     ttcaccggtt ttccatcgcc tgcaatgccg gccgaggcga gcgaaggtcc catgaagtcg    121920
     taatagaggt cgttgatcgc cagcgaatgc gtccacttcg cgccatactt ctgtagaagc    121980
     gacgtggtca gctgcggcat gcgctgcgag gtttcggcga tcggcgtgtc gacatattcg    122040
     agcaccgtgc cgccgagatc ttcgatttcc ttcttcatgc gatcggcctt ggcaatcgcg    122100
     atcgcatagg tggagtcggt aaagatgatg acgcccggct tgccggcggc atcggcaaag    122160
     gcccaatccg ccgcggactt cgatacttcc atcgcatcgg tagtcacgtt tgcaaagaca    122220
     ccgacttcgg gaaccggacc gaccgccgag gcagcgtgcc aggaaaccat cggaatgccg    122280
     gcagccttgg ctgcttccat cgccggcttc tgctcgaccg cgtcaaagcc gttgatgatg    122340
     atgccatccg gcttcagcgc catggcctgg ccgaaagccg cggtccgccc gccgatcgag    122400
     ccggcgccgt caagcgcctt taccgtccag ccgagcgcgc ctgccgcttc ctgaacgcca    122460
     ttgaccacgc cgaggatgcc accgtttttc atatcgccgg caagaatgac gatgttcttt    122520
     ccggcagcgc ccttggggcc gctcgtcggg ccgtcccagg cgctcacctt ggaagcatac    122580
     ttttcaacca cggccttggc atcggccatt gaatcggccc atgccggcat gctgagcata    122640
     acggcgacgg ttgcgaccgt tgcctgcaat aatgttctgc gcttcatgtt cactcctcca    122700
     ttttgtttgt tatgaaatgc cgggataagc cggcatcctc atttggatgc gggtgtgatc    122760
     ctcctcacag ctccgcgctt gcgctgggcg tagcctgcga tgccgatggc aatcagcagg    122820
     gtcacgccgt tgaacagcgg ttcgacgaag aacgacccgc cgaattgctg aattcctgat    122880
     attccaacgg ccaggatgat gacgccgatc aaggtgcccc agacgttcac ccgtcccggc    122940
     ttgatcgtcg tcgatccgag gaacgcgccg acaagcgccg gcaggagata ttcgaggccg    123000
     acgctcgcct ggccgatgcg cagcttcgag gcgagcagga ccccggtcag ggccgcgagc    123060
     agccccgagg tgacgaatgc gccgatcacg aatttgcgga ccggaatgcc attgagggct    123120
     gcagccttcg gattggcgcc gatggcgtag agatagcggc cgatcggcag gtattcgagc    123180
     acgatccaca tgcagatggc gatcagcagc acatagaagc cggtgatcgg aaggccgaac    123240
     agcatggtgc cgttcagcgc atagaaacca tcaggcagga cgccgaccac ctgtcggccg    123300
     ccggtgtgcc agagggccag cgcgtatagg accgttccgg tgccgagcgt cgcgatgaag    123360
     ctgtcgatct tcgcaacctc gaccagcagg ccgttgatgc agccggtcag aacaccgagt    123420
     gcgagcacga tgacgaccgc gaccggccag ggcaggccgt aggccgtctg caggctgatg    123480
     gcgagaatgt gccaaagcac gatgccatag ccgacggtca gatcgatgcg acccgatgcc    123540
     atcgggatca tcgcagccag cgacagaagc gcgatgatag ccttgtcgga cacgatcgag    123600
     cggacattca acacggtcgg gaaagtatcc ggcagaagga tcgagaagat cacgatcagg    123660
     ccgacggtca ggatcaccag cccgtaaacc gggatcaggc gtccgatctt ctgtcctgtg    123720
     gacagaccgg ccatttcgct cttggtcggc tccagggccg tggattcaat ggattgcatg    123780
     gctgttctcc cgatggctca agcggcttcc gatgcggatg cggccgtgat gaccgcctcc    123840
     gtcgtcagag cgcttccagt cagttcactg acgattttcc cgcgcgaaaa gaccagcgcg    123900
     cggtggcaga tatgggcgat ttcctcgaag tccgtcgaca ccacgacaac cgcgagaccg    123960
     gcctcgagcg cctgggtgat cagacggtag atctccgcac gcgccccaat gtcgacgccg    124020
     gcggtcggat cttcggcgac cagcagcttg cggccggtcg ccagccagcg gccgacgacc    124080
     actttctgct ggttgccgcc cgacagggcc tccaccggca gatccgggtc gttcggccgt    124140
     agaccgacgg aatggccgat cttatgggca aggtcggctt cgccgcgcgg cgacaggaag    124200
     gacaatagcc cacgcccgac ggctcccgga ttaaggtagg tattttcccg aatggacagc    124260
     gagagcgcca cggactcctc cgtccggtca cgggcaatca agccgatgcc cgacgccatt    124320
     gcccctcgtg ggctggaaag gtcgggggcc tcgtcatgca gcagaaccga gccgttgaag    124380
     ggctcgcaac caaacagggc gcggccgatc cgttcctgac cggcgccacg caatccagcc    124440
     agtcccagaa gctcgccctc gcggatatcg aaggatatcg ggcctgtgcc ggcgcagacg    124500
     agatcgcgga cctcaacgat cgccttgccg ggcgtgatcg ccgtcttgga aaagaggctg    124560
     tcgccgctgc ggccgatgat catcgtcacc agctcctcgg gggtggtctc gctgacgggc    124620
     ttctgtccca ccatgcatcc gtcgcgcaga accgcgaccc gatcggcaat ccggaagatt    124680
     tcgtccagcc tgtgggaaac gtagatcatc ccgacgccac gatccttcaa cggacggatc    124740
     gcattgaaca gccgatcgac ttcatcggcg ggaaggctcg ccgtcggctc gtcgagcacc    124800
     agcacgtcgg cttcgacggc aagtgcacgg gcgatggcga caagcgactt ttcggtgcgc    124860
     gacaatgccg agacccgcgt cgtggggtca aagtcgcaac cgaccagttt caaggcttcg    124920
     ttggcgcgcg cctgcgtcct gttccaatcg atgaggccgc gacgcatcga gaagccctgc    124980
     gacaggccca tgttctcgcc gaccgtcatc cactcgatca aaccgagatc ctggtggatg    125040
     aaggcaaccg gctgccgctc gttcggcttc gggggacgat gatggtagct ctggccgcga    125100
     aacaggatgt cgccgctatc gggcctgtag atgcccgcaa gtgtcttgat gagcgtcgat    125160
     ttgccggcgc cgttttctcc cagcagcgcg aggatttctc cttcgcgcag gtcgatcgag    125220
     acgtcgcgca gcgcctgcgt tccgccgaag ctcttggtga tcgactggaa ttccagcagt    125280
     ctcttggctt ccactgtggc tcctcccaag ctgcggtttt catggatgta tgttatcgat    125340
     aacatttatg cgtggtcaag cggaaagatg gcgatcccga atttaactgg agattggcgt    125400
     cagtcggttt ggaatccgtc gagaaggcgc atcatctcgg ccgagtcttt tggcccaagc    125460
     ccggcagcgc agagcagacg gtgaatctcg accaccgagc cagtcatcgg cagtggcgtc    125520
     ttcgtcttca gcgcaaagac ttgaagcgaa tccaggtcct tcaacatgtt gtcgattctg    125580
     cctgtcggcg agaaatcccg ggcggcgaat ttcgccatga attcctgcaa tatgcggcta    125640
     tccgccctgc cgccggcaag ggcggcagga atggcggccg gatcgacgcc gccggcttca    125700
     gcgagcttga ccgcctccgc gacggcctga aacagcacgg cgcaaaacag ctgattgatc    125760
     agcttcgtgg tctgccctgc gccggataca cccatcagcg tgtaattggc ggcaagatgc    125820
     cgcatcacta cgcgcgcccg ttcgaaatcc tcagcactgc cgcccgccat gatcgtcagg    125880
     cgtccgctca gcgcaccggg cacgccgccg gagagcgggc aatccaccca cgccatgccg    125940
     gtttcccgac gcagccgcat cgccatgtcg gccgtgtcgg ccggatcgat cgaggacata    126000
     tcgatcagca ccttgtcagc attcgccgcc gccgcaacgc ccttttcgcc gaagacgaca    126060
     gcgcggacga tgtttgcgtg attgaggctg agcacgcaaa acgccgacca tgagaccgct    126120
     tcctccacgg agccggccgc gcgtgcgccc ttggcctgca aagccgcaac tttttcggta    126180
     tccaggtcgt agaccgatac cttatgcccg gtttcgatca atcgggtgac gatcgccgtt    126240
     cccatgatgc cggcaccgat gacggcgaca tctgctctgt agtcatcctg catgataatc    126300
     tcctcccttg acggccatgc cgctcagtcc cttgcaagcc agtgctacga tatcatccaa    126360
     cgcatcatcg attgccactg tcacgacatt agcttcaccg gtcggcggct ccagcgtctg    126420
     caactggctg tcgagcaaag tcgcgggcat gaaatggccc tgacgggcct gcatccgcga    126480
     cagcagcaga tcgcgggatc cctccaggaa aacaaaggcg agacgcccgt ccgccgcttg    126540
     cctcaacctg tcccgatagc ttttcttcag cgccgaacag gaaatcacca gcccttgcga    126600
     tgcgtgttgc gcggtcctta tttcctcgcc gatccggtcg agccagggca ggcggtcgtc    126660
     gtcggtcagc ggtatgccct gcgccatctt ctcgacattg ccagcggggt ggagttggtc    126720
     gccctccaga aacagcatgc cgtttcgagc ggcgagatgc tcgccaaccg aagattttcc    126780
     gcagccgctg acgcccatga cgacgacggc cagaggtggc gcctttttgt cgaaatccat    126840
     ggtctcgtct ctatcagagg caggtcgtga tgccgccgtc gacataaagc gtgtgcccgt    126900
     tgatgaagga cgagccccgg cccgacagga aaacggcggc gccgaccagt tcgtcgacat    126960
     tgccccagcg tccggccggc gttcgcttct cgagccagga cgagaactcg ggattgtcga    127020
     caagcgcctg attgagcggc gtcttgaaat agcccggcgc aatcgcattg atctgcaggc    127080
     cgtacttggc ccagtcggcg cacatgccgc gggtcagatt gcgcaccgcg cccttggtcg    127140
     ccgtataggg agcaatgccg gggcgcgcca gttcgctttg cacggaggcg atgttgatga    127200
     tcttgccctg tccgcgggcg atcatgggtt tggccgctgc ctggccgaca taaaatacgc    127260
     tcgaaatatt ggtggtcagc agcagctccc atttgtccgc cgggaaatct tccagcggcg    127320
     tacgaaactg catgccggca ttgttgatca ggatgtcgag cggaccgata tcggcttcga    127380
     tcgcgtcgat acccgctttg gcagcgtcct tgctggtcac gtcgaagatc gccgcatggg    127440
     cagacaggcc ttgatccttc aggctctcga ccgcgcggtt gacgctttcg ggcgtgcggc    127500
     cgttgatgat gacttgggcg ccatactgcg ccaggccttc ggccagggca tagccgatcc    127560
     cctggctcga gccggtgatc agcgcacgcc gtccggtaag atcgaacaag ttcttcatgc    127620
     aaataactcc tccggtttcg ccgcgggtga cggcttcaaa ctgccgctga cggtgaaact    127680
     cacttgacat cgcttttccg aattatatgt tatcgataac ataatcaact gtcaaaatgc    127740
     gggatggaaa cggaatgcct aaggtagaaa tcttgatgac cggagcttat ccggaatggg    127800
     acatggtgga tctggaggcg aactaccgca tccatcgcct gtgggaagcg gcagatcggc    127860
     acgagctgat ctccagggtc ggcaaggata tccgcgccat agcgacccgg ggcgaactcg    127920
     gagcctccgc agagctgatg gcgcaattgc cgaaactgga aattgtctcc tgttacggcg    127980
     tcggcaccga cgccatcgac ttgtcctatg cccgcgccaa cggcattcgc gtcaccaaca    128040
     cccctgatgt gctgaccgaa gatgtcgccg atatcgccat cggactgctg cttgcgacgg    128100
     caaggcaggt cccgcaggcc gatgttttcg tccgctccgg ccagtggggc agtgtcgcga    128160
     tgccgctggt gacgcgcgtc tcgggcaaga aggtcgggat cgccggcatg gggcggatcg    128220
     gcaaggcgat cgccaggagg gctgccgctt ttggctgcga aatctcctat ttcgcccgcc    128280
     atgatcacca agatgttgcc tacacctacg agcccgacct gatcgcgctt gccgactggg    128340
     ccgactttct gatcgtcatc gttcccggcg gggaggcgac catgaagatc atcaatgcgg    128400
     aggtgctcaa agctctcggt ccgaacggca tcttgattaa cgtttcgcgc ggaacgaccg    128460
     tagacgaaga ggcgctgatc gcagcccttc aagaccgcac cattcaggct gcgggccttg    128520
     atgtcttcct gaacgaaccc aagatcgatg cacgtttcct gaccctccaa aacgtcgtgt    128580
     tgcagcccca tcacggctct ggcactgtcg aaacccgcaa ggccatgggc aaactcgtca    128640
     gagacaatct cgctgcgcat tttgccggta gcgctcttcc aactcccgtc gtgtgaggac    128700
     cccgatatga aagccatcgt cattcatgcc gccaaggatc tgaggatcga agagcgcgag    128760
     ccggaggttg cgggcgccgg gcaggtggag attgccatcg aagccggcgg catctgcggt    128820
     tccgacctgc attattacaa tcacggcggt ttcggcaccg ttcgcctgcg cgaaccgatg    128880
     atccttggcc atgagatcgc cggcacggtc aaggcgctgg gttccgacgt cgccgatctt    128940
     gccgtcggag accgtgtcgc ggtttcaccg agccggccgt gcaaccattg ccaatattgc    129000
     ctgaaggggc agcaaaacca ttgtctcaac atgcggttct acggcagtgc catgccgatg    129060
     ccgcacattc agggcggctt tcgccagcgg ctggtggcgg agcgttggca gtgccacaag    129120
     gtcgcggacg gcatttccat tcacgaggcc gcctttgccg aaccctttgc ggtgacgctg    129180
     catgcggcaa accgcgccgg gtcgctgcta ggcaaacggg tgctggtcac cggttgcggc    129240
     cccattggga tgttggcgat cgtcgcggcg cgcgtcctcg gcgcccgtga gatcgtcgcg    129300
     accgacgtga ccgacagcgt tctggcgatt gcgcgcacca gcggcgccga ccgaacgatc    129360
     aatgttgcca cgcatgcttc cgacctcgcg gcctacagtg ccgaaaaggg atatttcgat    129420
     gtcatgttcg aagcgtcggg aaatgagcgg gcggtgcgct cgggcctaga aacgcttaag    129480
     cctcgcgctg ttctcgtgca gctcggcctt ggcggcgatg tttccattcc gcagaatatg    129540
     atcgttgcga aggaaatcga gatgcgcggc acattccgtt ttcacgagga atttgcgctc    129600
     gccgtcgaac tgatcaacgc gcgtcgcgtc gatctgaagc cgctgctgac aggtgtcttt    129660
     aagattgaag aggccgtcgc cgccttcgaa ttggccggcg atcgcagcaa gtccatgaaa    129720
     gtccagatcg ccttctgacc gactgcatga tccttgcagc cattcaaagt gttacagcgc    129780
     cgcgcatccg aaaagacgcg ccgcgccgca gtactcaagc tgtcggtgcg ccgttgcggt    129840
     ccgtgctttc gcgcaagaca accttgtagc cggtcaacgt gatctcatcg ccggtcgcct    129900
     cgccggtatg gagggtatcc agcaggcggg cggcggcctg acggccgatg ccataacaat    129960
     ccacattgat ggtggtgatg cgcggatgac agatggacga gatctcatag tcgccgaaac    130020
     cggcaatggc gatgtccctt ggaaccttca ttcccctgcg cgtgcattcc atgatggcgc    130080
     caaaggcgga aaggtcggag acacagagaa ccacttccgt gtccggccag cgttccagca    130140
     ggctgacgat cgcctggccg ccctgctcca tggtgatggg cggcacgccg aaggaaatca    130200
     ttcgtcccgg tccgaggccg agttcttcga ctgttctctg gaaaccgctt cgccgctggc    130260
     tgccgcgcgt atcgcgcgcc gtcgttccac cgatatagcc gaacttccga tatccctgac    130320
     tggcaagcgt ccgcaccaac agggccatcg cctcgctgtt ggaaaacccg acaacctgat    130380
     tgatcggatc ttccggaagc tcccaggttt cgacaacggg aatgccggct tttgccagca    130440
     tgcgccgcgc gcgcgccgta tgcgagccac cggtcaggat gatgccttcc ggccggcggc    130500
     gcagcatagc ctcgatcagt tcttcctctt tctccgacga atagtcggta tagccgagga    130560
     ggagctgaag gccggtattt tccagtgcat cggtcatgcc ccgcgcagtg tcggaaaaat    130620
     tcgaattgtt gattgagggc accagggcag cgatgaagcc gcttcgcctt gacgaaagac    130680
     tgccggcaga caggtcgagc acataaccga gtgcgtcgac cgcctccatg atgcgctttc    130740
     gggtctcctc ggaaacgctc gcgtcctggc gaaaggcacg cgaaacggtc atggcagaaa    130800
     cgccgacata tttggcgacc tccgccatcg tcagcttttg agcgtctccc ggcttgagac    130860
     gtttgacttt cggctcatcc tcgtttttca ctggtctccg ctttcaaaca agcttccgaa    130920
     ttgggtagtt caagagacga taaagttatc gttatcatcg tacaatcgat attaatgcaa    130980
     aaacacacca ttcgaacgcc cagaaagcaa gcttccttgg gaattttggc aaaggccggc    131040
     agatcggcgt ctgtacgaag ccgtcaaaac acgacatgat gatatcgata acaatctgag    131100
     cgcaatggag gagtatcatg ttcgggcaaa ttgacggtac ggggtttgag gttctcgacc    131160
     cgcgtttcga aagctgcttc gtcgggcaca cccgcgtcga gcgtctttgg accggcggcc    131220
     gctggctgga gggaccggcc tggtttgccg ccgggcggta tctggttttc tcggatatcc    131280
     ccaacaaccg aatgatgcgc tacgacgacg ccagcgggca gacgtcggtc ttccgctcgc    131340
     ccagcaacaa ttcgaatggc aacactgtcg acaatcaggg tcggctgatt acctgcgagc    131400
     atctgacgcg ccgtgtcacg cgcacggatt tcgacggcag ggtcaccctt ctggccgatc    131460
     gaattgcagg caagcggctc aattctccaa atgatgtcac cgtcaagtcc gatgggaccg    131520
     tctggttcac cgacccgagc tacggcatcc tccacgatta tgagggcgac tacggcgcag    131580
     aggaaatcgg tggatgccac gtctaccggc atgatccggc aacaggtacc accgatcagg    131640
     tgacctccga tttcgtcaag ccgaacggac tggccttttc ccccgacgag acgttgcttt    131700
     acgttgccga caccggagca acgcatctgc ccggcggtcc gcgtcatatc agaaagctcg    131760
     cggtctcgaa tgaggggagg ctgaccgatc tcggcgtttt cgcagaatgt agtgcaggtc    131820
     tgttcgatgg ttttcgtgtc gatcgcaagg gcaggatatg gacgagcgcc ggcgatggtg    131880
     tgcacgctta cgatccggat gggacgttga tcggcaagat ccatattcct gaaggcgtct    131940
     ccaacgtgac tttcggcggc gagaaactga accgcctctt catcactgca agcacgtctc    132000
     tttatgctgt ttatctcacc gccaacggaa cgagactggg atgatcactg agcagaggcc    132060
     gcccttttgg gacggcctct tgtttggtac agttttgtgc ctcttgcctc accgttgact    132120
     gagaccgtcc gccagccgaa ccagaccgag gaaatccgac ctgtaaccga aggtgtccgt    132180
     gcctcgcgat gccgcggcga gatcggcgat cgcctgatag gaataggtgt cgacggccgc    132240
     gacatggctg agtttctggc cgaaggctgc gactgccacc gagaaacgga catcctgcgg    132300
     cgcggcatcg acggtggcga ccgcgttgcc gtcgttgaca ggcgtggtga tgagggcgct    132360
     cttgtcctcg cccggccgct tgtagcgcat cttgacgaag gcaagctcgc cgtgatgggc    132420
     gctgtcggag gcctcggccg gcaccttatc ggctgcgccg taccgcaggt cgtcattcat    132480
     cacggcgggg cttcccttcg gcgtaatctc gtaaatcgcc gtgacgctgt ggccggagcc    132540
     gatatcgccg gcatcgacgc ggtcattgtt gaaatcctcg cggttcagcg cccgcgtctc    132600
     gtaaccgatc agccggtatt cggcgatccg ttccgggttg aactcgacct ggaatttgac    132660
     gtcgctggcg atcggaaaca gcgtcgatcc ggcctcttcg accagcgtct tctgcgcctc    132720
     ggccaaggta tcgatatagg cagcactgcc attgccgttc tgggcgagcg tctgcatcag    132780
     ggaatcgttg agattgcccc gtccgaagcc gagaacggtg aggaagatgc cgtctttgcg    132840
     cttctcttca atgatgcgct tcaaatcccc atcgctcgac ggaccgacat tgaagtcgcc    132900
     atcggtcgcc agcataaccc ggttgacgcc gtccttgacg aagccctgct tggcaaggtc    132960
     gtaggccgcc tcgatgcctt cggccccgcc ggtcgagcct ccgggctcca gcctgtcgat    133020
     cgccgacagg atcttcgatt tctccgccac gcgtgtcggc gccagcaccg tgccggcatt    133080
     accggcatag gtgacgatcg acacggtatc gtcagccttc agcctgttga ccatgagccg    133140
     gaaggcgctc ttcagcagcg gcagtttgtc cggctcgtcc atcgagcccg acacgtcgat    133200
     caggaaaacc agattggcac gcggcgtggt cgccggcgca atatcataac ccttgatcgc    133260
     cacatgcatc aattccgtgt cgcggttcca cggggtcggc atgacagtca ccgtcgcctt    133320
     gaaaggctgg tcggcattgt taggacccgg ccagtcatag gggaaataat tgatcatctc    133380
     ctcgacgcga accgatagtg gatcgggcat tgccccgccc gtcaacgacc ggcggacgaa    133440
     ggcataggac gcgctgtcga catcggcgga gaatgtcgaa accggatccg tcgcgacgct    133500
     cttgatcgga tttgccgccg cattggcaaa ccgctcgcga ttgggatcga gctgcatctg    133560
     catgcgcccc tccgcaggcg gaacaggcga gggggcgatg gcggccatcg gttcggcaaa    133620
     ctgccgctgg gggacgatgc cgggagcggc cggcgcagcg cgtttggtag ccccgagtgc    133680
     cgcggcagaa ccctccggct tgttcgtgag ggcggcgttg gcatcgtatt cggatgtctg    133740
     cgacgcatcg ggtttcgcga gggccggcgc ctccttgtcc tgcagcgctt gcgcgacagc    133800
     aacagattgc tcagccaggc tgacgttccc ggccggtatt tgcggcgcga ccgcaaccgg    133860
     ctgaccggtg gttgcagccg gttgtttcga cgcctcactt ttcgaaagat tgccggcgat    133920
     ctcagtctgg tcgatgatcg gcaatccgtt acgggtcagc tcgatcgcga gataaccggc    133980
     ggccggaatg accagcagcg tcgcaagggc tgaaccggcg aggaatttct tgttcatggc    134040
     agggctccat atccagttga tgatggagct ttgacgccag cctttcgcat ttccttgggc    134100
     cgccgttgca ttattttccg cggtgtcgaa ggcctgcatc gcggcagcaa gtgcacgcgt    134160
     acgcgcctcc ggcgttgctg ccggcggtgt caggcgggag agcttgtcga gttccttgtc    134220
     cacggtcata cctcttcctt gccgagcacg gccttcagcc tcttgcgcgc ttcatgaacc    134280
     tgccaggaca cagtcgcctc cgagcagccc atgacatcgg cggcagccga atggctgaga    134340
     ccttcgccgt aaacgagcag cactgcgtcg cattgcctgt ccggcaaggc gcgcacggct    134400
     gcccataatt cgctcgatag ctcatcgtca tttgcggccg gcgcatcggg ctgcggttcg    134460
     acagcgtagg cgcggaatgt ctgctcctct cgtgcaagct tgcgtctatg gtcacgggcg    134520
     gcattgagcg tcagagtata aagccatgtc ctgaagcggc tggcgccgcg aaagctgcgg    134580
     atggctgcgc cgagcttgac gcagacctcc tgggcgatgt cgtcggcatc cgtggaactg    134640
     ccagaccacc gccacgccgt cgcatggacg aaatcataat ggcgcgacac cagttgcccg    134700
     aaggcctccc ggtcgccgcc ctgcgctcgt tctatgagct ccgcgtccaa ttccgcacct    134760
     accccatgct atccagcaag atgctatttc gagattgaga cgtttctcgg atgactttcc    134820
     ttgggtcggc gatgaaaaaa ttatcgcgaa ttttgaaagc cgcgacatcc atgggtcgcg    134880
     gccagacaga tcgtccgctt cacagaggcg catgatgagg acagagtcgg ccagggacat    134940
     gatctgtcat gtcccaaatc gcgaaaggac cttcatgtcc gctcaaccac ctgcccccac    135000
     cgaaaggggc atcctgcagt ttctggcgat ttgcgattcc ttctatccgc cagacgccgt    135060
     tctagcatcg atcgaacagc agcgacattg gtacgacacg ctctgcgctc gtttcgaccg    135120
     cccgctgccc ccggagatga tctttgcgga cggcatgctc cagcgcatac cgatccggcg    135180
     ctaccgcccg cggaaaatca gcacccgcac cagtctgctc tatcttcatg gcggcggctt    135240
     tgttgtcggt tcgctcgaga gccatcatgc catctgcgcc gagatcgccg attttgccgg    135300
     cgcggaactt gtttcggtcg attaccggct ggcccctgaa tatcgctggc cggcgcagac    135360
     ggatgacggc tttaccgtgt tgaagcatct gctttccgcc aacagcaagg tcgtgctgat    135420
     cggcgacagt gccggggcca atctggcggc gggccttgca ttgcgcgcgc gcgacgaggg    135480
     cctgtccgga gtcgtcggcc aagttctgat ctatccggcg cttggcggtg accttgccgc    135540
     aggctcttac gtcgaaatgg ccgcggcgcc gggcctgacg acggcggatg tcggctatta    135600
     tcgcgaaatc ctgcaggcgc cggcaggcaa tgagatcgcc gagcccctgc aggcagcttc    135660
     gcttgccggg ctgccgccgg ccttcatcac ggtcgcgcat ttcgatccgc ttcgggacga    135720
     cggccggcac tatgccgccc ggctcaccgc ggagggcgtc gaagtctggt tccgagagga    135780
     gccgcaaatg gtgcacgcgt ggctgcgcgc ccgccacatg agcgacggcg cccgcgatgg    135840
     cttccgtgcc gtctgcgagg ccgttcggcg tctggcgatc gcctgacgat cacatcaggt    135900
     cgcgcgcgat ccgcttttcg gcaaagacct tttcgaagat ctgcacgtcg tcctcgaagg    135960
     cggtgacgac agcactgatg atccagtcgg tccgggtgca ggcaacacgc ccggtcgcca    136020
     ctgtccgcac gaaccagccg gggcggcgca tgtcgcaggt ccaggtcgag gtcccggtca    136080
     tcgacagggg attatcgggt gaaatcgacc agagttcctc gcgcaattgc cgggtcgaga    136140
     ggcctgtctc agggtgctcg gtgagcccgg tatcctcgtg gatgtgatac tcggtcctgt    136200
     tgaccgagag atcgcggacg acctgccgct tcgtcgcggc cgccgcgtgc tcaatgtatt    136260
     tcggcagcgg atcgggattg gccggttcct tgatgtctat ccgctggtgc tcgccgagca    136320
     tcggcagccc cagaccgagt gcggcgatat cgacctcgat gccgtcgtca tcaggcggcg    136380
     gcaggatcat cggccaatag gcggtagaaa gcgaaaggcg gatgcgatgc cccttgcgga    136440
     agcgataacc gcaggcatcg agcacgagcc ggatcggcac cgtctcgccc ggtttcagcg    136500
     gcttgggatc tacattgccg tcccggtggg taagattgac gacgccgaaa gcgacacgcg    136560
     ttgccgtgcc atccggatgg acatcgacga gccgggcgca gagatttccg cacgccgccc    136620
     gagagcgcag cgcaagcgtg agcacgggcc ggccgagata gtcgtgatcg ccagcaagcg    136680
     gcatcgtatc gaagaccagc gagccggcat cgtccgagcg ttgatcaatc gccatttcgg    136740
     cgtcgggttt cagcgtgaaa tattcacccg atgccgtccc ggtgtcgagc ggagagcgga    136800
     gataaacggg atgttcgggc gcatgcggga tcggcatgcc ttcggtcagc ttgccgaact    136860
     gctcgacata gaagcactgc atctgtggcg gcgaccagac gtccttggcg acccagaagc    136920
     ccggatcgct gtcgcggcgt ggggcagggc ggatggcatc gagaatatag gcgcgggcct    136980
     gcggcagcct gtcgatccca ttgtcctcgc cccgcagcca tttgttccac caggcgattg    137040
     cctcgccatg gaaatcggtg cgcggcttcg gccaggcgaa atgcggatat ttgtggaccc    137100
     aggggccgat cagcgccttc gccttgccgc ccaggccttc gaccgccatc agcggcgtat    137160
     tgcggtagcc gtcggcccag ccggcaatca ccagcgcggg gatctccacg ctcgaaaaat    137220
     cctctgagat cgagccgtga cgccagaaga catcgcgccg ctgatgggcc agccattcct    137280
     ccatgaagaa gggttcgcct gccaggcgtt ccagccacat ttccttccag cgttcgccga    137340
     cgagtgcggg gtcgggcggg cgcgactggt agccaagcat cgttgccgcc catgagagct    137400
     gggcggagag atggcagccg ttcttgtagt ggatgtcgtc attgtagcgg tcgacggtcg    137460
     aggcgatcga tatgacggcc ttcagcgccg gcgggcgcaa tgctgcgacc tgcagactgt    137520
     tgaagccacc ccaggagatg cccatcatgc cgaccgcgcc gttcgaccat ggctgcgagg    137580
     caatccaggc gatcagctcg caggcattgg caagctcgct ttcggtatat tcgccgtcga    137640
     tgacgccgtc tgattctccg gatccgcgga tatcaacgcg cacgccggca atgcctgcgg    137700
     ccgcgaatac cggataggtc gactcgtccc tgaggctggt tccgtcccgt ttgcgatagg    137760
     gcaggaattc gaagacggcg ggaacgggat cttcgctagc gccatccggc atccagatgc    137820
     gcgcggcaag ccgcgtccca tcctccagcg taatccattc attctcgatg gtggtgaagc    137880
     cgcgcgaggt catgctcatt ccttgatgca tattccgtaa gacgaaggtt ctgccctcgt    137940
     caggtcagtt gccggcgctc tccatgcgac gcgtggcaag cacccgttcc agccagccga    138000
     tttccatttc cggcacggat ttcaacagca gatcggtgta gtcgtcaaag ggcggcgaca    138060
     gcgccgtcga tttcggaccg aaccgtacca gcttgccgcg atgcatcacc gccacgctgt    138120
     cggcgatcgc ccggacgatc gcgatgtcgt gggtgatgaa gacataggac agctgctctt    138180
     cttgctgcag gcgcagaagc agcttgagga taccctccgc caccagcgga tcgagcgccg    138240
     aggtcggctc gtcgcagagg atgagttcgg gcttggcggc cagcgctctc gcaatcgcca    138300
     cgcgctgctt ctggccgccg gatagttcgg ccgggtagcg gtcgacgaag cccttgccca    138360
     tttcgatctg atcgagcagt tccttcaccc gggcggtctt ctcggcacct ctcaggccat    138420
     aatagaaggt cagcgggcgg ccgatgatgt cgcgcaccgt ctgtcgcggg ttcatcgccg    138480
     tatcggccat ctggtagatc aactggatgc gcctcaaatc gtcattcggc cggctcttca    138540
     gacctggcat cagcggcttg ccgtcaaaga cgatgcggcc gctgctcggc ggcaacaggc    138600
     cggtgatgac gcgcgccagg gtcgatttgc cggaaccgga ttcaccaacg accgcgagcg    138660
     tctgcccctt cggcacgtgc agcgagacat cgtgcagcac tttgaagccg ttggaatatt    138720
     cggcgctgac attttcgacc ttgagaagtg ctgcagactg gtcggccgcc tcctcacgat    138780
     aggcctgcct gacattgacg agagcgcgcg tatagtcttc ccgcggcgcc tcgatgatct    138840
     gctggacact gccatattcg acctgcttgc cataacgcag gaccatgatg tcgtccgaga    138900
     tctgggcgac gacggcaagg tcatgggtga tgtagagggc ggcggtgtgc gtttcctcga    138960
     tggcatgctt gatcgccgcc agcacgtcga tctgcgtggt gacgtcaagc gccgtcgtcg    139020
     gctcgtcgaa gacgatgagt tcgggattgg agcagagcgc catcgccgtc atcgcgcgct    139080
     gcaactggcc gccggagacc tggtggggaa agcgctcgcc gaaggtttcc ggattgggca    139140
     ggccgagaac cccgaacaga taaagcgccc gtttgcgcgc ctcgtctttc gtcatcaatc    139200
     tatgtttgac cgaggcttcg atcacctgat cgccgagcct gtgggccgga ttgaaggcgg    139260
     cggcggccga ttgcgcaacg tagcagaccc gtgcgccgcg gattttccgg atgccgtcct    139320
     tgccgagcac caggatatca gcgccgtcga gccgcacctc gccaccggtg atttcggcgc    139380
     cgccccggcc ataggcaagc gccgaaaggc cgatcgtcga cttgccggcg cccgattccc    139440
     cgatcaggcc gagaaccttg cccttctgca gatcgaagga aaccccgtct acgatcgtca    139500
     ctcgcttcgg cggttcgccc ggcgggtagc tggttgcttc gatcttcaga ttacgaacgg    139560
     aaagaagctc aggcatcgcc gcgccctccc ttgaggctgg atgtgcgttt caggagccag    139620
     tcgaccacga ggttgacgca gacggcaagt gtcgcgatcg ccgtgcccgg caccagcgct    139680
     gccgagatac cgaagatgat gccgtccttg ttgtccttga ccatgccgcc ccaatcggcc    139740
     gcaggcggct gaatgccgag gccgaggaag gaaagcgtcg agaggaacag gatcgagaag    139800
     gcgaagcgca ggccgaattc ggccagcagc ggcgacagcg tgttcggcag gatttcgcgg    139860
     aagatgatcc aaagtttgcc ttcgccgcgc agtgttgccg cctcgacgaa ttccatcacc    139920
     gcgacatcga gcgcgacggc gcggccgaga cgatagacgc gggtggaatc gaggatcgcc    139980
     atgacaagga tcaacacgac gatgttttgc ggcagcaccg caagaacgac gagcgcgaag    140040
     atcagcgtcg ggatcgacat catcagatcg ttgaagcgcg aaaagaccgt gtcgatgatg    140100
     ccgcgcgaga cggccgcggt gaagctcagg ataatgccca gcgagaagga gatgacggtg    140160
     gcggcggatg cgaccgtcag cgtcgtgcgc gcgccgtaga tcaaccgcga gaagatgtcg    140220
     cggccgagat tgtcgagacc gaaaatatac tggttatcag gcaactgcca cacgtcgccg    140280
     acgacctgcg tctcgccata gggggcgagc cagggagcga agagcgcgaa gatgaaagcg    140340
     atggcgatac cggccatgcc gatccaggcg gtgatgggga tatctcgcaa tctcatcgcg    140400
     gatgcctcag ccggggattg gcgataatcg cgagaatatc ggccgtcatg ttgaggaaga    140460
     tatagacagc cgcgaagatc aggccgcagg cctgcacgac gggcatgtcg cgcacggtga    140520
     ccgcatcgac catatattgt cccatgccgg gatagacgaa gaccacttcg acaacgacga    140580
     cgccgaccac gagataggca aggttcagcg cgatgacatt gatgatcggc gcaagcgcat    140640
     tgggggcggc atgtttgacg atcgagcgga aggcgctgag gcccttcagc tcggcggtct    140700
     ccatataggc cgacgacatg acggagagga tagccgcccg tgtcatgcgc atcatatgcg    140760
     cgagcacgac gagcacgagg gtcgccgtcg gcagcgcgat cgccttcaac cgctcgacga    140820
     agcccatgct gtcatagacg gtcgctggaa aggtcgccat gccaaggttc accgcgaaga    140880
     gcaggatgag caggtagccg ataaagaatt ccggcagtga gatcgccgca agcgagatga    140940
     tgttgatgat cttgtccggc aggcggttgc ggaagtgcac cgacagcatg ccgaggccga    141000
     cggcgagcgg cactgatatc accgctgcga aacccgcgag gaaaagcgaa ttgccgaggc    141060
     gtttgccgat ctgctcgctc accgaattct tgctggccca ggaggtgccg aagtcaccct    141120
     gaacggcgtt gccgagccac tcaacgtagc gcgtcgtcac cggacggttc agcccgagat    141180
     cctggcgaat attggcaacg gcctgcggcg tcgccgactg gccgagatag gttgtggcaa    141240
     aatcgccggg cagggcttcc aggccgccga agatcaggat ggaaacggca aaaagcagga    141300
     ccaggctgag cacgaagcgc tcgaggatga gggcaagcag cggaaaacgc tgccggaacc    141360
     cgaggccggg caagatgctt ggggcaggat tggtcatggc gaggacctcg cgctaaaacg    141420
     tcgggaggac cgcggggttt catcccacgg tcccggcttc gttggagatc agaggggcaa    141480
     acgtcccctt gccatcaagc gtccagccag acgcgggtcg caacgtagcc gttcgacatg    141540
     tcgttgccga tgtcgtggac ataacccttc acctgcttgg tggaggcatt cacgaaatcg    141600
     ttgaacatcg gcaagatcac cccgccctcg tcgcgcaccg tcatcgccat ggtgcgatac    141660
     atgtccttgc gcttgacttc atcaagttcg gaacgggcct gcagcagcag cttatcgaag    141720
     tcaggacgct tgaaacgggt gtcgttccaa tccgccgtcg agagataggc ggttgaatac    141780
     atctggtcct gcgtcgggcg gccaccccaa taggaggtcg agaagggctg gacgttccag    141840
     acgttggtcc agtagccgtc gcccggttcg cgcttgacct cgatctcgat gccggccttc    141900
     ttgcagcttt cctgatagag gacggctgcg tcgacaccgc cggggaaggc gacttcggag    141960
     gtgcgcagga ggaccgagcc gctatgacct gacttcttat agtggaaggc agccttgtca    142020
     ggatcgtaaa cgcgctgctc gatgccctcg ggaaacagcg cataggtgct gttgatcggg    142080
     aagtcgttgc cgaccttgcc gtaaccgccg aggatcttct gcaccatggc ctcacggtcc    142140
     atggcatatt tgagggccag gcgcaggtcg ttgttgtcga acggcgcctt gtcacaatgc    142200
     atgatgaaga cgtaatggcc acggccggcg gtcgagagaa tctcgacgtt gggtgcgcgt    142260
     ttcaagaggt tgacggtctt cgggtcaacc cggttgatgt agtgcacctg gccggacgac    142320
     agggccgcga tgcgggcggt cgcatcgttc atgccgatga tttcgatcga atcgacgtaa    142380
     ccgcggtcgg tgcgccagtc gtctttgttc ctttcgaagg tggcgcggac gccgggctcg    142440
     aagcttgtca tcttgtaggg gccggtgccg atcgaggcga gaggatcgtc gacgccgccg    142500
     ttcggctgga tgaccagatg gtagtccgac agcagcagcg gcatgtcggc attgccttcg    142560
     ctgagcgtca gcacgagatt gccgccgtcg gccttgatct ccttgatcga gccgagaaca    142620
     ccgagcgcgc cggattccga cttggcgtcg gtgtggcgct tcagcgtcgc aacaacgtca    142680
     tcgatcgtca gttccttgcc atcgtgaaac ttgacgccct tgcggatctt gaaggtccag    142740
     gtcgccgcgt ccttcgacgg ttcccaggat tcggcgagcg ccggcacggc ggcaccggtc    142800
     agcggatcag actcgaccag catgtcgccc cagcagcggc cgatgcagaa catgacctgc    142860
     gacaggaact tcgccgggtc gttggaatcg gtagcggcac cgccttcgag gccgagcttc    142920
     aagtgaccgc cgcgcttcgg ttcggcagct tgcgcacttt cggtgaagag cttgtcggcg    142980
     acggcaagtg tgatgcccgc ggccatggcg cgtcccatga attcgcggcg gctgagcccg    143040
     ccggcggtga cacggcttgc gagatacttc gtgtagtcgt tcattcccca gttccttctt    143100
     tatggtgcgt tgacagaact tccgggcagg tccgcagacg gtttcctctc cacctccggt    143160
     gcccgcatca tgcgggaaaa taatgcggtt gccgccgcct ggctattttc ctttccaaat    143220
     ggggcttcgc ttctcggcga aggcccgtgc gccttctaat tggtcctcgc tcgaatagag    143280
     cctgtcgacc gtcgcaaact gccgtttggt gatcttgttc atggcagtct ggaacgtcga    143340
     accctccgct tcgcggacga tttccttgat ggccgcatgg acgagcgacg gcccgctctc    143400
     aagcagccgg gcaagctccc atgctctctc catcagccgc tcggccggca ggacctcgtt    143460
     gataaaaccc cagcgatgcg cctcgtgaac gtcgagccaa cgaccggtca aaagcatgtc    143520
     catggcgatg tggtagggga tgcgtttcgg cagcttgatc gaagccgcat cggcaaccgt    143580
     gccggagcgg atttccggca gggcgaaggt cgcatgttcg gcggcgagga tcaggtcggc    143640
     agaaagcgcg atctccagac cgccgccgca acagataccg ttgaccgcac aaatgaccgg    143700
     cttgttgagg tcgcgcagtt cctgcagccc gccgaagccg cccacaccgt agtccccgtc    143760
     gaccgcatca cctgatgccg ccgccttgag atcccagccg gcacagaaaa acttctcgcc    143820
     ggcgcccgac acgatggcga cgcgcagcgc cggatcgtcg cggaaatttc ggaagatcaa    143880
     ccccagagca cggctggtcg caaggtcgat ggcattcgcc ttcggccggt cgatgacgac    143940
     ttcgagcact ccgccgtcct gtcgtgtgcg aatgggttcg ctcaacctat gctacctcct    144000
     ccgccgtatc aaagcatcga ctacggccac gccacgccct tcgggaagaa ccatcaatgg    144060
     attaatgtcc agttcctcca gccatgccgc gttctttacg acataatctg ccgttgctaa    144120
     gacagcgccg acagcggcct caagatcgcc ttttggccga ccgcgatagc catagatcaa    144180
     ttttgcaagt ttgaggcgcg aaattgccgc gtgaatgtcg gttttcgtcg ccggaagggg    144240
     taggatgacg gaatcttcaa gcaattcaac gaagattccg cccgccccga gcgtgagcga    144300
     caatccgaag acagggtcgc ggatagcgcc gacaatgagc tcggcaaccg gcggatcgat    144360
     cattttctcg acgagataac cggcattcgg cggcattgcc gccgccgcat tcgacaccgc    144420
     ctttatattc tttaggttga gtgcgacggc cccggcctcg gtcttatggg caatgccgag    144480
     cgctttcagc acgacgggaa agccgagccg ctcagcttgc tcggccgctt gaccgggaga    144540
     agaggccaac agcccttgcg gaaccggaag gccgaaggcg gcaagctcgg ccttcgcatc    144600
     ggcctccgtc agcgtctcga tctcgccatc gatagagggc acatcgagca gcggcagggg    144660
     cggcggacga tcccaggcct ggccgatgcc ggcggcgacg tccgcagccg tgatggcttc    144720
     gtcgataccg cagaaggtaa tgatgccgtt tgccatcagc cgatcggcga tcggctccgg    144780
     catgttttcc ggaagggtcg ccagaaggcc ggccagcgca ccggttgcag cggcagccgc    144840
     aatcaccgcg tctgccgtca tcgcccattc ggatgcatcg cagcgatcat cgcgcggaaa    144900
     gtcgaggacg acgagattga gggcataacc gccctcgaac atggcgctga aggcttcggt    144960
     ctggcgtgca agatcccccc acacgaaggt gtggtaatcg agcggattgg acagcgtcac    145020
     catctcgccg agaacgcgcc gcagacgggg caattgttgc ggctgcagcg cggggaattc    145080
     cacattgcga ccgacggctg catccgccat cagcgaagct tcgcccccgg aacagctcat    145140
     cgacgagatc gaatggcttg cgagcgggcc ggcgacatgc agcagcttca gggtttcgag    145200
     caacgccggc aaggtctgga cacggccaag accaaggcgg gcgagcacgg catccgcgac    145260
     cgcatcgctg ccggcaagcg aggcggtatg cgacaccgcc gcgcattttg cctgctcgga    145320
     cctgccgacc ttcagcacga cgaccggctt cctcgaccgt cgggccatgg tggccagccg    145380
     ttcgagtgca gagagattgc cgaaaccttc gacatgaagg ccgaccgccg tcacacgcgg    145440
     gtcgtcgatc aatgcgcagg cgacatcggc aagcgatgtc tgcgcctggt tgccggcggt    145500
     gaccacatag gcgatcggca ggccgcgggt ctgcatggtc aggttgatgg cgatattgga    145560
     ggactgcgtg aggatcgcga cgccacgtgc gatgcgctgc atgccatgct gatcgggcca    145620
     gagcagcgca ccgtcgagac cgttgatcag cccgtagcaa ttcggcccga ggatcggcat    145680
     gtcgccggct gcctccagca gggcctgctg caactcggcg ccgtcgccga gttcacccgt    145740
     cgcctcgctg aaacccgatg cataacagac cgccccgccg gcaccggccg cagaaaggct    145800
     gcggacgatc tcgacggtct gcatcctgtt gacgccgacg aaggcggcgt ccggcgccga    145860
     aggcaggtcg gagacggagc gataacaggg ccgcccgagc acctcgtcga gctttggatg    145920
     gacgggccag atctcgccgg caaaacccat gcggtcgcac tgctcgatca ccctgcgcgc    145980
     ctcgcggccg ccgaagacgg cgatcgtttg cggtctgagc aggcggtcga gcgggcgcgg    146040
     cgtcatcggc ttatgctccc aagggtctaa gcagatcgcg gctgatgata tgccgctgga    146100
     tttcagaggt accgtcccag atgcgctcga cgcgcgcatc gcgccagaag cgggcgagcg    146160
     gcagatcgtc catcaggccc atgccgccga agatctggat cgcctcgtca gtcacgcggg    146220
     ccagcatttc ggaggagtag agcttggccg aggcgatctg ccggtctgcg gagagtccgg    146280
     catcgagccg ccaggcggcg gcgagcgtca gccaatcggc cgcgtcgatc tcggtaatca    146340
     tatcggcgag cttgaacgac acgccctgat tggcgccgat cggcttgccg aactgcttgc    146400
     gctcggcggc ataaggcagc gtcatgtcga agacgcgccg tgcccggccg acgcaggtgg    146460
     cggccaccgt caaccgcgtg ccatagagcc atttattggc gatttcgaag ccgcgatgca    146520
     cctcgccaag tacctggctt gccggaatcc ggcaatcggt gaagctgagc gttgagttgt    146580
     ggtagccgcg atgcgaaacg gaatcgtagc ccccgaggat ttcgaatccc ggcgtgccgc    146640
     gatccaccag gaaggcggtg atcttcttct tgatgccctt cggcgtttcc tcctcgcccg    146700
     ttgcggcaaa gacgatgacg aaatcggcga cgtcggcatg cgagatgaag tgtttcgtgc    146760
     cgttgaggac gaagtcgctg ccatcgcggc gggcagcgca tttcatgccg cgcatatcgg    146820
     aaccggcgtc cggctcggtg atagcaagcg catcgatctt ctcaccgcgc actgcgggca    146880
     ggagatagcg ttctcgctgc tcgccctcgc aggccatcag gatgccggac ggccggccga    146940
     agaaaaccgt cagccccagg gagccgcgcc cgagttcccg ctcgaccagc gtgaaggtga    147000
     catggtcgag accggcgccg ccgacttctt ccgggaaatt gcaggcgtaa aagccgagat    147060
     cgatgcattt gcgccggatc tcgtctccga gctccggcgg gacgatgcca ctgcgctcga    147120
     cctcgttttc atgcggatag atttcggttt cgacgaaggc gcggaccgtc tcgacgatca    147180
     tttcctgttc ttcgctcagt ccgaaatgca tgcctatcct cctaccgcct ctggccgacg    147240
     tgacggccgg caccttcagg cacggccaaa ttcgcgtggg ctcctgcaac cgccttgacc    147300
     ttgtcgagaa tgacggccgg cgccggtgtg gccttgccgg ccttgctgtc gacatgcagc    147360
     aacatgtgtt cggcggttgc cagagcctcg cccgtcgccg tgtcgtacag agtgtggaag    147420
     acatgcagcc gcttctcgtc gacggagagg atctggcagg tcgagtggat cgcctggccg    147480
     agtttcgcct cgccgagatg gcggatatgg gtttccaccg tgtaatagct ctgccccgcc    147540
     tcgacatagg cgagatcgac gccgatgagg cgcaacaatg cgtccgatgt atcgccgaaa    147600
     acctgcaggt agcggtgctc ggtcatatgg ccgttatagt cgacccaggc agggccgact    147660
     ttcgtctcca cgagcctcag cggcttcgac gggtcgaaag acgtggccgc cctaccgcct    147720
     tgcgcccaga gcgattgctc gaagtccttc agcagcttgc cggcgcccca gcccttgccg    147780
     ccatcgccgc ccttgagggc ctgcaggatg ccgacgaggt tttcgtcgcg gatgcgttcg    147840
     agctcgcgga tcgacaggcc ggccgcctgt tcgtcggatt gccggccgat cttttcgatc    147900
     agcgcatcgt cgagatcgac gacatcggtg agcttggtcc agggccaggc gaggcatgga    147960
     ccgaactggg cgaggaagtg gcgcatgccg gcctcgccgc cggcaatgcg gtaggtctgg    148020
     aacaggccca tctgcgccca gcgcaagccg aaagagtagc ggatgacatc gtcgagggtc    148080
     tcgaccgtgc aaatatcgtc atggatcagc cacaaggcct cacgccagag cgcttcgagc    148140
     agccggtcgc cgacaaaggc ctcgatctcc ttggcgatgt ggacgccctt cataccgagc    148200
     ggcgccagtc tttcgatcgc cgcccggatg gtcgccgccg aggttttttc gccaccgacg    148260
     atttcgacga gcggcagcag atagacggga ttataggggt gggcgacgaa gaggcgttcg    148320
     ggatgcgtca tgtcgcgctg cagatcgctc ggcagcaggc ctgaggtgga agagccgatc    148380
     agggcgtccg agcgtgctgc agcatcgatc tcagtcagga cacggcgctt gaggtcgagc    148440
     ctttccggca cgctttcctg aatccagtcg gcgccggcga cagcttcctc gagcttcgcg    148500
     cagaaggtca gcctgccgcg gggcggcagg ggtgctccgg tcagcatggc ataggctttt    148560
     tcggcgttag cgagcacttc gccgacgatg cggctcgctt ccggatgcgg atcgaacaca    148620
     tcaacgtcaa tgccggccag cagaaaacgc gcgatccatc cgccgccaat gacgccgccg    148680
     ccgatacaag ccgccttgtt gatcccagtc atgccgtcct cagcgcttcg tcagtttgag    148740
     tttcttgcga acgtcttccg ggccgataat ccgggcaccc atgccctcga ccacttgcac    148800
     ggccttttca acgagctcag cattggtggc gagttggccc ttgccgacaa agagattgtc    148860
     ctccaggccg acgcgcacgt tgccgccggc cagaacggct gccgccggat aggccatggc    148920
     gttgcggccg atcgaaaagg ccgaaaaagt ccagctctga ggcacgttgt tgaccatcgc    148980
     catgaaggta ttgagatcgt cgggcgcccc ccatggtatg cccatgcaga gctggatcag    149040
     caccgggtct tcgatcaggc cttcctcggc aagctgcttg gcaaaccaga gatggccggt    149100
     gtcgaaagcc tcgatttcgg ggcgcacgcc gagaccggtc atcttcttcg ccatggcccg    149160
     cagcatggcc ggcgtgttgg tcatgacata gtcgccgagg ttgaagttca tcgtgccgca    149220
     gtcgagcgtg cagatttcag gcaagcattc ggcgatatgg ctgacgcgct cggtggcgcc    149280
     ggccatatcc gtgccgttag gattgagggg aagggggctt tcgacatccc cgaaaatcag    149340
     gtctccgccc atgccggcgg tgagattgag gacgacatcg acatcggccg agcggatgcg    149400
     gtcggtgacc tccctgtaga ggtcgttgcg gcggctggca gcacccgttt ccgggtcgcg    149460
     gacgtggcag tgaaccaccg cagcaccagc ctttgccgcg tcgatggcgg aatcggcgat    149520
     ctgcttggga gtgatcggca cgtggctgga tctggaaacc gtgtcgccgg cgccggtaac    149580
     ggcgcaggta atgaagacat cgcggttcat cgcaagaggc atgtttttgt tctccctcgt    149640
     cttgtcggca ttacgcgaca ggatgaagga cgatgcgttg caatatcgga agcaaccgat    149700
     acattatcgg aactctaggg agatgatctt gctgcagcga tccacagaac ggctcgatat    149760
     cgaccttctc gtcctgccgg acgcgaacct gatcctgatc gcctcggtga tcgagccgct    149820
     gcgcggcgcc aaccgcattt ccggcagcga gctctatcgc tggcggctgc tgacgccgga    149880
     cggagcaccg gtcccgacca ccagcaatat tgccgtgccc gcgcaaggcg ctttcaaggc    149940
     gacgaccgag gatacgccgc tgttcgtact tgctagctac aactggcgcc gaagtgctac    150000
     gccggcgctg aagatgcagc tctcccaggc cgcccgctat cgcacggtga ttgccggcat    150060
     cgagtccggc acctggctgc tagccgaagc cagcctgctc gacgggctcc cggcaaccgt    150120
     ccactgggag gactacgagg attttgcgct ggcctatcct gaggtgcggg ccgtcaagga    150180
     tcgtttcgtc atcgacggca agcggctgac gacgtcaggt tcgcttccga ccgtcgacct    150240
     gatgctggag gtgatccggc aaaggcaggg ttattcgctg gcgctcgagg tcagccggct    150300
     gttccgctac gagcagccgt ccttccatgc ggacgagcag ctttccgcag cctcggcggg    150360
     gttgcgcatg catgatcccc gcgtgaccca ggcagtacgg ctgatggagg agcatatcga    150420
     gcagcctctg gtcctgacac ggctggcccg gcgggtgggt atcagcgccc ggcatctgca    150480
     gtatctcttc cagcagagca tcggcgcgcc gccgcatgtg cactatctgg cgctgcgcct    150540
     gaatgcggcg cgccgcaagg tgatcgagac gacagcctct ttcgccgaca tcgcggcggc    150600
     aaccggcttc aattcggcct cagcctttgc gagaagctac cgggcgagtt tttccgagag    150660
     cccgtccgag acccggcgcc gcttgcgccg ccgcatcacg tcatcgcagg cgccggtata    150720
     ggctggaacg cgtcccgtat catctcagca agctcccgaa cggcctcgct ggaacggtag    150780
     gtgcttcggc ggagcacgac cttggaggag tcgaccggcg ggaaaccgtc ttcggcggtc    150840
     agctcccggc agccgggcgg tatattgctg cgggaaagcg tggtcacggc aaggccggca    150900
     atcacggcat tcttcagccc cgagccggta tcggcgatga aggcgatccg atagttgcgg    150960
     ccgatctgct ccagcgaccg gagcgcaaaa tcgcgcgacc aggtggaatt gcgataggtc    151020
     gcaatcggca ggggatcgat gtcgtgcagc cgatggacca ttgatgtgac ccagaccgtg    151080
     ggatcaatgc agatgacctc gcctttcgtc tcatcgctcc agtcgaaaac gacggccaga    151140
     tcaagctcgt cccgctcgag ggcggcgagg ttacggacgg tatagtcgca ggacacggtc    151200
     acctcgacgg ccgggtggcg aacggcgaaa gccgcgagcg ccgccggcag taccgtctgg    151260
     ctgtattcct cgggaattcc gatgcgcacc ggcccatcta gcggcttgct gcggatcgtc    151320
     gcggcggcct cgttcaagag gtcgatgatc ctgcgggcat aggggacgag ttgcatgcct    151380
     tgacgcgtca gcaatacgcc gcgggcgccg cgctcgaaca gcgtttcgcc gatcgtctgc    151440
     tccagctttt tgatctggct gctgacggcc gactgcgtcc gcccgatgcg ctgagcggcc    151500
     gcggagaagt tcgacgtctc ggcgacgaca agaaaggttc tcagcaggtc gctttcaatc    151560
     ggctcgtgca tgttcagcca tagaaaaaat cgatgatagc catctctact attcgtttgt    151620
     ctgatgtcaa ttctgggcgc acaaatgacc cgcgttcgac ttccttcttt gagaatatct    151680
     gcgtgacaat tgaaaatccg gccagacgcc tcgcaagcag cgagcatgag aagggtgtgt    151740
     ttctcatcgt tgctgcgaca cttgcctgga gcgcgagcgg cgtctattcg cgactcctga    151800
     cgaccgacgt atggacggcg atcgcctggc gatcgttgtt cggtggcctg ttcctgctga    151860
     tcccctgcct tttcctcgaa gggggtattt cacggcagca atggcgtttc atcttccatc    151920
     cgtccagcct tgcgatgatc gcctgccaga ccttcagtca gggctgcttc atcggggcgc    151980
     tctacatgac caccgtcgcc aatgtgacga tgatctatgc gaccgcgcca tttatcgcgg    152040
     ccatgctcgg ctgggtcatc ctcagggaga gggtctccag gcggacgctg attgccggcg    152100
     gcatctcgct cctcggcgtc gcggtcatcg tcgcctcgtc gatcggcggc ggcaccggat    152160
     ggggcgacct gctggcgctc ggcatgacag cgtccttcgc gctcgtcatc atcattccgc    152220
     ggatcagtcc cgacgtgccg agcctgccgc cgaccgtggt cagcgctttc ctgacgcttg    152280
     cactcttcgc gccgttcggt tcggtaggct cgctcgacct gcacaactgg atcgttcttg    152340
     ctgccttcgg cgcgaccaat ttctccctgg cactggtgct cttccttgcc ggggcgaagc    152400
     ggatgccgcc agcggaggcg gcgctgatcg gcacaatgga aatcgtgctc acgccgttct    152460
     gggtctggct gctgttttcc gaagagccgc ccgtcgccac gtttttcggc ggcgcgatca    152520
     tcctcggcgc agtgatctgg cacacggcca tcgacgtcag ccgcagccgg cgaccgcatc    152580
     gcgcctaaag cctttaggcg gcgatcaatc ttccgggacg atccggaaaa ccgccgtatt    152640
     cgcgggatca gttactcccc tgcacagcga gctatggcga ctttgccgac tgtcgtcttt    152700
     gcgttgcacc catgtcgttt tcttgatcgc tgttttccgt caggcatggt ttgtttgtgg    152760
     tgttcaaggc gctatctcgc aaactggcga aatgggcatt gggaagccgg cctgacgcgc    152820
     cgacgctccc agcagcggta ggagaactga aatcctcaag gaaatcgccg gatagaaatc    152880
     cggaaagata tcgagatgga tcgaaaggag attctggagc tggaaaccag ctcttggcag    152940
     agcaaatcga cggattgcag gcagacgatc acgagcggaa cgacaggcga aagccatgac    153000
     gtttactcct cttctccatt caatctgtcc cttttgcaaa atccgaatat cgcccgatgc    153060
     ggcggtatcc tcgtgttgtg gacaccgggc tgctgaggag gcaggccgga gggaaggttg    153120
     ccatcggctg cattggttgc agatcgaggc attcaaacaa gtgggaggaa ttcatgagta    153180
     aaaatagagg cgtcgtctat ctccggccgg gcaaggtcga agttcgcgac atcgacgacc    153240
     cgaagctgga agcgcctgac ggccgccgca tcgaacacgg cgtcattctg aaagtgattt    153300
     ctaccaatat ctgcggctcc gatcagcaca tggtccgcgg ccgcacgacg gcgatgccgg    153360
     gcctggtcct tggtcatgaa atcaccggcg agatcatcga gaaaggcatc gatgtcgaga    153420
     tgctcgaaat cggcgatatc gtctcggtgc ctttcaatgt cgcctgcggc cgctgccgct    153480
     gctgcaagtc tcaggatacc ggtgtctgcc tgacggtaaa cccggcccgc gccggcggtg    153540
     cttatggtta tgtcgacatg ggcggctgga tcggcggaca ggcacgctac gtcaccattc    153600
     cctacgcaga tttcaacctg ctgaaaatcc ccgatcggga caaggcaatg gcgaagatcc    153660
     gggatctcac catgctctcc gacatcctgc ccaccggctt ccatggcgca gtgcgggcag    153720
     gcgttggcgt cggctcgacc gtctatgtcg caggcgcggg ccccgtcggc cttgcggctg    153780
     ccgcttcggc tcgcattctc ggcgccgcag tcgtgatgat cggtgacttc aacaaagacc    153840
     gtctggcgca tgcggcgaag gtcggtttcg aaccgatcga cctgtcgaag agcgaccgtc    153900
     ttggcgacat gatcgcgcag gtcgtcggca ccaacgaagt ggacagcgcc atcgatgctg    153960
     tcggcttcga ggcccgcggc cactcgggcg gggaacagcc ggcgatcgtg ctcaatcaga    154020
     tgatggagat tacccgtgcc gccggttcga tcggcattcc cggcctctac gttaccgagg    154080
     atccaggtgc tgtcgacaat gccgccaaac acggcaattt gtcgcttcgc ttcggcctcg    154140
     gatgggccaa ggcgcagtcc ttccacaccg gccagactcc ggtgatcaaa tacaatcgtc    154200
     aactcatgca ggcgatcctc cacgaccgac tgccaattgc cgatatcgtc aacgccaagg    154260
     tcatcccgct cgacgatgcc gccaatggat atgagagctt cgaccaggga gcggcgacga    154320
     aatatgtcct cgatccgcat ggcgaggtgg cgaaagccgc atagcgacat tactgcacac    154380
     ataggaatgg ccgggcgaaa acccggccat tccgcattct cgaaaaattg gacggcgaac    154440
     tactggatgc tgaacgggaa atatttggcg ttgatcatgt cataggttcc gtccgcctgg    154500
     atgctcttca acgcttcgtt cagacgtgtc agacgctcct tgtcatccaa gcgcagcgct    154560
     ataccggcgc cttcaccaaa ataggtgacg tcgaccaggt ccggcccctt gaactcgcag    154620
     cagcttccag ccttggtgtt ggcaatccaa tcatagatgg ccagtttatc ctcgaggata    154680
     atgtcgacgc tcccatccgc cagacccttg tacaattccg gcgaagaccg aaacaccgtc    154740
     tttttcattg ccggataaag atggttggca taggattcct gcgctgtcga cgacgtcacc    154800
     ccaagaattt tgtcgctgag ggcggcgggg ctgacatcgc tgatcgacga atccttccgg    154860
     gcgatgaaca ccgacgggct gttgtagtat ttttcagtga aggcaacctt ttgacgccgc    154920
     tcaaggctca tcgacatgga tgagatgatc gcgtcgtatt tgtcggcaac gagatcgggg    154980
     atgatgtcgt cccacttctc gatgataaat tggcattcaa acttgccgac ctcgcacagc    155040
     gcattggcaa tatcgatatc gaagccctga agcttgttgt ttgaatcgag atagttgaag    155100
     ggcggaaatg caccttcgac ggcaattctc attggcatgc gatcctgcgc agccagctcg    155160
     agcggcgcgg ccgccgctaa caagacaccg atcccgcccg ccatcagcgt tccgcgcaat    155220
     atggtctgaa tggatatgcg caacatcgtc gggagctcct tggggcatag tcgatctcgc    155280
     gccatagtgg gccacagctt ttaattctac gtgaacgctt ctttgttagc gtcgacgaat    155340
     gcgcgcgtgt cgtggtgttc aggggtctag gcttgcagat cgttcttcct tccagctcca    155400
     atacgtttca gcaatcctgg atcgcctccg ggagaattct gttccttatt gccgtcagcg    155460
     ggctcggagc gatcgggctt gtcgtactct cggcgctctg ggcaggaacc gaaagcgatg    155520
     ccgcagccct cgatcgacag cgtcagcttg tgaatgcccg cctgcgcgaa caggtcgatc    155580
     aagtcgcgca tgttatcggc cagttcggca atggctatct cgcacgtgtc tatcctgccg    155640
     ccctttcgac cgaaggctcc tccggcctcg atgccgtttt gacggcagca gccgggagtg    155700
     cgatcggcca gacggctatg tcggcgttcg gctacgacca ggcctttgtt gtcgatgaaa    155760
     aggcgcaact gctcatgctg gcggacgccc aaacggagaa gcggtaccgc tggatgaggc    155820
     ctctcttttt gcctctcctt caggatgccc gctttggggt caggcgaagc acggctttga    155880
     acgaaagaac gccatcctca atggaagccc gccttgcgag cgccgcccat tccaaccgtg    155940
     ctctggccaa tctgatgcgg ctcgagggcc ggccgaccat cgtcggagtc gtcgccatta    156000
     acgaggctgc cgggggacag cgccagccga tgcggcaatt cctgatcgtc gtgcgcttta    156060
     tcgatggtgc ggcgctggac gaattgagcc ggcaacaggg ccttaacggc gcccgcttcg    156120
     cgcgcaccgc cgatgcggac gaaaatgagg ttgcgttcca gattgacgcc acggcaaacg    156180
     gcgaaccgat cggctttatc gtatggcggc cggatcttcc aggttcgagg gtgatcggtc    156240
     gattgatgcc ggcgctttcg attgccgcct tggtgatcgc gatcctgttc tcggtcttgc    156300
     tggtgcgcct gcgaaggagt ctcggcgagt tgaagaaaag cgagctgcat gcaaggcagc    156360
     ttgccttgca tgatgtgctc accgatcttc ccaaccgcgc tttgttcgct atgaggttcg    156420
     acgagtgcct ggccgagacg cagaattcga ccgagcgctc ggcggtcgca cttctcgacc    156480
     tcgatcgctt caaagcggtg aacgacacat tcggccatgc cgccggcgat gaactcatca    156540
     ggatggccgc cgagcggatc cgctcgctgc ttcgtccggg cgacacgctt gcccggctag    156600
     ggggcgacga atttgcgctg cttctccggg acatcaaaga tcatgaccac gttttgccgg    156660
     caatatgcga agcgatcgtt gccgaacttg gcaaaccctt cccgcttttg cgcggcgaag    156720
     cggttgcgcg cgtcggcggc tcgatcggcg tgaccgtcgt gccggatgcc gggcggaatg    156780
     ccgatgacat catgcgctac gccgacgtcg cgctgtacga ggcaaagatg ggcggccgag    156840
     gccagtggcg tctctattca ccgtccatgg acggcggccg aaatgcacgc gacattctca    156900
     agaacgaatt gcgggaagtt ctggccaaag gcatggcctc agatggtcca cacgccgatc    156960
     cggtttcgaa ccggccggac ttcggatcgc tcgaggtcta ttaccaaacg gtccatcgcg    157020
     ctgaggcagg atacgcggcg tcgggcgcgg aagctctcgt gcgttggcgt cacagtcagc    157080
     gcgggctgtt gacgcctgcc agcttcatcc ctgtcgccga ggagggcggc ctcatcgacg    157140
     ctctcggttt ctgggtcttg cgcgaagcct gcagagccgc ctgcaaatgg ccggaggaca    157200
     cgtttgttgc ggtcaacgtg tctcctgccc agttgagaag accgaatttc gccgaggaag    157260
     ttttcgccgt gcttgaggag agcggtctgc agccgtcccg gctcgagctc gaactcaccg    157320
     agtcctcact gatcgaggac aactcggacg tttatacggt gctgaagtcg ttgcgcagcc    157380
     ggggtgtcca ggtttcgctg gatgatttcg gaactggctt ttcatgcctc agccatctcc    157440
     tgcgcttcga tatcgaccgc atcaagatcg atcgatcgtt cgtctcacag ctcggcacca    157500
     aggccaatgg ggcggcaatc attggcgcca tcgtcgcgct cagccgtaac ctcggtatct    157560
     cgacgacggc cgaaggggtc gaaaccgatt atcaacgcga ctttctggcc gccctcggct    157620
     gcaccgacct ccaaggctac ttcttctcca aacccgttcc tattggcgag cttgatagtt    157680
     tccggaaagc tgaaagcgcc gctgggttac tgacgaccgc ccgaggcgcc gtcgcgtgag    157740
     aggcttcaga tcttccgcag gctaggggaa ctttcgcccc gcgtcgcggt tgacgcgcga    157800
     agaccgaatg gaggatgtga tgggcgaggt cggggaatgg cggcaccttt gcgtcgacat    157860
     gcagcggatg tttgccgaag acacgccgtg gcacgttgcc tggatggcac ggatctctcc    157920
     ccagatcgaa gagctggccg ggcggcatcc gtcgcgaacg atctttaccc gcttcctgcc    157980
     acccgagcgt gcggacgaca tgccggggaa atggcgggat tattaccaga aatggtggat    158040
     gatgacgggc gaacatcttc cgcgcggctt catagatctc gccccatcgc tggcctcgtt    158100
     ggttccgccg gcaaggcact tcgacaaacg cacttattcg ccttggatcg acggccgcct    158160
     gcatccgatc cttcagtcgg agcgggtcga tacgcttgtg ataacgggcg gtgaaacgga    158220
     tgtctgcgtg cttgccacga cgctcggcgc gatcgatctc ggctatcgtg tcatcgtgct    158280
     gaacgacgcc gtctgtagcg gcgccgacga tacgcatgac gcgtcactgg aacttctgca    158340
     cgatcggttt tccgtgcagc tcgaactcat ggataccgaa gagtttttga gatgcgttgg    158400
     ctagtacgct tggcgtgacg atgaaggctt cgccgtaata ctgctcatcg cctccaccga    158460
     cagtggctgc atgacgggag gcgtcggtgg cgacgaccat gggcgtgaga ttccctgctt    158520
     ccgtcattgc taggtgcgaa tgatatgatc ttggcccatc cggccagttg ccacggatga    158580
     ccgagaggtc ggccttagcg cctgccgatc gatggactaa acaccatgag gctcaggacc    158640
     tcaaagagca cctgtgctgc ggcgtgcgcc gtgttggtcg ttgcgtcata ttgcggggcg    158700
     acttcgacga cgtcaccacc caccagattt atccccttca gtccgcgtat cagttcaagg    158760
     acttcacgcg tggtcaatcc accgacctcg ggcgtgcccg tgccgggcgc aaagctcgga    158820
     tcgaggctgt cgacgtcgaa ggaaagatag gtggggccgt cgccgacgat ggattttgcc    158880
     ttggcaatga cggccgcaat ccccattccg ctgatgtcct ctgcgtggat cacggtcatt    158940
     cccgaagcgt aggagaattc ccacaaatat tccgctgaac cgcggatgcc gatctggata    159000
     gtccgtgtcg gatcgagcac gccgtcaagc accgcattgc ggaacggccc accgtgatga    159060
     aacttcgtct gatcgaaagc gccgcttgta tcgcaatggg catcaatatg gatgaggccg    159120
     accggttggt gccggccgat ggccttcaat atcgggtggc tgatggaatg atcgcctccg    159180
     acggaaagcg gggccacgcc ggcatcgacg atctggccga tccgcttttc gatgtcgtcg    159240
     tggctgagtt ccaaccggta acggctttgg aacgatatgt cgccgatatc ggcgacccga    159300
     agatcgaaga ccggcgccgt agcgagaaca tgattgtagg ggccgatcct ttcgatggcg    159360
     cgaagtgctc tcggtccgaa acgcgagcct ggacgattgg tgacgccaag atccatgggg    159420
     atcccggtga tcgcaacctg gagattgccg aaatccggat catcggccgc gacctgcatg    159480
     tagggtgcgc tgaggaaggt cggcactccg gcgtatggcg ccagtctcgt gccgctcttg    159540
     gagatgatct tctccgctac tttgcgaaac ttctcatcga atatctcgcc gccattggcg    159600
     tctgcaaatt ctgcgcgcag ttgctcgagc cgcgttttat cccacaccat atgcatgcgt    159660
     ctccgcttca ggtccgtctc gtcagacaaa gaggttgaga aaacaattgg tatcgttgta    159720
     gcaatcggta tcaaagagaa atcgatatga tcgctgcaaa acccaattcc ctcgttgccc    159780
     gcctctctgc cccgcccatt ccttccgtcg tcgcctggag ccacgaatac aaggggggaa    159840
     aagggccact catcgatttg tcgcaagctg tgcccggcta tcccgcgcat ccggagatgc    159900
     ttcggcttct cgccgaggcg gctgggcaac aggcgatgac aggatacggg ccgatcgagg    159960
     gcgaaccttt attgcgcaag acctacgcgg ctcacgttgc cgaatattac ggcgccgacc    160020
     tttccgccgg caatatccac attaccgccg gctgcaatca ggcgttcatg tgttcggcaa    160080
     tcgcgcttgc cggcgccggc gataccgtcg cgctgaccaa tcccttctat ttcaatcacg    160140
     atacgacgct gtcgatgctg gggatcggtc gacggctggt cgattgcgac ccagccttcg    160200
     gctttcttcc cgatccaggt tcggccgagg cggcccttgc ggccggcgcg aagatgcttg    160260
     ccgtcgtcac accaaacaat cccaccgggg ccgtgtatcc gccgagcctg ctgcatgagc    160320
     ttttcgttct ctgccggaga tacggcgcct ggctgatcct cgatgaaacc tatcgcgatt    160380
     tcctcggcga ggataacgga cggccacact cactcctctc agagccgggc tgggaagaca    160440
     cgctcgttct tctctacagc ttctcgaaat ccttctgcat ccccggtcac aggctgggtg    160500
     caatcacggc agggcctaaa ctcatcgccg agatcgccaa ggtgatggac aatatgcaga    160560
     tctgcgcgcc gcgctcggcc cagatcgccg ttgcatcggc gatcccggcg cttgccgatt    160620
     ggcgggccgg caaccggctg gagattgctc gccgggcgga cgctttgagg ttggtccttt    160680
     ccgggctgcc ggattgggag atcggtgcga ttggcgccta tttcgccttt gtccgccatc    160740
     cccacgccga tcgatcgtct tccgaagttg ccgagaaact cgccaaggaa tccggcatcg    160800
     tttgtttgcc cggcgcctat ttcggcgagg gccaggagcg ttacctcaga cttgcctttg    160860
     ccaatgcgga tgtcgcctcg attgggctat tgtccgagcg ccttcgctag accgttttga    160920
     tcaacctccg ccggaagttc atgatagccg ccgcgccagt agagcagcgg ccctatgccc    160980
     tgccggattt ccattgcgca aacatgtccg accaaaatgg catgggaatt gtagtggaaa    161040
     gcggtttcga gcttgcagtc caggaccgtc agggcgtttt caagggcggc cgcgccggtc    161100
     ttgaggcgat accatcctgc accgccgtag cgttcggcgc cctttcgtcc gtcaagaccg    161160
     gcaaaggatt gcgccacctg ttgctggtcg gcggcgagca cgttgacgca gaagcagccg    161220
     taccgctgca gcgccggcca tgaggaagac gctcggttga cgctgacgat gacggacggc    161280
     aactccgccg atagcgagga gaccgacgtt gccgtgaagc cggtgcggtg ttgcccgtcg    161340
     ccgaccgtaa tcacgctgac ggcacccgcc agatgacgca tcgaaagctt gaagtccgct    161400
     tcgctgatca aagcctcgac actcatcggg ctggctcttt tgttttggca aagcggttta    161460
     ccggcattga aagaccgagg ttttcgcgca aggtcttgcc ttcgtattcc tcgcggaaca    161520
     gcccgcggcg tcgaagctct ggcaggacaa gccgcacgaa gtcgtcgagg ctggacggca    161580
     aggtcggaaa catcaggatg aagccgtcgg cggcgcgcgt ttcgaaccat tcctccatga    161640
     agtcggcaat ctgggccggc gtgcccgtca tgccatttcc ggtatgcttc tcggcatagt    161700
     gccggatgag ctcgccgacg gtgcggccgc ttctgacgaa atcgaccagc tcgtcgaaca    161760
     aggcgcgtga tcccttgggc gccgccggca gccgatccat ggggaaaggc ttgtcgagtg    161820
     cgacgtcacg caggtccgcc tcgaggaatt cggagagcat cagccggccg acatccggat    161880
     gcatcttgtc gatcagataa tccaccttcg cctttgcctc ggcttcagtt tcaccgacgt    161940
     tgatgacgat gcccggcatg atcttcaggt catcgggatc gcgcccaaag gccggcatcc    162000
     ggcgcttgac gttttcgtaa aaagcccggt tgcggtcgat attcgatgcg aggctgaaga    162060
     cgatctccgc cgtgcgtgcc gccatgtcca ttccgggttc ggaaccgccc gcctgggcaa    162120
     tgacaggacg gccctggggc gttcgcgcga tgttgagggg tccgcgaacc tggaagtgcg    162180
     tgcctttgtg attgagcgtg tggtgcttgt ccttgtcgta gtagacaccg ttttcacggt    162240
     cgagaagcag tgcgccgtcc tcgaagctgt cccaaagacc gaatacgaca tcgacgaact    162300
     cgttgccacg ctcgtagcgt aacgcatgcg ggtcgagccc ttcacgattg aaattgtagc    162360
     cggtttcgtc gtggtcggag gtgacgacat tccagcagac acggccctta ctcagatggt    162420
     cgatcgaggc gaacaagcgc gcgacattgt atggttcgta ataactcgtc gataccgtcg    162480
     ccacgaggcc gaggtcattg gtggtgaccg ccagagccga aagcagcgac agcggttcga    162540
     aacggttcat cttggttgga atgcgggcaa gcgctttcgg atcgccgacg gcagcggcag    162600
     gagaatccgc catgaacatg aaatcgaatt tggccgcctc ggatcgtttg gcgacatcga    162660
     gcagatgggc gaagtcgttg gcgccattga cgtcgcttgc cggatgcagc caggaggccg    162720
     ggtgaaagcc gaatgtgtag acgaaagtcc cgagtttcat cttgtcggtt cgcgccatcg    162780
     agctctcctg ctatgtcggc cacgccgcca acggtggagg gcgactgcgt aaattatcgc    162840
     caggcgcaaa ttttcatcaa tatcgctcag ctaggttccg ttttagtttt tctaaagtat    162900
     cggcttaggc gctgacgcca gggcctgctg acgggaaatg gcaatgagcc actcgcggaa    162960
     ttcgtgcccg tggggcttct gcaaggccgc acggtcccag gcgagaaaat agctttcgcg    163020
     cagtgcaatg cgcaggtcga cgggaatgac cagcgtttgc gcttcaagct cgtctgatat    163080
     catcgacatt tgtgcgagca cgacgccgcg cttgttgaca gcagcatcaa tcgcgctgct    163140
     cgaaagagtg aaggaaaggc ccggcgtcga cgcatcgagg gggacaccgg ccttggcggc    163200
     aaactccgcc cagctgggat aaggggtgaa gtgccgttcc cactcgacat ggaggagggg    163260
     cttttcgaaa agatcgcgag ccgcatgcgc gcgatcctgc atcagcgccg gcgagcaggc    163320
     aggcaccacc caatcgcgga acagttcggt atagtgttcg tgctggagga cgtccgatcc    163380
     atagctgacg cggaaatcga catcgtcgaa accgatccgg ggctctttgt cgcgtccgat    163440
     aatcctcact ggaacttcgg gatgaagcgc ctgccagtcg aagatgcgcc tgccgatcca    163500
     tttgttgacg acggaggaaa gcgcactgag caccagcgcc gtctcgttgc gcgccttttc    163560
     caacaattgc tgggccagcg caaattgctc gaaccccttc gatatctcct gatggtagag    163620
     ccggccccag gcggtcagct cgacggttcg cccgctgcgt tccagaagcg aaattccaag    163680
     aaagctttcg atcttgcgga tctgctggct gatggcgccc ggcgaaaccc tgagctccag    163740
     cgccgctgcc gtcacgccgc cgcagcgccc caccgcctcg aacgcctgca aacttttcag    163800
     cgggatcgcc ttgaggcgct catcggtcac ttgcagaacc tctcgtgatt ggcgtcgagc    163860
     tcaatttgct gccggatgaa acgtccccgc aaactggaac cggtcgcctg gatgggtgaa    163920
     ctcgacatag gtcaccgtac gaccgttctg ccaggtctgg cggatgaggc taaggcaggc    163980
     ctcgccgcgt tccgtctgca ggatccgcgc cgtcgtggtg tcggccgaaa cggcgcgaat    164040
     gacatgtttg gccttggacc agggaacctc gtcaagcagc catttgccgg gcggagttga    164100
     agcaaagctc tcctctctcg cccgtgggac agcatcgagc atgatgatcc gccgctcgat    164160
     ggcattcggc ctgccatcga cgatatgcag gcattggagc ctgaggactt ctgcatcggc    164220
     aggttccgac agctgctgcg cctccgcctc tccaaggcgc tcgatcttgc gggcgaggat    164280
     ttcgaagcgg tgttcgtgcc cggccagttc cgcttcggtg ctgatatcct ggatatccat    164340
     caccgtgcgg tcgatctggg gcgatgcgac aaacgaacct gtcttgcgcc gtctgacaat    164400
     catgccgcgc tctgcgagcg ccgacagcgc cttgctgacg gtcatccgcg agcaccgata    164460
     ttccgccgcg agttcgtgtt cgacgggaat acggtcaccg ggccgccaat cgccgctgat    164520
     gatcttcgtc tcgacatcgg tgaaaatacg ttgataaatc gacaccaagc ccgcacctca    164580
     tccggcgtca aggacataaa ttccggaacg gtcatgccag cgagatcgac gccacccggc    164640
     acaaattttg cgttcctcgt cttttacatt gacactctag gccagcctat atctatttgt    164700
     atagtcaaaa gcggagcata gaaatccgcg cagaggaaat cgaagtcggg aacaaaaact    164760
     cctccgccgg gggaataaaa actggagaga tgatcatgaa ggcacattca ctgctgaagg    164820
     gtctggtcgg cgccgcgttc ctgctcggag cagccgtttc cgcccatgcc gccgacacgc    164880
     tggcagccgt caaggcagcc ggcaccctca aggtcggcac cgaaacggct ttcgcaccgt    164940
     tcgactatat cgatgccggc gaacacacgg gcttgaacgt cgacctcttt gccgagatcg    165000
     gcaaggaact cggcgtcaag atcgagtggg tcgcccttcc ctgggacggc gtcttcccgg    165060
     cgctcgaggc cggcaagttc gatgtcgtcg caggtcctgc aacgatcacc aagaagcgca    165120
     tggagcgcta tcgcttcacg ccgccgatcg ccgaagcaac gattgccatt ctgaagaagg    165180
     ctggcgacac gacgatcagc aagccggaag atattgccgg caagacgatc ggtgtcggca    165240
     aggcaactgc gcagctcgac cagctgaagg aattctccgc cacgctgccg accaaggtcg    165300
     acgtgcgcga atatcccgcc tttaccgaat cctacgccga tctcgccgcc ggccgtattg    165360
     ccggcgtcgc caattcgctg ccgaatatcg ccttcgtcgc cagccagcga aaaggcacct    165420
     tcgaagtcgt cctgccgcca ttcggcaaga agtcctattt cggcttcatc ggtctcaagg    165480
     atgccgacca tgcgcccctg atggatgcga tcgacgccgc gatgctcaag atcaaggcag    165540
     acgggcgcat ggcagagctg cagaagaagt ggtttggtgc atctttcgat acgcctgatg    165600
     ctgtcaagga cccggcattc tgatttgccg ccggtgaaac gaacgcgccc cgccagtggt    165660
     cggggcgcaa tctgccgtgg catcagagtt cacggccgca gcgcccaggc aaacatcgcc    165720
     catgtccatc aagcttttcg aactgcttct gcaagcctcg atctacacgg tgacgatcag    165780
     cgtggtttct atcctgatcg gctttgcgat cgcgatcgtt atttccgcca tgttgctttc    165840
     gcagcaacgg cttttggtgc tgccggcgaa gattttcatc agtttttttc gcggagtgcc    165900
     gctgctggtg cagctgttgc tcatctataa cctgctgccg gcgatcgaca tcaacgtgcc    165960
     gagcatcgtt gcggccatcg ttggtctgtc gctgtgtacg gcagcctacc aggctgaaaa    166020
     tctgcgcggc ggttttgcca gcgttcccat gggcctggtc gaatctgccg aaatggttgg    166080
     catgagtccc gttcagatct tccgtcgtat caaggccccg atcgccctgc gcctgacctt    166140
     tccagcactc gtcaacgaag cgatccttat cctgaaagcg tcttcgctgg tctcggtcgt    166200
     cggcgtcatc gagctgacgc gcatggccca ggatcttgcc ggcagcacct tcctgccgct    166260
     tgagattttc gcttccgccg gtctaatcta tttcatcatc aattggatcg tcgcccttgc    166320
     gggcggcctg atcgaacgct ccctgccggg agtgccgcga tgaccttcga catcaatgtg    166380
     attttcaaca attttccgga aatcctcagc ggcgcatggc tcaccatcgt catctggatc    166440
     gtcaccacgc cggccgctgc cgcgctcggc ttccttgttg ccgttgccag gcgttttggc    166500
     ggcgttgtcc cggacaaggc attcggcgtt gtcatcgcag tgctgcgcgg cacgcccttc    166560
     ttgattcaga tattcctcgt ctactacggc ggccccttcg tcggattgtc actcgatccg    166620
     atcccggccg gcgtcatcgg cctttccatc tacggcgcgg cttatttcag cgagattttc    166680
     cgttcgggct ttgccgccgt cccgaaggga catatcgagg ccggcctgtg cgttggcctg    166740
     acacaagggc agatcgtccg acgcatattg ctgccggaga tgaccatgct ggtgttgccg    166800
     ccttcggtca acatgacgat catcctgatg aaggagacgg ccgtgctgtc catcatcacc    166860
     gtgccggagt tgacggcgac gttgagtgcg atcggttcgc agcaatatgc tttcgtcgag    166920
     gcgctcttcg tgcttgccct tttttattgg gcgctggtgg aaatcaccgg ctggctcggt    166980
     cacctcgccg aaacgaaact ctcaagattc aggtttttca acatatgagc attcctgcga    167040
     tcgcagtcaa aaatctcgtc aagacctttg gcggttccac cgtgctgcag ggcatcgacc    167100
     tcgacatcgt tcagggacag gtttcctgcg tcatcggccc atccggatcc ggcaagagta    167160
     cgctgctgcg ctgcatggcg tttctcgagg aatcgacgaa gggtacgatt gccgtcaacg    167220
     gcgaggtgct tggctttgcg gaaaacgcca agggcgtccg ggagcgggtg ccggcggcgg    167280
     cgaaccggcg gatccgatcc cagatcggca tggtttttca gcagttcaat ctctggccgc    167340
     atatgaccgc gctcggcaat gtcagcgagg cgctgaagtc cgttcacaag atgagccgca    167400
     aggatgctga ggagcgggca atggcccagc tcgtcaaggt cggcctcgag ggcagggcag    167460
     ggcactatcc gtcgcagctc tcgggagggc aacagcagcg cgtcgccatc gcccgggcgc    167520
     tagccctcaa cccgaagatc atgctgtttg acgagccgac ctcgtcactt gatcccgagc    167580
     tgaccggcga ggtgctcaac gtcatgcgcg atctcgccgc cgagggcatg acgatggtcg    167640
     tcgtctccca cgagatcgga tttgccgcga cggtcggcca gcagatcatc tttctcgatc    167700
     acggcaaggt gctgttcacc ggcccgccgc aggacgtctt caaacggccg agaaatcccc    167760
     gcctcgagca atttctggat acctatatcg atcgcggcgc ctcgatgctg ctgtgacgtt    167820
     catgtccttt cggatcgtcg ggcagacctt caaggccggc gtcgggttca ggcagtgtcg    167880
     tcttcgaata ttttgacggg ccggtcccac tggatgagca cgacacagcc ggtctcgctc    167940
     cagaccgaat gttcgctgcc cggtgcattg acgatataac tgccgctgat gtaatcgccc    168000
     gtctcgtcgg attgaacgcc atcgagcacc aggatggtct cgagcccctc gtggcgatgg    168060
     cggggaaccg aagcgccggg ctcatatttc agcagcgcca cgcccggctg atcgccctcg    168120
     aaggggcgga tccagtgaat ggtgacagca tcgcggaaag ggccgaattc caactccttc    168180
     cagccgcctg aggtcaggcg ttcgcgggtc gtttcaggca tgggcgatgc tttccagaat    168240
     gtcgtcgata tgggcggtcc agccgacgat cgcgccctgg gcgcggatca tggcgatggc    168300
     ggcggctttg aattcgggga aatagctttc cgtggcctcc tcggcgagca ggcattcata    168360
     gccgcggtcg tttgcttcgc gcatcgtcgt ctgcacgcag acttcggtgg tgacaccggc    168420
     aaagacgagc tgacgtatgc ccttctgctg caacacggtg ccgaggtcgg tcgcgtagaa    168480
     ggcgcccttg ccgggttttt cgatgacgac ttcgcccttc accggagcga gctccggaag    168540
     aattgccgtg ccgggttcgc ccgagatcag gatgcggccc atcgggcctt cgtcgccgat    168600
     cctgagcgca ggattgccgc ggtcgcgttt ggccggtggc aggtcggaga gatcaggccg    168660
     gtggcactcc atcgtatgga tcacaggcag gccggcattg cggaagccct ggatgaggcg    168720
     tttgacatcg ggcacgatcc tggtgatgcg gctgacatcg ttgccgaggc tggcgccgaa    168780
     tccgcccggc tcggcgaaat cgcgctgcat gtcgatgacg atgagggcga gctcatcgtg    168840
     tttcaccgga aaggcgaagg gttctgcctt gatccccatc atcaatgatg ccccgccatg    168900
     tgggcgccga tcacgccgat atcggccgaa cgcgccggtg tctcgtaaac cagcttgcct    168960
     tccgaaatga ccatgatgcg gtcggacatc tcgagcagtt cgtcgaggtc ttccgaaagc    169020
     agcagcacgg cggctcccaa attgcgggcc ttcatgatcc gggcgcggat ttcggcaacg    169080
     gccgagaaat cgaggccgaa acaggggttg gagactatca gcagatcgac atcgccggtc    169140
     agttcgcggg cgagcaccgc ccgctgcacg ttgccgcccg agagcgctgc gatcggcgag    169200
     gaggaagagg ccgtcttgac cttgaagtcg gagatcagcg ccgaggcacg cttcttcatg    169260
     ctgcccttgt tcagccagat cgcgtccttg ccgtccagct tcaaatcgaa ggtgcggaac    169320
     gcaaggttct cgctcacggt catcttgggc gcacaggcat tctgcaacgg ctcttcgggg    169380
     atgaaacgca ccctgttctt gcgggtctcc tcacgggtgg cgccgtaagt ctcgccattg    169440
     accatgacct ggccgctatc ggtcgggcgc tggccggcca gaatttccgt cagctccttc    169500
     tggccgttgc cggatatgcc ggcgatgccg acgatctcac cggagcggac cgtcagcgcg    169560
     tcgatctcga tcgtcttcag gccggagcga tccggagctt tcacctgggt cacagtgagc    169620
     acggatttgg ccgcttccgc caccggcaga cggctgtcga gctcggcgag cttgacgtcg    169680
     ccgatcatca tcgccgccat ctcggcggtg gagagctcgc cgaccttgcc ggtgccgacc    169740
     agcttgccgc gccgcaggat cgagacggca tcagcgaact tcgtcacctc gtggaacttg    169800
     tgggagatca tcagcacggt gagctcgccg cgctcggtca tcccgcggac gatgccgagc    169860
     atctcatcgg cttcggccgg cgtcagcacc gaggtcggct cgtcgaggac gaggaaggaa    169920
     cggccgagat agagctgctt gacgatttcg agcttctgtt tttcgccggc ggcaagctcg    169980
     ctcaccggcc tgtcgagcgg gatcttgaac ggcatgcgct ccatgaaagc cgccagatcc    170040
     ttgcgttccc tgggccagtt gatcaccgcg ggcacttcgg tgcggctgat gaccaggttt    170100
     tccgcaccgg tcagagaggg aaccagtgtg aaatgctggt agaccatgcc gagcccatag    170160
     gtcgcggcat ccttgggtga ggcgaccgcc acctcgcggc cgtcgaccga caacgagcct    170220
     gacgtggcgt gatagaagcc catgatgcat ttgacgagcg tcgacttgcc ggcgccgttt    170280
     tcgccgagaa gcgcgtgaaa agagccggcc ggaacggcga tcgagacgtt gtcgagcgcg    170340
     gtgaagctgc cgaaacgcat ggtcatatcg agcgtctcga tgccgacggc cttgccggct    170400
     tgcggaaggg gcgtgtcgcg gactgtgctc acttcattgc tccttttcga cgatgatggc    170460
     gacgggaccg ccgccgggcg gaccctggtg ttcggcgccg ccggacacat agagatcggt    170520
     aatgccgaag atgccggcga gaacgccgcc gacgaaggca cgggcatggc gggtgcctgc    170580
     aatatccgag tcatcgagca tcgtgtggcg cctgccgtcg atcctgccgg acgggtccgg    170640
     ctcggccttg gcgagaaccg ccgccagccg gctgttttcc ggcaggcgtt cgcgggcttt    170700
     cctgacggaa tgcgcgtcga tcgcatccag catgaccgcg tggtcgatcg acagcggacc    170760
     ggaccatttt gcgctcatgc cgaggacgat gatttcgtga tcggtgagtt cgcccccgga    170820
     cgaggttgag gcgcagcggg aaaagagatc gaaacgtgtg cagatgtcgg catcgccgat    170880
     cgatgtcgca tctatctcgc cgagtgccac ggcgacgccg agagccgaag cgccgcgcga    170940
     gaggcccatg gatttcagcg tgtcgtgggt tgcgaccgtc ctgcctgctg cctcggcctc    171000
     ggcaatccgg cgcgaggtga gcagcggaca cttgatctgc acgaaatgga catcggcggg    171060
     atcatcgatg ccggcatccc tcatcgcgga cttcacgcct tcggcaacga gcaggatctg    171120
     ttcccggcgc ccgagatgtt cggggggcag cgcgggggta cgcgacacac caatggccag    171180
     cgcccgttcg cccggggttt ctacggtttc acgcgcaaaa accgtccaat gcggcgagag    171240
     cgccccctcg gtgccgccgg acatgatgat cgagacgccg tcgacgccat atctactgaa    171300
     caatgtctcg aagctgcggg tggcataacc gcgggtaaaa tcattgacgc agccgttgcc    171360
     ttccgtcttg ccgagaacgg cgacgacgtt gttcgcctga aggccgctgg caaagagcgc    171420
     ctcgacgccg gcaacgtcat cggggccgtc ggctggcacg cgaaagacat gggcacgcaa    171480
     tgacggcatc agggcagcgc ctcgactaga gccgcggaat tggagaccga gccgaagacg    171540
     ccgccctgca tcttcaccat cttgatcgcg gcgaggtggt ttccgtagtc ggtcgcaccg    171600
     cagcagtcct ccagaagtag gcattcgtag ccgcggtcgt ttgcctcgcg catcgtcgtc    171660
     gaaacgcaga catcggtggt gatccccgtg aggataatgt tctcgatgcg cttctggttg    171720
     aggatgagtt cgaggtcggt ggcgcagaac gaacccttgc cgggcttgtc gatgatcgtc    171780
     tcgccttcga tcgggtagag ttcggggatg atgtcccagc ccggttcgcc acgcgtcagg    171840
     attcggccgc aggggccggc atcaccgatg ccggcgccga tccgctgcga gcgccagcgt    171900
     ttgttggccg gcagatcggc gaggtccggg cggtggccct cgcgggtgtg gatgatgtgg    171960
     tagcccttgg cccgcatggc ggcaagcacg cgtttgatgg gttcgatcgg cgcctgcacc    172020
     agcgacaggt cgtagcccat atggtcgaca tagccgccct tgccgcagaa atccgtctgc    172080
     atgtcgatga tgatgagggc ggtgttatca ggcctcagag cgccattata gggccacgga    172140
     tacggatcgg cgtcgataaa atgcccgttg gtttcgacca tcgcgtccat cattctctct    172200
     cctattccgc ggcaggtttg aggggttcgc cgtaacggcg catcggcttg tcaaatccgc    172260
     aggacgtgcc gtccttgacc tttatctcgt cttcccatgg caggcggtat ttgccggcga    172320
     taaggtcgtg catgtaggtg tagggcgcat cctgcgcgcc gccggcgacg gcgacgtagc    172380
     cgcgatgacc gaactggtag atattattct ccacgcccca gccgagccgg gcctcgcgaa    172440
     cgagatcggg acgcacctcc gcggtgatga tctcgttgac gcggccggag gttccgtggg    172500
     cgatgatcgt gccatcgaaa ttgcaaatca tgccttcacc catggaatcg aacgttccgt    172560
     ccgagccaca catgcagaca ttcgcggtga tcatcaggtt gcagaaggcg ttggcctggt    172620
     tggtgaagca ccaggcatcg cggatcggcg ccgtgtagcc ggctgtgcgg atcatgattt    172680
     cggcgccctt gtaggcgcat tcgcgcgcca tctccgggaa catgccgtca tggcagatga    172740
     tcagagcgag cttcgcgccc cgcgggccct cgatgacagg gatgccaaga tcgccgggct    172800
     cccagggctc gacggggatc cagggatgca tcttgcggta atagagcttc aactcgccct    172860
     gatcgtcgat gacgatgccg gagttgtagg gcatggcgcc agggttcagc tccatgatcg    172920
     agaagcagcc ccagatccgg ttgtccctgc aggcctgctt gaaggccgcg acctccggcc    172980
     cgtcgagcgt gcacatgatc tccggattga tgtccatgga aaggccatgc agcgcgtatt    173040
     cgggaaagac gacgaggtcc atgcccggct ggttgcgccg cgctttggcc accagatcaa    173100
     cgatcacctg cgtctgtttt gccaagtccg ctttggtaac ggtcaccggc agctggagct    173160
     gcaccaggcc gataccgacg ccgtgttcgg atttgttgag accgccaagt ccgttcatcg    173220
     aaaggctccg ttatttcgtg agcgagagcg cacccggcgc accggcgagc gaacgggtgg    173280
     gcgaggaggt ggcgatcagg atgatgaggg tgagcacgta aggcgcggcg taaaaaaggt    173340
     agtagccttg cgtgacgccg accgattgca gcgccgggcc gagcgcgcca gcaccgccga    173400
     aaagcagggc agcgagaaag cagccgatcg gattccagcg agcgaagatg acgagagcca    173460
     ccgccatcag gccctgaccc gacgagatgc cttcgttcca ggatcccgga tagtagagcg    173520
     agagataggc gccgccgatt gccgccagcg aaccgcccac tgccgttgcc agcaagcgaa    173580
     cccggtccgg atggatgccc atggcccggg ccgcgtcggt gctgtcgccg acgacgcgca    173640
     ggatcaggcc gatgcgggta ttcttgaagg cccagaacag gaagagggca agtgccgcgc    173700
     cgatgaagaa cagcacgttg atattgagcg ccgcctggac ttgcggagtg ctcgaccagc    173760
     cgccgagcgg gatcgagggc agtttcgggg caaccggctg gatgaaggat ttgccgagga    173820
     agaacgccat gccgagaccg aactgcatca tggcgatgcc gatggcgata tcgttgacct    173880
     tggggaactt gcagatccag ccgtggatga ggccgaagat cgcgcctgcc accatggcag    173940
     ccagcacgcc gagggtcggc gagccggtca tgacggccac agcataggcc gtcatggcgc    174000
     cgaagacgag cgtgccttcg aggccgagat tgatgcggcc ggagcgttcg gtgatcgcct    174060
     cgccgaggct gacgaagatg aagggggtgg aaacgcggat ggcgccggcg aagatcgcca    174120
     gcggcacgcc ccagatgccg atgcctgtct cttccatcag aggctccttt tccagaggtc    174180
     gggattgaag atcttgaagc ggccgtagaa ggtctcgcag aagagaatga cgatgaagag    174240
     cgtcccctgc agcaccagaa ccgtagcatc cggcaggccc atgcgccgct ggatgaggcc    174300
     gcccgaggcg tcgatgccac cgagcaggat cgcgaccgga atgatcgcca gcggattgtg    174360
     cctggcgagg aaggcgacga ggataccggt ataaccgtag ccggcggcaa gcgaggcgtt    174420
     ggcacttccc tgcaccgccg ccacttcgat catgcccgcc agaccggcaa agctgccggc    174480
     aagcgcggta aatccggcaa tcagcttgcc caccggcagc ccctggatct gcgcggcgcg    174540
     cacgttgccg ccggcgatgc gggcggcaaa accatagctc gtcgcctcga tcacgatcca    174600
     ggagatcatg caggcgagga tgccgatgac gaggccccaa tgcacgtcca tgccgggaat    174660
     gttgccgagc atgtagtccg ccggcagcgg cctggtcgac ggcttgttga ggcttgcagg    174720
     atcgcgcagc accccttcga caaactggtt catcagggcg atggcgatat aggagagcag    174780
     cagcgacgaa atggtttcat tgacgccgcg atagtgccgc aggaaaccgg caaggccgat    174840
     ccagatgccg ccgaccacca tggcagcgat tgccatcaga atgagagtga ggaaaacagg    174900
     cgcggtgccg gcgagcggca gagccatggc tgcggcggca acgccgccca gcacgaccgc    174960
     tccttccccg ccgatgatga cgaggccgag acgggcgggc agggcgacgc agagtgccgt    175020
     caggagaagg ggtgcggcac gacttaagct gttctgcacc gaaaaccagc tgccgaaacc    175080
     gccggtatat atcagttgga agagggtggc cggcgacttg ccgaccgcca ggatgaagag    175140
     ggagaagagc gcaagaccga tcaggatggc cgcgaggccg atgacaacag gctcggctcg    175200
     ccgcgcgatc cattcgaaga tggggcgcag cgacaccggt ttttccgtga tggctattgc    175260
     gggatcattg gcctcgatgg tcatggcgct tctcccttcg cggtttatgc cgtggacccg    175320
     gcgacgccct cgaccagata attcatgctc tcgagctcga tcgcgtcttc ggcgtagctc    175380
     ttgtcggcag ccacgacggt gtcgccctta ttgtccttca acggtccctt gaagaccgag    175440
     aagccgccct tcatcatctc agcctgcgtg gcttcgaagg ccttgcggcc ctctgccgac    175500
     acggcgggac cgagcgcgct catcttcacg aagccgtcct tcaggccgcc gcgcacgaag    175560
     ttgccgagct tttcgccggc ctgcgccttc ttgacgaagt cgctgtagac gttcccccag    175620
     gcccattcgg cgccggtcag gtatttttcc ggagcaagcg ggctctggtt ggcgtgatag    175680
     ccgcagacga aggcgccgcg gccggcggcc gtctcgacga ccactttggg gctgtcgacg    175740
     tggcaggtga tgacgtcgac gccctggtcg accaaggcgt tggtggcttc ggcctccttg    175800
     acggcgagcg accattcgcc ggtgaagatc acctggcagg tgataccagg atcgactgcg    175860
     cgcgctccaa gcaggaaggc gttgatattc tgcagaacct gcgggatcgg cttggcggcg    175920
     acgaagccga tcttcttgct cttcgtcgca tggccggcgg caatgccgtt cagatactgg    175980
     ccctggaaga tatagccgaa ataggagccg gtgttcgccg ggttcttgcc ctcctgccag    176040
     aggccgccgc agtggcggaa ctggatgtcg ggatgtttgg cggccacggc cagcatgtgc    176100
     gggtcgaagt agccgaagga ggtcggaaag agcagggtcg cgccatccag gttgatcatg    176160
     gattccatcg tcttctggac gtcgacggtt tccggcacat tctcttcttc gaccagcgtc    176220
     acgcccgata gcgccttgac cacggctgca ccttccgcat gcgcctggtt gtagccgtag    176280
     tcgtccttag gaccgacata gatgaagccc acggtcagcg ctgtttgggc tgcggcggag    176340
     gaggcgatca ggccgggcat ggcgccggca agcgcaccgg cagcggaagc ctggaggaaa    176400
     ttacggcggt tcatggaaag gagtttggtc atcggaatgc tccttgcggc gctgggccgg    176460
     ttgcgaactg gtacagaaaa gtgcatgcaa tgcatgtgcc agaaattaat ctattgtttt    176520
     ttatagttta tccgcccagc aagatctgtg cattgcaaag tgcatgcaga ttgatcgaat    176580
     ctttgcgtaa aaagtaatca atagatattt cttgttcatt gttactgcgc gattggcata    176640
     aattcggatt tcctgaggtg ctcgtgcatc ggaaagcgaa aatttaacaa tatcttcgcc    176700
     actagatttg acttatcgag tctcgaaccg catctgtatg cagaatgttg acgtgagcag    176760
     attcgtatcg tgaagcagac caggcgcaga gaagtgatcc gtaccggaac caccgtcgaa    176820
     cagatggtgc gagcgattgc cgacatgatc gtcacggggg aaatcctgcc cggcgcgaaa    176880
     ttggacgagg tgtcgctcgc ggttcgtttt gacgtttcgc gcacgccggt acgcgaggct    176940
     ctgcgtgagc tgggcgccat gggattgatt gcgcgcgagc cgaaccgcag tgccgtcgtg    177000
     accaatgtca ccgaggctta tctgcattcg atgttcgaag cgatggccga actcgaagcg    177060
     atctgcgcca ggctctcggc cgagcgtatg acggtcgatg agcggcgcgc gctggagctg    177120
     gagcatcggg aatcggtgag gctcgtgcat gccggtgcgg aagaagaata ttcggctcac    177180
     aataccgact ttcacacccg gctttatcgc ggcgcgcaca atgatcatgt cttcgagatg    177240
     gtcacgcaga cgcgggcgcg cctcgcgccc tttcggcggg cgcagttccg tctgcccggg    177300
     cgcctggcaa aatcctatga ggagcacggc cggatcgtca ccgcgatcat gcgcgcggac    177360
     gccgccgccg ccgggcaggc ggcatattcc catgtggaaa ttgtcagcga tgccagcgcg    177420
     gtctttgcaa cgcccgggga gtaaagaggc gcgacgcctg aaatcaggcg ccgctacaaa    177480
     ggcgaaaaaa ccacggccgg taaacgccga ggttatgtcc cggtctctac tccgccgctt    177540
     cgatgaagcg gtggcgttcg tagaggaact tcagcacggc ttcacggcat ttgagatagg    177600
     tccggtcgga ggcgagttcg atgcgattgc gggggcgggg catggtcaca tcgagcactt    177660
     cgccgatgcg ggccgccgga ccgttggtca tcatcacgat gcgatcggac agcagcaccg    177720
     cttcatcgac gtcatgggtg atcatcacca tggtgttgcc gaggcgagcg tggatctcca    177780
     tcaccgcatc ctgaagatgg gcgcgggtca gcgcatcgag cgcgccgaag ggctcgtcga    177840
     gcagcaggat cttcggctcc attgaaagcg cgcgggcaat gccgacgcgt tgtttcatgc    177900
     cgcctgaaat ttccgaaggc cgcttatccc tcgcatgcgc catctgcacg aggtcgaggt    177960
     tggccatgac ccagtcatgc cgttcggcct tggtcttcgt tcggttgaag agtttggaga    178020
     cggcgagatt gacgttctcg tagaccgtca gccagggcag cagcgagtgg ttctggaaga    178080
     cgacggcgcg ctccgggccg ggtccgttga cctcacggtt ttcaaggagc acggcgcctg    178140
     ccgataccgg agtcaggccg gcgatgaggt tgagcagggt ggatttgccg cagcccgaat    178200
     ggccgatgat cgagacgaat tcgcccgcgg aaatcgtcag gttgatgtcc ttcaggactt    178260
     cggcgcgtac gccgccccga tcgaaatgtt tgtcgatatg gtcgagcttc agataggcgt    178320
     tcataggagc gttcctcagt tggccatggc gccgcgcgtg atgagtttgc cgagtgctgc    178380
     caccagtttg tcgagggcga agccgacgat gccgatatag gcgagcgcga cgatgatgtc    178440
     cggaaggcgc gacgagttcc atgcgtccca gatgaagaag ccgatgccga cgccacccgt    178500
     cagcatttcg gccgcgacga tggcgagcca ggaaaggccg acgccgatcc tgaggccggt    178560
     gaagatgtaa ggcgctgccg aaggcagcat gatcttccag aaaaactcga actggttgag    178620
     ccgcagcacc tcggcgacat tgcggtaatc ctgcgggata ttgcggacgc caacggcggt    178680
     gttgatgatc accggccaga tcgaagtgat gaagatcacg aagatcgccg aaggattgga    178740
     atcctggaag gctgcgagcg acagcggcag ccaggcgagc ggcggaaccg tacgcagcac    178800
     ctggaagatc ggatcgaggc cacgcattgc ccagaccgac tggccgatga tcgcaccgat    178860
     tatgacgccg gtgaccgcgg caagcccaaa gccatagaga acgcgctgca gcgaaatgag    178920
     cacgcgccag ccgagcccga tatcctggga gccatagttg aaaaacggat aggcgatcag    178980
     gtcataacta tccagccaga cccgatgcgg cgagggtaaa gacgcatccg ccgatgagca    179040
     gagcacctgc cagacgagca ggatgagtgc cagcacgacg actggcggaa cgacgttgcg    179100
     aagtgcggtc agtgccgctc gacgaaaatc gatccgcgat ccatgcttgc cggaaaatgg    179160
     cagaaccttt gccgccagct tggcggaggc agacgttgag ggaatttctt tatttgccag    179220
     ggcggacatc aacgcgctcc tcacgggaat gaaaggccgg cgcgcccgtt gcgcgccgga    179280
     gcgggtcagg agacagcctt gatcgaaagg ctgtcgagat aggccgaagg attttcaggg    179340
     tcgaagacct tgccgtcgaa gaaagtctcc ttgccgcgag aagacgatgc ggggatatcg    179400
     gccgccgcga cgccgagatc cttggcggcc tcgcgccaga tgtcttcacg gttcacctgg    179460
     ttgaccagcg ccttgatgtc ggtgctcgcc ggcagatttc cccaacggat gttttccgtc    179520
     atgaaccatg tgtcgtggct cttgaacgga taggaggcgc cgtctttcca gaacttcata    179580
     tagaggtcgg tggccttgac ctcgcggcca ttgccataat tgatgtcgcc cttgaggcgg    179640
     ccgagcacgt ccttggtcgg aacgttgaac cattggcgct tgccgagaat gtcagccatc    179700
     tccgccttgt tgtccatgct ttcgcaccac tgctgcgcct ccatgacagc catcagcagg    179760
     gccttggcag cattgggatt cttttcgatc cattcggcgc gcagtccgag cgccttttca    179820
     ggatgaccct tccagagctc gccggtggtg gctgcggtaa agccgatgcc ctggttgacg    179880
     agctgctcat tccacggttc gccgacacag aagacgtcca tgttgccgac cttcatgttg    179940
     gcaaccatct gcggcggcgg cacgacgatg gtcgaaacgt ccttgctcgg atcaatgccg    180000
     ccggcggcga gccagtagcg gatccagagg tcatgggtgc cgcccgggaa ggtcatggcg    180060
     gccttgatct ccttgccctc cgccttcttc ttctcgaatg ccgccttcag cttggaggaa    180120
     tcgagctgca cgccggtgtc ggcatattcc ttggcgacgg aaatgccttg gctgtcgagg    180180
     ttgagccgcg cgaggattgc catcggcacc ggcttattgt tctgcgtcac cttgccggta    180240
     tgcatgagat aggggagcgg cgacaggata tgcgcaccgt cgatgccgtt tgcggcgcca    180300
     cccagcacga ggttgtcgcg ggtcgcaccc caggaggcct gtttggccac atccgtttcc    180360
     ggaaggccat gcttgtcgaa aaagcccttt tccttggcga tgatcagcgg cgcggaatcg    180420
     gtgagagcga taaaaccgag cttgacgccc ttcacctcag ggcctgctcc ggctgcgaag    180480
     gcgccggatg gaaaggccgt cttgacagcg ccgatgaggg cagccgctgc agtcgtcttg    180540
     agcatgctgc ggcgggtaat gccggttgtc gaaatcccag tctgcaaatt cttagtcatg    180600
     cgcaggttcc ctctgctggc tgaatttgga cacaaaaaaa cgccgccgga aattgcgtcc    180660
     aggggatggg agaatcccgg agcaaaaacc ttgcgacgtc ggtgtctatt gtaggcgctt    180720
     atgccgcgcc tatccgcacc ggtcgccgtt gaccgatgcg tatctgaacc tgcaatcggc    180780
     gtgccaattc tgcaggatgc tggtaacaga ttgaagtaaa aagagaaacc cgaagaattc    180840
     gcgagtgcct atactttagg catgattgct ttgtgccgag gttttgtgcg actgctgcta    180900
     tgtgcgcggt cgtgagagcg cctatttgtg cagcgcacgc gcgccgcgcc gtcccgcaac    180960
     accgaagact accgctcgaa tggctcgccg agcgaagcga cgccgttcag tttcaacagg    181020
     cggcggtcgg cggagatgat gccgagcacg atgatcgtga ccagatatgg caggctcgag    181080
     agcagttgcg agggaacgtc cagtccggtt gcctgggctg caagccccat cagcgagact    181140
     gcgccgaaga ggcaggcgcc gaggaagata cggccggtga gccaagtccc gaagacgacg    181200
     agggcaatcg cgatccagcc gcgcccggca atcatcccat cggcccagag tggtgtatag    181260
     accaccgacg cataggcgcc ggcgaagccg gccatcgcgc cgccgaaggc gatggcgagg    181320
     acgcggactg agattaccga atagccgatg gcgtgagcgg ccttgggatt ctcgccgacg    181380
     gcgcggacga tgaggccaag cttggtgtag gcaaatatgg cccacaaagc gagggtcgcg    181440
     gcgagtgaaa tccacacgac gatgtcctgg acgaacaggc cgccgacaac cggcagttcc    181500
     gaaagcccgg gaaggccaag cttcggcagt cccctgaccg tgaggctttc ataggtcttg    181560
     ccgaaaagcg cggaaaggcc ctggccgaga atgccgatgg caagccccgc cgccacctgg    181620
     tttgcccgga aacccagcgt gacgaaggcg aagagcagcg aaaggaccgc gctgccgagc    181680
     ccggcgacga cgaaacccag gagatgtccg ccgccctggt agacgataat gaaagcgagc    181740
     acggcaccga aggccatcaa tccctcgacc ccgaggttga ggacgccggc gcgctcggcc    181800
     accagctcgc caagggctgc cagaagaaac ggtgtcgcag ccgcgagcat gccggcaaga    181860
     atgaactcga tggcgttcat gatgggctcc ggtgggcggc gcggcgccat tcaaggcgat    181920
     agcgcacgaa ggcgacggca atcaggtaag tgagcagcag actgccctgg aagacacgga    181980
     cggcggcgat cggcaggttg gccgagacca tggcattgtc gccgccgata tagatgaccg    182040
     ccatgaccag cgccgagatc acgatgccga tcggatgcag gccaccgaga taggcgacga    182100
     tgatggccgc atagccatag ccgctcgcga ccgaacgctg cagctggccg agcggaccgg    182160
     cgacttcggc ggcccccgca agaccggctg caaaaccgcc gatcagcagc gaaagccaga    182220
     tcgcccaccc ttccttaaag ccggcatagc cggcagctcg cggcgccaga ccgccgactt    182280
     gcagcttgta accgatgaag ctcctctgca tgaagaccca ggccgcaacc gacaaagcga    182340
     gcgtgatgag gaacgaaaca ttgacgcggg taccggcaat cagggtcggt accatcgcat    182400
     cgtactggaa catcaccgac tgggggaagt tgaagccgtt cggatccttc caggggccga    182460
     gcagcagata gttcagcagc tgcgccgcga cgaggctcag catcagggaa acgagaatct    182520
     cgttggcgtt gaggcgcacg cgccagaagg cggtgagaga agcccaaagt gcgccgccga    182580
     tggcgccgag cagcagcatc gccggccaga tccactggcc cgtcgcctgc ggaaaccaga    182640
     ccggaatggc agaggcgaag atcgcgccga gaatgaattg gccttcggcg ccgatgttga    182700
     agaccttggc gcgaaagccg atcgccagtc cctgtgcgat cagaaggagc gggcctgctt    182760
     ttagcagcac ttccgaaaat gaggcccagg aaaggaaggg ctcgaagagc atcgcataaa    182820
     tgaccgcgac agggtcacgg cccatcaaaa tgtaaagtcc gaggttgagc gcgaccgcta    182880
     tgacaagtgc tatgacgggc gcgagcaagg tcgcggcaag cgaagcgcgc tcccggcgga    182940
     ccagggtggg aacgaaagca agggaccaag cactcatcac tggactttct cgggcgaggc    183000
     ttgtgccccg atcatgtgtc ggccgatctc ctcgggcttc gtgtcccgcg ttgcgagcgg    183060
     cgggcttagc cggccgtgat gcagcacctg gatggaatcg cagagctcga acaattcctc    183120
     cagctcctcg gaaatgacga ggatcgccat gccctgattg cgcaatgcga ccagacggct    183180
     gcggatggcg gatgcggcgc cgatatcgac gccccaggtc ggctgcgcca ggaaaagcaa    183240
     tttgggagac agcatgattt cgcggccgac gatgaacttc tgcagattgc cgcccgatag    183300
     agtgccggct tcggcatccg ggccgggcgt gcggacatca ttctgacgga tgcaatcatg    183360
     ggtgaacgcc aacgcacgcg ctttgtcgac gagaccgtgc cgcaaaagct tgagcggatg    183420
     agccgtcagc aggctgttga ggacgagcga catttcgggc accgcgccgc gtccgagccg    183480
     gtcttccgga acgaaggcaa atccgagcgt tcgccgcgcg gcggcatcga gcctgccgac    183540
     atccatctcc atcatgtaga tccggtcgcg ttggtcacgc cccagcaccg tctcgcctga    183600
     aatcaacgcg gcaagctcgc cttggccgtt gcccgaaata ccggcgatcc ctaggatctc    183660
     tccggcacgc acctcgaggc tgatgccgga gagcggcacc gcgaagggat cgtcgggctg    183720
     ataatccaac ccaatgatct ccagccgctt ttccccgccg gacagtggca gggccgagat    183780
     gggcgccggc atctcacggc cgatcatcat gcgggcaagg tcatgggcat catgctcgcg    183840
     cgggtcgaca tctccggtca cccgtccgcc gcgcaggatc gtcgcccggt cacagatcgc    183900
     ccggatttcc tcgagcttgt gggagatcaa caggatggaa acgccgccgt cgcgcagccg    183960
     gcgcagtgtg tcgaagagct tctccaccag ttgcggcggc aggacggagg tgggctcgtc    184020
     gaggatcagc agcttcggat tggtcatcag gcttcggatg atctccaccc gctgccgctc    184080
     gccgacggac agcgcatgca catgggcgag cgggtcgact tcgaggccga attcccgtcc    184140
     gagcgtccga atgcgttcct tgagctcagc cttgcggccc ggcacgacca gccgaatatt    184200
     ctccaggacg gtcagggtct cgaacagcga gaagtgctgg aagaccatgc cgatgccgtt    184260
     gcgcctcgcc tcggcggggg aggcgaggcg caaagagttt ccttcccaga tgacctcacc    184320
     gtcatccggt tgctcgacgc cgtagatcag tttcatcagc gtcgattttc ccgccccgtt    184380
     ttctccgagg atcgcatgga tcgattgcgg cgccacgtcc agatcgatgg cctgattggc    184440
     atggatctgg ccgtagctct tcgaaatgcc gcgcagcgac aggagcgggg tggtcatgac    184500
     ttatttcggc agcggcgtgg agacgccctt gacgtgccag ttcatggcga tgatctcggg    184560
     gtcggccatg gttgcaccgg atgcgacacc ttcgctgccg tcggccttgg cgatcggccc    184620
     ggtgaagggc gagaagctgc cgtcggcaac ctttgcctcg atctccttga tcttggtcat    184680
     cacgtcagcc ggaacatccg cattccagtc gaccacttcg acgaccttgt cggcgacgcc    184740
     gaggaacgca ttggcgccct tgaaagtgcc ggcaaggtgg gcgtcgaccg atgccttgaa    184800
     gaacggcgac cagtccgtcg agatgcatcc gagataggtt ttcggtgcgt acttcttcat    184860
     cgaggagttg aggttgaagg cgtagacgcc ggcttcctcg caggccgaga tcacagacgg    184920
     cgtgtcctgg gcgttggaga agatcacgtc gcatttctgc gcgatcaggg ctttggcggc    184980
     ttcctgctcc ttggcagggt cgaaccatga gttcacccag accaccgaga cctcgatgtc    185040
     gggcttgacg gcttgggcgc cgagggtgaa ggcgttgatg gacgtgatga gttcgggaat    185100
     ggcgaaggcg gagacagagc caagcttgcc ggtcttggaa agtgctgcgg cagccatgcc    185160
     gagcagatag gtaccttgga aatacttggc ggcgaagggc gagaagttcg gagcaacctg    185220
     gaagccggag gcgtgcagga ccgtgacgct tggatcgcgg cgggcgatct gcaaggcgcc    185280
     gttctgatag ccgaaagagc cggcgatcag gaatttgttt ccgtcggcga cggtcttgtt    185340
     catgatgcgg tcggcgtccg ggccttccgc gatattctca agcacggtga cctttacctt    185400
     gtcgccgtaa gcggccctga tcggctcgag accggcggca agcgcatgcc cccagccaac    185460
     gtcgccgatc ggcgacggga cgacgagcgt gatgccgagc ggctcgtcgg cggccaaagc    185520
     aaggcggctg ccgagcacgc cagcaaggcc ggtggcggca gcggccgtca tcaggtttct    185580
     gcgggtcagt ttggtcatgt tctcagttcc ctcttttggt ttttttaaaa ttccacggtg    185640
     gatagtgcgg cctcggcatc ggcagccaac ttggcttcgt cgagcccggg aaattcgccc    185700
     ttctgccaga cgacgcggcc attgatcatg gtcatgtccg tcgccatgcc gatgccgacg    185760
     cgggcaatca ggctcagcgg atcgtggcgc gtgccgacat aatccatacg ccgagtgtcg    185820
     atcgcaaaca ggtcggcagc catgccgggc gcgagccggc cgatatcgcg ccggccgagc    185880
     aggctggcgc cgcctgccgt gccgtagccg agaaaatcga ccggcggcgg cacgggatgg    185940
     gcacggctgg aggagacgag gcattgcagc atgtaggcgg aatgcaggca gtgcatcagg    186000
     ttggagttgt cgttggaggc cgcgccgtcg cagccgaggc cgacacgcag gccgaaggcg    186060
     gccatggcgg gaatgtcggt gacctcagcg ccgaccagat agactggttc cgggcaatgc    186120
     gcgacaccgg tgccgctggc cgccatcttc ctgagttcgt cgtgtgtcag ttcccagcaa    186180
     tgggcataga aagtatcagg cccggcaaag ccgagttctt ccagatagtc gaccgtgcgc    186240
     atgccatggc gagcctgaat gaccgggctt tcgccttcgc cgacatgggt atgcatcatg    186300
     acgccgcgat cacgcgccaa tgccaccgat tccacgaagg tctctcggta gcagttcacc    186360
     ggctggcacg gcgcgaccac gacctggcgc atgctgaagg ggctggtatc gtggtaggtc    186420
     tcgatcagcc gtgcgcagtc ggcgatgaat tcgtcggtcg tttccagcat ctcgttcggg    186480
     atagtcgagc cttccgactt cggcagggta ttgccgccgc ggccggcatg gaaacgcatg    186540
     ccgagcagtt cggctgcttc gaactggcgg tcgatcagcc gctttccggc gtgccggggg    186600
     aaattgtatt ggtgatctaa ggccgtggtg cagccatgct tgaccatctc ggccatcgcc    186660
     gtgacggagg cgtggtaaaa gcactcctca tggagctgcg aaaagatcgg gtagatgcgg    186720
     tccagccact cgatcaccga gagcttcgtc cagtcgagat cggcacggtt gcgcacgaag    186780
     cactggaaga agtgatgatg ggtgttgaca aggcccggat agacgaacca gccggcagca    186840
     tcctgaacgg tcgtgccggc aggcagcgcg tccgccccca gattctcacc gatcgccata    186900
     atcgccggac cgttggtcag gagatcgaca ttgcgatggg cgaccggccc tttgccctcg    186960
     tcgacgatca cggcagcgca gttcttcagg agatatccag ccatctcacg cctcgcccgg    187020
     ttcgatctgg ggttcgggct tcaactcgtg tagtcggtga atgccaggca tttcgataaa    187080
     cttgtcgagg gcgcgcagcg cccgggacca gagccggatc gcaggataag catccagcgt    187140
     gacgccccca tcgggcgcca gcgccacata gggaaagcag gcgatgtcgg caattgtcgg    187200
     ccggtcggcg gcgaggaaac gcatgccgcg aagaccctgc tcgacaagcc cggcttcaag    187260
     ctcgcgaagg gcggcgatgc cctgggcctg cagcgcgccg atatcgcccg gccgcagcag    187320
     catttcatgg agccgcgcac cgccgaggct tgccgtcagc cggccggaga acgacagcca    187380
     ttgctgcacc cgcgccgctt cctcggcctt gccgctgccc agccattcgg gtgctgcctt    187440
     ggcggcgaga tagacgagga tcgccgacga ctcggtcagg atcaggtcgc catcctccag    187500
     gatcggaatg gagcctgccg gattgagtgc aagcagctcg gggcctcgat gctcggcgcc    187560
     gggatggaaa tctaccgggc gcaagtcaag cttcacgccg gtcagcgccg ccatcaggcg    187620
     caccttgtag caactgggcg agagaatata gtcgtagagc ttcattgcgc caccagctgt    187680
     gcgccgtagg tataattgtg acgcttcagc cagcgccggt aagcgatcga tgtcagatcg    187740
     gcccgcgtcg gaatttccat gccggggtcg agcggcagca gccgcgggat ctggttttcg    187800
     aggatcgaac ggtcctgcag aaagatcgtc tgctggaagt ggatgaggtc ggtcatcgcg    187860
     gtctcgtcat cgaagagcgc catccatggc cagacgtcgc agaggtcttc ggccagcggc    187920
     tgcacgaaga gcgtgatgac atcccattcg ctcgggcgcg gcgggcaggt cttgtaaagc    187980
     acggagcagg tgggcgccgg cacgcggtac atgtattccg tcgtgatccc gccacttgcc    188040
     gacttggcgg cctgcggctg gtagaatttc acctgcgttg cccagacctc gtcttcttcc    188100
     tcgcggatct cgaccttgta gttctggacc tcggtatgcg gctccgcgcc gagaatgtcg    188160
     gtgtggacga aggggaaatg ggcgatgtcg aggaagttct cgacggcgcg cagcggcgag    188220
     cagcgcacgc gcaccacgcc gacatcgacg aagcggcggc cgggctggtc ggcctcggga    188280
     atggggaaaa gctccttctt cggctcgccg agggaggacc atacatgacc gtaacggacg    188340
     cgcaccggca gagcacgccc atcgccgcgc gtcaccttcg cattgccatc ggcatcgcgc    188400
     gccactttaa tcggctcgcc catcagcgcc gtcttgcggc cggcgctgtc gagctggctg    188460
     aaaagcccga ccggatacca ttcgtcgatc atcgcctgca tggtcattgc gcgatctcct    188520
     ttttctgaag accctcggcc cggcgccgca ggctttcggc ggcccgtgaa gcaccgatgc    188580
     ccgcagcagg gccggcatca cccttcaaca gcacatggat cagcgtcttt ccgtcttctt    188640
     gagcggacaa tagcagacag atggtcccgg tgaatgcatc gaactcgaca agaccgtctg    188700
     ggctcgtctt ggcaccggcc gccgcctcga tcgccgcgat accggcgaac gccgtcaggg    188760
     agcgcagggg aatgaggccc tcgagccccg gcggcttcga tgcgggcgtg cccaccgcca    188820
     cccagatcac gctgcccgct tcctcgacat catgggtggc gacgcggatg ctttccggtg    188880
     gcgtcagccc cggatgggcg gggatgcgca gacagtttcc ggcctggcca tagctccacc    188940
     cgtgatagat gcaagagagc gcctcgccac gaacgaagcc gtgagacaag cgcatgccac    189000
     ggtgcggaca gcgatccgcc gatgccgaaa tgcgccccga agcgctacgc cacagggcaa    189060
     tcgatccggc tgccgtccaa gccggcatga cggttccggc cggcaaatcc cgggaaaggg    189120
     cgactggcgt ccaaaagccc gtcgtatcgg aaggcatgag tagaattccc aaacaaaacc    189180
     aaatgcttgc cgatcaagtc ccgcatcggc gccgaggcaa ttccgccgca accttatcag    189240
     gtttgcataa ttatttcgca ttggcaacat tgagtaaata atatgcaccg gcgaaatacg    189300
     cgagagcccg gactaggtcc tttcgccgct gatcgcagtt cgatctatcc tctcgaccca    189360
     cacgtcgatg ggcccgagag agcatcccat ctccatcatg tcgatcaact cctctggccc    189420
     ggcaacctca agttcgatcc gcatggaact cgtatgagat atggtgtgcg agagcccaag    189480
     cttagcggca tggcgccgga tccagggaac gaaggaggca acctccagat caccgacaat    189540
     cgtcatccgt tctagaaggt cgcttgtatc ttgtcccatg ctcgcccttg ttttcctaca    189600
     tcatagcgcc tgaatgaact tcgggaaggg gtcgccgtca aggcgagaat atggcgtcgg    189660
     agtttccttt gcaaagccct gcggcggcat accaattccc cgccaccgta tggctgcgcc    189720
     gctggcgacg cgacgtatgg aaacaactca ggctgcgtga tggcacagcc tagtcgggcg    189780
     agcgaccgcc agtcagcatt gcgacaaaag ccgtgacttt gggtgtgcgg aaccgagctg    189840
     ccggatagac gacatagatt cctccggccg gcaggctcca gtccggcaac aatcttatca    189900
     gtcggccagc gtctatatgc tctccagcca gaaaatccgg cagcacggat atgcccgccc    189960
     ccgcaagcgt ggccgcgaga accgcaggcg tcgaattgct catgaggctc tgttgcatcc    190020
     gcacggtgcg cctgtcgaaa tcgccctgga taaacctcca ggtcaccggc tccttgaggg    190080
     ccagattggc gataaacggc tggcccgccg catcctctgg actgttcaaa ctgagcgtgg    190140
     cggagaagct gggagacgcc acaagaaact gccggaacga accgatccgt ctcgcttggt    190200
     gactggagtc atcgagccaa ccaacgcgga tcgacagatc gatctgattg gcgagcagat    190260
     ccatcttcgt atcggcgagc agaagctcga ccctgcaagc ggggtacttc cggataaagg    190320
     atgcagcaat cggagcgatc gtgctcgcac cataatcatt gggcgcagca atgcgtagca    190380
     tgcctgtcgg ctcggcattt gcgcgggtga tttcatcgac cgcgtcctcg gcttcgcgga    190440
     aaatcaagac gcagcgcgcg tagagaagct tgccggcctc agtcggctcg acgcgtcgtg    190500
     ttgttcggag gagcaagctg gttttcaact cagcttccag ccgcgcaacc tgctggctga    190560
     cgaccgtctt cgtgattgcg aggcgctcgg cagctttcgt gaacgagccg gtatcgacga    190620
     cggctgcgaa ataggccagc cgattgaggt tgacagcctc cataaccttc ttccccttaa    190680
     ttgtaagttt ttgacataca ttctgtcgca tttaacaata tttatcgctc aatagaagtg    190740
     cgctaatctg ttgcccatcg ccgcaaggat ggtccgatat gcatcttatc tatctctacg    190800
     atccgctttg cggctggtgt tatggtgcgg cgcccgcgct cgacaaaatg gccaagcttg    190860
     acaatctcac cgtcgagctt gcgcccaccg gggtcttcgc gggcgaaggc gcgcgtccgt    190920
     tggatgaacg tttcgcagcc tatgcctggc ataatgacca gcggatcaac cggctcacgg    190980
     gacaggtctt cagccagctc tatcgcgatc aggttctcgg gggcgcagac gatatgttcg    191040
     actcagcccc tgcgacgctt gggatcatag ccgtcggggt gacgcaactc gacagggaag    191100
     gcgatgccct gaaggcactt caaagcgctc gctatgttga cggccgcaat acctcggaga    191160
     tcgctgtcgt ggccgacgtt ctcgatcagg ccggcttttc cgattccgcc gctcgtgtcc    191220
     gggctccgga cgaggctctg ctcgaaatct atcgcaacag gatcgggaag tcccgccaac    191280
     tcatggctgc attccggatg gatggtgtcc cggcgctttt ggtcagcgac ggcgataagc    191340
     gccgcgtgct gcgcagcgtt gccttgttcg gcggctttga ccgacttgct gccgagcttc    191400
     aggcagcgtg atcgttcgtt ttcagcagac cgttccatga actaccgacc tgcggggggc    191460
     aaccctcacg gcagcagaaa atcgaaactg gcgaacatcg gagacaacca tgtattcaag    191520
     gagagaaatc atgaaaacca ccctcgcagc cggcgccgtt gccgtttttg cgcctgccgg    191580
     tctcggcaac gcagctgggt caaagctggc ctggaagcac ttccccgccg gtcagaatgg    191640
     cttctttcgc gctccggtgc tgctgaccgg ccccagcgaa gcgttgctga tcgatggcgg    191700
     gttcacctat cccgacggcc gtgcgctggc ggaggcgatc aaggccaccg gcaagacgct    191760
     gaccgcaatt tatgtcagcc agtccgatcc ggactattac ttcagcctga agccggtcct    191820
     cgaagccttt cccggcacaa aagtgctggc cgcttccgat acgattgcag cgatcaaggg    191880
     caatatcgag aaaaagcttg ccgtttgggg gccgcagctc aaggagaacg gcccgcagac    191940
     ccttgcagac atcgtcatgc cggaagcctt cgacgctcca agcgtcacag ttgatggcga    192000
     aacagtcgag attgtcgcgg ccgaagcagg gttaagcaat cgccggtacc tgttcgtgcc    192060
     gtcgctgaac gctgttttcg gaggcgtcat gattttctcc ggcgtccacg tgtggacagc    192120
     tgacacccag gctccggagc agcgtgccgc ttgggtggcc accctcgaca agatcagcgc    192180
     ccgcaagccg acgatcgtcg ttcccggcca catgatgccg gaagcggcaa ccgatctgtc    192240
     cgccgtcgaa cacacgaaga gttatctggt cgctttcgag gaagaacttg ccaaggccgc    192300
     cgattccgcc gcgctgaagg ccgccatgga agcccgcttc cccggtctcg gcatgggcgt    192360
     tgcgctcgac ataggctcca aggttgccaa gggagaaatg aagtggggct gaacggccga    192420
     tcttcaaact gatccgaggg gcctgggagg gcccctcgct tctaggaagg ccgcgaaggg    192480
     tggtgacgca gtgcttaagc aatggcggcc cgcccgccaa gaagcctatg gaaatggaag    192540
     ccaagcacct gcgtgtcgcc ccagcatctc ggtgcttgtc tgaagcgact ggtgacttgc    192600
     cgattttccg tcaagttcgg cgttaaaggc aacgctagtt ccataattca gcttatgcca    192660
     ctttacgcca tcttagattg catatatttt cgccgttgaa ctgcgaaaga tccgccaccc    192720
     gactgctaaa taatgataat ctcaacagaa ctacacacgc tggagaggat tttgacttcc    192780
     tcttccccct cttaacgtga ggcggcacaa agccggcgtt gccggccgaa agccgaggcc    192840
     gccgcacgag atgacgaagg agctaggcgg aggactaacg aaaatagttg attgccgctc    192900
     tcatctttag taccgacctg tcacccggtt aaaggaagtc acgtggctat actcccgata    192960
     caagatccgc ctcgaacggc tgaaactttt gtcgccgaaa atataggtct tttgatagag    193020
     cggaacgaaa ttctcttcga cgtcagtctt aaatttccgg caggagaagt tgtcgcactg    193080
     gtcggccaca acggctccgg caaatccagt cttctcaaaa tgttggctcg ccagcttgtg    193140
     ccgagcactg gatcgatctc ttacgggaac caggatctga ggatgtatag cgaacgcgcc    193200
     tttgcgcgtt cggtcgcata tctgccccag gatgtcacga ccggatcgga aatgacggtc    193260
     cgcgagcttg tgggatgcgg tcgctatccg tggcacggag cgctcggtcg cttcaccaag    193320
     aacgatgaag agaaagtcga ggaagccctt cgagccacgc atatcgagac gttcgccgaa    193380
     cgtatcatgg gaacgctatc gggtggtgag cggcaacgtg cctggattgc gatgctgatt    193440
     gctcaggacg ctcgctgcct gttgctcgac gaaccgactg cggcactcga cgttgctcat    193500
     caggtcgagg tgctctcact tgtgcgacgc ttggcgcatg agggtggaag gagtgtcatt    193560
     atcgttctcc acgacatcaa catggccgct cgcttctgcg atcggatcca tgcattgaaa    193620
     cgtggtcgcg tggtggccag cggaacgccg ggcgcgatcc tcgcgccgaa cacgctgcaa    193680
     gagatctatg ggatcgacat ggacgtgatc tctgcgccca acctgcccta tccgctcgcc    193740
     tatgtttgct gaggctctgc gttcaatggg ggtttcgcgg cgctcctttt tgcagttcgc    193800
     cggggcctcg ctcattccag ctccgctgtt tgcacagtcg atgggcccaa ggatcgtcag    193860
     tctcgactac ggccttgcgt ccactctttt atccctcgga ttgcctccga tcgggatttc    193920
     ggacctcgcc gattgggaca gatgggttgt cgaaccgccg atgccaaaat ccgtcgtcga    193980
     tatcggcagt gcgttcgagg tcaattttga gattctcgtc acgctgaagc ccgacattat    194040
     cttgaccaca ccctacctgg atgagctgtt gcccaagctg cagtcggtgg cgaaagtcgt    194100
     tcggctggaa atctttacgc cgggcattgg acctattctt accgctgcca tcgcggcaac    194160
     gcgtaaattg gccgttgagc ttggacgtga gaatgaagca gagcagttcc tcgcgcgagc    194220
     cgacgtcttc tttgcgcaat gccgcagtcg cctggagggc aagaacctgc cgccggtcgc    194280
     cctggtgaat ttcatggatg cccgccatgc ccgcatctac tcaagtcctg gactgttcca    194340
     caatgtactc gagcgcatcg gtgtccggaa cgcctggacc agagagtcga attactgggg    194400
     ctttgaaacg atcgggattg aagatctctc caagatcacc gatccagacg cgcgtctgat    194460
     cgcctttgag ccaattcctc tggacgttct tccgaaactc gctcagagcc cgctgtggaa    194520
     caggctttcg tttgcgcgtc caggccatct gtcgattctg ccgccagccc tgatgttcgg    194580
     gatggtgaac gaagccatgc gtttcgcagg ccttttgaca gatcttctgg agaaggacgc    194640
     ttgatggttt cccgccgcga caatatcggg ccagcaattg tcttcctcct cctgatgtgc    194700
     ggtggaggcg tggcatcgtg gtttcttgcc gctcctgcgc tgtcggaaat ggctcgaggg    194760
     gactacgatg tcacgcgaat ggtgttcacc tattcgacgc ttccccgtct tgcgacggcg    194820
     ctgattgccg gagccgcgct tgccttgtcc ggtgcgctgt ttcagcaagt tttgcgaaac    194880
     ccgctcgccg atcctgccac ccttggcgtg tcggccggag caaacctggc gctggtggta    194940
     acatcgctgt ttctccccga cttgcttggc gccggccgcg atcttgtcgc tctgatcggc    195000
     agcgcgaccg ctgctgcgat cgtcgtcagc ctgggcgcgc gccgcggctt ttcgccttat    195060
     tcgcttgttc tgtcggggct ggttctcagt ctttggtgcg gcggcctcgc tgccatcctg    195120
     acctatttga accagcgcta cctctcgagc ctgttcatct ggggcgccgg ctcgctggca    195180
     cagcaaagct gggtcattcc cctgtcgctt ctttggaaat tggctgtcat cgccatcggc    195240
     tgcgctttcg tgatgagacc gctttcgctg ctcgatcttg gcgaaagcag ttccacggca    195300
     cttggcgtca gattggtccg cctgcgtttc gttgtcatcg cccttgccgt cacgcttgct    195360
     gcatttgtca cgagcgccgt tggggtcatt ggtttcattg gactggtcgc gccgacgatt    195420
     gcgcgattgt ccggagcacg gcgtcccacg cagctcatcc tctggtctcc gctgatcggc    195480
     gccgggctgc tgttcttcgc cgactccatc ctgcaactcg tcgccggcgg acttggtgat    195540
     ttcttgccga cgggggcggt gacagccatc ttcggttcgc cgctgcttct cgcgctcctg    195600
     ccgcggctga agatccgtca tagactacag caatcgccgg cgttcagacg gccacgtcga    195660
     tgggatggaa cccgaccggt catcatcgcg gccgccggcc tgctcgtcct gttgatggtc    195720
     agcgcttttc tcggacgcga cgtcaatggc ggctgggctt ttacatcagg cgaattttcg    195780
     gtcgatgtcc ttgcgatcag gatacctaaa atcctcgccg ccctgacatc gggcgccatg    195840
     cttgctgttg cgggctccat ccttcagcgg ctgacgggaa acgaaatggc aagtcccgaa    195900
     gtcctgggaa tcagtgccgg cgcgaccttc ggtgttgcaa ttgccctgtt tgcagtcgct    195960
     ccaggatttt ccgggcaatt tgcatttgcc gtggctggtg cgatcagcgt tctttttgtc    196020
     atcttcgtca gctcccggcg atcggcgttc gcacctgaac gggtcctgct tgcgggcatt    196080
     gccttaagcg cgatggtcga tgccgtcgtc ggcgtgttga gctcgacggg agatccaaga    196140
     gcagttctgc tgatgcggtg gatgagcggg tccacctatc ttatcgacgg gtcgaccgcc    196200
     gcaatggagg tggcgctcgg cgccgtgctg attgccgtct cgctcgccgc tcgccgctgg    196260
     cttgacatac ttccgcttgg gccgtcgcct tcggcggcgg tcggtatacc cttggcgaaa    196320
     tcgcgatttg cgctttttgg cctcgcagga ttgttgacgg ctgccgcgac gctcacggtt    196380
     ggcccattgt cattcatcgg cctcatggga cctcaccttg cacgggaggc gggattggcg    196440
     cgcgcgctgc cgcaaatggt cggcgccgct ctgatcggag gggggcttat ggttgctgct    196500
     gacttcgtcg gccgcacgat cgtatcgccc taccagatcc cggccggtct tgtttccgca    196560
     ctcatcggag cgccgttctt gatgctgatg atgcggaagc gcggagccgg ctgagggttg    196620
     cgcgcgcagg gccgtgggtg tcatcgcggc gatgaagtcc gccatcacta ggagcggttt    196680
     gctccaccag cgaagatccg cagacaaacg gtcatccacg acgccggcta cagcgccgct    196740
     gaaacagtcg gaattactgc ataattcctt cgctcagatt gtggacgccg ccttgatcag    196800
     gcggcgtccg tcacttttac caggaatact tcagcgtacc gacgacctta cgccgatcgc    196860
     cgtagaactc agttccgtaa tagctggtgg cgagatactt atggtcaaag aggttcgtcg    196920
     cattgacggc cagcgtcaca tcctcggtca ccttgtagct gactgcggca tcaaccagcg    196980
     tatagctggt aagcgacacc gtatttgcat cgttaccgta ggtttgaccg atatagcgga    197040
     cacctccccc gatcgtcagg tcaccgcgcc atccatctcc cggaatcgta taatcgagcc    197100
     aggccgatgc cagatgtcgc ggcacgcggg aaggccggtt accgacattg ccgcctgtcc    197160
     cgtcttcgcg gatttcagca tcccaatagg aataggcaag cgtgagattg agcctgtcgt    197220
     tgattgcggc tttcccttca agttcgatgc cgcgcacacc aaccttgcca atctgctcct    197280
     gcaccagagg gctgacatag ctcggcacat tggtttgggt aagatcaaac agcgccaagg    197340
     taaagaggcc gtcaaaccca tccggctgat atttgaggcc aacctcgtat tgttcaccct    197400
     gctgtggttt caacgatccc gtcacagcgt agccgtttgc ggtctgcgcg acgagcggtt    197460
     ggaaggtttc cgaatagttc gcataagctg cgagattcgg cgtaaattta tacgtcagtc    197520
     cggcccgctt ggtgaaagct gacgccgtgt cgtcgtcact tgtcccgcta tcgaggtaat    197580
     ccgcagtcgt gtgaacctgg tcccatcgtc cgcccagggt aacgatccat cgatcgtcga    197640
     acgtcaattg ctcctgagca tagatcccga gcgcctgctg cttgacgcgc cagttcacga    197700
     agggccgaga ttgatgcagg aaagaccgca atagaccgga ttatcaatat cgatcggccc    197760
     cgccgtgccg aacaggatgt tctcgcgcgt attgtcactg gtatagtcga cgccgaccag    197820
     cgtcttgctg tcgatcccgt cccatccggt atcgtactgc agctgattgt cgaaggcgta    197880
     gcggttggac atgccgtcga ccgagaacgc cgttcgattg gccgtcggat ccagcgatgc    197940
     gccatagact tcggcatagt cgagctgcgt atagcgggca ttcgagcgga aggtcaggtt    198000
     gtcgttgatc tcgtgctcga actgatagcc gatgtcggtc tgctccgtat tgaagcgatt    198060
     gaagtccggt tcgcctagga aagcgtcgat atcgatattt gcgccggtcg gaacaccccg    198120
     cgcacccgtt ccatcgcgtt tataataatc ggtcagaatg gtgagcgagg tgccctcttc    198180
     cggcttgatc gtcagtgccg gtgcaatgta ggtgcggtcg tcgttcgaat aatccaagcc    198240
     ttggtcaccg tccttggcaa gtccggtaag ccggtaggtc catacgccat cggcatcgat    198300
     cgggccgcca aaatccgcac ccacctcctt ggtaccatcc ccatacgacg tgtaaacttc    198360
     accatgcttc tcatccaagg gacgcttggt gattgcattg acgagtcctc ccggaccgtt    198420
     aaggccaaag agggtcgacg tcgatccttt catgacctcg acgcgctgaa gaccataggg    198480
     ttcgaggcgg ctggcagtga accaggcgga aatacgcgcc gccagtccat cccggtaggt    198540
     gccaagcgcc gtctgatcaa agcctcgaat tcttatataa tcgtagcgat cgtcgttacc    198600
     gaactcatct gaaaagacgc cggcggtata agcgaccgcc tgctgaagat tgtccacatg    198660
     acgctcttcc aactcttttt gcgtcaccac cgacactgac gccggtacat cgaagaccgg    198720
     agtatctgtt ttggtgcctg tggcggtatc cttggcaacg atggtgcgat cagggccaac    198780
     cacacgatcc gacttgccgg ttatgacgat cggggccaat tgcgtcgcct cttccgccga    198840
     attgtcttgt gcccagccaa tgcccaccga tccgaacgac actgtcatca aagcgctgct    198900
     cgcaatcaat cggcttgtga acacacgcaa ctttccctgt agtcctactg tcatattatc    198960
     ccctgtcaga gcatatcgag cagtgtgacg gccgcccctc cggccgctgc agcgagtccg    199020
     tttactaaaa caggagaatt ggagtcaact taatagtcac gcttttgtga ctatatttgc    199080
     tcctggtcgg gaccgagagg tttggggaca acacggagag aggatgtaat cctgaacggc    199140
     ccatctggca ctgaccttga cgagtgcacg cgcgaggacg atcgtccaac cgccgggtct    199200
     attcaccgat gaagcacttg cagagagcgt cacatgtcgg tcaaactctg gacagcgaat    199260
     gcgatgccaa ccgcgcgatt cacggccgcc gcaagaacgg acatgtgggt ctcgccggca    199320
     taaagctcga attcggtacg caatccgtcg gtagtgccgt ttaatcgctc cgccatctcc    199380
     cgcgccagga ggacggtccg ttccgtcttc ctcttctcca ggcgtgcggt ggcatcctcg    199440
     ttgcggtact ggaagggagc cagctcatcg ccttcgtatt ctccggcgga caaatgcagg    199500
     aagggtgcat tccccggtgc gtcttgacgc tgcgcctcgt tcttgaggat ttcactgttc    199560
     tcccaataga tggttgggct ggccgcaatc caattggcaa acagacctgg acgctcgaac    199620
     agggcataga gagtaaagag gccgccgaag gaatgtccga aaagcgatcg gcgcatcgga    199680
     tccaggatca ccatctccgc aatccgcggt ataagctcgt tctcgatgaa atccaccagc    199740
     ttaccggtcc ctccgatgac aaccggcgga ccaccctcaa cgaacggcgg ataggatttg    199800
     accggcggag gccccaggtc ccaagaccgg cggagcggat catagggctc gtcggagggg    199860
     tagccgatcg ccgcgatcac cccccaaccg acattcgtcc ccgttgggta aggtgcctgc    199920
     gtgaccaagc tggcgactgc gaaggggaaa gtggcgttgc cgtcggtcat gacgagaagc    199980
     ggccatcctc ccgcaggcgg tttctccgcc ggaatggaaa ggaataagcg atagggctcg    200040
     ccgcccgcag caggagccag atcgaaaaaa cacgttccga gcatcgaata gacgctgatg    200100
     ggattggtca tgagaaagtt ttctgatggt tgggaggata ggggaaggga aattgatatc    200160
     ggtgctgttc accggcaggt ttcgaagttt tccaaggtcg gtgcaactct tgctgatatc    200220
     ctggcttccg cgaaagcgca tcatggcagt cacggttcga aggtttacag aggctgatct    200280
     aacctcgtcc gggcatgatt tgaagacccg gagctatcga gccgcatttc gatcccacag    200340
     atgaactcac aagggcctca attcaatcat ctccgaacac tgctaagccg acgtctgttt    200400
     cgtagctttc ctgagtttgc agcccctggg tgttaacgtg aactacacgt cagagccatc    200460
     acttctcaag catcacggcc gaagatgtcc cgagaggtag tgtagctcgt tcggtcgtca    200520
     tcggcttttt ccggcataat ttgacggcct gtttccggac ggtaacggga ctttttaatg    200580
     cgcgaaatgt tcaaaaggtt ctcagccggc tgcaccaaaa cggcaccggt tttttctagt    200640
     gatgcagatg ttgggaacat aagtactgct gcccgatcgc tttacggaca agatgcaaaa    200700
     cagcggccgc ctggtgcgca ctatgtgcgc gctacgatgg tcgctcaggt gattgcacct    200760
     tttgggtagg cgttttcaaa catctgggga cggaagcgat tgtggatttc caaaagcaaa    200820
     ggcaggcttc gcaatgacgc tggaggtatc tgaacgtgcg cgtttagctt cgcgagagta    200880
     gcgcctgcct cgagcggtaa cctccacctg gatttctcgc cttgccaaat tttgccatgc    200940
     tggctatttt agcccgatga gcactacgaa tatttcgctg ccggataacc tgaagccgtt    201000
     cgtcgaccag caggtcgccc ggcgaggcta tggtaccagc agcgaatacg tccgcgagtt    201060
     gatccgtcac gacaaagatc ggcagcactt gcgtagtctc ctgcttgagg gtgcttcatt    201120
     cgagacgacc gagccggttg atgccgccta tttcaatagc ctgcgagccc gtgcctcgcg    201180
     gcaaagctcc aagtgattgc aaagtctatc gttccccgcg agtcggcccg cggggatatc    201240
     gagaatgccg tggactacta tgctcgcgag gctggcgctc aagtcgcgat tagcttcgtt    201300
     gacgcgctgc agtcgacatt tggtttgatc gcaaagcatc cttcatcggg ttcatcgcgc    201360
     tacgcatatg aactcggttt gccccatctg cgcagcatgt cgctgaaggc tttcccctat    201420
     accgcctgga tcggctgaag ctgcatcgca tcgccgacca gcacgatttt cgcccctgct    201480
     tcttcattgg atgcgcaagc aaaggccaat cgcttcgtgc gaacttgacg agctcacacg    201540
     ttcagcagcg ccgcccgagt tgcgttgggc ggacgtctgc gataagcgcc tttgtacgcc    201600
     gctcccgcac ggaaggcgcc aaggacttct gaggaaccga gacgagcatg gccgctgaaa    201660
     atgacgaata catctatgac gaagtgactg gcgaatggcg tccggcttcg gagatggcag    201720
     catccgccag tggcggtgag gcggtcgttc gagacgcaag cggcaatgtt ctggccgatg    201780
     gtgactcggt caccgtcatc aaggatttga aggtcaaggg agccggccag acgctgaaac    201840
     agggcaccgt catcaggtcg atccgcctca ctgataatcc cgaggagatc gattgccgcc    201900
     atgatggaat taagggcctc gttctacgca ccgagttcgt gcgcaaaccc taattcgagt    201960
     tctcagggcc tgctcagcgg aatcggctga cctccgtggc cgacttgcgg cgacggatga    202020
     attcgcgcag cagcggcagg aagaaggctt tgctgaagcg gccggttggc ggctcaggct    202080
     caagatagaa tgaatttccg acgatgtcgg tattgaactc atcgaagata atccaaagcc    202140
     tgcgatcggc atcgaggccg gcgcggcgct tttcgatggc cggcacttcc acagcaaacc    202200
     gcgacgcctc cggctgcttg gtggtgatgg gaaagaagag aaccagatcc ccgtccggcc    202260
     gcggcattct cacgccgacg gccaccggcc gctccttgcg tccttccgtc tctccacgcc    202320
     cagcctctct cgcccataga tagggatagc gtatgacgct tgcggtctgg atcagctcgt    202380
     agttcatcag ttgcctgcct cgtcctcgcc ggcgtaggcc tcgacggcgt tttcgaactc    202440
     agcaaacagt tcatcgggca tcgtttcaat ggtcccggcg gtgcgccgat ccgactgctt    202500
     catcagccgt tggtagtctt cgatattgag gaggaccagt cggggtttgt tccgctgggt    202560
     aatggtcact ggatggcgga gggcctcggc gatgatgtcg ccagacttac gggagaggtc    202620
     gctggttgaa taggaaccgc ttgacttgga catatgggtt tccttgttgc tgtatttgtt    202680
     gcaatataca gcatttccaa caatgctgca agttgctgat ttgaggcgtt gcggccttgc    202740
     gcggacggga attgcgtccg ccattgccgc tcagctcaca acggctgcgg cgatcgccaa    202800
     ttgtgaggcg ggcgtcgtcc accgcctctc agcgtctgaa gcgcctttta ccacgaggat    202860
     caaatggcgc gcaccgcatg aacggggatg ccagtttccg gcgtgatatc cctaataatc    202920
     catgccagtg atccgaattc ttcgtcggtc aacccaacca atgtcggaaa ccggacctcg    202980
     accccaccgt catcggccgt caaagcgttg atccaactgc cgccattgat gcggtattct    203040
     taggtgccga cgtcgatttc gagatcatcc agcagatgga tggtcaagcg cccaaaaatc    203100
     tcgttctcgc cctgcagctg atatccggcg aattcatcct ctccggtgaa aacacgtcgt    203160
     tccaatgcca tgattacctg tatccgagcg attgccgcgt cgagcccctc aatcaggcga    203220
     acatgaagct ctcgcgagaa accgctgtcg caaccgaagc ggtttgcgag gacgacaagc    203280
     gaaagccaga aagcttggcg cagagcatga ggttctgatc ggttgtcata atgtgatctc    203340
     cttcatcttt gacgtagatc ggccactccc cggcaaagag gggtcgagga ccgcggaccg    203400
     cggcttgcaa gcgggggaac cgattttgtc gcttgcggca aaattggggg agaccgcgcc    203460
     gtccctgacg ccggatttgg atcttccttg tccgaggcaa cgccgaaccc gatcctgaag    203520
     tcgatactgc cgaccgcccg cagctcgaag gctacagcct gatttccttt gcctggatcg    203580
     caggctatag cccgacgtcc gcatctttgc ctgcccacaa tttgtccgcg atcagccggt    203640
     gctgttccgc tgctgcccta tctttttccc ggagctggag ttcgctaagg cggcgatggg    203700
     cctgatatcc cgaagagggt cggcttttct gaaggcgatg ggcagtcgct gcgcaattcc    203760
     ctctgcgcga agcgtgccgg ccaggtcgaa cgtctctgcc agctgcgcca aattctgggg    203820
     aacacgaaga ccaaacggaa accaatggat gctgcggcga gcaaagcaga gcttgtttgc    203880
     cactcctccg ttatcgaccg ccgacttgct cccgagcctg gtgattagcg ttcacaaaaa    203940
     gaagaggagg tgatagtttt gcgcaagctg tgaacgattt tcacggtcgg gtctagaccg    204000
     agtgatccaa tttcgcggag acgctgatgc gtgaatggcc tacgcagagt gtgagggatt    204060
     ttcacggacg gccgctgcct gagcgcggtg aaccggctgg gtatgccgcg atcatggcac    204120
     gctacgatct gatcttgccg ccacctataa ggatgaccgc gatagccgag cgacatcatc    204180
     cgacatcaac cgaggcgtgg ttgatgctga cgccccggta tcgtccacag cccgagcttg    204240
     gccctcatct ggtttttgcc ttcagatacg aaggcgtcga tctccaggtg ttatcggctc    204300
     tgttccagat cattgagact gacgagatcg aggctatcat ccgggccacg ccaactggcg    204360
     ctttcgcgcg ccgcctctgg ttcctgtacg agtggctgac cgatcggcag cttgatattc    204420
     ccgatcccgg gaaggtgcgg atggtgacga tcctcgaccc ggatcagcaa tatgcactag    204480
     ccgaaggcga tccatctccg cggcacaagg tctcgaacaa tctgccgggc acgccggcat    204540
     tctgcccact agttcgccgg acgccggatc ttgccgcgtt ctcgcaaaag gcgctcggtg    204600
     aacgggcccg cgaggcgatg ggtcgcgtcc gtcccgatct tttagcgcga gccgctgctt    204660
     ttattctgct caacgattcg aagtcctcct tcgccatcga aggagagcga ccatcaggcc    204720
     aaagggcagc gcgctggggc caggccatcg cgcaagcggg cgtgcgtccg ctcagcctcg    204780
     acgaactcga tcgccttcag cgcatcgtca tcggagacgc ccgcttcgta cgtctcggcc    204840
     ttcgggacga aggcggtttc atcggcgtac atgaccgaga caccaacatg cccatccccg    204900
     atcacatcag cgcgcggcat gaggatctgg aaagcctggt gggcggcctg atcgcattct    204960
     ctgaccgcgc cgcgcggggc gcgatggacc cagtcgtagc agcggcatgt cttgcattcg    205020
     gcttcgtcta cattcaccct tacgtggacg gtaacggccg cctgcatcgc tggcttatcc    205080
     accatgcgct tgccgccgct tcctacagtc ctcccggcct tgtgtttcca gtcagcgcgg    205140
     tgatcttgcg caacatcgac cggtacagag cggtattgga gtcctggtcg gcgccgctcc    205200
     ttccgttcat cgaatggcgt ccgacggtct cggccaatgt ggaggtgcta aacgacacgg    205260
     ccgttttcta ccgctatttc gatgccacgg cgcatgcgac cttcctctat gcctgcgtcg    205320
     aacagacggt cgaacacgat ctaccgcaag aggttcgctt cctgcaggcg tttgacacgt    205380
     tttccgaagg ggtccagcag atcatcgaca tgccaacggc tcaagccgaa ctgctacaca    205440
     agttcctcgg gcagaacgac ggccggctgt cgcagagggc acgcacgaag gagtttgctg    205500
     cactggacga cctcgaggtc gaaaggatcg aggcgctcta tgccgacgca ttcgagcgag    205560
     accgagcctg accaccgctt tcgcgtcttt gttcccaatg ggaaatagat ctagagcgtg    205620
     aactcattaa tccgcttgtc cgatcaagcc ttgcaacgcg ggcatcagaa gagcaaaaag    205680
     cgttatgtcc gagaacaacg tcaacgcgct ttcgttcgag ttcgatcgct cgaatatgtt    205740
     tgagccgctt ttgcaggctg acccgtcgtt tcgtgaaaag tgggagacat tccaggagga    205800
     atatcgatct gacgaccagt tgccatttta cttggcactg tcagagcttg ctcgtcatct    205860
     gattcaggat ttggaaacag gtaacacgca tcgatttgac gcggtctttg atgtggtcga    205920
     acgctggcac atcaagggcg atccgtatgt taaacaggcg gctacagtag gtctactcga    205980
     agatttgcag aatagtcatt tgcatcgcaa aactcgctct gacgatttta ttccatggct    206040
     gcggccggaa actctcggat ggtggactaa ggtccatgaa ttctgggcta caggaaagcc    206100
     gataatttga gcctttcctc agaagttggg ttccgagaat ggcaggtttt tgattcactg    206160
     gggctttgat ttggaggcct ctcatgtccc gtcagcagtt cgacctgact gatttcgaat    206220
     ggagcatcat acagtcgttg ttgccgaaca agccgcgcgg cgttcctcgt gtcgacgatc    206280
     gccgtgtcat caacagcatc ttgtggcggt tccgaaccgg ctcgccatgg gcggacgtgc    206340
     ccgagcgata tggaccttat acaacctgct acaatcgctt cgtgcggtgg cgcaaagcag    206400
     gcgtctggga tcatgtcctg catgaggtgg caaaggcttt cgacggcgac atcgtcatga    206460
     gtctgtgccc tagtcgctct cttcgcctta agtgacgtcc ggtattgagt ggagcaccag    206520
     acatttccgc cggatgaaat tgcgatcagg tttcaccatc gcctggtcgc gatccacccg    206580
     tatccaaaca gaaatggccg tcacgctcgc tcggcggccg atcttctgat cgaaggtctt    206640
     ggcgacgagc gtttcagttg gggcggcgaa ctctggccga tgtcggtgaa ctgcgcactc    206700
     gctacctcgc agcccttcgc gcagccgaca accacgatat cacgccgctg ctctccacca    206760
     ccgtctaggc ttctttagcc gaccttcagt gctatgtctc cttcgggcgg actgcggatg    206820
     acgatgtcat ctcttccttt ccagggaaaa gctcgaacgg cggttgacct cgacaccgat    206880
     tagagaagcg ccgcaagacg ggatttcggg aattctcgac acgctaaggg cggatcaagg    206940
     gcagccgcag gagcctcagc atagcggccg acagaggcgg aaccgacact gcccccgcct    207000
     gtgcgttccg tattcaagcc actccgatgg acgtcaagga gtatcgagat cagtcgttgg    207060
     aattgccttc tgggaaaaag aagcccggca cgaggccggg cggtggaggg taatggcgcc    207120
     ggcgcggata tccgtgacga caggcgcgga cgtcgtcgtc gaggacgcgc tctgctgatg    207180
     gttgacgcgc ctgctgaagt tgttgattga gcgtgtcgag ctgggatttc agctgggtga    207240
     tgctttcgat ctgcttggcg atcgccgtct gatcgatgac cgggatgccc tgtgggaacg    207300
     ccgttccgac cggcagcagg gtagccgcta gcaccagagc aaaccgtgtc gtgctccttt    207360
     ccatcaatcc gttctccttc cttgctgaaa caatggtagc cagtcttcaa tccggtcgcc    207420
     gacctccgcg cggatcgcct cagcgagttc gacgttcgcg gtgcggccgg tcaagatgtc    207480
     gagctcgtca tcgaaacccc tgaggtttag ttcggcgacg acgctattgt gaccttgctt    207540
     gacgatgaag cggcggcttt cgaccgagag ctcgcgcgaa agaagttcga actctcgctc    207600
     cgtcagtttg aatccgtcga cataatcgcc atggctgctg ccatcaagat agaagcggcg    207660
     acagggcgaa gagttgcatt tgagatcatt tgctttgttc cgatcgatca ttctgaaaca    207720
     cgagaaccga ggattgccgc cgggcgctga agacgtccca cgatgcggct tcatcgggct    207780
     gggagaggga ttttccgggt gctggcgccg cctcgccatc agccgattcc tcgagaggga    207840
     cttcttcgcg cggctcggcg atggcgacag acgccaggtt ggaggacagg gggaccattt    207900
     cctggcggac ctgcctgtca tatttgacca tcttaccgac tgacggatcg tcccgtccgt    207960
     aataggactg aagcatgacg ttctcggcat ggctcgcatc agcaccggcg cgcaaggaaa    208020
     gccgatagta gctatcgagc agtgtggccg tggccttgag gttcaggcag ggatcgaacg    208080
     catccgaaat cgaaagcttc agcttgcgca actcctccat gccgatacca ccaagactga    208140
     cctgaatgtt ctggtgatcc gcaatgaggg aggtcgcaag ctcaattgct tccgccttcg    208200
     atgcgggttg gcgctcaagc ggcgaaccgc tgttgatccg aatggcgaaa ggcttgaaac    208260
     ggctctcgag actgacgaca gcagcgagcg ttctgacttc cacaatgggc gcgcatgtct    208320
     gcgcgagatc cacgaaagcg accgccatcg atcaatacca gacccgctgc gtggctgtcc    208380
     catcgatggt gacatcgacg tagtgaggtt gcgatcgcac gttcggacga gccgtcgaat    208440
     aacccatgca ccggcggcgc ccatcctccc gctgccatcg cggcgagagg accgaacctt    208500
     gctgaaattg ttgccggcgc caagattgag gcagaatgcg tcgctcaccg gctgcagggg    208560
     ccgtcgacac gcagatcgct tctcgcccgc gcggaccata atcgctttcc agccaatatc    208620
     cggtttcgca gtaatagggc tcgtagcccg ggcgcgaact cctacagccg acgccgctgc    208680
     atgtcgggaa cgaatgcccc tcggcaagct cccgccattc tgcgaattgt gttgggccgc    208740
     cgggattgga gaggcacagg acgacctcgc aaccccaatc agttgcttgc gcgttgccag    208800
     gcgaggtaag atagggtggc aatatgcagc aggccgcgac aactgagttg aacagaaggt    208860
     ttttcatgag cacgatcctt caaaggacat ccctttgcgg aagaggtggt ttgcgtgtag    208920
     agcaatttat actgacttat ataacacagt aaaatgacat gacaagagca ctcaagactc    208980
     aatggcacaa tctcgctttt tcaggcctga tcctgcatga gatcctcgat catcccctcg    209040
     acgatgacga gacgcctcaa gcaaggctga agcaggtcgg catgatgacg atcctctaca    209100
     gcatgaacca ggcacaccag aagctaacgc tttccagcat catggaaata acagctctga    209160
     cacgcagtgg cgtcaaggag acggtggatc tgctggtgaa gcgagggatg ctggacgaga    209220
     cgatcgtcaa gaattccatg gggcgtggaa cggcacgcca gttcgagatt tcacaggcgc    209280
     ttctggagaa attgagctcc ttcggagccg gataagcaac ctatcttaag tgacgagttc    209340
     tgatgcacca cctcggcggc ggacattaat ccattctgga gtaaattctc agggcaagtc    209400
     accgcagtgc ggatctcgcc cgtctcatcc tctcccggcc ttaactcgcc aaggcaacca    209460
     tcgttgccga accggaatat ctcgcggaag ccctgctata ttacatcaac gatccgatat    209520
     atctgacccg cgagcagaaa ttcaggacct acgtccgctt caccaagaag ggtcagctcg    209580
     acgcggatct tggagagacg ctgaaaacta gccaggacct gcacgcccag acccggtctc    209640
     cagtggtaat cctgatgcag cacaagctga agagaatagt tccggaccag atttgccggg    209700
     agggttacaa ctggagacct tccatgcctc gcgccaacag atcgacgatt tcctgttgac    209760
     tgcgatgctg ctcgccgaat tcggccctgc gaattatttc gaaacctatg atgtgtatct    209820
     gttggacggt gatcggaaat agaccgtctg acgaaaaagg aggcgtccgg catgaacaca    209880
     agcttgggtg accgcagggt gaccgcatca ggccgagcgg gcttgcgcga ctatatcgcc    209940
     attgcacggc tcgatcacag tacgaagcat gttttcatcg ttcccggcat catcctcgcc    210000
     tatcttctgc ggggggtcag aaccgacgac ctgacgtcct caatcctgct cggatttgtg    210060
     accgcgctct gcatcgcatc cgcgaactac tgcattaacg agtggttcga ccgcgagttt    210120
     gaccggcatc atccgacgaa atcgcagcgg tccgccgtgc aatgcgcgat gaacggcagg    210180
     ctggttcagc tcgaatggac cgtgctgctc atcgtcggcc tgggctgcgc catcctctcg    210240
     agcaaacttc tgttcttcgt cgcctgcctg tttgcgattc aggggatcct ctacaatctc    210300
     gatccgatca gaagcaagga taagacctat ctcgacgtca tctcagaatc gatcaataat    210360
     ccgatccgct tagtgatcgg ctggtcaatg atcgacccaa cgagcctgcc gccgggatcg    210420
     atcatcctgg cctactggtt cggcggcgcg ttcctcatgg cggccaaacg cttatcggaa    210480
     tatgacgaga tcgtcgcgtc gcatggcaag gagttgctgt cgcgctaccg ggcgagtttc    210540
     gccaagtata cgaaggtatc gctgaccgcc tcctgcattg cgtattcact gttttcgatt    210600
     gcctttctgt ccgtcttcct ggtcaagtat cgcatcgagt acatgctcgt cttgcccttc    210660
     gtcgtagccc tgttcacggc ctatttcgtg atggcgacga aaccgggctc tacggcgcag    210720
     aaaccggaaa agctgttccg cgagcccggc ctaatcgcga tcgtcgcggc cctggcggcg    210780
     gccttcatct tcgcgacatt cgtcgacatt ccgcttttag tgacgctgac cgaacagcac    210840
     tacatcacca tccaatgatc gcgaggaatg tcgactgggg cagtatccgg ttcgtcgtct    210900
     tcgacgtcga cggaacgtta tacaaccagc gcatgctacg ccttcgaatg gccggcgaat    210960
     tgattgctga tgcagtggcg agaggcagcc tgaccaatct gcgtgtgcta cgcgcatacc    211020
     gctccttgcg tgaagccatc ggcgaggggg agatcgacga ttttcaggcg agcctgatga    211080
     cgcgaaccgt cgcgcgaacc ggccagccag ccgaaaggat agaggcaatc gtcagcgagt    211140
     ggatcgagcg ccgtccgctc gcctatatcg catcctgccg gtatgatggg ctggtggagt    211200
     tgtttgccgg gctcagacgg cagaacaagt cgatcgggat ttattctgat tatcctgccg    211260
     acgagaagct gcagaggatg acattgtcgg ccgattacat attggccgca agcgatcccg    211320
     gcgtcggcat ccagaagcct gatccgcgcg gcctgcagat gctgatgcag cgcgccggcg    211380
     tcggcccggc gcaaaccgta ttgataggcg acaggcccga gcgggatggc cttgcggcgc    211440
     ggcgcgccgg tgtcctgccg ctcattcgct ccgacgggcc acgcgagggc tggctgacct    211500
     tttcgaccta ttcggaccct gtgttcgcag cgctgcgggc aaaggaagcg tccggatgat    211560
     cttgtcaaag gctatccgct atgtgttcac cggagggctg gccgcgttcg tcgacctcac    211620
     ggtgtttcgt ggcctgctgg cgtttggcgt gcccctcggg ctctcggcga catcgagctg    211680
     gctgatcgcg gccgccgtca attacagcgc caccagccgc tatgtcttca atcaggcaac    211740
     aagccgcaag cgcgcttcac tgttcctgat cggcgcactg ctcggcctct cgatcaatgt    211800
     cttcgtgacg ttgatcctcg tgcagcaggt tgggctctcg cccttgtggg caaagctttt    211860
     tggaatcggc gcggccttcg tcttcaattt cctgataaac cttctctggg tgttcaggta    211920
     gggccagcga gcgacggcgc catatctttc cgtcctttga aggacggtgc ccagaataag    211980
     agaaagttca gcggagcctt gttggaaggc ttgttggaca gcggcgcaat atgaaccatg    212040
     cctgagataa gcgtccgcca gcagcatcta gccaatatgt gcttaatgtc cccttcggag    212100
     agatagtgtt gaaaacactc ggcgttgccg atgctttggt gtcatgattc aatcgtcgca    212160
     ttgatttgcg gcggattgag tgatgatggt gtcaggtggt tcctgcgcag ctcttctacg    212220
     acttccgcct cgatgatgct tcgcccgagc gaagcggccg aggcgatttg cgtgccaagg    212280
     gaaattccca aaattccgat cttaccgcca gagcgcggtt gccccttgag ataggcgact    212340
     acgccctgaa cggccaagat ccagcccgac agttgctgct cggaataggc gatccgcgtt    212400
     cccgcctcac gtgtcgtggc aatggtgtcg aggtcgcccg gcgacagcac atgaacgaga    212460
     taggcatcca atcccgctgc cttgaacgcc tgcccgatct cgtcatgtcc tggtcaacgg    212520
     cacgccagag ccagtgtttg cggccggcga tggaaactac cacctcgtcc agatgccaga    212580
     cgtcccggcc cgacggccgt cggcggcgga tttgcttcgc gtaggccggt ccgaatttcc    212640
     gaccccgtcg ccggatcgtt tcatacgaaa cgacgatgcc gcgctccagc agcagttctc    212700
     gaccagccgc aggctcaaag gaaatctgaa atacagccag accgcgtgcg cgatgatctg    212760
     ttgcgggaga cggtgacgct tgtagctgat ggctgaattc ttcatcccac catctccaca    212820
     ccccactcac tgacagcagg tttatgtgac aacaccgaac tgaacgaaac tagctagtct    212880
     gttgcttggg acgaacggag accgtcgaga aattcgataa tcatcgcggg acggtttccc    212940
     tgctcaattt tttcgaagat tgccaccttt catacaggac tccggctcag atatgcagcg    213000
     cgcttcccaa cgctttcagt gccgcttcca tgaccgcttc gctgcgggtc ggatgcgcgt    213060
     ggatggtgcc ggcgatgtct tccaggcgcg cacccatttc gatggcgagc gcaaaaaccg    213120
     ccgaaagctc ggagaccccg gctcccaccg cctgcaggcc gagcacgaga ttggtgtcgg    213180
     cgcgggccac gacgcgcacg aaaccttctt cggacaacat cgtcattgcc cgcccgttgg    213240
     cgctgaacgg aaactggccg gtgcgaattt cgtagccttg cgccttcgcc tccgccggcg    213300
     acaggccggc gctgacgatc tccgggtcgg taaagcagat ggcgggaatg catcttttgt    213360
     cccaggcccg cttcttcccg gccatgattt ccgccaccat ctcgccttgc gccatggccc    213420
     gatgggcaag catcggctcg ccggttatgt ctccgatcgc atagatcccg cgcatggacg    213480
     tgcggcagcg gtcgtcgatc ctcagataag gcccggcacg atcgagatcg agctcttcga    213540
     gaccggatcc tgcggttctt gggcggcggc caacggtaac gaggatgcgg tccgccggca    213600
     gggtctcacg ccggccatca gccgtttcga cgatcagagc ctccccgttg tcggcaaggc    213660
     cgatcgcctt ggcacccgtc aacacccgga taccgccttc agtcagcttg cgcatgacgg    213720
     ggcgtaccag ctctgcatca tattgcggca gcacctgcgg cgtcgcctcg acgatcgtca    213780
     catcagaccc catcttggaa aaagccgtcc cgagctccag cccgatataa ccgccaccga    213840
     ccacaacgag ctttttcggc aactccgtca gcgacagcgc ctctgtcgag gacatgacgc    213900
     ggccgccgaa aggcaggttt gcaagctcca ccggatccga accggtggcg atcaccacgg    213960
     tctcggcgcg gatgatctgc tggccggttt ccgtctccac ctccaccgtc ttgccatcgc    214020
     ggaaatgggc tcggccgtgg acgatcttga ctcgcgcctt ctgcagcagc cccgaaacac    214080
     cggtcgtcaa ccggccgacg atcccgtcct tccaggcaat cgtcctcatg agatcgatcg    214140
     aggcgccttc gacgcggatg cccatcgggt tcttgccggc aagcatcttt tgcgcgacgt    214200
     cgaattcctc ggccgcatgg atcaacgcct tggagggaat gcagccgacc gtcaggcagg    214260
     tgccgcccgg cttgccggcc tcgacgataa cagtatcgac gccgagctgc ccggcgcgga    214320
     tggcgcagac ataaccgccc ggaccggcac cgatgacgag gagcttgcag acgatctctt    214380
     tcatggatct cagctttcga taaaaatgag cgcaggcgtt tcgatgagcg tgcggatgcg    214440
     ctggacgaag tttgccgcat cccagccgtc gatgatgcgg tgatcgaagc tggaggagag    214500
     gttcatcatc ttgcgcggca cgaactgcgt gccgtcccag accggtcgcg tggcgatctt    214560
     gttgacgccg atgatcgcca cttcgggatg attgatgatg ggtgtcgaga cgatgccgcc    214620
     aagcgcaccg agcgagctga tggtgatggt ggagccggaa agctcatcgc gtgtcgcagt    214680
     ccccgagcgc gccgcttccg ccagccggtt catctcggcg gcgcaatccc agatgccgcg    214740
     ggcttcggca tgccgcacca ccggaacggt cagaccggcc ggggtctgcg tggcgatgcc    214800
     gatatgcacg gcaccatagc gcgtgatgat gccggcatcg tcgtcgaaag tggcgttgac    214860
     gtcaggctgt tcggaaatcg ccttgaccag cgcccgcatc aggaagggca gaaccgtcag    214920
     ctttggatga tcaggcctgc gatcgccgtt catggtggcg cgcaactcct cgagcgcggt    214980
     catatccact tcctccacat aggtgatgtg ggggatgcgc gaggcggaga gcaccatctt    215040
     ctcggcgatg cggcggcgca ggccggtcag cttgatctcc tcggtcgccg tcttcctggc    215100
     aaagccgttc tttgccgttg caggcgcggg cccatggctt aggaattgct cgatgtcctc    215160
     gcgcaggatg cgcccggccg gtccagtcgc ctgcacctgc ctaagatcga caccgctttc    215220
     cctggcgaag agccgcacgg agggagcggc aagcggcttt tccgccggcg ttgccgccgg    215280
     cactggcgcc ataggcgctg gcggagcagg ttttgcaatt tcggccttgg gggtttcggc    215340
     aatcggcgtc tgcgaagtcc caatggactg aggctcgccg acatctcccg ccgtctcgac    215400
     ccgtaccagc ggggccttga ccgcgatgcg gtctccgacc tcgccggcaa gccaggtgac    215460
     ggtgccactg acgggagacg gaatttccac ggtggccttg tcggtcatga cggcggcgat    215520
     caccatgtcc tcacggacgg gatctcccgt cttcacatgc cattctacga tctcggcctc    215580
     ggcgacccct tccccgacat caggcatctt gatgatgaat tcgctcatgg ctcaggcctc    215640
     catgacttcg gcaagcgccc gcccgacacg gccgggaccg ggaaaatagt cccactcctg    215700
     cgcatgcgga tagggcgtgt cccagccggc aacgcgcacg actggcgctt cgagatgata    215760
     gaagcaatgt tcctgcacca gtgctgcgac ctcggcgccg aagccggagg tcagggttgc    215820
     ctcatgcacg acgacgcagc gacccgtctt cgagaccgat ttgacgatcg tatcgagatc    215880
     gagcggcagc aggcttctga gatcgatcac ctcggcatcg atgccggcat cctcggccgc    215940
     agcaagcgcc acatgcacca tggtgccgta ggcgacgacc gtcaccgccg atcccgcgcg    216000
     ccgcacctcg gccttgccga tcgggatggt gtagtggcca tccggcacct ctccgaggtc    216060
     gtgtttcgac cagggcgtca ccggccgctc gtgatggccg tcgaaggggc cgttatagag    216120
     gcgcttcggc tccagaaaca tgacggggtc gggatcctcg atcgccgcga tcagcaagcc    216180
     tttggcatca tagggattgg acggcacgat caccttcagc ccgcagacat gggtaaaaag    216240
     cgcctccgga ctctggctgt gcgtctggcc gccgaaaatg ccgccgccgg tcggcatgcg    216300
     cacgacgatc gggcaggtga aatcgccgtt ggaacggtag cggatgcgcg ccgcctcctg    216360
     cgtcagctgg tcataggccg gatacatgta atcggcgaac tggatttcga cacagggttt    216420
     cagcccatag gccgccatgc cgatcgccgt gccgacgatg ccggattcgc tgatcggcgt    216480
     atcgaagcag cgcgttctgc cgtattttgc ctgcaggccc tgcgtgctgc gaaagacgcc    216540
     gccgaaatag ccgacatcct cgccgaaaac gacgacattg tcgtcccgtg ccatcgagac    216600
     gtccatggcg ctgcgcacgg cctcgatcat cgtcatcctg gccatgtcag taccccgcct    216660
     tctgtcgctg gcggcggata tgcggcggca tctcggcata gacgccctcg aaaatgtcgc    216720
     gcaccgaagg cctgccgccg gcatgcagtg tgccatgcgc ctctgcctgg cgctgcgcct    216780
     cgatcacctc gtccatgatt tcggcttcgg cctgcacatg ccgttcctcc gaccacgcac    216840
     ccttgacgat cagatgtttc ttcagccgca gcacgggatc gccgagcggc caggcctccg    216900
     attccgtctt gggccgatag gcgctcggat cgtcggaggt cgaatgcgcg ccgacgcgat    216960
     aggtcacata ttcgatcagc gtcgggccga gattgcgccg ggcgcgctct gccgcccagt    217020
     aggcgacggc atggacggcg agatagtcgt ttccgtcgac acgcagcgcc ggaatgccga    217080
     agccgaggcc gcgcgccgcg aaggtgccgg agccgccgcg ggcgatgccc tggaaggtgg    217140
     agatcgccca ctgattgttg acgatgttga gaataacagg cgccttgtag gtcgaggcga    217200
     aaaccagcgc cgagtggaaa tccgattccg ccgtcgatcc gtcgccgatc caggcggcgg    217260
     caatgcggct gtcgttcttg atcgccgagg ccatcgccca gccgacagcc tgcacatatt    217320
     gggtggcgag attacccgag atggtgaaga agccatgctc cttggaggaa tacatgatcg    217380
     gcaattgccg gccgcgcagg ggatcgctct cgttcgagta gatctggttc atcatctcga    217440
     ccatcggata gtcgtcggca atcagcaggc cggcctggcg ataggtcggg aaattcatgt    217500
     ctcccgtctc gagcgccttg cggaaggcgc agctgacggc ttcttcaccg agatgctgca    217560
     tgtagaagga ggtcttgccc tgccgctgcg ccatcagcat gcgggcgtcg aaggcgcgca    217620
     gcttcatcat gttgcgaagc ccggtcagca acgcctcatt ggagagcgac ccagcccaag    217680
     gaccgaccgc ctcgccctcg cggttcaaaa cgcggatgat ggaataggcg agatcacgga    217740
     tatcttcgga tgcgacatcc acctccggcc gcggcacgga accagccttg gcaatcttga    217800
     cgttggaaaa atcgggctga ccgccagggc gaacggcggg ttcgggaaca tgcaggctca    217860
     accgagcgga atccaccatg ctttttcttt cctccctttg gcggccttgc tcccccctcc    217920
     ggaagcaggg ccggatgtgg ttcttataga ttgcgggcga tcaccatgcg ctgcacgtcg    217980
     ctcgttcctt catagatctg gcagatgcgc acatcgcggt agatgcgctc gaccggatag    218040
     tcagccatgt agccataacc tccatggatc tggatcgcgt cggagcagac gcgctccgcc    218100
     atctcggagg caaagagctt cgccatcgaa gcttccgaca agcagggcag cccggcctcc    218160
     ctgagggacg cggcatgaaa gacaagctgc cgcgccgcct cgatccgcac cgccatatcg    218220
     gcaaggcgga aggcaacggc ctggtgctcg aagatcggct tgccgaaagc ggtacgctcg    218280
     cgggcgtaat cgcgcgccgc ctcaaaggcc gcccgcgcca tgccgacggc ctgcgccgcg    218340
     atgccgatcc gcccgccctc gagattggcg agcgcgatgc gatagccctc gccttccgcg    218400
     ccgagcctga gttctgccgg aatgcgcatg ctgttgaagg cgatctggca ggtatcggag    218460
     gaatgcagcc caagtttttc ctcgacgcgg atcacctcgt agcccggcgt atctgtctgc    218520
     acgatgaagg cggtgatgcc cttctttccg acatcgagat cggtaacggc aaagacgatg    218580
     atgacgtcgc cgttcttgcc cgaggtgatg aattgcttgg agccgtcgat cacgtagtgg    218640
     tcgccatcac gccgcgcccg ggtcttcagg ttcgaggcat cggagccggc ctgcggctcg    218700
     gtcagcgcaa agccgccaat ccactcgccg ctggccagtt tcggcaggaa gcgctgccgc    218760
     tgctcctcgg cgccgaattt caggatcggc acacagccga cggagctatg cacgctcatg    218820
     atcgtcgaac aggttccgtc gcccgcggca atctcctcca gcgccgcggc ataggcgacc    218880
     acgccggtat ccgatccccc ataggcttcc ggcaccagca tgccgagcag cccgagttca    218940
     cccatttcct tcaattcctc gcgtgggaag agatgctccc ggtcgcgttt ggctgccccc    219000
     ggcgctagcc ggtcgcgggc aaagtcacgg gcgagatctg agatttgctg ctggaggtcg    219060
     gaaaggatca tctgttctct ccctctccta ttgccgttcg atggcaacgg cggtcgcctc    219120
     gccgccaccg atgcagagcg cggccatgcc gcgcttcagg tcgtatcgct ccagtgctgc    219180
     aagcagcgtc accaggatgc gagcccccga ggcgccgatc ggatggccga gcgcgcaggc    219240
     gccgccatgc acgttcactt tttcatgcgg caggttgaga tcgcgcatcg ccgccatggc    219300
     gacgacggcg aaagcctcgt tgatttcgaa cagatcaacc gccgacagcg gcaagccggt    219360
     gcgatcggac agcttctgca gcgcgccgat cggtgcggtg gcgaaaagat tgggcgcctg    219420
     tgaatgcgtg gcatggccaa ggatggtcgc gagcggcttc aggccgcgac gctccgcctc    219480
     ggaacggcgc atcagcacca gggccgccgc gccatcggag atcgagctgg aattggcggc    219540
     ggtcaccgtg ccgccctcgc ggaaggcggg tttcagcgtc gggatcttgt caagcttcgc    219600
     cttgtcgggt tgttcatcgc ggctcgccac ctgctcggct ttgcccgatt tcaccgtgac    219660
     cggcgcgatc tcgctctcga aacagccttc ggcgatcgcc ttctgcgccc gcgtcagcga    219720
     ggcgatggcg tagctgtcct gcgcctcgcg cgtgaattga taggcctcgg cgcaatcctc    219780
     cgcgaagctg cccatcaagc gccccttgtc ataagcatcc tccagcccgt cgaggaacat    219840
     gtgatccacg acacgcccat ggccgagcct gtaaccgcca cgggccttgt caaggagata    219900
     gggcgcattg gtcatgcttt ccatgccacc cgcaaccgct acagaagcgc tgccggcggc    219960
     gatcaggtca tgcgcgatca tgacggcctt catgcccgag ccgcacatct tgttaacggt    220020
     gctggccgcg gtcgcgaagg gaagaccggc atggatcgcc gcctggcgtg ccggcgcctg    220080
     tccctgcccc gccggcagta cacagccgaa gacgacctcc tcgatcgcct cggcctcgac    220140
     gcggctccgc tgcaatgccg cgcggatcgc cgttgctccg agttccggcg ccgtcgcctc    220200
     cttcagctct ccttgaaagc tgccgatcgg ggtgcgcgcc gcaccgacga tgacgatggg    220260
     atcctgcaat gtcatgtttc ctcctctggg caacgcgctc agcgcgcgcc catccgcaat    220320
     gcgccgtcga ggcggatgac ctcgccgttc agcatgttgt tttccaagat atgacgcacc    220380
     agcccggcga attccgccgg acggccaagc cgcggcggaa agggcacgct cttgccgagt    220440
     gctgcctgaa cctcggccgg catatccgcc atcatcggcg tctcaaaaat gccgggtgcg    220500
     atcgcgacga cgcgaatgcc gtgacgggca agctcgcggg cgatcggcaa ggtcatcgcc    220560
     gccaccccgc ccttggaggc ggcataggct gcctgaccga tctggccgtc gaaggcggca    220620
     accgaggccg tattgacgat gacgccgcgt tcgccttcgg catccggctc ggtcgtctgg    220680
     atcgctgcgg cggccagccg gatcatgttg aacgtgccga tgagattgat gccgaccgtg    220740
     cgcgcaaaac tctccagccg gtgcggtccg tcacggccga tcaccttttc ggccggtgcg    220800
     acgcccgcgc aattcaccaa accgcgcagg ctgccaaagg cttcgacggc agcggcaacc    220860
     accgccgccc cctcctcgcc atcggtcaca tcggccttga cgaaacaggc atcgcttccg    220920
     aattctcggg cgatttcctg accggcttcc gcgttgagat cggcaatcgt cacgcgcccg    220980
     ccggcctcca caagcgcgcg cacggttgcc gcacccaagc cggagccgcc gccggtcacg    221040
     atgaaacttg ctccacggat cagcatgaat ctcttcctcc ctgccgactg cgccccctcc    221100
     aagcgcaacc gacggatacg attctattcg ctccacctat tgcaagcgat gacagaactg    221160
     ctccattatt tcggccagtt ttgccatagc gaggatagaa tggccgagat cgagcgacgc    221220
     atgatcgcgc cgggcttcgt ggaggaggca ctcgacagcc tgcggcggct cggcaagccg    221280
     acggcgccgg tccttgcccg cgtcggcctg gcatccccgg tcgatcagcc ggtttcggca    221340
     gagacctatg gcgcgctctg gctggcgatc gctgtcgagc tcgacgatga attcttcggc    221400
     atggggggtc gaccgatgcg tagcggcagc ttcacgctgc tttgccactc tgtgctgcat    221460
     gcgccgacgc tgggtcacgc tctgcgccgg gcgctgcgct tcctcgatgt cgtgctcgac    221520
     gacccccggg gacggctcgt catccgcgac ggtctggccg agatcgaact gagcgatgcc    221580
     ggcggcccgc gttcggcctt cgcctaccgc acctactgga tcatcctgca cggcctcatc    221640
     tgctggctgg tcggccggcg cattccgatc cggctcgtcg atttccgctg cgcggaaccc    221700
     aaacaagggg ccgactaccg gctattcttc ggcgcccctg tgcgtttctc gcaagctatc    221760
     agccggctcg gcttcgacag tgccctgctc gacctgccgg tggggcgcag cgaacaggcg    221820
     ctcaaacagt tcctgcgcgg cgcgcccgcc aatattctag tgcgctaccg ttatgatgcg    221880
     ggcatcgccg ccggcgtccg ccgtcgcctg aaccaggcga cgcctgccat gtggcggagt    221940
     tttgccgagc ttgccgccga tatgcgcatg ccgccctcca cactccgcca ccgcctgcgc    222000
     gacgagggac aaagctatgc cgccatcaag gacgacatcc gtcgcgacct cgccgtcgaa    222060
     ctgctgctga acacgacgat gaccatcggt gagattgccg tgcagcttgg ctattccgag    222120
     ccgagcgcct tcttccgggc cttccgcaaa tgggtgggca agagccccga agcctttcgg    222180
     cgggacggag cggaaatcga gggcatgtca gtcgaatctg ttgacccgcc ctgactggcc    222240
     tcgcgctttc gcgaacatgg cggcaatctt catcatgaag gacttgctga agcgaccaaa    222300
     gaaccgcctg atgaggctcg atgtaccagg atcgctcgac gatatcgtaa ttgtattcgt    222360
     cgacgacgat cccactctgc ttgagatcac cgagaccggc gcgctggcgt tcgatgtcgg    222420
     gaatttccag cgccaccctt cccacttccg gcggctgtgt ggtgattgcc agaaggacga    222480
     gatgggtgtt tccatcgctc gcactgcgga tcgcgatgac gacacagact gggcgctgtt    222540
     tgcgcccctc ggtctcacca cgctgctgtt gccacgccca gagataggga taggttatca    222600
     cctcgccagg acgaaactca tggttcatcg tcgtagcttt caccgcgcgc cagccgctca    222660
     atcgcctcgt cgaacaattc ggcatgctcg tccggcatct ccgaaatgtg atgggcacga    222720
     cgcgggtccc cgccgctgcg catccgctga tagtgctcat agctcatcag cacgaaacgt    222780
     ggctttctgt ggcgggtaag aataaccggc tcgcggctcg cgacatcggt gacatcacca    222840
     atctgtttat tgagatcacc tgtcgtgaac tgccgcatga ttatcgtctc cggtttaatt    222900
     tccatatatt ccatattttc aagaaaatca cgctcacgcg ccctcgacaa gattcgcaag    222960
     gctcttcggc cgcatcattc aagggcactt tgaccccgcc gcaacccgcg ctacatattt    223020
     cagcgggagg agtgccatgt ttgatttttc gcttggcgaa accgcggacg cgatccgtga    223080
     aacgacggcg cggtttgctg ccgatcatat tgctccgctg gccgtggaga tcgacgaaag    223140
     caacacgttt ccacgccagc tctggcccga gatgggtgcg ctcggcctgc atggaattac    223200
     cgtcgaggaa gaattcggtg gcgccggtct tggttatctc gatcatgtcg tcgccatgga    223260
     agaggtttcg cgcgcctcgg cctccgtggg gctcagttac ggcgcccatt ccaatctctg    223320
     cgtcaaccag atccgccgct gggcctcgcc ggaacaaaag cgccgctatc tgccgaagct    223380
     gatctccggc gaacatgtcg gctcgctcgc catgtcggag gtcggcgccg gttccgatgt    223440
     tgtctccatg cggttgcgtg ccgagaaaaa aggcgaccgc tatgttctga acggcaccaa    223500
     attctggatc accaacgcgc cgcatgccga tgtgcttgtt gtctatgcca agacggatcc    223560
     cgcggccggc ccgaaaggca tttccgcctt gatcatcgag aaaggcctgc ccggtttcgg    223620
     cgtctccaag aagctttcca aactcggcat gcgcggcagc gatacggccg aactggtctt    223680
     cgaggattgc gcggtgccgg ccgaggcgct gatgggcagg gaaggcgaag gcgtgaagat    223740
     cctgatgtcc ggcctcgatt atgagcgcgc cgtgcttgcc ggcgggccgc tcggcatcat    223800
     gcaagcctgc ctcgatgtcg tgctgcccta tgtgcgcgat cgcaagcaat tcggcaaagc    223860
     gatcggcgat ttccagctga tgcagggcaa gatcgccgac atgtatgtgg cgctgaattc    223920
     ggcgcgcgcc tatgtctatt ccgtcgcccg cgcctgcgat gccggccgcg cgacgcgcac    223980
     ggatgctgct gccgcgatcc ttttcgccag cgagaacgcc gtgaaagtgt cgctggaggc    224040
     gatccaggcg ctcggcggcg ccggctatac caaggaatgg ccggtcgaac gctttttgcg    224100
     cgacgccaag ctttacgata tcggcgccgg caccaatgag atccgccgct acctgatcgg    224160
     ccgggagctc attgcatcat gacggtgatt tcgactgcga tcgatcgcga cagcgacagc    224220
     ttcaaggcca atgccagcaa gaataaagcc ctgatcgacg aactcctcaa tcgttcggcg    224280
     aaagcgcgcg agggcggatc gcaaacggcg cgcgagcgcc ataccggcaa aggcaagctg    224340
     ctgccgcgcg atcgcatcca gctgctcatc gatgccggca gcccgttcct ggagatcggc    224400
     acgctggccg ccaacggcat gtatgatgac gaggcgcccg gcgccggcat catatccggc    224460
     atcggccgcg tgtccggccg cgaggtgatg atcgtcgcca atgacgcgac ggtgaagggc    224520
     ggcgcttatt tccccatgac ggtgaagaaa catctgcggg cgcaggagat cgccatgcag    224580
     aaccgcctgc cctgcatcta tctcgtcgat agcggcggcg ccaatcttcc gcaccaggcc    224640
     gaggtctttc ccgaccgcga tcatttcggc gcgatcttct acaatcaggc gcagatgtcc    224700
     gccgagggaa tcccgcagat cgcctgcgtg atgggcagtt gcaccgccgg cggcgcctac    224760
     gtgcccgcca tgtccgacga gacggtcatc gtgcgcaatc agggcacgat cttcctcgcc    224820
     ggcccgccgc tggtgaaggc cgcgaccggc gagatcattt cagccgaaga actcggcggc    224880
     gccgaaaccc atggccgtcg ctccggcgtc gtcgatcatg tcgccgaaaa cgacgagcat    224940
     gcgctgctgc tcgtgcgtga tatcgcagcc actctcaaca gcgtgaaggc cattgatatc    225000
     gacctgcagc agccacggcc gcccaaactc gatcccgagg atctctgcgg cctgatcccg    225060
     ggggatgtgc gctcgcccta tgatgtgcgg gaggtcatcg gccggatcgt cgatggctcg    225120
     gaactgcatg agttcaagcc gctctacggc accacgctgg tctgcggctt cgcccgcata    225180
     tggggcatgc ccgtcgccgt catcgccaat aacggcgtgc tgttttccga aagcgcgctg    225240
     aagggcgcgc atttcatcga gcttgcctgc cagcgccgcg tgcctttgct tttcctgcaa    225300
     aacatctccg gcttcatggt cggcggccgt tatgaggccg gcggcattgc caaggatggg    225360
     gcaaagctgg tgacggcggt tgcgaccgcg agcgtgccga aggtcacggt catcatcggc    225420
     ggcagcttcg gcgccggcaa ttacggcatg tgcggccgcg cctatcgccc gcgctttctc    225480
     ttcacctggc cgaacagccg catcagcgtg atgggcggcg aacaggcggc ctcggtgctc    225540
     gccacgatcc gccgagactc cacggaggcg cgcggtgaga attggccaat tgaagaggag    225600
     gaagccttca aggcgccgat ccgcgccggc tacgaggccg agggcaatcc ctattatgcc    225660
     acggctcgcc tctgggacga cggcatcatc gatccgcgcc agacacggga cgtgctgggc    225720
     cttgcctttt ccgcctgcct gaatgcgccg atcccgaaag ggccgcgctt cggcctgttc    225780
     aggatgtgag gcgccgatga tggaaagcct tctcattgcc aacaggggcg aaatcgctcg    225840
     ccgcatcatc cgcacggcca agatgctcgg catccgcacc atcgccgtct attccgaggc    225900
     cgatgccggc ctccccttcg taagcgaggc ggacgaggcg atcgccatcg gcccctcgcc    225960
     ggcccgcgaa agctacctct cgcaggaacg catcctcgat gccgcccgga aaaccggcgc    226020
     tgccgcgatc catcccggct acggtttcct ttcggaaaat gccggatttg ccgaagcggt    226080
     ggaaaaggcc ggcatcatct gggtcggcgc gccccctgcc gcaatccggg caatggggct    226140
     caaggatgcg gccaaggaat tgatgcaagc agccggcgtg cctgtgaccc ccggctatat    226200
     cggcgcggac cagagcgaag agaggctgac ggccgaggct gatatcattg gttatcccgt    226260
     gctcatcaag gcggtcgctg gtggtggcgg caagggcatg cgccgcgtcg atcgcccaca    226320
     ggatttcgcc gaacttctcg cctcctgccg ccgtgaggcg gctgccgcct tcggcgatga    226380
     ccgcgttctg atcgaacgct atatcgccaa tccgcgccat atcgaggtgc aggttttcgc    226440
     cgacaagctc ggcaattgcg ttcatctctt cgaacgcgac tgttcgctgc agcgccgtca    226500
     ccagaaggtc atcgaggagg cccctgctcc cggtctcgat gccgccacgc gggcagtaat    226560
     ctgcgatgcg gcggtgaaag ccgcaagagc ggtgaattac gtcggcgccg gcaccatcga    226620
     attcatcgcc gatgcctcgg aaggccttcg cgaagatcgc atctggttca tggagatgaa    226680
     cacccgcctg caggtggaac atccggtcac cgaggcaatt actggcgagg atctggtgct    226740
     ctggcagttg aaggtcgcta gcggcgaacc gctgccgaaa atgcaggacg agatcgccat    226800
     gaacggctgg gccttcgaag cccggctcta tgccgaaaat cctgccgccg gctatctgcc    226860
     gtcgatcggc cggctcgaac atctacgcct gccagaaaca gtccgcgtcg atagcggtgt    226920
     cgagcaaggg gatgacatca ccgccttcta tgacccgatg attgccaagg tcattgcgca    226980
     tgggccgaac cgcgaggcgg cactttcgaa gctcgcagcc gcctgcgctg gcatcgaggt    227040
     ctggccggtc agatccaatg ccggtcttct cgcccgcatc gccatcgatc cggattttcg    227100
     cgcagctcgg atcgataccg gctttctcga tcgtcatgac gaaaggcttg tggcgacgga    227160
     gccgagcgaa actgcaatcg atagcgcggc cacggcgctt ttaaagaaca ccgatggtaa    227220
     tccctggacc gcgctgaccg ggttccgcat cgccggcgca gaggacaaga gggtgcgcat    227280
     ccgtattggc gatcacctcc attgggggca atcgcgtccg gagtttgagg ccaataccat    227340
     cacgatcggt gaaaccacgg tgcttttcga ggccggcaat gcctggccga tcagcctgcc    227400
     cgtcgccagc gaggtcgagg caagtcagag tgccggcgat ggcgcgatcc tgtcgcccat    227460
     gcccggcctc gtcatttcgg tggatgtcgc cgacggcgat cgtgtcgcca agggcgaccg    227520
     cctgctaacg gtcgaagcga tgaaaatgga acattctctg cgtgcgccct tcgacggcat    227580
     cgtcgaaaag ctgcaggttt cctcggggat cagggtctcg gaaaaccagc tggtcgtcag    227640
     cattgtgaag gagcaggatt gatggccggc cgttatttcg acgaatggac ggtcggcgac    227700
     cgcatcgccc acgacatccg ccgcacggtc accgagaccg acaatctgct gttcacgacg    227760
     ctctcccaca atccgcaacc gctgcatctc gatgccgact atgcggccgg caccgaattc    227820
     ggccggatcg tcgtcaacgg caccttcact tttgccctca ccgtcggcct ttcggtcggc    227880
     gacacaacgc tcggcacgct cgtcgccaat ctcggctatg acaaggtaac gatgccaaag    227940
     ccggtcttca tcggcgatac gctgcgggtg gaaacggaag tgatggagct gcgtcgctcg    228000
     aactcccgcc ccgatgccgg catcgtcacc ttccggcata tcaccctgaa ccagcgcggc    228060
     gagatcgtct gccagtgcct gcgcacggca atgctgaagg tgaaaccgtc atgaagctgc    228120
     gctcgctgct ctttgcgccc ggtgaccggc cggagcgttt cgaaaaagcg ctcgcctcag    228180
     gcgccgacgc cgtcattctc gacctggaag attcggttgc gcccctaaac aagccgaaag    228240
     cgcgcgagag cgtgcacgag ttcgtcctgc atcatgccgg cgagaccgct ctcctgatcc    228300
     gcatcaatcc cctcgcctcg ccagaattcg aaggcgacct tgccgctttg agcggccttc    228360
     gtccttttgc gatcgtgctg ccgaaggccg agggtgccgc ttcggtgctg aagcttgcag    228420
     gctctcttgc atctgcaatg cccatcttgc cgatcgcaac cgaaacgcca tccgcgatct    228480
     tcgagatcgg cagctaccgg aatgtcgcga ccagcctctg cggcctgacc tggggtgctg    228540
     aggatctgcc tgccgcgatg ggggctacga ccgcgcggag gacggatggc cgctacacgc    228600
     cgccttacga gcttgcccgc tcgctcacgc tgttcgcagc ccatgccgcc ggcgttccgg    228660
     caatcgacac cgtctatccc gatttccacg atctcaacgg tctcagggcc tatgtcggcc    228720
     gagcccggcg cgacggcttt tccggcatga tggccatcca tccgagccag atcgaaacga    228780
     tcaatcacac cttcacgccg gatccgtccg agatcgcctg ggccgagaaa gtcgccgccg    228840
     ccttcgccgc cagcccagac gcgggtgtca tccagctcga cgggcgcatg ctggacctgc    228900
     cgcatctcaa gctcgcgacc cgcattctcg atgtggccgg gcgatagagc aaatgcgcca    228960
     ccaatcagcc cgcctttgcg gtgtgcttgg aggcggcgtt ctctcggttg aggtagccgg    229020
     caccgatggc gacgtagaga tccacatagt ccttggcaac ctgttgcacg gtgtcggcaa    229080
     ggctctcctg ggcatcggag accgaccgct gcgcctccag gacatcgagc aatgacgagg    229140
     cgccatcctt gtagctcgtg gtcgaaagcg caagcgactc ctgtgccgtt tgcacctgtc    229200
     tgcgcaacgg ttcgagcgtc tgcgtgtcac ggcgaacagc cgacagcgca ttttccacct    229260
     cttcgacccc gttcagcacc gccgctttcc aggcgagata ttgggtcctg gcatcggatt    229320
     tttcgatgtc gacattcgca cgcaatttgc cgccatcgaa gatcggcagg ttgagtgtcg    229380
     gcccgaaggt ccaactggtc agagttccgc cgcttgcacc ggatgatttg acccagctcg    229440
     gcgagatcga gccggataga gagatcgacg ggtagagctg ggcttccgcg gccccgatat    229500
     cggcgacagc cgccgccagc tcgcgttccg ccttgcggat atcgggacgg ttgcggatga    229560
     gatcggccgg aatgccggcc cgaatgtcgc cgcggaaaac cggctggccg gcgcttttct    229620
     gcagttcgcc catcagcgag gccgccggca tcccgagcag agtggcaatg tgatggcccg    229680
     attcggtgaa gctctgttcg aggccaggaa tgtcggactt tgtcgactgt accagaccct    229740
     cggcctgaac gacgtcgagg cgggaggccg cacccgcctt gagctgcagc tgcgtgagtt    229800
     cgtaagtctg ttggcgggat ttcaaattcg cctgcgaaag cgcgatgcgc tgctgataat    229860
     agcgggcgtc gatatagctc tcgaccaggt ctttcagaaa ggtgagcttt gcattgtcgg    229920
     ccgttgcata ggcggccccc agcgaggcga tcgcactctc cttcgagcga cggtactggc    229980
     cgaagatgtc gagcagccag gaaaggctgg cctcgccacc tgtctcattc gtggtaccga    230040
     tcgtcgtacg ctcagaaccc ttctcaccgg ataccgtgtg cgatgcgccg acatcgaggc    230100
     tcggcaggcc accggcagcg gcaaccgtga cattggcgga agccgaattg atgcgctcga    230160
     gcgcctgcag gacatcaagg ttctcgctgc ggccatgagc caccaggccg tcgagccgct    230220
     tgtcacgata agccgtccac cactgcgccg ccacgacatc gccgttgctc ttggtactcc    230280
     cctctttgaa tttagcagga agcggcatct ctgggggtac gtgattcggg ccgctgacgc    230340
     agcctgccag cagaagcgtg accgccgatg cggcgtagcg gagcgatgat aggttcatgc    230400
     agagcgacgg attcacgggc gagctttctg aaccgggatc gtgggttcag gcttagcgac    230460
     gccaacgtta atggcggtaa agacactgta aagttaggta aaatcgctgg gccggatcag    230520
     gcttggtcgt cagccgaacc atagagtgtc ggctttcggg gaagctccag ggtgattgcc    230580
     agacctccgg catccggcaa cgacgcatgt acccgcccgc catggcgctc gatggcctgt    230640
     ctggtgatgg ccagacccag gccatatcca cctctcggta cagcctcgtt tccgcgtgag    230700
     aacggttgga agatccgttc gagttcgtct cgactgacac ctggcccctg atcggtaaca    230760
     cagattttga ggcgctcgtc tgtcgtctcg cacgatacgg atatacgcga atgctcggct    230820
     gtgtacttga cggcgttgcg gacgacgttt tcgagcgccc tgtagatgag ctcgccttcg    230880
     acttcggcgc ggaaaacgcc ctcgacactg gttgtgattg agacctcccg cgcctgagct    230940
     tcgaatgccg catcgccgag aatttcgttg agcagctcga tgacatcaag agcgtgcgtt    231000
     ttcagcggcc ggctggatcc ggcagtcaac ctggcaagcg tcagaacttc gccgaccagc    231060
     gcatccagcc gttcgacctc ccggtccatg cggtctagca tggcgccgag tttcgccggg    231120
     ctctgccgga gcacgccgac ggcggcctgt aggcgggaca aaggcgaacg cagctcgtgg    231180
     gagacatcat ggaacagcct ctgctgcgca tcctgcagct cctgaagccg ggcggcgctg    231240
     gaatcgaagt catgcgcaag cgcggtaacc tcgtcctttc ggccggccat cttgtcaccg    231300
     atgcggaaat cgaagcggcc atgcgcgagc gcgctcaagc catcgcgcag atgcaccacg    231360
     ggacgaatga gatatcgggc gagtgcacct gccgaaatcg tgctcgaaat caggatcgtg    231420
     agccacggca agaacggacc gaagttctcg aacgtgaacg tcgccttggc cggcagggaa    231480
     atctggtagc aaacctcgtc cttcaggacg aatcgtgtgt cgacggtctt ttgaacctcg    231540
     caggcatcgg ctttcgccgt tttggagatc gtcagaccag atggtagcgt ctcttcactt    231600
     gcgcgcacga aatgcgcggc ggcatcctcg ccatctctgg cgagcatgtt tgcggtgaga    231660
     ttcagggcaa tcactcgccg ctcttcctcc agttcgcgcg caaaaggaac gccctggagg    231720
     aaattgacga gcaggatgat aacgccgacg gttgccgcca tcgtcaacca gatcgtcgtg    231780
     aagaatttcc agaaaagccg gggcatactc agtccacgag aagttgatag ccttggccgc    231840
     gaacggactg gatccaggat tggccatcct ccctcagtcc gagcttctgg cgaacgctgc    231900
     tgatatggac gtcgatccgg cgatcgaacg gggtcagcgg cttgccgaag gcccgcttcg    231960
     aaatgtcctg cttcgacacg agctggccgg cgctgcgggc gaggacctcg agcaggctga    232020
     attccgtgcc ggtcaggtcc aagctttcgc cgcgccattc ggcgatcctg ctgccaggat    232080
     ggatcacgag ttttcccgcc cttatgatgt cgatcgaagc accggccgcc ggctggcccg    232140
     cccggcggag gatggcgcgc agtctcgccg caagttcgcc cggcgagcat ggcttcggca    232200
     catagtcgtc ggcgccgaga ttgagacccg atatcctgtc gacgtcatcg ccccttgcgg    232260
     taagcatcag cacaggaacc tggctgagct tcctgatcct ctgcagaacc tcgatcccgt    232320
     tcatccgagg catcatgatg tcgagcacga taatatcaac cgtattgccg gccgccgcgg    232380
     caatggcggc gcgcccgtct gtatccgtga cgacctcata tccttcttcg accagatatt    232440
     cctgcagaag cgtcgtcagc tcggcatcgt cgtcgataag gagaaccttg ttcattcgca    232500
     ttatccgctc tcaatcccgg caagccatac agcacaaata cagtcgcgca gccaagtttt    232560
     acctaactta acattaactt gaccgcactt aacgttcgtc ccgctactga tcctgccatg    232620
     acataatacg cgctgaaacc ggattgcagc gacatggccc gcaatccctc gttgagttgg    232680
     cgcggatcgg gaaaaggcat cgatgccttt gaccacctct tcggtcgaat tcccccccgg    232740
     aacgagaccg cgggacgcgt taccccgcag gcggccccgc gccgcctgcg cgtcctgcat    232800
     tttctcggcc aacagcgtac ctggcctgtg tcgcagagag aacctttacc aaactttaca    232860
     cttccttaac cgcgcttaac atctacacag ctattagagt tcgacctcag ttcgatccgg    232920
     agtgtcgtgt gtccaaggca catcgaaata ttctgcggtg ccgctttgcg gagcggaaag    232980
     tcatctgtgt cgagatttgg cggtggttat cgaagcttgc ttcaaagaac tatgtctcaa    233040
     ttgcttcttt cttgagtccc gggatccact caggacgcgc agaaaccgtt ccaatagagc    233100
     gtcatgctca cctggaagac atctccattg ggggaacggg gtgattgatg ctccgggtga    233160
     tcagggcgtg tttaccggac agatcgaaca gttcaacaag cctaccgacg ccgacgaggt    233220
     tgcggcgcat cgcctcgagg aaaggcggca atagccatcg agcgcggcac gggcgcagag    233280
     cgaagggccg aaatagaagg cgaacgctga cactagggac cgtcgtgagg catcggttcg    233340
     ttgtcaaagt cgtggagcgt cagtcgacac gtgctcgagc gacgaggcat attcccgctc    233400
     agaagaacgg tcccgccata tgccgagagt gacttaccga tttgcttctg tggtttccac    233460
     gaagagctgg ttgagctgtt tcatctcaag tgcatgggcg cgccttctga gggcggctac    233520
     ctgtttgagc gttgcaaggt tgtctgtcgt ctcaatgaga tgcgcatcgg cgaccagcat    233580
     ttccgcttca atcctgccct gctctctcaa ttgccagaca tccctgacgc gaaattggac    233640
     cattatgacg ccgaaaagcg ccacgagcgc ggaagcggtc attggcagcc aattcgggac    233700
     aaccggtcca taggccgaaa acaatgatga aaggccactc aaaacgatga tcgccaaggt    233760
     gagaaaattc cagagatatt gattaacctt ggaggaacga gcatagccgt ttcgatgtgt    233820
     tcgaaggtca cgcaaagcct gccttttgat ctcggctgcg tccgatggaa gcatgctttc    233880
     ggccgtctct tgctcgatct cccgccttgc cgccaaaatc acgttgatga cggcgatagt    233940
     gatcccgaag gttatcatga accacgcgat gtagtgcaaa gggacgtcgt cgagaatgac    234000
     gtttgacaaa aatgcgggtt gaaaaaactc aattaaagcg ccaatcgata tcaagaatat    234060
     agacagggca accactgcaa tcgaaagcat cgccgctata tttctatatc tgctatttag    234120
     tgtcattttc ttcagttgag cctggtcatc cccctccctt ctaaacaaat ccatcatcct    234180
     atcctcgaga ctatagggtt aaccatagtc aaccttttac cacgccagaa agcaagtaat    234240
     gtttgcgaag taatacttta cggatcgaat ttccggcacc tctcgctaat gtgcgggccg    234300
     gggcagcctc cacctcttca atccggtcgc ttcaggctac gctgatcgcc agcggccggc    234360
     cgagatcgag gccaatatag tcctggtgct gtcggacgat ctgcgcggcg tgagcgatcg    234420
     tcaggcttga tcgcggcgat gatctcctca aggtcgccca gcctgacagc cacttgaaaa    234480
     tcggcgctgc ctgagcgggt gagattgggc cttctcagga gaatggcttt gtcggtcccg    234540
     ccgctggatt ggtcagccag cgtggtccct cggcggtcat gtagatatgg tcttccaacc    234600
     ggatcccgaa tttcccgggg aagacgatca tcggttcatt ggaaaaacac atgccggcgg    234660
     caagcggcgc gtcgttgccg cgaacgatgt atggctcctc gtggatctcg agcccgaggc    234720
     catgaccggc gcgatgcggc aaacccggca ggcgatagtc ggggcctagc gagtgtttgg    234780
     caagcacctt gcgggccgca tcgtcgaggc tcgagcaggc ggcgccgatc cgggctgcgt    234840
     cgaagacggc ctgttgcgcc tcgcgctcga tccaccaggc gcgttcgaac gcgctgttgc    234900
     cgtcctccag aatataggtc ctggtgatat cggaatgata accgtcgatc cggcagccgg    234960
     tatcgacgag aacgacgtcg tcgcgaccaa ggacctgatc gccgtcggcg ccatgcggaa    235020
     gcgaggtcgc cgcgccgaag gagacgatgc agaacgtcga gccggcatcg gcgccggcct    235080
     ggcgatgctg tcggtcgatg aattcgacca cctcggatga tttgatgccc ggcttcaaaa    235140
     gcccatgcac ttgcttgtgg acgtcgagcg tcaggtccat cgcatactga atgagggcaa    235200
     gctctgcagc cgatttgatg caacgcaggt cgcggatcag ccgcccgcca tcggcaagcc    235260
     ttgccgcgcc catctccgct gccaatgcgt gatagaagaa aagcggcaag ccatcgtcga    235320
     gggcaagtct gccgcgctgg gcaacaaggc gggcgatgag agcggcgctg ctctcctcct    235380
     cttcccagac caggatttcc cccggcagat gtggcagcgt ttcgacacgg ctgcgctcga    235440
     accccggaac gatgtaggaa atggtcgcgg gcatgacgag cgcgccgagg aacctttcgc    235500
     tcggatgcca gacgagcccg gtgaagtagt ggaggctttc ggtcggccca agaagcacgg    235560
     cagccaatcc ttcggcttcg atcagtttcc gaagcccggc gaggcggttc tgccgttcgt    235620
     cctcagtgat gcggggtacg gggtgctgcc acgacatgtt gttttcctgc ttttcctgcg    235680
     cttcgagatc gatgaaaccc tcgccttgca gccaggatct tgaaccgaca ctaatgccgc    235740
     tgtaggcaat atgtcgacat gaaaagtgag gagatagcca tggcggtcga atacaccaca    235800
     ccgggcatgc tgatgcgcga tcatatggtc gacgtgcccc tggattggtc gaagccggag    235860
     ggtgagacga tccggatttt tgcacgtgaa gtgtgcgatc ccgcccgccg tcgtgaaaca    235920
     ctgccgttgc tggctttcct tcaaggcggt cctggcggaa agtcgccgcg gccgagcaac    235980
     ggcgggccgc catggcttgc cgaagccctg aagacgcacc gcgttatcct gatcgaccag    236040
     cgcggcaccg ggcgcagcag ccggatcgaa agtgcgacga tggagcactt tgccgacggc    236100
     agggccgcag ccgactatct cagcctcttt cgtgccgaca gcatcgttgc cgattgcgaa    236160
     catctgagga aaaccgtctt cggcggcggg cgctggcaaa cgcttggcca gagctatggc    236220
     ggcttcctga cacttaccta tctctcgaag gcgccggagg gactttccgc ctgttatgtc    236280
     accggcggcc ttgccggcct tggggcgacg gccgaggatg tctatcggcg cacctacccg    236340
     cgcgttaccg aaaagaacgc cgcctattac cgccgctacc ccggggatgc cgagcgtatc    236400
     ggccggatcg ccgactatat cgagaccaat gaggtgcggt tgcccgatgg cgatcgcctc    236460
     tccgttcgcc gctttcagac catcggcatc gatttcggca tggcgccggg ttacgagaac    236520
     attcattggc tggtcgacga ggctttctcc ggtcccaatg aagaacgtct ctccgagcgc    236580
     ttcctcgcgt cggtgatgtc gctgacctca tatgacgaca atccgctctt cgccgttttg    236640
     caggaaagca tctatggcca ggccgggacg ccgactgcct gggcagccga acgcatccgc    236700
     gccgagcatc cggcctttgc cggcgaccgg cggccgctgc tgttgacggg ggagatgatg    236760
     tatccctgga tgttcgagga aattcgctcg cttagggcct tcagggcagg tgtcgaggcg    236820
     ctggcaacga ttgagcacta cgccccgctc tatgctccgg cacgtctcgc tgcaaacgag    236880
     gtgccggtcg ccgcggtcat ctatcatgac gacatgtatg tcgatgccgg gctttcgctc    236940
     gaaacagcgc gccacgtcgc caacgtgcag gcatgggtga ccaacgaatt cgagcatgac    237000
     ggtgttcgcc agtcggcggc tgtcctgcgc cggctgatga ccttggtcag agagcaaggc    237060
     ggccccctcg cctcttgagg ctcgagcggt tcattgctct cgtcgcgtca ggacatgctg    237120
     atcgccaccg gccggtcgag gtcgcgggca atatattcct ggatctggcg gacgatctgc    237180
     ccggcgtggg cgatcgccag ttggtcggcc cgctcgacgt caccggcctc gattgcggcg    237240
     atgatctcct cgtgttcgtc gacatactgg cgcggcaggc ggtcgtcgaa tgtcgagtag    237300
     taaaggcgca ggatgcggcg gccctcgtcg agcagcctgg cgaagaaggc cgtgtaatag    237360
     gaattgccgg ctagttcagc gatcgcgacg tgaaattcgc ggttggcctc gatcatcgca    237420
     taggcatcgc gcgcggcaac ggcatcggcg aagtccttct gattccggcg gatggtcttc    237480
     atgatctcgc cgtttcgccg ttgcgccgcg ccgcgcgtcg tcacccggta catcagcgtc    237540
     agcgcttcga aataggtggg caggcttgcg aaatcgatcg ttgcgacgat cgtgttcctg    237600
     ttcggcagcg tcgtgacgag cccatcggcg gcgagccgca acagcgcctc tcgaatgggt    237660
     gtccgcgaca tccggaaacg ctccgacagc cgcacttcgt cgagcggact gccgggttcc    237720
     agcgccatcg acaggatttc ctgcctgagc gtcacataga cgctctgcgt gccagagccg    237780
     cgcacccgca cattttccgc gtcgttccgc attcgtccgc cctcttttgt tagagccttg    237840
     tattgcgttt cggccgattc tcgcaatgtc ggtcttcggg gtctcaaata tgtaagctca    237900
     catcattgaa tcttgtcgac agtttgtata taaggcaacc agtttcaacg aggctcgatc    237960
     aatgaccaca ggatggaagg gcgtatttcc cgccgtaacg acacagttca acgatgatct    238020
     ttccgttgat ctgccctcga cccagcgcgt ccaggacgcg cttgtaaacg atggcgtcaa    238080
     cggactgatc gtcatgggca catgcggcga gaacaattcg ctggaccccg aggagaagcg    238140
     cacgatcttg aaagctgccg tcgaggtcgt caacggccgc gttcccgtgg tgacgggcgt    238200
     gtccgaattc gacacgcgcc gtgccgtcgc ctatgctcgc gacgccgaaa aactcggcgc    238260
     cgacgggctg atgctgctgc cggccatggt ttatgtgccg aagcccgaag agctgatcgc    238320
     gcatttccgt accgtcgccg aagcgacctc gctgccgatc atgctctaca acaacccgcc    238380
     ggcctaccgc gtcaacatcg gcgccgatgt gctgaaggtg cttgccgatg tgccaaacat    238440
     caaggcggtc aaggaaagcg cgccggatcc gcgccgcttc accgatctca tcaatgaatt    238500
     cggcgatcgt ttcgatatct tcgcaggtct cgacgacgtg gcgcttgaag gcctgatgct    238560
     cggcgccaag ggctgggtct cgggcttgac cagcgccttc ccgcaggaat ccgtacaact    238620
     cgttgccgcc gccgaacgcg gcgactggga agaggcccgc aagatctatc gctggttcat    238680
     gccgcttctg cacctcgatg ccgaacacga cctcgtgcag tcgatcaagc ttgccgagca    238740
     gatcatgggc cgcggctccg agcgcgttcg catgccgcgc ctgccgcttt cgggcgcccg    238800
     acgcgccgaa gtcaccgcga tggtcgagaa ggccgctgcc acgcgtcctt cgaagatccg    238860
     ccaggctgcc tgatcatcga ggccggcgac cctcgcggtt gccggccttt cagtgtttgc    238920
     ggttcaggca agcgccagcg accggccggt cgccggatcg aacagatgca tctggttcat    238980
     gttgaacgag agcggcatcg tcgacatcgg cctgggcccg ctctcgggat cgatgcaggc    239040
     gcaaagactt gcctcgccga tgccgaaata gaccatggtc tccggcccga gtggttccac    239100
     aagatcgatc ttagcttcga tgtcggcata accaggacgg gcctggcggt cggtgatcga    239160
     ttccggcctg atcccgaaca cgactgattt accggcatgg ctggcatagt cgccggcgcg    239220
     cgccttcggc accggaagct cgctgccgtc agtcagtttg acgacgagac ccttgtctcc    239280
     tgatagcagc gtcgccgaca ggaaattcat cgacggtgag ccgatgaagc cggcgacgaa    239340
     ctggctgacg ggccgatgat agagcgcctg cggcggtccc gcctgttcga tgatgccacc    239400
     attcatcacc acgacacgat ccgccatggt catcgcctcg acctggtcgt gcgtgacgta    239460
     gacggtcgtc gtcggcaaca gctggtgcag ccgcttgatc tccgtgcgca tctgtacgcg    239520
     aagcttggca tcgaggttgg acaacggctc gtcgaagaga aagactttcg ggttccgcac    239580
     gatcgcgcgc cccatcgcga cgcgctggcg ctggccgccc gaaagctggc ccgggcgccg    239640
     gccgagcagc tcgctgatat gcagggtttc cgccgccctg atgatacggg cgtcaatctc    239700
     gctcttggcg agcttctgct gctccaggca gaacgaaata ttctcccgca ccgtcatgtg    239760
     cggatagagc gcgtagttct gaaagaccat ggcgatatcg cgtttgcccg ggccaagccg    239820
     gttgacgacc tggtcgccga tcacgatctc accgccggtg atgtgttcga gacccgcgat    239880
     catgcgcaat gtcgtcgatt ttccgcatcc cgacggaccc acgaaaacga cgaattcatt    239940
     gtcttcgatg tcaaggctga tgccgcgcac ggcctcgtag atgccatagg atttgacgat    240000
     gctcttgagt tccagccgtg ccatggtttt ctcctagacc tcgtgcaacc agatcgccat    240060
     cgctccgggc tcgcgattgg cccagaggtg ataggggatc gcggtgaaag gccgctcctt    240120
     cagcgcgggg cgcgcggtgc gatagagcgc attctgccaa tcggatatat cggcttcgag    240180
     cgcggtgcct tcgaggacgg tcgctccgcc gagaagcgag gcatcgtaac gggcagaaat    240240
     ttcctcagat gccggcaggc ggagccgctg cggctcgccg ccgaggtccg tctcctcgat    240300
     gcaatagacg acaggcccgc gccgcagcgc gacgcgcccg ccgtcttcgg agacggcagg    240360
     atgcgcgtag atgcgctcga ccggcatcga gaagccgatg cgcacctcgt caccattgcg    240420
     ccattccctt gatattgcgg cataaccctt cgtcacgcat tgatcgagat cgacggcaac    240480
     gccgttgacc gagatttgcg cctgcctgca ccatccgggg atccgaagac gaagctgaaa    240540
     ccggcttggc cgctcgacgg cgaaccgcag gctgatgtcg ccatcccagg gatattgcgt    240600
     cttctggatc aggcgcacga agctgtcgcc gactgtcagc tcggcggaat tggtgccgta    240660
     gagatggacg gcgagctgat gatcatcagt cgaatagaaa tattggccga gcgacgtgat    240720
     gaaacgggcg atgtttgtcg ggcagcaggg gcagtaatgc catttccacc ggcggtgctg    240780
     cccgtggctt tcaaggacgt tctcatagaa ataacgctcg ccgtcgcgcg agatgccgga    240840
     aagcgcgcca ttgtaaagca ccgtttccag cctgtcggtg aacttgctgt cgagatcgac    240900
     ctgcgccatg cgatggctcc agaagccgag cgcgacggcc gcgcatgtct cggcgtaagc    240960
     cgtctcgttc ggcaggtcga attcgcgggt gaacccttca ttggatgccg acgggccaag    241020
     gccaccggtc acgtagagct ggcggctgac cagattgtcg aaaagccggt cgcaggcctc    241080
     cttcaatgtc ggatcgtcgt tctcacggga gagatccgcc atcgcagaaa acaggtacat    241140
     ggcgcgaacc gcgtggccga cgacctggtg ctgatcgcgc accggcaaat gggcctgact    241200
     ataggcatat gtcttgtaga cgtaatcctc agggctctcg ccgcgcttgc gagcctcctc    241260
     gtcgtaatat gagggcattc gcccacgttc gtcgacgaaa taggtcgcaa gcttcagatg    241320
     ccgcggatcg cccgtcaccc ggtagagctt gaccagcgcc aactcgattt cctcatgggc    241380
     gtcataacct ctgagctttc cgggttcggc accgaaggtt tcgatgatat ggtcgactgc    241440
     gcggatcatc acatcgagga agcgacgctt tccagtcgcc tcgtaatagg cgacggcccc    241500
     ctccagcaga tggcccatcg aatacatctc gtgcaggtcg cgcagattgg tccaacgcct    241560
     gtccggctcg cggcgaatga accagctgtt gaggtagcca tctgccatct gccctttctc    241620
     gagtttttcg acgatagcat cgatcttcgt ttcgagcgcc gcattcgggt gagccttcag    241680
     cgtgtaactt gcggcctcga tccatttgcc gaaatcggaa tcgaagaaat gctgcatcga    241740
     cagtccgctc ggctggatcg ggcgcaccag cggcccggcc ggcttgtcaa aatcgagcac    241800
     ctcgaggaag ccctcctctt ccagccgctt gtgctgtgtc gggatggtga cgttgcgaac    241860
     cgtctccgtc cagctctgcc agaaaccgcc acggaacacg acactggaat ggtcggcggg    241920
     cctgtatcgc tgccgtcccg cagcgcgtgc cggttgaaaa cgaggtgagc tggtcatgag    241980
     gactcctgag cgggacgagc gctgttactt cacggcgccg gccgtcaggc cgcgcacgta    242040
     atatcgttgc aagagaagga aaagcaggat gcaggggacc atggtcacgg ctatgccggc    242100
     ctgaagcgcg ccccagtcga tgatgccata gatgcccgac gaaacattga ccagcatgat    242160
     cggcagcgtg aacttgttct ggtcggacag aaagatgagg gcggcaagga attcattcca    242220
     ggagttcagg aaggcgaaca tggcaacggt ggcaacaccg ggaagcgcga tcggcagcat    242280
     gatccggcgc aggatcgtcg cctgcgacgc accgtctatc cgcgccgctt cgatcagcgc    242340
     ctttggcacc gcgtcgaagg cgttgcgcat catgaagacg gaaaagggta gctggaacgt    242400
     cacgtagatc agcaccagcc cgagaaggct gttttgcagg tggaggaatt tcaggatcag    242460
     gaaaagcggc gtcaggatcg actgaaaggg gatcatcatc gttgccatga tcagcacgaa    242520
     gagcagcgat tggccgggaa agcggaactt cgaaaaaccg tatcccgccg gcaccgcgac    242580
     gagcaccgtc aggatcaccg ttccggcagc gatcagcacc gaattgccgg catagacgta    242640
     ccagccggcg ccgacatgct cgaggcgacg gtagttttca agcgagaagg ctttcgagaa    242700
     aagcgctgcc ggatcggcaa gtgctgcggc cgcgggcttg aaggaattgg cgaaagacca    242760
     gatgatcggc atcacgaaga agacggcaaa gacgcatgcc gtcagaacga aggcgagata    242820
     accgagccgc tcgctcgccg gcttccctgc gagattgtgg ttgagccgct ccatcaaccc    242880
     tcctccggcc gctggcgcag caggacgaac tggatggcgc tgatcgccac cagcacgacg    242940
     agcaacgcaa aggagatcgc cgagccgtat ccgagccgat aggatgagaa tgaggcgaga    243000
     tagatcgaga agaccgccga gatcgtgctg ttctcagggc cgccctgggt gatgatgaag    243060
     aactggtcga aggccagcat cgacgaggtg acgttgagga caagcgccag caccaccgag    243120
     ttcctcatca aaggcagcgt gatccggcga aaccggctcc agacactggc gccgtcgatc    243180
     ctggcggctt cgatgacgtc gttcgatatg ctctgaaggc cggtcaggag gatgatcatc    243240
     gtgaagcccg ctgttttcca gacgaccatc aggatgacga cgccgagggc tggccagaaa    243300
     ctttcgagcg gcctcggcgc gctgtcgatg atgcccgctc cgcgtagcag ctgcgcaaag    243360
     acgccgctat cgggattgag cagccacatc cacaatgtcg aggccgcccc gaagccgatg    243420
     acgacgggca tgaaatagat cgtgcggaaa aagccggcga tccgcagcgg ccggtcgacg    243480
     agcagcgcca gaggaaaggc caccaggaag atcgcaaccg taaccagcac agtgtagagc    243540
     agcgtgaaac ccagggaatg ccagagctgg gtatcgccga tcagttcggc atagttggac    243600
     aagccgatga acttcgtccg gccgagaagc ggccaattgt aaaagctcat ccagaccgtc    243660
     atgacaagcg gcacgaggaa aagcacgacg atgaacagca agcccggcag gatgaaggca    243720
     agaccaagcc aaccctttgg ctcggcttct ccggtcgcga ttgcgcgcct ccggctgcga    243780
     agtgtcgagg ataccaccgc aactcctcct tccgcttgaa tgtcgagatg tgaaatggac    243840
     gtcagggcat ccacggacac cctgacgaaa cgcgttggct tagttcggat tggtacgttc    243900
     aaggatacgg gtgaagtcgg cctgcgtctt ggcaatcgtt ccgtcgacgt cgtcaccgaa    243960
     gatcgtgccc tggatcaggt tgaggaaggg cccggtgcgg ctgacgaaga gttcgtcgga    244020
     cgaaaatgtg tagggcgtgc gcgccttggc aaggatattg taggcgacga gattgcgcgg    244080
     atcgaatttc gcataggctt ccgctgcgag gtcggtgcgc gacggcatcc ccgattcctg    244140
     ggtgatatag acctgctgct cgggctgcat gtagaaattg acgaaatcga gcgcgacttt    244200
     cttcttctcg tcgctgatgc cctttatcag ggaaagcgta tcgccgccgg caaagctcga    244260
     ttcaccgccc ttcggccccg ggatcggcgc aacggcgaat ttcacgtcgg gatatttgct    244320
     ggtcagcaga ttgacgatgt aggagccggt catcaggatg ccgaccttgc ccgaggcgaa    244380
     ggcttcgacg gcattgttgc cgttgccgga acgcgaggtc gggtggatcg caccggcctt    244440
     ccacatatcg cgataggcag cgatggtctc acgcagcgcc ggcgtatcga ccgtggcgct    244500
     gcggccgtca tcgctcagca catcggcatt ggcggcccac agatgcggca ggaagtcgta    244560
     gatcagccag cttcccgaat ttgccacgaa atagaagccg taggtctcgt tgccgagcgc    244620
     ggcgatcttc ttggcatcgg cggcgacctc ctccatcgat gccggcgcct tgttggggtc    244680
     gaggccggcc ttggtgaaga gatcggtgtt ataggcgatg atcgaggcat ccggcagggc    244740
     cggcacgcca tagatcttgc cgtcataggt ggcaagacgg atgtgcgacg ggctcatcgc    244800
     ggaggaatag ggcaagccct tcacgaagtc ggagatatcc tcgagaccat ccgccgcggc    244860
     aaaggtcggg agatagatca ggtcgagcac ggcgccatca ggagccgcgc tgccggcaat    244920
     cgccgcaccg agcttcggca ccatctgctc cgccgtgatc tgggtgacat tgaccttgtc    244980
     ggaatgtgcg gcattgtatt tgtctgccag tccctgaagg acggcgccgg acgacgtgcg    245040
     cacccatagg gtgatttctt cggcgccggc gagagaagag cttgccagca gcgcaagagc    245100
     agtgatcgtt gtttttagtc gaagcatgct tgttcccctt tttctcgttc aggcccaagg    245160
     ccgtcggacg aaatggacgt tagatcagaa atttttggct gtcgacagtc tgtgtgcata    245220
     aatctgatgt ccgtttgata aaacctttta acagcacatt tttttctgct aaaagctttt    245280
     atcacgaacc gatgacgagg cggaatttga agaatagcgg cgatcggaga cggacgattt    245340
     acgacgtggc gaaggctgca ggcgtcagca tttcgacggc gtcgaacgcg ctgaacgaca    245400
     ctggtcggac gaagcgcgag acacgcgagc gggtgcggcg tgtggcggaa gaaatcggat    245460
     ttcggcccaa cgcactcgcc cgtgggttgc tgagcaagcg aagccatgcg atcggcatgc    245520
     tgaccaacga cacctatggc agactaacgc tgccgatggc ggccggggta tcggaggtgc    245580
     tcgtcgatca cggcgtttcc gtcttccttt gcgccacgaa caatgatcca aggctcgccc    245640
     agctgcacct ggaggcgctt cttgaccggc aggtcgacgg catcatattc accgcgaccc    245700
     gcctcgacct caagccgccg gtccagctgt cccgcttgcc gatacccgtc gtctacgtct    245760
     ttgccgaggg gccggccgac agcgtcactt tcttccctga tgacgaacag ggcgcccgcc    245820
     tcgccgtcga ccacctgaaa gaactcggtc gatcgcggat cctgcacatc accgggccgc    245880
     gggattatct cgccgctcgc atccgcgccc aatcctatct tgatgcctgc ggcgacggtg    245940
     ccgaagcgat gttcggcgag tggtcggagg aatggggtca cgaagccgtc cagacggtgt    246000
     ttgcccggcc cggcccaaag cccgacgcca tcttctgcgg cagtgacgag atcgcccgcg    246060
     gcgtcatcga tgcgctgcgc gacctcaatg tggagattcc cacggatgtc gccgtggtcg    246120
     ggttcgacaa ttgggaggtc gtcgcacggc aaacgcgccc gccgctcagc accatcgaca    246180
     tggagttgaa ggaactgggc catcgcgccg gcctggcaat cctcagcctc tccaagggtg    246240
     aaccggtccc tgccggcatc accagattgc cgtgtcgcct ggtcgtgcgg cagtcttgcg    246300
     gcagtccccc tcaatccgac tgaaaacgac ggcaagcaac accggcaagc cggccgtcgt    246360
     cgctattatc tgtccgtgga attgccggaa cgggccaggc tgtttcggct gaccagcgac    246420
     ggtatctgga aaatatgctc ggaagcggtg cggccttcta ttctggaaat gagggcccgg    246480
     gttgcgacct gaccgagttc cctgcccgac tgatcgatgc ttgcgagatt gacgaggccg    246540
     agtgctgcgg tcggcgaatt gtcgtatccg atgacggcga gatcttcggg gacgcgcacg    246600
     cccatctcca tagccaggct gagaagggtg atcgcgtcga gatcgctcca gcagaatacg    246660
     gcgcgcggcc tgtccttcct cgataggaat tttcgcatcg cctcttcccg cttcggcgag    246720
     gcaatcggaa ttttgccgat cgctggcgag gagccgagcc cgccacgctg catcgcccgg    246780
     cgaaacccga tctcacgctg gcggacgacg gagaccgcgt gcccctggcg ctcgccaagg    246840
     ctcagcattt cgatgtcgcg atagccgcag gcaagaagcg cttccaccgc gatctccgcg    246900
     ccgcgctgat cgtcggcatt gacggtatcg aaggccgtag cgctggcatc gtggtaaccg    246960
     acggcgacga tcggtatctg gactgcgaat tttgcgagga tgtccgaggg caaacgcggc    247020
     gcaacgagga tcaggccatc catcttgtag tcgatcatcg actcgatcaa cgacgtctcc    247080
     agctgcacgc gcgcatcgct gaccccgatc atcgcctgat agtgcgaagg cgccagcacc    247140
     ccgttcacgc cggcaatcac ctccggaagg aaaggattgc ggatatcgat caggagcacg    247200
     ccgatggtga aactccggcc acgcagccct cgtgctgccc gcgaggggcg atatgcgagt    247260
     gtttcgatgg aatcagtcac ccttgcgcgc agtgcatcac tgacgccata ggcgtttcgc    247320
     atcaccttgg aaactgctgc gaccgatacg ccggcgtgag ttgccacggt ccggatcgtt    247380
     acgcgatcat tccgttgcgg cttttgtttt tcttcgattg acatgaaatc tctggcttgc    247440
     tgcgggtcgt caacatcgcc cgcacaacca ccatggcaga ctggtaacga aaattctatt    247500
     gcgcttccga agaaaatgta gaacgttata tggagaacgt tctacaactc gtcgggagga    247560
     cttgatgaac tttcagccgg cagccatcag cggcaacctc gtttcgcgta cctggtccgg    247620
     ggatatgatc gcgccgctat cggatggcgg tcagggaacg gcggcaagct tcgtttctca    247680
     aactttcgag catgatggcc cggggctccc cgtcgatctc ttcatctccg cacttggcct    247740
     ctatcgctgc ttcatcaacg gcgttcgcgt cagcggtgac ttgctgacac ccggctggac    247800
     gaactacgac gatcgccttg cttaccagcg gtatgatgtc tcgaacctgc tcaagccggg    247860
     cctcaaccgc atcgagatct ggcttgccga cggatggtac cgatcgccct tgatgtgggg    247920
     cgcccaggcg atcccgaatt gctggggtga gaggatcggc gccattgcgg atctgatcgg    247980
     agctgatggc gcccttcttt ccaccgacac cacatggcga agcggtgttt tgccgattct    248040
     gaagtcgggg atctatttcg gcgaaatcta tgatgcccgg caggaaagct acttggagag    248100
     ccacggcacc gagagactgc cgttcgacag ggcattgctc gtcgcgcatg aaactgctgc    248160
     ggtgcgcgag ctgcggccac tcgccgcggt cgaaaactgg atcgacgatg agggcaggac    248220
     gatctatgat ttcggccaga atgccggcgg ctacattaga tataccgtcc ggggcactgc    248280
     cggcgccgaa gtccgggtgg agcattcgga agttctcggt cccgaccgtc atttcgacaa    248340
     tcgcaactat cgcacggctg ccgcgcacac cgtctatacg ctacggggag acggcgacga    248400
     gacctacgcg ccgcatttca ccttccacgg cttccgttat gccagggtga cgattacggg    248460
     cgatgcgaag atcctcgcaa tcgcgtccat cccgatctcg tctgtggccg agcccgccgg    248520
     cggtttcacc tcgggcaatc cgctggtcaa tcgtctggtc gaaaatacca tctggtcgca    248580
     gcgcgccaat ttcgtcgaag tgccgaccga ttgcccgcag cgcgacgaac gcctcggctg    248640
     gacgggcgac gcccaggtct ttgccgcaac cgcatgctgg ctgagcgaca gccaatcctt    248700
     cctgagaaag tatctgcggg atgtgatggc cgatcagcgc gaggatggcg ccgtctcaca    248760
     tttttcgccg gatccgacgc gtctgcatcc gaccaatttc ccgggctatg ccggctcgac    248820
     cggctggggc gacgcgatcg tcgtcatccc ctgggtgctc tacacccatt acggcgaccg    248880
     ggccgttctg gcggagtgcc tggattccat ggtgcgctgg gtcgattttg tctggtcgat    248940
     ctcggatggt cccctggttc gcccgccgtc gcattggggc gcccgaggct tcaccttcgg    249000
     cgactggctg cagccggtcg gcgacaatcg aaagcctcgc ccgacgatcg ccgacgactg    249060
     cgcggcgacg ctctatcact tcatctcgac cgaccttctg gcaaggatcg cagccactct    249120
     cggcgagcat gcccttgaag agaagatgaa acagcgcgca aacgagatcc ggctgacatt    249180
     ttccaacgag ttcatcacgc cggcgggacg gctcgcgcac aacgaccaga catcctacgc    249240
     cttggccttc cttcacgacc tgataccggc agagcacagg caagccgcac agcagcactt    249300
     ccggcaggtg atcattgatg ccgactacaa gatcggcacc ggcttcatcg gaacgccggc    249360
     cctgttgccg gcgctgacaa agctcggcat ggacgatctt gccgaaaagg tcttcctgca    249420
     ggaggatgtg ccgggctggc tctaccaggt gtcgaaaggg gcgacgacga tctgggagcg    249480
     ctgggattcc atggcgcctg acggcacgat ctacgaaccc gacatgaaca gctataacca    249540
     ctatgcctat ggcgcggtct gccaatggct attcgaaagc gtcgccggaa tttcgccgag    249600
     cccgagcgca cccggatttg ccgaggtgat cgtcgatcca gcgccgattc cttcgctttc    249660
     gccggtatcg gcccatcatg atatcagcca gggacgcatc gaggccggct ggcagtgcga    249720
     cggcaacaag gtcacctatg tgctgacact tccggaaggt tgcatcggcc ggttccggcc    249780
     cggaaaacgg catcaaaacc cgtcgctcaa tggagagccc gtcgtcgagg aagccgttat    249840
     tcaccccggg acgcaccgac tggccttttc tctacccact tcctgaggag cataaacgtc    249900
     acaccgttca gaggaggaac gtcatgacac atcggattaa agtcattctt gcgggcgcgt    249960
     ccgcgctttt ggcattggtc gcggccggcc cgtcgcatgc agaaaccacg ctgtcattcc    250020
     tgatcgacaa caatccggac acggtcgctg ccgccgaggc gctggttgcc gcctatcaga    250080
     caaaggtgcc cgacgtgacg atcgaaatcg agccacgggc cggtggcggc gagggtgaca    250140
     acatcatcaa gacgcgccta gcgaccggcg agatgtccga tgtgtttctc tataattccg    250200
     gctcgctgct ccaggcgctg aaacccgcgc agacgcttgt cgatctgagc ggtcttgcgt    250260
     cgcaggcgaa ggtggacgaa ggtttcaagt cggtcgtccg cgccgacggc aagctctacg    250320
     gtgttccctt cggcacggcg atggcgggcg gcatcctcta caacaggaaa atctaccagg    250380
     acctcggcct gtcagtcccg aagacatggg cggacttcat ggcgaacaac gcaaaggtca    250440
     aggcatcagg caaggtcgcc gtggcgcaga cctatcgcga tacctggacc tcgcagttat    250500
     tcgttctggc ggactattac aacctgcatg ccgccgtgcc gaacttcgcc gccgactaca    250560
     ctgccaacaa ggcgaaatac gcagagacgc cggcggccat gaaaggcttc gaacggctga    250620
     aggacgttca cgacgctggc ctgatgaacg aggatttcgg cgcagcaagc tatgacgatg    250680
     gcctgagaat ggtggcaacg ggcgaggcag cgcactatcc aatgctgagc ttcgcaatcg    250740
     gcgcgctcaa gcagaattat cccgacaacc tcgcagatgt cggtttcttc gcgcagccga    250800
     gcgacgacgc ggcgacgaat ggcctgacgg tctggatgcc gcccgccctc tacattcccc    250860
     ttaccagtca gcacgcagag gaagcgcaga aattcgtgga tttcgcagga agcgtcgaag    250920
     gctgcaagat catggtggaa accaacaccg tgcaagggcc tcccttgatc gacggctgcg    250980
     gtctgcctgc cgacgtgccg cctgcggtga aggacatgct tccctatttc gaggccaagg    251040
     acaagacgac cccggcgctg gaatttgttt cgccggtcaa ggggccggct cttgagcaga    251100
     tcaccgtcga agtcggctcc ggtattcgcc agccggccga cgcggcaaaa ctctatgacg    251160
     acgatgtgcg caaacaggcc aagcaactcg gcctgcccaa ctggtagcgg tctttcgggt    251220
     caattaacct cgctcccgat ggagcgagga tccacccgat cgaagaggta gtcatgaccg    251280
     agacacgccc ccgctcgcgc aaatcgccct acccgctgtg gtttttcatt ccggccgcaa    251340
     tcatctacgg cgtgctgttt ctggttccca ctgtatcctc tctttggttc agcctcacgc    251400
     gctgggatct ttcgaccgcc gaattcatcg ggctcgaaaa ctttcagcag ttcttttccg    251460
     aaccattcct ggtcaaggga ctggtcaaca cgctgatcta tgccgtgacg acatccggcc    251520
     tgaagacggt ctgcgggctg ctgctcgccg tgctcctgac cagcaatatc tttgcccgcg    251580
     gcttcctgcg cacgctggtc ttctttcccg tcctggtctc gacgatcggc atcggcatca    251640
     ccttcacagt gatgatgcat ccaaccaggg gcatcatcaa cgtcacgctc gaaacgctcg    251700
     gcattcccgg cccgggatgg ctcaccaatc cggcgctggc gcttttttcg gtggctttgg    251760
     tcgatgtctg gaagggtgtc ggcctcgcaa cgctgatctt catcgccggc cttgctgcga    251820
     tcagccccga ttattatgag gccgcgcgga ttgacggcgc cacgcgtctc cagcaatttt    251880
     tccgaatcac tctgccactc gtgcgtcccg ccactgtcat cgtggtgaca ttgtcgctga    251940
     tcggcgggct tcgatccttc gatctgatat gggccatgac ccgcggcggg ccaggtttct    252000
     cctccgatgt ggtcgcctcg gtgatctata agcagtacca ggcgggtttc tacggcctgt    252060
     cgacggccgg aaacgtcatc ctgtttgcgc taatcgccgt aatcatcctg ccattcaccc    252120
     tgtggttcaa ccggcgcgag gtcgaggaat gagaagcgtc cgcccttacg tgaccggcgc    252180
     gatagccctt gcggcggcgg ccgtcatctt cgtcatgccc ttcgttttcg tcgctctgca    252240
     ggcggtcaaa tcgaaatccg aagcgtctcg ccttaatttc gaattgcctg cgcagtggct    252300
     gttctgggat aatctggtcg ccgttttcaa ggcgcgcgac taccagctca tgctcgccta    252360
     tttcaactcc accctgatca ccgtcgcctc cgtcacgatc ctgatcctgc tgtcggcaat    252420
     ggtcggatat gtgatgcagc gccgcaggac cgtctggaac agagtggcct ccgttgccct    252480
     attcatgggc ctgatgatgc cgccggccgt cgtgcccacc atcggcctct tgcaggagat    252540
     cggtctcttc aagaccatga cggggatgat cctgatccag gtcgcctata atctttcttt    252600
     ctcaaccttg ctctaccggt cgttcatctc gaccataccg cgcgacctcg acgaagcggc    252660
     gctgatcgac ggcgccaagc cccgacagat cttcttcaga gtgatcttgc cgctgttgaa    252720
     gccggtgacc gtcaccaaca tcgtcgtcca atccattgcg atcttcaacg atttcaccaa    252780
     cccgctctac taccttcccg gcaaggagaa cgtgacggtg cagctgacgc tctataactt    252840
     ccagagcatg tacacgagcc agtacaatct cctcttcatg aacatcctcc tcgtgacgat    252900
     cccgccgctg atcgtcttca tcttcttcaa caggcagatc gtcgcgggca tgacggccgg    252960
     cgcagtcaaa gggtagcaga atggctgagc tcactctcaa acaggttcgc aagagctttg    253020
     gcgccctcga agtcatcaag gggatcgatc tggaggttgc ctccggcgaa tttgtcgttt    253080
     tcgtcggccc gtctggatgc ggaaagtcga cgctgctgcg catcatcgcc ggcctggagg    253140
     agacgacatc aggcgcgctg accatcggcg gcaaggacgt gacctatgcc gaaccctcgg    253200
     agcgtggcat cgccatggta ttccagagct acgcgctcta cccgcacatg accgttgccg    253260
     aaaatatcgg cttcgggctt tcgctcgccc gtcgcccaaa ggcggaaatc gccgccaagg    253320
     tcgcggcgac ggctgaaacg ctgcagctcg cccagttgct ggagagaaag ccgaaagcac    253380
     tctccggcgg tcagaggcag cgcgtcgcca tcggccgcgc gatcatccgc gatcccaagg    253440
     ttttcctgtt cgacgagccg ctctccaatc tcgacgcttc gctccgcgcc cagatgcgcc    253500
     ttgagatcgc cgatctccac gcgcgcctga aatcgacgat gatctatgtc actcacgacc    253560
     aggtcgaagc catgacaatg gccgacaaga tcgtcgtcct gaacggcggc gcggtcgagc    253620
     agatcggcag tccgatggag ctctaccgca atcccgcaac acccttcgtc gccgggttca    253680
     tcggcagccc gaaaatgaac ctctatggcg gcgagatagc acggcgaatg aactgcgcga    253740
     cctacggcat tcgccctgag catatcaggc tttcggaacg tgccgggcaa tggcagggca    253800
     ggatccggca tctcgagcgg cttggcgccg acgctatcct ctacctggac gttcccgaac    253860
     tcggcgagat ggtggtgcgc gccgaaggcg agacgccgtt tgcatctgga atgacagtct    253920
     gggcaaatcc ggtcgaagga gcggaacatc ggttctgagg atggcaagcg cgccaccgtc    253980
     tcggcgctcg attctgccga cgcacggcgt ttacgacacc gctatcttca cgccaacctt    254040
     ggaatcctgc aatcaatgat taatatgcag tcattgatgt atggagatag cgatggcaag    254100
     catgacgatc cgcaatctcg atgacggtct gaagcagagg ttgcgcatga gggcagcaac    254160
     gcatggccgc tccatggagg acgaagcacg ggatatcctg cgcatggcgc ttgcgacgag    254220
     cgaaccgccg gcgcgcaatc tcgcggatgc gatccgggca cgtctgctct cggttggcgg    254280
     cgtcgaactc gacatcccgc cccgcgagcc gatccgtgat cccccggaca tctccgcgtg    254340
     atcattctcg ataccaacgt catcgcagag ctgctgacgc ccgccccgaa tgtggcggtg    254400
     atcggttggt tcgccgcaca acatcctaca tcgatcttca cgacagcagt caccggctga    254460
     gatcctctac ggactgcgtc tccttcccga gggacgtcgt cgacgcgatc ttgaggcggc    254520
     gatcttgttg gtatttagcg aggatattgg cggtcgtgtt ctgccatttg atcgcgacgc    254580
     ttcaaatttc tatgccacta tcgtcaccga ccgccgcaag gcgggtcgac cgttcagtca    254640
     attcgatgct cagattgctg ccatcgcaat ttcacgcggc gcttcactcg cgacacgcaa    254700
     tgtctcggat tttgcgggaa tggacctcaa gatcgtcaat ccgtggaaag acagataaag    254760
     gcgcggaacg ccagcgcatc ctacaggatc tgcttctatt gcgaaagtct ccgcattttt    254820
     gtttactcga taacatgccg gccgtctcgt cgacacgagg ctcagctgga cagtcagaaa    254880
     cgcggatcgt cattttccgc accgaggatc attctggccg caggactttg gaacggccgc    254940
     cctgctggcc gatttcctgc cgtttgacga gcacgggctg cgtctgttca acagccccac    255000
     gctggccgtc cctctgctct gcctcccacg tttgttgcgt tccccgacgc cgaggcacag    255060
     ccttgcgcag cttggcttat ctctgcgcta cggcagcggc gcatccgatt acgtgacgga    255120
     gggatctatg aggttggtac tgtgccggcg cagagcttcg tcaacaggat gccgctcggt    255180
     ctaaaagccg ggcgcgcgac gttcgagttt atcggcggca gtctcctcgt cgcaacgatc    255240
     tattatcccg gcgatcaaag ccacagctac atccgtcgcg atgaaacggc aagaaagggt    255300
     ctgaccgtcc gcggcggctt cgcagaggga tttggccttc gcgccgaggc tttgaaaaaa    255360
     atgctgcgcc gtgaatggaa acggttggga ctgatacagc tcccgggcac atcgctggcg    255420
     gagcctggca tcgatgcaca tttcgccggc actctgccta tgggcgcagc cggcccgttc    255480
     ggtacttctt cggatggcga catgaatctt catcccggtc tttacgtcgt cgatggttca    255540
     attcttcccg atctttcctc gaaatacgtc acgatgacga tcatggccaa tgccgaccgc    255600
     atcgctcacc gtctcgccga gacggaagca aactcggcgc tctgatgtcc gctgccgctt    255660
     tcaagccctt aattggggca atgcatcgcc ggccaatgat aaaagcggct gataatctcc    255720
     ttctgaaagc actgaaaaat caacaaggcc gagcgtggcg cgcatggcgg agagcgacgg    255780
     ctccttgatc gcggcgccaa gcgcatttcg caggagaagg actctgtcgt ccgacgcatc    255840
     gcctgaggtg ataaaaggca gacccggacc tttggtcgtt tcggcgatga tgcggaccgc    255900
     ttggatatgg ccgggatcga agcgccgaat atttgcatag gtcacgcaat cgatggccgc    255960
     actgtcggcc ctgccttcga caacggcggc gatgctgccg ccgtggctgc cggtttcgat    256020
     aatccggccg aaaaagtggc cgtcgcgggc aagcggagcg accgctgcgc gaaagaaatt    256080
     gctgccggaa ttgctgtcag ggccgttgat cgccgccgtg gtgccgcgca agtcctccag    256140
     cgaatgaagg gcagaatcct tggcgacgat gatgaagctg cgcatcagcg ggccgtcgca    256200
     gccgggatgg tgatatatcg gcgtcgccac caggcggacc ctgccccgca ggctcgttgc    256260
     aaagggatag ccgcatgcct gcgagagaag aagatccggc ctcagccaag cttcatcata    256320
     gcgaaccgcc tgatcgagct tttcgggcag gtccttgagg ccggcttcca aaagatagtg    256380
     ccggaggaac gaccataact cagcggtcgc ctccgcgacc ggctgggatg tagcatacat    256440
     ggcgatgctg acgagaggca ttctggtctt tccctgcgag gcgcaagcat cgactagatc    256500
     aagcaatgcc gccgaggcat acatatttga gctcggtata ttcgtccaac ccgtgccttg    256560
     acccttcgcg gccgagacct gacattttca caccgccgaa tggagcctcg gctgtggaga    256620
     caagaccggt attgacgccg accatcccat attcgagcgc ttcggccaca cgaaataccc    256680
     gcgacagatc gcgggcgtaa aaatacgaag caagcccgaa ctcggtgtcg ttcgcctgtt    256740
     cgatgacgtc ctcttcgtcg cggaaacgaa aaagcggtgc aagcggcccg aaggtttcct    256800
     cgcgagcgac ctgcatgccg gcagcgacat cgcgcaggat tgtcggctcg aagaaatggc    256860
     cgccaagcgc gtggcgtttg ccgcctaaga cgatcccggc accctttgta acggcatcgc    256920
     tgatatggct ttcaaccttg gcgacggcgt tgtcgtcgat cagcgggcca agcacgacgt    256980
     cacgctcgag accgttgccg accttcaggc ccgaaaccgc cgcggcgagt ttggcggcaa    257040
     acgcctcata gacgccgtcc tgaacataaa gccgattggc gcagacgcag gtctgaccgt    257100
     tgttgcggaa cttggcgatg agcgcgcctt cgacggcagc gtcgagatca gcatcgtcga    257160
     acacaatgaa gggcgcattg ccgccaagtt cgaggccgag ctttttgatc gtcggcgcgc    257220
     attgccggta aagcagttcg cccgtccggg tggagcccgt gaatgtcaaa acccgaacgt    257280
     cacggcttgc cgtcagcact ccgccaattg ccgctgcgtc acccgtgacg atgttgagaa    257340
     gccccggcgg caggccggca cgctcaccga gaacggcgat ggcaatggca gagaatggcg    257400
     tctgcagcgc cggcttgagc acgacggcac agccggcggc aagcgcaggg ccaatcttgc    257460
     gggtgatcat cgcattcgga aagttccagg gcgtgattgc cgccactacg cctgcgggct    257520
     ggcgcaggac gaggatccgc ttgtccggct gatgtcccgg tacgacctcg ccgttgatgc    257580
     gcctcgcctc ttcggcgaac cattcgatga agctcgcacc ataggtgatc tcccctttgg    257640
     cctcggccag cggttttccc tgctccagcg tcaggatcat cgccagatcg tcgcggtttt    257700
     cgatcatcag ccgatgccat gccttgagaa cggcggcgcg ctccccggca gtcttcttcg    257760
     cccaaagctt ctgggcgatg accgcggcgc ggatggcatc ttccgtttcc gccgcaccga    257820
     gatcggggac cacccctagc ggctcgcctg tggctggatt gcggaccgtc gccgccttgc    257880
     ggccttccgc ttcgatccag cgatcggcga tggggcatgc ctggcggaac agcgagggat    257940
     cattgagctt catatgacaa ctttcaacag aatacgtgag cggcaccggg atcgaaattc    258000
     agatggacta tatcgccacg gctgagcccg acgatagcct catgaccaaa cggcagacga    258060
     accgccagcg cctcacccgt cgccgtctcg gtcgagacgt gaatattgtt gccgaggaag    258120
     gtaatgtcgc tgacggttgc ggcaagaccc gctcccgcca cctggtttcg cgacaaccga    258180
     atgcgctcag gcctcagcat cagggctgcc cttgtcccgg agcttccttt tccatgcacc    258240
     ggaatgtcat tgaagacgct tccgccgcca agcgaaatgg tggcctgccc atcggaggat    258300
     gacagcaggt cgcaggaaat gaagtcgctg tcgccgatga attcggccac gaagcgggtc    258360
     cgcggattgg catagagttc cggccccgtg ccgatctggt cgatgacccc cttggaaaag    258420
     acggcgatcc ggtcggagag ccgcagcgcc tcctcctggt cgtgcgtgac atagaggatc    258480
     gtcacttcgg tctgctgatg gatccggcgt atctcatgct ggatttcctc gcgcagcttc    258540
     ttgtcgagcg ccgacagcgg ctcgtccatc agaagcaccg gcggatcata ggcaagggct    258600
     ctggcaaggg cgacgcgctg ctgctggccg ccggacattt gtgcgggctt gcgatcctcg    258660
     aagccttcga gcctgacgag acgcagcatc tccttcactt tgctatcgac ctcggctttg    258720
     gacttgcgcc tgaccttcag ggggaatgcg atgttttcgc ccaccgtcag atgcggaaac    258780
     agggtgtagc gctggaacac catgccgatg ttgcgcttgt gcgaaggcgt gtcgagcaag    258840
     gtcttgccct ccagcgtgat gtcgcctttc gttggagttt caaaaccggc caggatgtag    258900
     agggtggtgc ttttgccgga tccggacggt ccgagaaagg tcaggaactc cccgcgccgg    258960
     acgtcgagat tgacgtcgtg gacggcgacg accgggccgt attccttgcg tattccgcgg    259020
     atctgaagga acggttcttt cattgtttca gtaccttacg cacgacggca accagcgcca    259080
     tcaagaggat cgtcaaaagg atgagaaggg tcgacgccgc agcgacaacg ggcgtcaggt    259140
     cctgccgcag cgttgcccat accttgacgg gcagcgtctg cagggtcggg ctggacatga    259200
     agattgccac caccacctcg tcccaggaag tcaggaacga gaagacggcc gccgaaaaca    259260
     gcccatggct gatcgccggc agggtgaccc tgatctttgc ttccagaggc gaggcgccgc    259320
     aaagaaccgc cgcgtcctcg atcgacttgt cgaagccctc cagcgcactt gagatggaga    259380
     ggatcgagaa gggcagcgcg agaacgaggt gcgaaatgac gaagcctacc aacgtgccgc    259440
     caaggccgat cctcagaaag aaggcataaa gggcgaccgc aagaaccacg acgggcagga    259500
     tcatcggcgt caggaacagt gctttcagcg catcgcggaa caggaacgaa ccgcgcacca    259560
     gcccgaagga ggtcacgagc ccgagcagca ccgacagaac agtcacgatg accgcgatct    259620
     tgaagctcgt ccaggccgat tccagccagc gcggatcggc aaagagctcg ctgtaccatt    259680
     gaagcgtcca gccgggcggc ggaaagatca gccactgcga ggagccgaag gagagcgccg    259740
     cgataaagac gatcggcatc agcaggaagg ccgcagtcag aagcgttatc gccagcaaga    259800
     tgtatttcca ccagccgaga cggtcgaaat tgagcaacat gtcaacgccc tcccggattc    259860
     tggttgccga cgaagcgcag ctgcacggca taaagcaaca gggtcaccac gaggagaacc    259920
     agcgccgcag caccgcccat gccccagttg accagcgact gcacgaattg cgcgatcagc    259980
     tctgcgagca tcatgttcga ggtgccgccg agaagcgacg gcgtgacgaa ataaccaagc    260040
     gacatgacga agaccatgag tgcaccagcc gccatgccgg gcattgccaa gggcagcaga    260100
     acacgggtca ggcactgcca ccggttggcg ccgcaaagtg ccgccgcctg cagggtagac    260160
     gggtcgatct tcctgatcac gccgtagagc ggcaggatga tgaagggcag catgatatag    260220
     gtcatgccga tggtcacccc ggtcaggttg ttgaccagtg ccaagggctt gtcgatcagc    260280
     ccaattccga tcagcatctt gttgatgagc cccgtgcgct gcaaaagaac catccaggca    260340
     taggtgcggg caagcaggtt ggtccacatc gataggagca ggatcgcaaa gatcaccgag    260400
     gttaggcgcc cgggcatgat tgccagcgcc caggcaacgg gaaatccgat cagcagcgaa    260460
     atcaccgtga cgagacctga gacgatgaag gtgttggcga agatcttcag ataggtcgcg    260520
     gacccgatca gctgcgcata gtttccaaaa cccggcacgg gttccagcac gctgcgcaac    260580
     aggagcactg ccaccggcgc gatgaaaaag atcgtcacga aggcgagagc cgggaggacc    260640
     ccgccgaaac ctgttgccct gcgcaccttt ggcaggggcg caattgcagc ggaggcatcg    260700
     ctatatgtcg acatgacagt ccttcccacc cgtcaatttc cgcaggcgcc gaggtccgac    260760
     aagcgggcac cgacactgcg ggggcacggc gaacattcgc cgtacccgtt catctcaagt    260820
     ttcaggctat ttcgcctgcc aggcgtacca cttctcgccg atggcatcgc gattatcagc    260880
     ccagtagttc atatcggcat tcacctggct ggccgtctgc tgatccggca gggtcttggc    260940
     cgtctccgga tccatcagct tggccgagtc aacgttgatt ggtgcatatc cggtggcttt    261000
     tgcaagggcg gcctgcggtt cggcagaagt cgccattgca atgaacttca tcgcggcttc    261060
     cacgttcggc gaacccttcg gcacgacgag cgaatccgca gcggtgatgt tctgttccca    261120
     tgaggtctcg gtcttgatac cgctcgccgc aagcgcggtc atgcggccgt tccagacact    261180
     gccgaaggga gcctcggcgg atgccagaag ctgctgcgac tgtgcgccgc ccgaccacca    261240
     gacgatatcc gatttgatcg tatcgagctt cttgaaggcg cggtcgagat caagtggata    261300
     gagcttgtcg gcggccacac cgtcggcaag cagcgccgct tcgatcacgc cgggagccga    261360
     ccacttgtag aatgtgcgct ttcccggaaa ctttgccgtg tcgaacagat ccgcccatgt    261420
     cttcgggcag gcggtgacgg catcggcatt gcagccgatg acgaaggaat aatagaagct    261480
     gccgaccgag taatcagtca cgaagcgcgg atcgagcttg gatttgtcga tgaccgagaa    261540
     atcgagtttc tcgagctggc cattcttgcc ggcctgggcg gcatagtcgc cttcgacgtc    261600
     gacgacgtcc caggtgacct ggccagcctc gaccatcgcc ttgagcttgc cgtaatccgt    261660
     cggcccgtcc tgcacgacgg tgataccggt cttctccgtg aacgggctgg cccatgcggc    261720
     cttctgcgcg tcctgggtcg ttcctcccca gctcgagaag accatgttgt cggcgtgcgc    261780
     cggtacggac acagccacga atgcggcaac cgccgcgaca gcaaatgttg ttttcatgtt    261840
     cccttatcct tgttctggtt tgtcctacgg gtatgcctta tgccgtcagt gcgcctcgct    261900
     cctgggagaa aagttggctg gcttcataat cttgttttcc gccacttcga tcagatcgcg    261960
     gatcttgggc aggaaggcct gccaccgggg atcggccaga agcctctggc gcctcgcctc    262020
     ccggtcgtcc aggctcgcaa aggcccagat gtgaacgatc tcgttgatcg ttccgatctc    262080
     cgaaaagaag taaccgacga gcgtgccgag atggctcttc tggatttcga tcccctcttc    262140
     ctcgacgacc ttgagatatt gcgggatggt gccgttcttc agccgatagg tgcggatttc    262200
     gtaaaacatc ggcgctacct catcacgaag ggatcgggga tcggatcgtc cgatgtcctg    262260
     agccagatcg tcttggtgcg ggtatagtcg agtgctgcgg ccatgccgcc ttccctgcca    262320
     tggcccgaca ggccgaaacc gccgaacggc gcgatcggtg ataccacgcg gtaggtgttg    262380
     acccagacga tcccggctcg cagccccttc atcagccggt gcgcccgggt caggttctgg    262440
     gtgaagacgc cggaagccag gccataacgg gtatcgttgg cgagccgcag cgcctcggtc    262500
     tccgtctcga atgacacgac ggacaagacc ggcccgaaga attcctcgat gagcgagggc    262560
     gaggcgacat cgtcgcagtc gagaatcgtc ggtgggaaat agtagccgtc gccgtcgatc    262620
     ttgcgccctc ccgtgacgag gcgggcgccg ctttcaatcg acttggcgac gagggcgccg    262680
     atattgtcct gctggcgctt ggtggcaagc gggccgactt cggtcgccat atcgagcgga    262740
     gcaccgatcc ggattgcctc cgccttctcg cgcagcaggg cgacgaattt gtccttgacg    262800
     ctgcgttcga cgatgaggcg cgatccggca acgcagctct gccctgtggc ggcgaagatc    262860
     cccgcgacct gggcattggc agcgctctcg agatctgcat cggcaaagac gatgaatggc    262920
     gacttgccgc caagttcaag cgaggtggag gcgaggtttt cggccgagtt gcgaacgacg    262980
     tgccgggcgg tttcagggcc gccggtaaag gcgacatgcg caaccttcgg gtgccgtccg    263040
     agggcggcgc cgcacgacgc gccgaaaccg gtgatgatgt tgacgacgcc ggcgggaaag    263100
     cctgcctcgt gcacgagccg tgcaaattcg agaagcggcg ccggcccgtc ttccgaggcc    263160
     ttgaccacca tcgtgcagcc ggccgccagc gccggtccga tcttcaccgc agacaggaag    263220
     agctggctgt tccacggcac gaccatcgca acgacgccga tcggctcgcg gcgaagccag    263280
     acatccatgt cgggcttgtc gatcggcagg taggcgcctt cgatcttgtc ggcgatgccg    263340
     gcatagtagc gatagtattc ggcgacataa gcgatctgag ccgatgtttc gcggatgatc    263400
     tttccggtgt cgcgcgtctc cagttctgcg aggatctgcg cgttagcggc aaccagatcg    263460
     gccagcttgt aaagcagctt gccgcgttgg gtggccgtca gtttcggcca tgggccatcg    263520
     taaagcgccc tgtcggccgc gttgacagcc cggtcgacat cggcctcgcg cgcttcgggc    263580
     atatcagccc agaccgcgcc ggaggcgggg tcgatgctcg gatagctggc ctcgccatct    263640
     gaaaattcgc cgtcgatata gtgctggaaa cgccgcatgg tgttactcct gaaatgccgg    263700
     catgacctcg gtgatgaagc gttcgagcga cgccttcttg cgctcgaagc tcatgccggt    263760
     gtcgatccag aaggaatatt cgtcataacc gagtgcttca tacgccttga gccggtcgat    263820
     gacggtctca gcatcgccaa cgacgttgtt ggtgcgcatg acctggtccg acagcatcgc    263880
     gtttgctctg atctggtcgt ccgggatccg ttcgatcaga ccctgggtaa ccggcttctc    263940
     attcttgaac caggcgaaga aataattgta gtagacgctg agctcatggg cggcctgagc    264000
     gacatcgtcc gccgacgagc cgacataggt atggcgcagc aacatgatct tgggccgctc    264060
     gatctcggga tgcttggcgc atgcgtcgtt gaagcgctcc atcaacgact gaacctcgtc    264120
     gtcgccttgc cagaggggcg tgacctgaac gttgcagccg ttggcgacgg caaattcgtg    264180
     cgaattcgga tcgcgcgctg ccacccatat gggcgggttc ggctgctgca gcggtttcgg    264240
     cgccgaggtg gtcgacggaa acttgaagaa ttccccgtca tgggcgtagt cgccggccca    264300
     tatgcccttg accgccggga tgagctcacg catgcgctga ccggcacccc aggcatcgag    264360
     accgggcaac agacgctcgt attcgaagga ataggccccg cgcgcgatac cgatatccag    264420
     ccttccgtcg cagatgatat cggccatggc cgcctcaccg gcaagcttga tcggatgcca    264480
     gaagggggca atcaccgtcc ccgttccaag ccgtgcccgc gatgtgcggc gtgccagatc    264540
     ggcaatggtc acgaacgggt tgggcgcaat ggtgaaatcc atgccatggt gctcaccggt    264600
     ccagatcgcg tgcatgccgc ctttgtcggc gatctcgcaa agcgcgacga attcctcgta    264660
     gaggctctta tggctttggt tggcgtcgag ccgctccata tggacgaaga gggagaactt    264720
     catgcttttg cgtccttggc tggaattggg tgaacagtgc cgccggtctc gtcgccgaaa    264780
     tagacgccga aattgccgat cgagctttcc atcgcaaaac ggttgacgat atcagcagtc    264840
     gaactggtct tgaactttgc cgcaaccaat gcgtcaggct tcaggaacct gccgccggca    264900
     ggctcgccct ctccggcaac ggcgtgatag acgatgtgct gcttgccgtc gctcttgccc    264960
     tcataaaccg aatagagaaa gccgatgctg accttcaacc cggtgagcgt ttccaggtat    265020
     ttttgcagcg tctcggtcgg actgccgtca tgggcatcga cacctggcag ggagagcaaa    265080
     tcttcgccga gcagcagaac cttgccgcgg cgttcgacaa cggctgcaag ttccatattg    265140
     ccttcgcttg ccgcggacac cgccttgctt gcgagcgtcg gcgtgaaata accgccacgc    265200
     gcatagccga gaccgttgcg gccgctattg tcgaaagctt cgatgcgccc catcaagatg    265260
     acgtggtcgc cagcctcgat gacctcttcc atggcgcatt cgaaccaggc cgcaacgctt    265320
     gagaatatcg ggcagcctgc cgatcccttc gcccactcga ccgccgcaaa cctgtcctcg    265380
     accgggcgtg caaaggtgtt cgacacgtct ttctgcgttt ccgaaagcac gttgatcgca    265440
     aagtgctgtg ctccggtcat ggtggcgaaa ttgcgcgacg acttggcaag gcagacgagc    265500
     agcaaaggcg gattaagcga gactgaggtg aaggagttcg ctgtgaagcc gatcggattt    265560
     ccatccccgt cacaggcggt gacgacagtc accccggtcg gaaaggcccc gaatgcatct    265620
     cgcagtgctc ttgggtcgac agtctggatt gtcatcgttc atcctccccg aacgacagcc    265680
     actcagcgag cagcgaattg acgatatcag gcgcggtcag gttcaccata tgacgatggc    265740
     cttcgacgat gcgagcgtag ccctgcggcg caagctctgc catttgcgtc gccatcaagg    265800
     gcgtcgagtt cggatcatcg gaccccgtca gaaacagggc cggaccagcc acgtctttcc    265860
     agccgttggc ataggtctcg tctcctcccg caaaggcggc gtaagcgacg gcatagccct    265920
     ggggatcaac gaggttcagc cattttcgcg tcaattcacg cgcagtgacg ctgtctgcat    265980
     catcgccgaa ccagcgggcc agagggcctt ccttgtcgac gcccgatacc ggaatggccg    266040
     cggcgcgcgc aagcacggcg gcctttgctt caggatcacg cctgtagacg ccgttgaggt    266100
     aggcgacgcg gctgatccgc tcgccaaagg tcacggccgc ccctcctgaa accagtgcgc    266160
     ccatcgagtg tccggcaaca tttgccgtgt cgattgccat ctcgtcgaga aagcgtccga    266220
     accagtcgac gaactcctcg agccgactgc ccgccggcaa ctttgcgctc tcgccatgtc    266280
     ccggcatatc gacggcgatg acgcgatggc ccgcagacag gaatgcgatc tgcggagccc    266340
     aggcctccag ccgcatgccg acgccatgaa tgagaaccag cggctcaccg ctgccggcct    266400
     cgtgataggc cgttccgctt gccgtccttt ttcggggcaa ggcaccggcg gcgtttgttg    266460
     ctgcagcggt gcgtgtggtc gatccggccg tcagcatctc agagcgctcc ttcaaacgcc    266520
     cgcaggattg gcaacgtcct gccccaggtc tttcagatcc tggtagcggt cgccgatgcg    266580
     gtgatgcggg cgcccgccta tcgaagcacc gagagccacg acgatctcgt cggcagcagg    266640
     cgcgtcgggg atcgacgtct ggatggtcag gtagtgcgaa cggcggcctt catcgttctt    266700
     gtccatcagc gggatcatga tcggcgcatt ggccggaccg cgtgtgttgc agaaggcgag    266760
     ataggacttg gcgccgacgg cctggcgata gaaattgccg aaacgcagcg tgtggataag    266820
     cgcggacccg tgttcgattt cgccgtccag gccgacgaca gcggactttc catatccttc    266880
     gacagcttcg ccggacccga ccgcatcgat gatcatcttg gtcagcaact cgccgagcac    266940
     cggagcgcct gcgtgaattt cgggcttgag gtcgtcgacg aagccgcgac cggcccaggg    267000
     attcttcacg accgcgaagg cggtaaacag cttcagcgga accgccgcgg ccttgccgcc    267060
     ttcgatcagc gtcgtttcga tctgcagtcc cgtcttgcga atttgaatgg ccatcgagca    267120
     cctcatttct caatttcgta ttatggtata ccataatata tgattgtcaa gttggttccc    267180
     tcgaggagca gtttaggcca aggcgagttt ttcgatttgc cgcgcgtgcg cccttcgacc    267240
     caccgggcag cgctttcttc ccgtcagcgc gttgtcagct gacaaacgac atggcggcgc    267300
     ccgtggaggc aggccgagtg cagaagtcac ggtcatccca gtccatgcta ccgccttaca    267360
     tattacttaa tatggcatac catcacattg gacaaagttg ggtgtcaagc gcggagtatg    267420
     ggttccgcta aattgcgcgg aacatcatcg cgaatggagt aatatcgaca gctgagatga    267480
     gcgctttgcc aggcctgcgg ggaagcggca cgggccgctc gtgcctagtc ggcaggcttc    267540
     ttccccgaca gcaccgcttc ggcaatcgcg ctcgcggcgg cgacgtgatc catcgccgcc    267600
     cggtaagccc cctcgccgtc gccgcggcgg atggcgtcga cgatcttcga catctgcagc    267660
     gggccttcga tgccgcgtct ctccgtcttg atcgtcatcg agcgcaggtg gttgatgcgc    267720
     acggtgagaa gattgacgac accccaggca acgttcctgt caaccatcgt gaacagcgta    267780
     tgatagaagg aagaggtgtt cgtcagcaca gccgccatat cgttatcgcg gtaactgttg    267840
     cggatcccgg ccagagattc ctcaagcgca gcgacgatct cggggctgcg gcgctccgcg    267900
     cacagccgcg ccgccatgcc ttccagcgcg ccacggatct catagatctg cttggcctcc    267960
     ccgatgtcga gctgcgcgac gatcggcccc ttgttcggca gattggcgac aagcccttcc    268020
     gattccaaat gcctcagaac ctcgcgcacg actgttcggc tgacgccgag ctgggcgcag    268080
     aggtcacgct cgacaaggcg atctccggga cggaaatatc cgttgacgat ggcttcgcgg    268140
     accttgtcga gcgccaattc ccgcaaggtc tttgcaggac gctcgactcg aattgcgtcc    268200
     tttagagcgc cgctcattct gtacctcagt gttggacttt gcacgctcaa cttccgccgc    268260
     ggcagccgaa tgcaagaatc gtattatggc gtaccagata ctgtagctgt cggcggccgg    268320
     caattcaaca agcgctgtgc cgacctatag cgccgctcgc cttttcagac gcgcaaagga    268380
     cgttgcagca cctttgatct gctgccgacg cgtcgggagc tagcctcttg aaacgatctc    268440
     ttcgaccacg gccttggcct gcacccggat atccggaacg gcggtaatct cccagaattg    268500
     ccccgccgtc agggcaccga ccgcaaatag tcgggccggc gatatccggg acggggctat    268560
     cacctcggaa gcggaatcca cctggagccc gaggccaaga ggatcggggg caatcaactc    268620
     gaagcggctc atttccttca aaagcggtga atgactgatc ccggcccgct ccattcccgt    268680
     gcaattgacg agccagtccg ccctgatctc ggcgatctcg cgcgccgctc tgaccctgta    268740
     gccggcaacg agccggccct cctcggcccc gagcgatttc aggaagcctg cgtggaaacg    268800
     aacagttccg tctaagacca gtgtctcaaa cctgtcgaac acgtcaggcg cgacccggtg    268860
     acgatggatg ttccaccagg gaagcgcatg cctgaggaag cgtgcccgct ctttgctcga    268920
     aagccgttgc cagagagctt gcgttgcagg cctcagaccg tccatcacgg ctcgccagtc    268980
     ggcaaccgtc ctgctctttc cccgcagggt cttcaatatg ccgctaatgg tgtccggaag    269040
     cttctcaacg tcgatcggca gaggcgccgg cggctttcgc gcatgtccga ggggtgcgag    269100
     cccgcgccgc gaaagcacat cgatcctgcc acggtggcca tgggcacgaa gcgccagcac    269160
     ctgatcgatc atcgtcaggc cggatccgag gatacacacc gcatcggatg gtgcaacgcg    269220
     cctcagccac gaaagccgcc acgggttctc gatgatccgc gatcgcagcg atggcggaat    269280
     tccgtccgga gcgaccggaa gggtcgcgtt cccgacgccg aggcagagca ccacggtctt    269340
     cccggcaatc tcgtcaccgt tgccgagatg gaaggccagc gtgctgctgt aacgttcaat    269400
     gcatcccgct gccttagcct tgatgaaatc gacccggcaa cggccgtccc gctttcgaag    269460
     caaccgtgca agcgtatcgc ggacataaag accataatcg ctgcgcgagg cgaaatcgcc    269520
     ggcctgcaac ggacggccat ggcttttaag ccagtcgaca aagtcgtcgg gttgatgcgg    269580
     caaaaggctc atgcggccgg ccggaacatt gaggcgatgg agatagagct ccgtccggta    269640
     agccgtcccg cggccgaaac caggatcgtc gccgacgacg gcgaccttcg ccgaagcggg    269700
     aagctgctcg atgagattgc aggtaaccgc tatcgctgaa aaaccggaac cgaccacgat    269760
     aacatcatat gccaaataca ttctccctga agctcagagc gtcatcgaga tatttcgtca    269820
     ttcaagccca atgtcgctcg ccggtccctg ttgatcgcac aagcggcaga atcacgaaac    269880
     aattatctct attgtctata aatatagttt gttatttctg cgtaaaaaaa gcggccgcac    269940
     ctaagatgga aaatcccctg ccgggaccgt gtctcaccgg cagcgcaagg cttgtttcaa    270000
     tcgaccactt gatgatctag attctggtcg aaagggagca agtgaatgaa gctgtcagaa    270060
     caggtcaagc cgatcagcta tctcaaggcg catgcgccgg aggtcatccg aaagctgaag    270120
     gataatccgc agccggtcgt cattacgctt cacggagagg cgaaagccat ccttcaggat    270180
     atcggccaat acgaagaaac acaggagacg ctggcgcttc tgaaggtgct ggcgctgacc    270240
     aaccggcagg tcgaggaggg caaactgcgc cccgctgcgg aatccttcgc gcgcatccga    270300
     aatcgtctgg ctgacagcca accctgatgc catctcgtgt tcatgtcgcc gaggacgccg    270360
     aacgcgacga tcgctatcgc ttcatcgcta gcgcgacgtc gccgagacgc cagggcactg    270420
     acggaaatcg agagcgcatg cgccggcgga aatattccga aggagttggc ggggatcgga    270480
     atttccgaat atcgggaact acaccataag ccgtagcgca tgatctatcg cattatgggc    270540
     accgatgtcg tcggctactg cgtcgtagac ggacggcgcg agatgcgaag cattctcgag    270600
     cgaaggctca tccgctgacg tccggcatat cgtacttcag cgctttggat atccaagctg    270660
     ctttacttga gctgaatcca gccctcatga ggcttccagc gccattcccc ttccacaggc    270720
     tgcgtcagcg gcaataggaa gcgtccgaga tcagtgacca ccgtgcccaa ggcgggtggt    270780
     gcggccgcca tccgttcgcg accaaggaac gcccgccatt gccgatccag acctcagcat    270840
     aggcttcgct gagacccgtt ggcccctccg tcggaatacc cgtccctcgt ctcgcaaagg    270900
     tctggcgcac cgcctcagcg agggtggacc gctccaactc gaacgtctcg gcaatcagcc    270960
     agagatcata gaaatccttc aggcggctat ttgccatgcc gagcgatacc agcgcctcga    271020
     atttctcggc gaccacggtc ccgaccggat aggcccgcag gcgcggcacc ggcgcatcga    271080
     gcagcgacgg atattctatg tcgaccggtc caggcgtgac ggcgtcaccg aaacctatgt    271140
     ccacctgaat gggaatgcgc gcgcctccga tggtggcagt ggtacggaca cgaacgccgc    271200
     catattcgac ttcctcacgg atcggcgcgg ctgcgagtgc atccacgtcg aagactacgc    271260
     catcagcgtc caccggctgc gtgcaaatgg catggaaagt ttcggcgatg gccttcgggc    271320
     tgttttcgcc gtagcccagc agatcgaggt cccgcgtcgg ccgaaacggg tcggcgatcc    271380
     aggttacgaa cagcatcgcg cccttcagga taaagcggtc gcgatgctcc gataggctca    271440
     gccggtacag gagtctttcg agcgcgtagc gcgtcagtag gatctgaaag tccgtacgct    271500
     ctgcgcgaga ccgatccagc agccgggcgc gcaccgatgc ccctacgttt ttcttgagtt    271560
     cacgcgccat cggccaccgt cgcttcgaca tagggtcgca tgatcgacca gatcctcgcc    271620
     tctttcgcat atgtccagag gtcgtcgctt gtggtcttgc gccgacggag cccctcgcgc    271680
     agcccctcca tcgcaacgtc gaggccgact ttcgcccgat agcggaagca atcgacgatc    271740
     gaacgcgccg gatttgtgat cggcacctcg acgccctcga tgcgatgccg ttcgacgccc    271800
     tcggtgagag cggacccctt gaagcgtacg aacttgatag gcggataatc gatcttgggg    271860
     cgccaggcag tgcggtcgat cgccatccac acagccgagg gcatctgcag cgtcagttcg    271920
     tggtattgga gggcggaggt caagcagacc acgccctttg gaaccagaac agccgcttca    271980
     gcgagtgcat gggccgcctc agcctgagtg tccgggagtt gatacaggcc tcgtgccggg    272040
     cggacgactg cctcctcccg aacgagacgg gcgagcgtct ccggtccaat gccttcggca    272100
     acgaaatcct tcagccggag catcccccgc gctttcagga ggtcgagcgc tcgaagtctc    272160
     tgggcggtag tgaatgtcat cgcctgtgac gattcctcca ttcatcgaat atatagcaga    272220
     ggttttatca caaagccgct tgctcggaaa tcccccattt cgacaccccc tacagcgcgc    272280
     tgtggaggcg aaggcggcga gcattcacgc aaaggcttat tctgcaaggt ctggtgctgg    272340
     ggccagagct tgacgcggag gcgcggaaat cggcctctat ttcgtcaccg tcaccgtcac    272400
     cgtcggcgaa agccggaggc tggcccagct gtgcgcgtga aacgcaagca gatcaagaag    272460
     accgagccga tccgctgcat catcgacacg cagaacgatc cggccgaaat caaaaaagac    272520
     cacaggtcgg tgatggaact ctacatcccc aatcccaaac tcttcgtgcg cgaaagggac    272580
     cgtttcaact ccatctgctg ggtgagctcg gcacgatgac tacgatcggc aaggcgagca    272640
     acctcgcgga tacgctcgac gtcaccagcc cgatccggtc ccactcgctt cagctgatcc    272700
     gcgagatctg agggatcggc gcgaccgaag cgcgtttcga ttgcgctgac gatatccttt    272760
     gcctcggcaa gcgcctgacg gccctccgat gtcgccgcca gtcgttcgac gaactttgcc    272820
     ttgtcgctat aggggagatc atcgagattg cgcagcaacg cttcgctccg gcggctcggc    272880
     cccagaacct cgacgacgtc ctgcttttcc cgcttccagc gctccgagcc gcattcagcc    272940
     gcaaggcgac gctgccaggt gttggcggat tggcgaacat gcgaagccag cgcatcgatc    273000
     cgggaaagcg cgtgtttgcg ttcagcgttg tctccgaaca ggccggtctt gccggcgagc    273060
     gcaccgatcg tctcgggcga agtgctgatt tggttggcaa gcgcgaccgg atctgcattc    273120
     tcatccagga tccggccacg caacacgtcc atggccgctg gcgcgtcctt gaacacctgc    273180
     ggcgcaagct gctttgccgc ggcccaatct cgttcgaatg ccggcatcgc ctttgcccgt    273240
     ccaaccgctt cgacactcat cgcataagtc ttcacggccg caacgagcac gcggcgttca    273300
     tcgtcacgtt catcgacatt gggatcctgg tgcgaagagc cgccatcggc gatggtgcgc    273360
     gctgcgagcg gccgcggttc ttgcattggc ttgggaaccg ccgtgtccgg gatgggctgt    273420
     atccctttgc tgattccctg agatgcgacc tcactctcgc cctgcccccg gcggtcgttc    273480
     atgccgcgcc gattggcaaa gtcatgggta tagtcgagcg tcgtctcctt gacgcctgag    273540
     cggctcagtg tctctgtcag ggatcgcaca gtcttgaacg catcgaggct ggcatagagc    273600
     tgcacctcct cgcgatgacg ggtcatcgcc acgtaggtca gatgccggtc catcgtcgtc    273660
     gacgccagga caaaactccg gtcgacggta gcgccttgcg tcttgtggat cgtcgttgcg    273720
     tagccgtgat caaaggattg gtaacgattg accggtacgg tcacctggcg ttgcccatct    273780
     tgcgtctgcg ccttgccgtc aagccgaact tgtattgcgt ccggcgcgac ggcgatcacc    273840
     tcgcccaaca tgccattctt gacggcgaga tcacgatcgt tctccaggaa gacgatgcga    273900
     tcgccgcgtg cgaaggatcg cttcccattg ttggtctggt aggtgagttc ctcaccacga    273960
     tcatccgagg tgccggtgct tcttgagagc tcaccgcgct cctgcaaccg agcgcgaatg    274020
     ccggcattga tggcacggac gtcgtcgcgt cgatgggcca tggcaatgcg cgtgtcgttg    274080
     ggattggccg atcggtcagc gacgtaatcg gcaatgatca ccttcagcgt ttccgcgcga    274140
     tccgtcttca gatgaacgct tccccgtgcc tcgtaggccg acaacccggc tgcggtccga    274200
     tgcgaggcaa agtcgatcga agcctgcttt tgccaatcgg ctttttgccg gcgcacttcc    274260
     gaaagctgcg catggccgac ggcttccgcg atcgcccgaa acggcgcgcc cgctccgatc    274320
     gcctgaagct gttcatgatc tccgaccagg acgagcttgg cgccggcccg tttgacctcg    274380
     tcgacgaagc gggcaagctg acgacttccg accatgccgc cctcgtcgat gacgaacacg    274440
     tcacgagcat tgagccgacc acgatcagcc tgccagctgt attcccagga cgccaaggtg    274500
     cgacttgaga tcccggacga ttgctccagg ccttccgcgg ccttgccggc caatgccgcg    274560
     ccatgaacgc gataaccttg cgcttcccag gcgtgccggg cagctgccag catcgtgctc    274620
     ttgccggcac cggcaaagcc gatcaccacg gcgatctgcg aggcgccggt gacatgctcg    274680
     atcgcctgac gctgttccgc cgatagtccc tgcccgggtg aaggatttcc cgcctggatc    274740
     gatctgtcct gatcggcgat ggccgcatcg acatagcgct tcgccacacc gtggttttgg    274800
     cgcgccttca tcgcaacagt ggctgttgcc atcgcaccct cgatcgccac catctcgacc    274860
     gtcgaatagc gtgcctctcc atcgcggccg cgaacactcg aactgtcggg cctcagctcg    274920
     acgagggcct tcgacgccat gaccgatgca aaggcgttct ggaaggtctg cggatcgtca    274980
     ttgatggtgc gatgcagagc cctggcaatg tcatagcggc tgaagacgct cttctcgttg    275040
     gtaatcagct tcaagatctc ttcgggccgc cggcgaacga tctcggcatt gcgatcggcc    275100
     gattgcggtg agatgcgcac gcgcgagact gccccaccct ggcgatcgat ctgagtggca    275160
     tgcacaccga catgttcgct cggctcgatc gtgatcccgg cttccagatg cgagcgatga    275220
     tcgatgcgga tatcgtggcc ggccctctca aggtgctcgt tggcaagatg ctcccacgcc    275280
     tgtctgagat ccttcagctg cagttgcgat ggcggcaggt gattggcgag aagccatctg    275340
     ttttcccgct cgagcagcgt cttgtcgcca aggccggttt ccctcacctc acgcgtcgtc    275400
     atcatcagat gcgcatggct gtttctgatg tcacttccct cacctggccg atggatcgcg    275460
     aagtcgacgg cagcgccata acgattggcg agatcttcgg caaaggcccg cgtcagcacc    275520
     aggcgttgat ccggcgtcag ttcgtgcggc agggcgattt cgaattcccg ggcaatccgg    275580
     gcgtcactgc gtttctcggc acgctcggcg gcattccaca aggccgatcg cttcatcgcc    275640
     caataggcgg aagacccagc cggcaagacg atctcggcat gctcgacacc tgtcctgttg    275700
     ctaaaatcat gggttagccc atcacgctcg ttcgtcagcc gctcggccgc acgataggcg    275760
     gcggacgcga cagcgctgcg gccaccgctg cgagcgatcg gcttcatgct gagatgatag    275820
     atcgccatcg cttgtcccct ttgttagcgg gctgccggcc cgcgctttga gttgcccggc    275880
     aactcgtaag tgcgcccttg tgccttcgtc gcttcgcgcc ttcgggcact ggtgggagca    275940
     cgcggcaatc tcccgatgac ctcgtaagcc gttcatcccg tcgcttccac gcgcagattt    276000
     gcgggtttcg aagtgctgct cttcgagaca acctcaatcg aggcacgccg gcggctctga    276060
     tcatccattc attgccgcgg ccaatggctc aatgggaaca agggagaagt catcatggcg    276120
     cgcaaaacca tcggcgagcg gctcgcccag ctggaggccc agcgaaagac attgcagatc    276180
     cgtctcggca agcaggagcg cgccatcgat acgcgccgca aggtgctgat cggcgcactg    276240
     gtgctgcatc ggctcgagca tgaccgcgat gtgcattttg caggcgggat cgccgagtgg    276300
     ctgagacggg aactgccaaa attcctcacc cgcgatggcg accgggatct gttcgacgat    276360
     ctgctgaagc cgcaggcaaa tgagccgact atcggcgata tcggcaacgg gagtgcaaca    276420
     tcatgatcca tgccagccag atcaaatctg ccttcgcaaa catgatgcgc atggcggtcc    276480
     gcgatccgct ctgggcgatc gtcgcgttca tcacctttcc gcttcgatat gccaggtcgt    276540
     tcctgaaggg tgcggtcggc tatgtcatcg tcatcgttac cgtctacttc gggatcgact    276600
     acctcagacg cgtgatgctc ggcggccata ggggtgacgt catctggcat atcggcgact    276660
     gggtattcat gctttttgcc gtcgtgctgc ttatccggtt tttgtccgag ccgctgatca    276720
     cacattttag cacagcgagc gacgccgaca cgcacgggac ggctcggttc ggaggtacac    276780
     gagagatcgc accgctgaca aaggcagaag gcggattgct gatcggccgt gcgaacaact    276840
     ctggccggct tcttcgctat ggcgggccgg ctcatcttct gaccatggcg ccgacgcgca    276900
     gcggcaaggg tgtcggcacc atcatcccga accttctgac cgccgaccgc tcgatcatct    276960
     gcatcgatcc gaaaggcgag aatgcgcaga tcgcaggtga tgcacggcag aagttcgggc    277020
     cggttcatat cctcgatccg ttcggcatca ccggcaaacc ttcggctgcc ttcaatccga    277080
     tgaatggttt taatcctgcc ggcatcgatg ttgccgaaga cgtctcgaca cttgccgacg    277140
     cactggtgtt cgacgaaccc ggtctttcgg gggacgccca ttggaacgag gaagcaaagg    277200
     cgctgatcgc tggattgctg ctgcatgtgc ttgccagcca gccagacgac aggcgcacgc    277260
     tgacgatgct gaggcacttc ctgacgctgg caccggaagc cttccgtgcc gtgctggacg    277320
     agatgcaggc aagcgacgcg gtgaacggac tgattgcccg tgctgccaat cgccatctcg    277380
     gcaagtcgga tcgcgaagcc agcggtgtgc tgtcggcggc ccagcgacac acgcatttcc    277440
     tcgacagtcc gcgcatgact gcggtgttgt cacgatcgga tttccggttt tccgatctta    277500
     aggcaaacaa ggcgaccgtc tttctggtct tgccgccaga cagacttgcg gcctactcgc    277560
     gttggctgcg tttgctggtg gcccagagcc tgaccgagat ggcgcgcacg gcaccctcgc    277620
     cgcaaccatc tgcgccacct gttctctatc tgctcgacga gtttgccgcc cttggtcatc    277680
     tggcgccgat cgaacgggcc atgggactga tggcaggtta cggagtgcaa ctctggccga    277740
     tcgtccagga cattcatcag ctgcgcgcca cctatggcca gcgcgccggc acgtttttgt    277800
     ccaacgccgg cgtgctgcag gtgttcggcg tcaacgatca cgacagcgcc cgtctggtat    277860
     ccgatctgct tggccaggag acggtcgtct tcaacacggc ggcacgcgcg ctcgattcgg    277920
     aaaggaccgg cctctccttt gccgagcagc atgtcggccg gccgctgctg acgcccgacg    277980
     aagtccgcaa tatgcatgcc gagaccgagc tgctcttcat cgccgggcag cggccgatcg    278040
     cggccgtcaa gctgcgatat tatgccgacc cggaatttgc cggattgttc accgcgtcac    278100
     agatctgacg aggcgatatc accaacgtga atcgatcggg cctcatcgat tcacaaatgt    278160
     cgttggacgt gagcaactgg tctttgcgat tctgcccgca tgacagctca gccctatcgt    278220
     ctctacatcg aacgcatcga tccatcgaag aacatggctc gcttttatgc gctgtcgatc    278280
     gagccgaacc tcttcggcga gacctcgctg gtgcgcagct ggggacggat cggcagccgc    278340
     gggcagcaga agatccatgt cttcgacagc gaggcaaaag ccgtcgatct cctgctcagc    278400
     cttttgcgca ggaagcggtc gagaggctat cgggtcctgc agtgatcggc atccgcgtct    278460
     ctcatgtctg agcgaaagag gagacagttg agaggaggaa gagacggctc acgccgccgc    278520
     ctcctcgtcg agttcgggct gcagggaatg cagatagtcg acggcgcgct gcgcatgtgc    278580
     tgccgccgag aagatggcgc gcttgtcgtt ggccagaacc ttcagccagc catcgagata    278640
     gcgtgcgtgg tcggggcgtg gttcgagctc tgggacgatg ccgagatcgg cgcagagaaa    278700
     cgcgctgccg agttcggcaa tcaactcctc gcgggcacgt tcgctccggt ctttcgcgta    278760
     gcggctgaga tcgcgatcaa gccgtcgcgg tgcggcggtc cagtgcgtca tctcgtggct    278820
     gaggatggcg acataggaag catcgtccct aaaggcatcc aggcatggca tctggatgta    278880
     atcacgctga ggggcataat aggcagccga tcctccgtgg cggatcagcg ccccggtatt    278940
     ggcaaagaag cggccggcat tgccgatgcg gctcatcgga tcctggtgag gggccatctc    279000
     gtccaagcgg ccgttaagac cggcgatctg atcggtgttg aacaccgtgt aggtcttgag    279060
     gaatggaaca tcctgttcga tctcggtgcc cgtctcggtc gtctcggtgc ggatgaacga    279120
     actggcaaag acgacggtcg tgccggtttc gcccttgcga acggcgccac cgagttcgat    279180
     ggcctggcgg aacgtcatcc agcgagatga ggcaaagccg cgggcgatgg cttcggacca    279240
     cagcaacaga acgttgatcc cggtgtaggg ttggccattg tggcgcagtg gccggctgac    279300
     ctcgcttgtc gcatgccccg tcgtccaggg tttggtccat ggccgcacgc cccgttcgag    279360
     atcggcgatg atcgtgttgg tgatgcggct gtagatatcg gatcgttgat tggattgttg    279420
     cctgctcatg ttggaacctc cgtttcgagg tcgcggccat cgcgacctgc tacggcggtc    279480
     cgaaagccgg gctgcaagcg ctgcctgcac cccgcggggc cgcaacgaag tggaggacgg    279540
     cacagccgtt gccggcggcg cgagcctggc aggaccaaaa gccggggcag gacgcgatgg    279600
     ccgcaatcgc aggggaggtt ctgatggagg cagacatggc aaatccgcga ggggatcaca    279660
     tcgctcgcgt cacagctgac cgcagcgcag atcgtttacc tggcgggccg tgccaatgac    279720
     ctcgcgatat cgacaatgtc gtcgcgcgag gcggttggat cctctttatt ccaggcgaca    279780
     ccgagcccga tccggaagtc gatgcctctc accgccttca gttcgaaggc cctgttcggc    279840
     aggccctcgg tccattccgg cgcaaagccg atgccaagcc cggccgagac cagcgacacc    279900
     agcgaatagg tgtcgtcgca gctataagcg atgttgcggg tcagatcgta ctcctcgaac    279960
     ttctcgttga agtaccgctc ggtataggag aggttcttgc gattgaaggc gatgatcttt    280020
     tccgagcgta gatcgtcgat ggcgatctcc gcctgctccg ccagccggtt ggtcctggcg    280080
     accgccagca gatagcgctc atgggcgatc gaggcgaagc gcaacgagcc gatattttcc    280140
     accggtctaa tgaagccgag attgatctgg ccgttttcca ggccgcggat gatgtcgccg    280200
     gtattgccgc ttgatatatg gatgcggata tccgggtact tgcgggcgat cttcgccaga    280260
     aacgccggca gcacgccggt ggtcgccgga tagacggtac cgatcctgat ctgccttatc    280320
     gtcttgccgg ccaccgccct ggtgatctcg gcactcagat cgacctcgct gaggatcccg    280380
     acgcagcgct cgtggaagat ctcccctgcc cgcgtcagtt ccacccgcct ggtcgaacgg    280440
     atgaacagcg cgcagccgag ctcgcgttcc agcgcctgca catggttgga gagcgccggc    280500
     tgggcgatgc gcaccttggc ggccgcccgg ccgaaatgca gttcctcggc caccgcgacg    280560
     aagtaggaga gctggcgtag ttccataggg tccttcgacg aagcgaggcg gatagcgccg    280620
     gcatgacgct ttctcgcttt tgtagagtat actccgtagc ggaatactct acaagaggtt    280680
     ctctcgctgt catggagata cgcgagacct tcgctcgaaa tttgagaact cttcggcagg    280740
     cgaggaaaat gtcgcaggag gagctcgccc atcgttccag cgttgatcgg acctacatca    280800
     gctctctgga acgatgcgtc tacagcccaa gtattgaggt gctagaccga ctagctgccg    280860
     tgctgggtgt tgagcctgct gacttactta gaaagctagg taaggaatag cgagcaaccg    280920
     cgcggcgacc ttggtattct caacgcgatc gccgccctag cctgctgcga aagttggctt    280980
     tcgcggcgta agcagattta tggaacttgg ttggttgaac cagatgctgt agtggggctc    281040
     ggcgcgagtc gtcgcggttc aggcttgttg cgaaggtgga ggtgagttgt tgttgatctt    281100
     tgcgtgatgg cgtgtcggcc gggccttgcc cgccccgtca tcgaaaactt agagtgtact    281160
     cgcgcaccac gaaattcccg tcctgatttg ggaacgtacg cgcgatgttc ccttcggctt    281220
     tcgccgacaa tgccaagtgc ttcgagtgca tttgtctccc tgcagcagtg tccggcacgc    281280
     ccagccgctt catctcaatc gcgagttcat ctaagcgagc cgcattacgt gtgacgggag    281340
     actcgaccaa acaagtagtc gaacttgccc ggggcaatct caagtcccat tgcggcaggt    281400
     gtgctttcag aagactatgc actcccccgc ggcaagtatg agttgatcag gtccgcggca    281460
     tcgtcctctc ccttctcgcg tgcaatatcg gcggcggttg caccagtgcg atcggtcttt    281520
     gtcaggtccg catggttctc caacaatagc tttgcaactt cggtgtttcc ccaggcggcc    281580
     gcgcacatca gcggcgtcac gccatcggca gtctcggcgt ttacgtccgc gccaagggat    281640
     agtaggaagt ttgcaacggc tgcttcgcca ttcgcagatg cctcgtgcag tgccgtcagt    281700
     tcaccatgac caatcgcgtg tactgatgca ccgttccgca ctagcgtctc aaccgctgca    281760
     agcaaacctt cagccgccga gaccatgagc ggtgtgcgac catgtatgcc gactttgttc    281820
     aagtcgagtt ctttggactc gatttctagc tgagcttgtg acgcgctggc cacgattcgc    281880
     tcaatgaaat gctcaatctt tgactgatcg ttcatgggag tacgttgaag ttccctagtt    281940
     caattcggtt cagtagtcct tgatacgttt cgaaggtcat cggtgttgca ggtgcgacaa    282000
     caaaatgccc tgtcttgcca gactgaagag cttgcaaacc ctcgggcaga ctgttgactg    282060
     gaaatgcgcc tccatacttc tgaatgaata gatcctttgg atcgaggttg agagacagcc    282120
     cttgcgcctt gccgttcttt gccaacggat gaatcagacc gtcggctgcc ggtttaacgt    282180
     ccacccccaa tcgcgcctcc aagccgtcgc ctcctcggag cagcgtccca aacggcttcg    282240
     cctccctcgc ggcctcaagc accgcctttc cagcgacctt accttccggc ccgccaataa    282300
     taagtgaacc ggccgtgaga ataccggcac ctcagttcgt gccgcaccag gccaacgcgc    282360
     gcatattcga cgccgtctcg ggcaacctcg gcatcgcctg aacttccacc cgcgcgcgcg    282420
     ttttcaccaa tcaacattgt gcccgcgggt gtcgacatga acgaacgtat catagacccc    282480
     aacgcctcct tcgaacattt tctggcttcg atacgagcgg attattttcg cccaatcgcg    282540
     gggcgtgcct gcgccgacga ctttgaagtc gacagccttg aactgcatat gctggctgct    282600
     cttagccgcg cccgggagcg tcgcgttata tgcgggactc ctataaacgc tggtcaaaac    282660
     gacactgtga cctatttcct ccctgaaacg atccaggatt ctggcaacct gaagtatgtt    282720
     gctccagaga gccatcggcg gatcggtatt aaggccactc gtcgcgttcc gactgccctt    282780
     cacaagaaat tcgtgccact ggaaatgctt cacgtctggc aggttcgtgt caaagaaggt    282840
     cttgaagtcc acatttccgg agatcactcc gtctatattc ggcttgtctt gatcaaccac    282900
     ctcctcggcg gacgcaggat cggattctgt tgcctcgcca tcgccttcgg ttgtgatgcc    282960
     tatttccagg gaaacgtgtc ccaagccgac tagcgctttg agaaacgcgg ccgcgccgca    283020
     ctgcttggag acagcggtcg gagaaaacac cccgtcacca atgtatttgc ctttgctgta    283080
     gttgttggag aatgaccaga gatatggggt ggcaatccgt cggcttcgat agccgaatcc    283140
     gttgaaagct tcccatctgt aaagagctct tgcaagcgac cagtcctgga gattgtccag    283200
     atcttcgaat ttcagagcgt caatggcgct ttgttcccac gtaaaaggag gcgtaccatt    283260
     tttcgggcgg cccgcaggca ctctgaatgt ccttgctgtg agcctatcgc cgttatgcag    283320
     atgcgtgctg aagttgaagg atgcctccag caagtgaacg cccgctatga accaccaggg    283380
     gattctaagc tgttgtccta cttcctggta ccgtgatttg ttgccgaacg cggtcttggc    283440
     gaaatccttc gctgctttct ccgccgccgc atccctgtac cttgccttcc tgaaaagcgt    283500
     tatatattca tccgccagat ccccaaactg acgggatgtt gataacacta cggttgacag    283560
     atctccgtta acaggcgcgc ccaccggaat cacgtcgaag tccgttgcag gcgggacgtc    283620
     tttctcgtcg tcgaaaacct cctcgaactc ttcattcgtc tgccaggtgg tccgcatacc    283680
     ttctttatcg tgcacggcgc tggcaatctc gctcaagcgc tcctgtatcg cgacaagccg    283740
     ctcctttgcg gaagccgatc cgatgttttc tatcgcctgg gatagctttg tcgaaagcgc    283800
     gagtatcttg aatgtcccct gtcggaattc cgtaatttcc tcgtctaaag cgccctcaac    283860
     ggcctcaata gccgcgggcc gaatggcttc ccggtcggct tcggattcag ctgtgagaaa    283920
     ctcgttccag agctgggttg ctacaatgct tgcatcggtg gccattattt cctccaagca    283980
     ggtttattag tttcgcagct tccggaccgc gtcccagaaa gtgtcggctt ttgcctgaat    284040
     gtttgcggct tcctcgacca tcatgcggaa atccgcaggc gtgttcgaag gcgttctggc    284100
     aactgttgcc aatctcgtgt gcgtgacttt tgcctggcgc aggagggcta catacgctgc    284160
     gagagagtcg tgatacgcgg tggtgttttg ccgcattgcc gtgatttccg ctccggaggc    284220
     cttgagtact gcgagttgct gggaaagata atagatcttg tacatctgcg gggtatcggc    284280
     gattaacgcg tcgatcagtt gggcgatcgt ttcgcgttgc tggagcaacg accgtctgat    284340
     ggcttcagcc gaacgagcgc gctccagatc tccggcgagg tcggaaaggg aggacacgat    284400
     cggaccgccg aagaccgccg gaagcactcc agtcgtcact ccggcaattg caacgatccc    284460
     ggaagctgcc gcggcgatgt cgttgatgga ggatttgagt tcatctgcac tttttccctc    284520
     gcttaattcg acaagcgcga gcgagtattc ggtgagcaat tggagcgcca gccgccgcac    284580
     cgcgacactc ggatcttcat ttctgccgcc cccgatcgct tgaggattga aacaggtcgg    284640
     gacacctgcg gcgtcagtac cacaggagtc tttcccctgc ttagccctgg aagctatcac    284700
     tttcgcggtt tcgtcataga gcagatctcc tgccttctgc gcctcagcga aagaggtatt    284760
     tagactcttg agatcttcgg gttgaatcct ggtcgcgcaa gccgcgagag cgatcaacga    284820
     aagcagggcg cagaaaagcc gaacccgtac gaagtggggg cgcaagtacc actgcatgcg    284880
     catgaaatcc tgcattgcga tcatccgatg caacatagag gtcaaagaga ctatcgaggc    284940
     agtaaaacga ggagcgggaa ctgccggtca cttacacagc atgaggtcgt tcagggtatc    285000
     ctgggccttt ttttgcacgt tgatcccgtc gggaaagacg tagtcggccg acttcgaaat    285060
     tgcagtcact tgctcgcgca gcagattgcg aagcgaattt tccgggttgc accccgcgaa    285120
     accgatggcg acgatcgcgt tgttgaccct gcggtctatc cgaaaaccgt tggctagcgg    285180
     ttgaggcggc aacgagtttt tcgagagcgc atcgacgaaa gctactgccc agtcgccggc    285240
     tcgatccggt gatccggatg gccatccagt cgcctgtagt gcccaactta ggaactcggt    285300
     cgaccagttt cgcatagtcg aatcgttgga tccggtcagc tcaacgatat atttcatttg    285360
     ctccgggctt aggctttcga cgatccgtac ggcgttggcc cgatcgttgc tcacagcagt    285420
     cacccaggca acgaggcgtc caaggtcttg cctgtagtcg gcttcgctga tgctccaagt    285480
     agaggcgaca tggtcccaat cgtcctggga tgacaattgg gagagagact tcctcgccca    285540
     atccctggtt tcagacgttt ccgagggaag gccactcaga tagctatcga tgtcactgtt    285600
     gagcccggct gccgatgcag gcgaaagcac agctcttagc agtcgatcgg aaacggacgc    285660
     tacgccttgg ggtgccttat cgtcgtggca taggggcgtg tgtgtgccga cctgctgtcc    285720
     cgtccttccg tcgatgagaa cgtattcctg tgtatcgtcc aactgctgca gttggaatgt    285780
     catctcttcc ccgtgctcaa gcgcttttcg catcggttcg gtgtcgacgc aacgaatgta    285840
     gaattcctgc ggggatttgc ccggcttgtt gacgaaaaga atgttgatga acttcgtgtt    285900
     caagtccccg ggaaacgcaa ccatcctgaa cgattccgaa ccagtaggcc gaccgacgag    285960
     aatggatctg cttgcgcttg ccgcaacgga ttgcatctcg ctgcttgaat ccaacgttat    286020
     caaaacatag ggcctgaccg tcttcagtgg gacgaaagcg agaaccagat aaagaacgac    286080
     tgccattgcg cccgcgccga caacggtcca gccgcgatag ctgccatgga catgcgtgcc    286140
     gaatgcaacc aggatgatgc caaaaccaat acatacagcg agcgctgcga gctgccagta    286200
     tgagggcgag agcgtaatat agtagaatcc gaagcctgca ataagcaagc ccgcgatcaa    286260
     agcgacatat tccatgccat gaggtattgg ccgtggctca ggttggctat tggctgtaga    286320
     tcgcagttca gcgttcgcgg tttcattcgc gtttgcgtcg atgtcactca tgtaaacgcc    286380
     cctctgaggc ctagcctcga ggcaaattta acacctttaa agtgtatttc aagacaaata    286440
     tggcgtgcct gagaagaaat attcttcttt ttattcagag ctaggctgaa cacttaattc    286500
     gcggccgcaa gggataaaca taaataacga acgtcagcgt tttgattcag tatatctgtt    286560
     ttttcatcgg cagaatgcgg ctctcattgt tgagcgctcc cgcaaagcct ggcatcgtgg    286620
     acgcctcgac aggagccccc aaagcctttg ctcttaacgg cgaccgacgc tcctctttcg    286680
     atcgctccta tcgtcggcgc aagtcctggt tggagcagag gcaggcgcaa atacgcatca    286740
     tgcgtcggcg tcttttcttc atgcatgagc gggtcgctgt gcggcgtggt gtcggccctt    286800
     gctattcacg atcggaagat gaccgagaaa tcgaatggcg catcgttcat tgcacgaccg    286860
     agatgtcggg ggatgtcagt cgccgcggcc agggaacctt cgttcagacc gccccagctt    286920
     ccctcatagt acgctttcca gatagccttc atgcggtcac gtattttccc tttgcttatc    286980
     gcgtagtatt gccacgcgac caatgcccgc caatcttcca gtagtcgctg gtcggaaaga    287040
     ttggatcgtc cgattgggcg cgcgctatct ggaacttcgg tgagcgacca tcgacgagag    287100
     attcctccat ttgacgcctt cgtctccgta actccgatgc caaacattgt tgaacctagc    287160
     ccgctgctgc aggctgagat gacggatgcg acaccgccac gagtgtggat tcctctggcg    287220
     tgtgcaccat ctaccccctg tacaagcact ccgtcagccc aaaaggccaa ctgagttgct    287280
     gcaaccgact ccgatcggct gatctgcttc caaccggcgg taaaccaatg tttctcatcg    287340
     ttaaatccct ccctaactct tgatgcccag cgaagcaggt tattttccac gcacgtcttg    287400
     atcggatgag atacgcaaag cgtgctttcg agtcccgcag acagcccaga tgcgcctcgc    287460
     tcactgatgc ccgtttcgtt gtgaaattgc ctccacgcat cttcagatag tgctgccgac    287520
     cagatttcag ttaaggtttt ccagacctgc gcatcttcat tcagtctgtg aaacaggtcc    287580
     gcgatattgc cgccaatcca gtggcccatg ccgatggtca ggttgggatc ctccgggtcg    287640
     tggaaatgca cttcggagaa aacccgcctt gacgagctcg tcgcgttgaa aatcttctgc    287700
     atgagaaaga gatcggaatt ctcgtcaaga acctgggacg ggtcgtcatt tacaaggtct    287760
     gccgcgttca ttgtctaagc tccaggcggt gggtgccggc catccgttcg aaggaccaga    287820
     agccggtgtt caagtcttgt cagaccctag cggagactgg ttgaaggatt ttcggatcaa    287880
     gtaagggtcc tccgaccacg tcgaaaggaa tgaaacggcg gcggccgctt gctgcccttc    287940
     aagactatca gcagttggac ttcgttgccg acagcgtctc gagcaattct cctgtacgat    288000
     gggcgacaca tctaacaggt actgcgagga gctatctcaa actcttccac ttttcttgca    288060
     aactgctcga atgctgattc agaactccct gccaccacgc cttgaattat atcacttggt    288120
     gcacttcata ctagctcact tgtatagtaa aaaagagcta cgctcgggtt gggcggactc    288180
     gcgttatagc gacgtcgagt tcccaacaag aaacgctaat tagttggaag ggcgtttgca    288240
     cccgatttcg aaggggccgt gggtgtggag ctttctccga gaggcgtgga ccgaatgcgg    288300
     tcgcggtcac cgaagaccct caagtgcaac cgccagccca gagccggaga gagcggacga    288360
     cgatggcttg gaggcctttt tggggaaagg tccgctgcga cggggtcggg ctgcgacgcc    288420
     cctgaaggtg gaaacaccga gggcctccag ctcgcgaagg ggccgccgcg gtctgagcca    288480
     aattgctatc gatcccaagg cctttttgtc ggataccgta ggattggatc ggagctgaca    288540
     atcctttgca gtaatcagtc ttcccgaacg acaagcgaaa caaagctggt cgaccatccc    288600
     ttgacggaaa gttccggcgt cgggccgcgc tgcgtggaag cggcattggc aagcagctgt    288660
     gcgagcggat cgccgagttt cgtcgccaac ccttggcgaa gggtctcgtc cgtcagacaa    288720
     tcctgttcca acgcctcggg agcgatgggt cgatcggtgg aaattatcag gaaatattcg    288780
     cggccggctc tgtctggtgc tctcagaagc ttcgttctga ccgaacccag aagcggttcg    288840
     tccgatcccg atggcggcgg cattagcagc ctgacgcagt agtccgcgtc gagattaaga    288900
     acgtaggcgt gtttgggcga aacactccca ttgtacaaac ccagcacaaa gctctggcgc    288960
     ggcttgatga ccgcttcgcc gtcctgcatc ttcggattgc tgactttgtc ggatcccttt    289020
     gtggccaaga gtactcttgc cctgaccggt gcgttggggt tttctgggtt agagagagaa    289080
     agaagcgcct ggtagcgggc caatcgacct aaaagcagtg cgccttgacc ctcggtgaac    289140
     gccgacaagg ggcggacagg gccgactgca gaaccgtcca gacgtttgag tcgaacgcct    289200
     ttatctgaaa catccaacca ctgtgttgca tcacggtcag gaacgatctc aacgaagctg    289260
     agcttttcga tgacgtcctt gacctgcccg cgtttcacct cgtctcctcc agacaatgcc    289320
     acccttagcc gcaaatcgcc aaatgaatgc gcctgctcca ttgcaaaaag ccttgccggc    289380
     aagataacat cctttttcaa atcgatttca gccgacgctg gatggacggc cgtcacgacg    289440
     ccgtcggtga gaacaggaaa gccgcggccg gcctcagccg cagtggtaaa caaggcaaac    289500
     tgcgagcctt gcgttacgcc ggacactgcg cctgcaaaaa gtttcacgcg ctgtgcgccc    289560
     tcaggctcgg cacgaaccgg tagctttccg agaggtcccg caccgagaaa tttctgcgac    289620
     aggccgcctt cgccctgcgg attgtggggc accccctggc tgttcagtgt aacccttacc    289680
     ctggtaagca catcgagata ggtaacatct tcctccgctg tttccagcac ccgaacgagg    289740
     gctctgctga attcgccgcg caccacgcca tcacggtcgg attccagagc ttcctcatcg    289800
     tcctgagccg cggcgagcag gatgctgtcg ccggtaaaga tgttgtgctg tgatgcttga    289860
     ctcttgtttg acgaccaacc cgctgctggt tcgttcagcg ctgggacggt ccgtgcctgc    289920
     gcccagagcc ttgtcccggt gccggaatgg caactatcca ggatgaccac aggtttcagc    289980
     ccgcggtcta gggcttttgc aacgaaggaa ctcaactcgt catctattat gtcggggatc    290040
     ttcccatcct tgtcccttgc gtcgtagggc aagatcgtgt cgtcaagctg ggaggtttcg    290100
     tccatcgatt tgtcgaactg gcgcgagccg tgacctgaga agtaaaaaag gacgacatcg    290160
     cctattgctg catcggacaa cagcttctgc agcccatcga ccaccgcttg acgctttgct    290220
     gcctgatcga tgagtgtctc tgtgttcgcc ggcatcagac cgtagcgatc acgcagaacg    290280
     ctctcgagtg ccgggacgtc gttggctgga cccctcagat tgcgaaaaga gccaccattt    290340
     gaattttgat aggtcccaac gcccaccagg agcgcatgga ggcccgggcg ttgctcggcg    290400
     ctcgccggca gcgaaaacag cacaaaacat aagacgaatg cggctaccgg tctcatggct    290460
     gagttccctg cgttttgacg atgacgaatt cccgagccag aacaggatcg ggaatgaaca    290520
     gacgcggcgt ttgggcaaca ttttcgacct catcgaagaa ggtggaccgc tttgcatctt    290580
     cctcatatgt gattgccggc acgggcatac tggccatctc cctctcctgg tcctgctcct    290640
     tgggtgattg gatttgcgcg aaactcagcc attcgccaat ggtgacatat ccatctttgt    290700
     tatcatctgc ctgcggtcca aggcctggtt cgaacagaac gtaggagaac agtccatgac    290760
     ccagtcgttg cagttcgcgc gcggattgcc ggctttgtga tgcgctgatc aagaacatcg    290820
     ccttgtcata ggcgagctgc gccaacgagc gcccggcaag cggaccagca cgcttatcga    290880
     gcttgtcaag ggtctggccg gactcacacg cgtcgataat caaaaccgta cggtccgcct    290940
     ttaaaggggt caaaacatcg cgcaacgcgc tggccgaaac agtgccctcg gtcttgtcgc    291000
     ttccgaccag accgtcagac gcgatcaacc gatagtctcc cgcaaaaccg ccaccatggc    291060
     cggcaaagaa aaagaaaacg gcgtcggacg gcgtgcttgc aagcaagccc gaaagcggac    291120
     cgcttgcgac cggctcgcgg ctcccagcca aaatttgcaa accactgaga attgtcgacg    291180
     cggtcgcctg ctcgtcaagc agcgaaacgg gcacgatacg ggtgtagttg ccagtcgatt    291240
     taagggtggc ttcaagcttg gctgccgcaa gacgggcatc ggccttagca taacggagct    291300
     tgtagccttc ttggtagcta tcgatcccca ccacgacgac gaaggcggtc ctatcacggc    291360
     ggaggctgtc actaccatag atgtggagtt ccgcctcttg actgcgcagg cccgaattcg    291420
     aaaagcaata gacgctcagg acattgtctc cgtcgctcag cggaattttt gatgaaaatt    291480
     gcgctttgcc agcgttcagt atcgggcggc tcgaggccac gaggcgacga tttcgaaaaa    291540
     ctcgacattc ttggacaccg tctccgagat cggcgacctc agacacgagg tcgacattgg    291600
     cgtcttcccc gatcttctgc ccaatgactt gactattttg tcggttcggc gcgatcacct    291660
     cccaggttat ctgcttgccg ctcgcatcta cccgctcgtc cgaaaccagg cttgaggtcg    291720
     tcgacatcgg tggcgcggca tcccggaggt agttcgatac cggcgagatg atctggacag    291780
     acggaggacg ggcggacaga gccggcgatc gcggcgctgc cgcatcaacg gcgccatctg    291840
     ctatgatcag tgacaaaagc tgcggtcgaa accacgtgtc aaacagaaca gaaggctctt    291900
     cggcgctcaa ccgcgtcgaa gcacgcgtgc cacggatatt tgcccaagcg gcatagcttc    291960
     catcgaaata tccatcactg gatttcacga gccagccacg acgatcagcg cccagcaatt    292020
     cccccttggc atggccatcg ctgatcctgt gaaaggcgat gcggccattg ttggatccga    292080
     tcgccaccgt cacgccgtct ggcgaaacag ctatcgagga aattgccccg ccagcataaa    292140
     actcgagagg cgtactctgt tcgccgctcc aaatgcgcac agcgccggtg cgctgggcaa    292200
     ggacgccgag agataaatcg cgccgccacg ctacaaggtc attgttgcca ccggcgccct    292260
     ccggaggtgt tacagatatc ggagacgacc aactcagtgt agccatgtca cccccggccc    292320
     ggaagactgg tacgccctcc gttttggtgg acaggggagt gatgatgccc gtcataaggt    292380
     cgacatcggc ggtgccttca aatcctcgca ccaccacatg gtcgccctgt ggcttgatcg    292440
     cgactgaaat tgcggaaaca tttcccaaag caatctggcg ggtctcgaat gtctccgcca    292500
     tgaccacggt gatattgtga taggaatgaa tcaccgcaac cgagccacta ctgacgaccg    292560
     cgtttgggct atcaacggaa aatgaacgaa gaaccgtccc cgtcgtcacg ttgacgattt    292620
     ctgcctttcc gctcttgtgc accagcatca gcgcctcagt gccgacaaag gccagcccga    292680
     caataccgtc cttgttgatc tcgggagact tcgtctgccc ctctccggtg cggtaggtgg    292740
     cgctgacatg tttttgctgt tcgacatcgc tgaaaccaag ctcgggcggt gtcgttacga    292800
     cattcaacgg gtctaggacc cggtaaaaat tcgaggtcgg ttcccagatg agcgcgccgc    292860
     caccttcaag gcctgccgca aggtagcgac ccgtggcact gaagccgaga gcggtgatcg    292920
     cgtcggcctc ctgtcccaaa tcgtccaagc gaaccggtgc cttaaaatca acacgctgaa    292980
     tgcgaccgtt ggcttggcca agaagagcgc tatccccccc atcggccatc agtgtaagcg    293040
     gactgtgacc tgccgtatag gtcttgaggg tccaatcccc tgggttcagc cggtagatca    293100
     tgttttggcc gacgaacgtt gagctaaaat ggcctccggc gacgacggcg ccgtcttcgg    293160
     caaaatagat aaattccggc gaattcatca aaggttgcga cccgacaacg gtcccatcag    293220
     gcagctgacg aacgacaact tctctgtcgc caacctccgc caagagtttc ctgtcttgcg    293280
     aaaccgccaa gacgcccttg gccgatgacg cgaaagatcg tgtttggcca gttaatagat    293340
     tgagcaaaac caccgcgcca ttgcgccgaa acaccagcgt atcgtcgtct gcgaacgccg    293400
     cctgcatgct gccatcctgg atttcgatcg ttgcttctaa cgtgccggtc tcggcgtccc    293460
     atatcgacag cagcgaatag gcagcagagg tcagccatct tccgtgcggg gaaaaaacaa    293520
     gtctccccgc ctgtccccgg aaggatcgaa caatccgatt gttggaaaga tccagaatct    293580
     ggatgtcagc atctccgcct acgagtgtgg cgtatgccga gttgtcgttt atgacggcaa    293640
     tcgcgacgtt ttccgagttt gaaggatcga ctgccagccc tgcaacggcc attgcgccag    293700
     gcgtcacata ttcgctgatc aacaagccgg tcgcggcttc ccaggtcttc acacgcccgt    293760
     ccgtcccagc cgtgacgatc agcccggtgc cagcaatcct gcctgctccg acaatctgct    293820
     tcaaatgaga aatggggagg taagccaaag gcctgtcgtc ggcggcgagc cccggtcgca    293880
     agaagagacc gaggagtaaa acaatgagaa gaaatacgca taatccggtt tgctgtttca    293940
     aggcaggcgc tcctctatcc atcgtccacc ttgaaaggca aagcggcgtg cgccatcggc    294000
     cgtgctcacg acgatctgcc cctgatcgat ctcgacgcaa caggactggc cagaagcatc    294060
     ttcaccgtct gtctgatcgg aggcgagccg cgcctgccag cgccaggcac ccccggccct    294120
     tcgaaaaacc tcgatccgtc caggacctgt cgggccagcg tcgccaaggc ttagaccacc    294180
     attcgtccac acaagcagat cgtcttcgac ggcaatctgt ccagagaagg tgcgcattgc    294240
     gggcggagtg aaaatcacct caactggtga taaaggcttt gccacatcga agacgcgaat    294300
     ggcgccgtcc ccgcccacaa agacttgggt atccgtcatg gcgacacttt gcgcgccggt    294360
     ttcgaccagc tgcaaaggat cattttccgg gctctgcaga tcaaaaaggt agaccctgcc    294420
     agagcggccc tcaagtacga caagccgccg cccagccgaa cgaacctccg ctccgaaacg    294480
     gccataggcc acggggtgcg gagagcgcag gcagatcgtt cctgcctggc cccgctgctc    294540
     aatacggacc gcaccggatc gtcgcaccgc tgccttgtga gaccacgacg ccgctccagc    294600
     ctcccagacg gcgagtgcag cggtgtcggg ttgaccataa tccaggtccg gaagcccaaa    294660
     aaaattcgaa ccatcagcgg ttgaacgcac acgcggatcg acgccctctc ccgatcccat    294720
     cgggcaaagc tgttgcgcag ctgcggacgt ggcgcaactg gcaagggcca agaacactaa    294780
     ag                                                                   294782
//

If you have problems or comments...

PBIL Back to PBIL home page